2BW7A

A novel mechanism for adenylyl cyclase inhibition from the crystal structure of its complex with catechol estrogen
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title A Novel Mechanism for Adenylyl Cyclase Inhibition from the Crystal Structure of its Complex with Catechol Estrogen
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 57
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2005-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2bw7A00
4CLUA 5IV4A 1CJUA 2BW7A 1CJKA 3C15B 5D0HA 4OYWA 4OYAA 4NI2B 3UVJB 4OYPA 4P2MA 4NI2A 1YBTA 4USUA 5D15A 3G82A 3R5GA 2GVDA 1AB8A 1CJUB 1Y10A 1CJKB 1WC5A 1YK9A 3MR7A 4CM2A 4OYBA 1Y11A 4USTA 4CLYA 4USWA 4CLLA 4OYOA 4OZ3A 2W01A 4CLKA 3G82B 1TL7A 2GVDB 4CLWA 4CLPA 1WC3A 1U0HA 4CLZA 4OYXA 1WC1A 1FX4A 5D0EA 3C16B 4P2XA 4OYZA 2WZ1A 3C16A 4WPAA 1CJTA 1TL7B 3MAAB 1CS4A 1FX2A 1CULA 1U0HB 5IV3A 4P2FA 2QV6A 3MAAA 4OZ2A 1YBUA 1CJVB 1WC6A 4WP9A 4CLTA 5D0GA 1CJVA 4CLSA 4OYMA 4CLFA 3C15A 4WP3A 1CJTB 1WC4A 1CS4B 1WC0A 5D0RA 1AZSB 4CM0A 1CULB 2GVZB 4USVA 3UVJA 4OYIA 3C14B 1AZSA 3ET6B 2GVZA 4WP8A 3C14A 3ET6A
chains in the Genus database with same CATH superfamily
1H0HB 4RZRA 1X9MA 5D4LA 3M6WA 5IWAF 1U47A 1UVNA 4O4RA 5L1IA 3MMCB 5HMXA 3F73A 2PT0A 4AL5A 2JC0A 2LMIA 1YI2S 2XM3A 1S9GB 2B6AB 3OVAA 2ILYA 1QE1B 2I38A 4UY85 2VFSA 1NJXA 3J7YI 1PJ6A 4WF9Q 4DBQA 2GVDA 5BYRA 4XPCA 4I2QA 5L46A 1SKSA 2DR8A 2YX1A 2JH3A 1QAIA 2FVQA 5A6PA 1GMWA 4O3NA 3G4SS 1L3KA 2HZCA 4O0IA 2VFUA 2I0XA 2Y1IA 1K1SA 2XMWA 6AT1B 1KWMA 3KLFB 3I82A 2V94A 2B9XA 4KT0C 3CD5A 1FI4A 3NOGA 1ELOA 3CD6S 4DSEA 3SI8A 2QSFA 2HHPA 1N0VC 4ZLJA 1FXDA 1RKIA 1T3OA 2K3KA 3RBXA 2XHWA 3GIRA 1U02A 3EXYA 4OIXA 3QWUA 2AZ1A 4DPWA 1VRTA 2UU9F 1SKRA 1ZM9A 4CYUA 1AFIA 1RT4B 1CQMA 3QO9A 1CJKA 1KSPA 2DO0A 1O6XA 3PZPA 2FHJA 1Y5NB 1HIYA 4RUHA 4G6VB 3FMBA 5B0CA 3OR2B 3GCWP 4BHQA 1N34J 2WONA 1BQNA 1V9OA 2Y0SD 3E01B 4KGVB 4KPCA 1V3ZA 1WG5A 3ISNC 5FD1A 1BQMB 1RTIB 1PYOB 1JKHA 2LVWA 7FDRA 3TOQA 3DLBA 4ANDA 2R2UA 3MPYA 3FMWA 3FFIA 2XMTA 4J9UE 2KDOA 3CT9A 4LRAA 1DJ0A 3I5AA 3IN5A 2HFSA 3BBBA 3KXDA 3PKYA 4KO0A 2QA1A 4AD6A 1N32F 4KGXB 4EBDA 1JIHA 4U96A 2CPXA 1VQOS 4RW9A 2ZWPA 2I5JA 4FP9A 1RAJA 1LWFA 2D3UA 3NCQA 4EFAC 1SC4B 4OHVA 2AYEA 1U2CA 3AAWB 2PGCA 5DO2A 4RW4A 4M5NA 4ZJLA 3SCKE 2UUWA 3BH7B 4QYRA 4RBUA 2HS0A 1WTFA 3A8IA 1JLCB 5A8WB 1S9FA 1VQLS 5IC6B 1Q82T 5H9EJ 4HEA9 2GFFA 2QMXA 4X66J 1UJ4A 4DCOB 2DD8S 4LFAF 2V4JA 1N5QA 3BJYA 3QSYB 4YB7A 2C2DA 5HROA 1JWWA 1NUEA 1NK7A 2Y8WA 2MEWA 5HBMA 1T94A 4U9RA 3IM9A 3G8TA 4HACB 3GYGA 2GQQA 2BJDA 2DNHA 4GO7X 1GMUA 2VG7A 4ID5B 2AEMA 4YHHJ 2R2SA 3IR5B 3C6UB 1F2GA 1ZAVA 4PPDA 3AQOA 4FF4A 4I6AA 2XMMA 1V5IB 4RUAA 5H9EK 3MMAA 3C2PA 3FSIA 3IC1A 1WC0A 2LXUA 4USVA 5J2MB 4DV6F 4IG3B 4F3QA 1D9FA 4C8OA 4J7CA 3V4IA 4RW6A 3PR4A 1FDNA 2FC9A 1EKSA 2QMUB 2GMJA 2RS2A 3HHKA 1AXQA 4R0EA 4ELVA 3AJ2A 3QIPA 3T41A 4TYAA 4J5OA 5LMNF 1Q79A 2XYPB 1C0TA 3MTKA 3CCVS 2HHWA 1KLNA 1SVDA 3EZOA 3J7YU 3LP1B 4KR0B 5C5JA 5E41A 1HHTP 4P72A 2QTWA 5K8NA 3MUVP 2BX6A 3AJDA 1FEHA 1KEKA 3CIZA 2CZ4A 2KRBA 1F3VA 5DDQC 2Q6CA 4DS5A 2FVSA 1VCTA 4ZDNA 2FJXA 3TQEA 2HPUA 4OX8A 1WG1A 2AWZA 2EFVA 4C8MA 4WIIA 2WAQD 2GGPA 4TY9A 3PRBA 2FPHX 3QRRA 2WVBA 5L39A 1MG7A 1U09A 2HFZA 3SIPB 2HZVA 3FNNA 3OV7A 1HI0P 4BCAA 3BR9A 3ILLA 4ECWA 3CDAA 4DSKA 2P9EA 2CQCA 1HBOB 4K8RA 1UPMB 3TVZA 5C25A 3H5YA 1NZAA 4HL9A 1NJYA 2FD2A 3MM9A 1NO8A 4ANCA 4ZPTR 5LMUJ 3Q8SB 1IKVB 1UVLA 4ZVRB 2GNKA 1NSQA 1S0NA 3I5BA 2E1PA 4DSJA 1TL7A 5FLXY 1AA1B 1SUQA 1M1KT 3KLHA 3D3BJ 2LEAA 1FNMA 3BPSP 1S6PA 1LW2B 3QT5A 1L3UA 2MGZA 1S49A 5LXRA 2YNHA 3D66A 1HKAA 3IO1A 2MKCA 1SC1B 5KFHA 1VC5A 3H2LA 4LFBJ 3SDEB 1B0PA 3KLIA 2QSWA 1QUPA 4HT7A 1V3RA 1JJ4A 3A12A 1VQMS 3EWGA 2AMCB 3O2IA 4PWDB 4USMA 3VWSA 4B9TA 2VH7A 2YPYA 1HI8A 2UXBF 3CUNA 4ZK7M 3LF0A 3CWJA 4NA3A 4EK2A 2C3MA 1LWCB 1OJ4A 2CPJA 3JS9A 2ZJQQ 4B3OA 3PYFA 5LT5A 1XNQJ 1XK8A 3PVXA 1TUGB 2W9AA 3FDSA 2O67A 4N8NA 2IM1A 1IR0A 2R4FA 1SV5A 5CYQB 2QGFB 1NKCA 5JJBA 1MWQA 1URRA 1S1UB 2ZM6F 5DZ7A 4ILLA 3HP6A 2JSXA 1XMOJ 1CJVA 1E6VB 1E6YB 2F7VA 3NCPA 3LGNA 2ALYB 1RCOB 3D28A 4NLVA 3NRBA 2AQ4A 2B4OA 4B9LA 1R7IA 1TK0A 3QFHA 1J5EJ 3CNQP 3UI3A 5HQLA 2F4VF 3MMJA 5EN1A 2DNRA 3HVTB 4RW8B 2DY9A 4LF4F 4C7QA 2D69A 4GKKJ 4DL0C 2AIRB 5IXUA 3AODA 1N48A 2W25A 3KK1A 2JZ5A 1UEVA 1RAIB 2XMJA 2Q3PA 3M6UA 2PC6A 4I68A 3GIKA 1U8WA 2UXDJ 1LW0A 2AYBA 5F41A 1KFDA 2AJ2A 3OTDA 2CKWA 3H5SA 1UZDA 4P9SA 4B3TJ 2UUTA 4N76A 2RKIA 2V8GA 1BMQB 5DGAA 3F56A 1VQSA 3B8HA 2V8VA 3CCES 1HWUA 3RB0A 3MUMP 4NLSA 2HHTA 2PI5A 2BW2A 4Q2MA 3M8WA 4NLWA 1C1CB 2FY1A 1ZYQA 1MN9A 5CCLA 3ONQA 1TP7A 5HMYA 3KUGA 2HNDA 3F41A 4CT8A 3MMBA 4L72B 1NK4A 2V63A 1UFKA 4DSIA 2D9PA 4QR2A 1PO6A 4PRFA 4F8RA 4XAKA 2B6AA 2AJQA 1QE1A 3BS9A 3OFFA 2RMLA 2PD1A 3HSDA 4B02A 3N01A 2HVHA 3N5FA 3R7NB 4LIRA 1B0VA 3EYZA 2W9CB 5HI7A 5L1LA 4ZCKA 1FKAF 2Z2LA 4BWJA 5GMEA 4P6QA 2DO4A 1RHUB 1HBUA 3HO1A 1XTZA 1AYEA 5HVGA 3VAJA 1HQEB 3HVRA 4KV8B 4RWXA 1Q7LB 4ERDA 4TQRA 4K0KF 1EP4B 1X0FA 3OLBA 1NK9A 3E8OA 4OZLA 2RNEA 3MCMA 4LQ3A 2QV6A 3LW5C 2WRMA 4ZS6A 2C3PA 1AUSL 4RUCA 3H4DA 3TX8A 1PC4A 2C42A 1IM4A 5I3PA 4B08A 3CO0P 3CCJS 4KGMA 1RU2A 4FPIA 1FKOB 1FRMA 4ZVQB 1C2PA 4WFBQ 3J7Z5 3OR2A 2KVQE 1A7GE 1FFSB 3HFZB 4P52A 4LF6J 3VZHA 3W62A 4DV2J 4KQZA 4USUA 3J7A1 1Y3JA 1BQMA 2A2DA 1RTIA 2NCKL 3I9V9 3K5MA 1VDHA 4JI5F 2DYAA 1S0MA 1VBKA 3G82B 3LQVA 1F1BB 2IDLA 3P3DA 4WFYA 4M5HA 1NAQA 1WC1A 3QZ7A 1QTMA 5E3AA 4C8YA 4DR3F 3O5TB 2IRUA 5K8MA 2EG1A 4F50A 1UVJA 2BBEA 2DIVA 4I7FB 3MM8B 2YPZA 3A3NB 4WP9A 2MQQA 3OHBA 1HMVA 3J81Y 1FA0A 2JFKA 1L3VA 3AHPA 3TAPA 3ELHA 2R8IA 4J9PA 3WC0A 3MECB 2JC1A 1AZSA 3DOMB 5A8WA 4ZPBA 2DIUA 3U1MA 3DNCA 3CCWA 1NHVA 1UWBA 4MK7A 4UOHA 1Q8KA 1WOSA 4OYWA 3L95X 2E9RX 2PE8A 2GHVC 3BGUA 2L9NA 3RBEA 4U95A 4DQRA 3MEKA 1K73T 2OD6A 1YSJA 2AX0A 1T0TV 5CA5A 3HPOA 4OYBA 3M8YA 2AJ0A 4JI0F 3EVWA 2DGVA 1VQKS 2DXDA 4ID5A 3T5KA 3C6UA 2G0CA 2FVCA 4OMFG 4I69A 5EX3A 4GKJF 2UUCJ 3WBZA 2UXCF 4BS2A 1H7XA 1DQ8A 4NX9A 2RU9A 3V81B 3CCZA 5J2MA 4IG3A 2R7WA 3WHIA 1I5OB 1DTQB 1CSJA 3D0GE 1TKZB 2UP1A 3KK2B 2MSSA 4LBHA 4DFMA 1FE4A 4QPXA 2EG2A 3SQGB 3AOBA 4JI7F 5BYSA 3M8QB 2V2QA 2GIRA 1UVMA 5GAHI 4DR1F 3HXMA 1WD6A 1MSWD 4F4ZA 2GA7A 4I6WA 3LP1A 5KFPA 4JYAF 4WFAQ 2VDIA 1JJCB 4J9RA 4KHMA 3PFOA 1X4HA 3PIPQ 4YB1P 4R8UA 2ZH2A 5HO4A 2E5HA 4QIEA 1WSRA 2J8SA 3DLGB 1RBLA 3ENWA 1RUSA 2O1PA 3MF5A 1DTTA 1JK9B 1FERA 5KG4A 1NZ8A 2C2MB 3MAAA 3UPFA 3FRYA 3EZ5A 5LM7E 1U1RA 4HDHA 4DR6J 2HWHA 5C2CA 2ZNZA 3VGUA 5L9NA 4L76A 4X62F 2OTLS 4DX6A 2HVEA 1UW9A 5DG9A 1N56A 2Z30B 5AE2A 1RBOB 5IM0B 1IBLF 1TKTB 4YEAA 1Q78A 1IKVA 2W7PA 1N4LA 4Y2CA 1SXLA 2WOMB 2ZC4A 3SBMA 3GV8B 2DY1A 1RAHB 2DRDA 4EMDA 1NPKA 5KT3A 1T05B 2M7SA 3MM5B 2ZUGA 1RAFB 5K8PA 4PABA 1LW2A 4OL8A 1SJ4P 3BSOA 2Z0GA 1VK8A 2VD3A 3PY8A 1VQPS 3US5A 2CNKB 4DV7J 2AU0A 1RAAB 2G1HA 5DQIA 3IR7B 3KMSA 4WXOA 2F9JA 3IWLA 1K44A 1HR0F 1VQ7S 4F67A 4DCPB 5A8KB 3VGSA 4ZCIA 2Q6BA 5B0GA 2LXFA 1RXOB 3GIJA 4YDDB 2LXIA 4PWDA 5AJ3J 1VOMA 3BPDA 5B0EA 5KFJA 1IQTA 1I6JA 2UV8G 1VFJA 3NXZA 5T7LB 2JL9A 2J7KA 2CNLB 4HT5A 1VISA 2VG6B 2W2QP 1QTNB 2QEXS 1LWCA 5HANA 4QWDA 5KFYA 4RUBA 3WQPA 2F4FA 2W24A 3FKBA 2CQ3A 4B9VA 2DKOB 3G6VA 1YHQS 2WCXA 3OD2A 5CYQA 4RU2A 4NOHA 2R8JA 3TP2A 3IXQA 2Z57B 2G0JA 1N5SA 1S1UA 2CWXA 2EI5A 2HEKA 4WZMA 3D6TB 5F0WA 1E6YA 1E6VA 1S1VA 3JB9k 1XJWB 2LU2A 1YQHA 4CRJA 4IO9Q 2UZAA 3Q8VA 1NSAA 5J1EB 2CWKA 4ATNA 3RW6A 2ZHOA 2CQDA 9ATCB 3HVTA 1X4BA 5M2PA 2E5LJ 5L1KA 3JTPA 3L4BC 2X3DA 3LUYA 1XMQF 4CIOA 2G4BA 3THPA 1RTDB 1UW4A 3C3LA 2RUSA 2PEBA 3H59A 2B56A 1I94J 4NASA 4MTPA 2V8DA 2AGQA 1GX6A 3PHEA 2XNRA 2CVEA 4TVAB 2ADCA 3BQ2A 4JI4J 5DLFA 2KJVA 4PG4A 4J9KA 3KHRA 2NXNA 5DDRC 1BUXA 2OPQB 5GAHU 2VBZA 3DLEB 2QLXA 2CNNB 1REGX 2MTLA 5KT6A 1K47A 5ETVA 5CZVA 4MAKA 3FZBA 3VALA 1D9AA 4G1PA 3TX0A 3H40A 5C7PA 2NXUA 3MPUB 4O3OA 3CXCR 1N36F 2GJFA 1KQGB 2MPUA 2NLWA 3I55S 1S72S 2AX1A 2WW8A 5E3QA 2CQ2A 1RT1A 3CC2S 3TARA 4DUYF 5D4OA 4MKBA 4MKVA 2YKNB 4A8KA 4KBIA 1IWGA 5JMNA 3C14A 2J8AA 4B3RF 2W9CA 4YDXA 3VAIA 3DN9A 1JLAB 1IR2A 2G2OA 1ZS6A 5HP1A 3QNWB 2FZGB 4H4KC 3V5RA 5SZTA 2OGUA 3R2CJ 4FS1A 3DOKB 1DAXA 2FJBB 4ANEA 4DN0A 4KV8A 2DGTA 3IMQJ 3HSGA 1B70B 3JYTA 3EMTA 1X31C 2F9DA 2HQ3A 1EP4A 4KYZA 4KE5A 4ZLNA 5KFEA 1P27B 2ZH7A 2ZDPA 2GIQA 3ZZUA 3V2UC 1QAXA 2KXHA 2HRUA 5G0RB 4DWIA 3DRRB 4YFUA 3OVSA 2OD4A 3ETOA 3TVKA 2NXJA 3W9IA 3R8YA 1RHRB 2FJWA 2KL8A 3CCUS 1FKOA 2VQFF 3SSQA 3POTB 1JMTA 2ZH4A 3NCRA 1MWZA 4WK1A 3R5AA 2FYXA 1RA6A 3KYLA 3CCMS 1SL0A 3KHHA 1KFSA 2BQRA 2G1DA 3D68A 4U7UD 1UEUA 2I1RA 2NYIA 4ZPWR 2OPRB 5CQGA 5HK4A 4ZVPB 4Z2XA 3D67A 2CQ4A 1BGXT 2W2NP 5KG6A 3G82A 3R5BA 4RJVA 2E1AA 1UVIA 4OI6A 2BM1A 2A6OA 3QPIA 3MI7X 1TK5A 1FK9B 2XI3A 4PUOB 3G86A 1NDKA 1T3NA 4I7FA 1JQGA 4AFFA 4DR4F 2Q66A 1KQKA 1U6ZA 4Z7YA 5GVQA 3JSMB 4J90A 3IAS9 3KNGA 5BJRA 3HZEA 2VBYA 4KY3A 1CVJA 4GO5X 2W8KA 2FJVA 3AT1B 3MECA 1Z1ZA 1UFWA 3DOMA 1NCLA 1LWEB 3GTYX 2J0XA 4CLTA 1LOUA 4ZP6A 2DEJA 3B82A 5KFZA 1Q81T 4A8FA 1HNXJ 2E1MC 3QATA 2MLXA 3M30B 3R27A 1T9TA 5EGYA 4GVLA 3BQ1A 4NLRA 3L7PA 4IDKB 3EPIA 2UU9J 3ET6A 5EWEA 2QA2A 3LANA 3T1AA 3W2WB 3K8VA 3HCXA 4OYAA 3ZTSA 1M1HA 3DLLQ 3TJ8A 1ZM4A 2CYYA 2X1GA 4MK9A 5F0UA 1F0XA 5KFTA 4Q7AA 2WVEA 3N5BA 3LP0A 3R97A 1FJCA 1QVGR 4TY8B 1WHXA 2KRRA 2R9LA 1Q4RA 3BKFA 2IC3B 2M5YA 1FCAA 4DJBA 2CJXB 3FUYA 8RUCA 4X65J 1NLKL 3H5UA 3K5LA 5GAGI 4DV5J 4DV0F 3CJ3A 4L75A 1TKZA 1UPPA 1PILA 3PFEA 3EDRB 2BJ3A 4B3SF 3NGUA 2VU5A 5K5MA 4ZLPA 2HQFA 1M90T 4NA2A 3OJUA 5HVFA 3V6HA 4DL4A 1M0SA 3KOAA 1XIQA 4PG5A 3M8QA 2V2VA 3ISZA 2LLZA 3T1YF 2KFZA 2V6AA 4KH1B 2P9GA 5E3RA 1RLCL 5KT2A 2VQEF 1NH7A 4OHYA 1Y0HA 2QE5A 4IRCA 2QMWA 3UNYA 1U2RA 5F8NA 2VFRA 3FBCA 1VRUB 1HBNB 2L9DA 2LQ8A 1U0SA 2ZH1A 2GIFA 1UFLA 1HW8A 2YKMB 3DLGA 4X84A 2MZ1A 4LR8A 3ETMA 5DG8A 3M9MB 3CF5Q 4LF7J 2Y1JA 3I32A 3D9BA 3G2XA 1IQZA 4ZVFA 1WUUA 4P71A 3QMQA 1S7IA 3TEGA 3U1NA 2CPEA 2ZH9A 1QAJA 3IWXA 4OI3A 3HHLC 1IUJA 3AD9C 2ZKUA 5IM0A 4CNZA 4RU9A 4DR2J 1TKTA 2GVZB 1LWXA 5BR8J 3GG1A 2B4VA 4P10A 4X64F 4ETZA 2WOMA 3R5CA 2H65B 3NAIA 1R27B 1T05A 1SJRA 2BE7D 3S6EA 4IFVA 2KB2A 1H72C 4L74A 5EWGA 3OQ2A 1EKRA 2XQCA 3GWCA 3RW7A 4ZVOB 3TJAA 3VCDA 4JV0A 1RU1A 3FJ2A 3AXMA 3VAGA 1XR5A 1RYRA 1VQ6S 3CJKB 4Y28C 2HRTA 4ECQA 5F9NA 1H3DA 5A8KA 2QYCA 2GAHC 4OZ5A 4FF1A 1WHVA 2MB0B 4OZ1A 1SBRA 3HM9A 2HZAA 2Z8QA 3AOCA 8AT1B 2N82B 1B3TA 5KT4A 2IM0A 3IGVA 4NLQA 3OXLA 3ENQA 5T7LA 3P4UB 2IPOB 1PAUB 4UY8T 5DQGA 4KGZB 4B9UA 1FNXH 3HF5A 2VG6A 3OUYB 3BM7A 4JI2F 2HGMA 1HNZF 4B3MJ 4WP8A 1QDUB 2VBWA 4M5IA 4A8QA 4ED3A 4IOBA 2H9ZA 4TYBA 1TK8A 1NNDA 2YQ3A 5DDOC 2JEFA 4I64A 4DN9A 3GQCA 1SH3A 1VHFA 2HHHJ 2RQKA 2JEGA 4DS4A 5J2PA 1CEZA 4DL5A 2KFNA 3L7UA 1BWVA 2HW3A 3EZUA 1X60A 3D6FB 5J1EA 4QZVB 1YJ7A 2W1BA 3FRZA 3NNHA 4FN5A 1RZMA 1TMJA 1KONA 4UOGA 1FRJA 3GSDA 4EYHB 3QT7A 2DHAA 5GAGU 1JLGB 1EARA 2GO9A 4IUFA 3LALA 1EQMA 2VPYB 3BN7A 4Y34A 4F02A 1R8BA 2MKSA 2M3DA 1H7WA 1YX2A 1C4CA 3FSYA 4JV1A 3AFGA 3I6PA 3H98A 2IMWP 4X4SA 2DHGA 1W26A 2OPQA 2NZCA 4HLBA 2NYHA 4CT9A 3DLEA 1P9YA 2Y0BB 3I0RB 4QIGA 4KHPJ 2J6SA 2GJ2A 2J0QD 4FYVB 2RIJA 4OX9J 3BYRA 3M8RA 2YBVA 2C2NA 4LSLB 4K4ZA 3PYEA 5GMKa 3HI9A 1N33J 1P1TA 4CO4A 4F2RA 4PYDA 2OP5A 5CYMB 3BSNA 3LAMA 2KZMA 3QGGA 1UEKA 4FVMA 2X3GA 3FQLA 2KI2A 1XNRJ 5ADZA 2YKNA 5E3PA 3UO0A 2VODA 4FBUA 3N4WA 1H74A 4NEYA 4OX7A 1X4GA 2XTJP 1RAEB 4C8NA 1NPRA 1HD0A 2EBEA 1VRTB 2B8PA 4QR0A 1GT8A 2KZZA 3QO9B 3V6DB 1UP1A 3M2VA 4H4OB 4LF4J 2DNPA 5C2GA 3QSIA 1ZETA 2MLYA 2BEFA 2ASLA 1OSDA 5G0RA 4LF8J 3CD0A 2C3UA 4ICLB 1M5SA 3CCLS 3NG8A 3HT3A 2V8HA 1NMEB 1Q8BA 5D3GB 3H25A 1AW0A 3POTA 3EVMA 3DU6A 4NPOA 5L9XA 4IH5A 4KIAA 1S4FA 2F65A 4OV6A 1NEEA 2DCUB 2JNJA 1O5JA 1XBWA 3OR1B 3DGVA 2VC0A 3KHGA 5E33A 4K2XA 3G96A 3KNAA 1HHQA 2QJ3A 2E5IA 4O3PA 4Q8FA 2I6WA 2HBZB 4ZVHA 4NYZA 1FK9A 1LKZA 2V5HG 1Q8LA 2VICA 2E66A 2HS3A 3I4PA 2CUYA 4Q5VA 2CPZA 2UVWA 1UETA 2DNNA 2Q79A 1FFWB 1YJVA 4CO5A 5L8RC 3JSMA 3ZZOA 2ZZMA 4C6AA 3QIDA 3K17A 4CZCA 4RNOA 1LK5A 3CJSA 1VS3A 3TYTA 2HHVA 3GFZA 1R8AA 4M5GA 3A4TA 4JI3F 4OI1A 4CO2A 2K06A 3OTBA 5D77A 5KG2A 4DMZA 3P5BP 2MJNA 4WKYA 3M30A 2VOOA 2ZZTA 1NM2A 5KFSA 2J5AA 4C9DA 4DV4F 2YKAA 1WEZA 2SXLA 2YWFA 3F0NA 1CS4B 2A1BA 3O3LA 4OYIA 4LR9A 1HI1A 3UDVA 2ZHAA 2XLJA 2QLWA 1RHJB 4Y2KA 4MKAA 3UR3C 2GZOA 4CLUA 2C2RA 1XN9A 3PIOQ 2AP6A 1U1LA 1L3SA 1T8EA 4F26A 3OL9A 3LGMA 3W8GA 3VAMA 3KUHA 2HQCA 4YY3J 3CJ4A 1RP5A 3LTOA 4LF5J 1N5TA 2DBBA 1C0TB 2CQ1A 3KDOA 3SCJE 5DRKA 1A6LA 2HNZA 4NZ0A 4K4SA 3I96A 3TUPA 1FTRA 2BMBA 2BOAA 2YKQA 2XS5A 2XWYA 1VBZA 1PIEA 4LT6A 4CDIA 2RSQA 4DEZA 4Y65A 1N34F 4A8OA 3HFKA 3ILOA 1IKYB 1YGYA 2A0FB 1YJ9S 3RRHA 1S1TB 2NSCA 4M95A 2IJFA 3FCVA 2UVRA 2GGPB 1EHWA 4GRSA 3THVA 5CCMA 2M88A 3AQPA 4U67Q 1LFPA 2L3MA 2HMIA 1B7FA 2EFNA 1OPIA 1NU4A 3PJXA 1T9WA 4DU8A 2IHR1 3TZXA 3LO3A 1VRUA 1HBNA 3QLHB 3ZZPA 3FBBA 2E7XA 4FF2A 5C25B 3I4HX 3BREA 1MW7A 3EPGA 2XCPA 3ZNUA 2V9WA 1DURA 4O3QA 2XYGB 3BZQA 4UTGA 4NXNJ 1G7CB 1OWXA 2ZBQA 2OEJA 2MHNA 1YJRA 1T11A 2LP4A 3M2UA 4XO0A 2YNIB 1YIJS 3MZIA 1HWIA 3KLHB 3PXGa 3HJFA 3TUJC 1S6PB 3PRDA 3NL0A 4X66F 4ED1A 5M2UA 4NLGA 2I9SA 3Q22A 1P6TA 1NKBA 3NKYA 1S79A 1G4CA 3QYYA 5JUMA 2BKPA 4ZN3A 3GR0A 5AXKA 1YVFA 1Q5VA 4OYMA 2U2FA 4YUDA 5DZ6A 2DISA 5JVGQ 3GJRB 4OFZA 2DH9A 4YHHF 3OFEA 1WHYA 1RJJA 4IKAA 4YB5A 5IV4A 1WI6A 4Z37A 3CJ0A 3RTVA 1S9EB 2CNOB 5ETMA 3W9HA 3BSAA 2B9YA 2QLJB 4KHRA 3AJ1A 4NLPA 4JI8J 4LJMA 2YQ0A 1A0OB 3CJKA 1YBTA 4PKDB 1ITPA 1R8HA 4ZA1A 4ED2A 2C1EB 4ZPAA 4PZVA 2LQ9A 1CJUB 2JWNA 2DXEA 2XSJB 5A8RB 3THTA 4CM2A 2BRKA 4CLYA 1FWPA 2GW8A 3GFXA 2H5EA 1TFYA 3RG6A 2AGOA 2IDEA 3QJJA 4QCLA 2JOQA 1TKDA 4N41A 1SV5B 4LSZB 2E9ZA 1UCNA 3BSCA 2GJIA 2FB0A 2Y3YA 2HYIB 1V5VA 4NXMJ 3OUYA 3MUTP 6FD1A 1CC8A 1EETB 1CJVB 2WVFA 4G1QB 2MQOA 2Y8YA 5IFMA 1NK6A 3LP2A 4CLFA 1YRUA 4QYZJ 3BB5A 1GXUA 4OZNA 2XMAA 2DNMA 3H0PA 2XYHB 2ZHBA 1ZH5A 2V67A 3LAKA 3T9ZA 3KG4A 1N5VA 4TN2A 4MMOA 5BXIA 1NDLA 1QUVA 3KTQA 3A8JA 3GV5B 3D4JA 4CH0S 2BA9A 1LW0B 1ZAXA 2B5JB 3A13A 1JXLA 2ZD1B 2F40A 1XR6A 4TKTA 3UD5A 3A1YG 2VBXA 5HN0A 2CIMA 4X4RA 1U8SA 5A0YB 2HIQA 2X51A 4CLKA 3CPWR 4CLWA 1YJTA 4QYZK 3HFVA 4EYIB 2GS8A 5KG0A 3W65A 3DGPB 5HATA 1REVB 1O0PA 3KFWX 5D0EA 3TJ9A 4WWSA 1JLGA 5LMUF 4PQAA 1I51B 3PW4A 3MR5A 1EB0A 1HR0J 5L1JA 1YDLA 1WEYA 3GJQB 1VRQC 3BH6B 3M6VA 5LOQA 3MMBB 3HKWA 3MD1A 3JTOA 2LFVA 3Q2SC 4J91A 1WG4A 3PEHA 3T5JA 1WC4A 5DDPC 4B9MA 2IRXA 5DG7A 3OW2R 1NK8A 3I0RA 2XY7A 3RGIA 2R3VA 2RILA 3A8KA 6FDRA 2KM8B 1S0OA 1UL3A 4WIQA 3FQKA 2FQQB 3TA1A 4LFBF 2LA4A 5HMWA 1OYDA 5A6WA 5DLGA 4MYUA 4LSLA 3M6XA 3CC4S 2AGPA 3C6TA 3GE9A 5D6GA 1U1NA 1RAGB 4EZ9A 5CYMA 3G6ES 4KSEB 2MZTA 1HBUB 3RUBL 2CJKA 5IT9U 3TNVA 4TLQA 4QIWD 2VKRA 3JTNA 3UDCA 4X4TA 3PNIA 4BDPA 5E3CA 4DV1J 3GG0A 4WFZA 2FZCB 3W8PA 1G6BA 1M5KC 2UUAJ 3MPWA 4DV3F 4O44B 3UR0A 5IS2A 4J9NA 1TKXB 4K2JA 1YLXA 1XNQF 1RWPB 1D8ZA 1WKJA 2IVFB 3JQMA 1YRXA 4PPZA 1HWJA 3V6DA 3A3PB 4H4OA 3MR6A 4AUKA 2C2EA 3UDEA 4LQ9A 2XCAA 1RT3B 1SI9A 2HK3A 5B0FA 1R31A 4J37A 4P7VA 1Y4ZB 2KYXA 1VYAA 1XMOF 1X9WA 2V68A 4EGLA 5GAEI 2HHSA 5GADI 3TA0A 1XEZA 3PHTA 2RH3A 4ICLA 2QA4G 3SMZA 1J5EF 1ULRA 3FEZA 4JB8B 4F4WA 1MMDA 1OIAA 5AT1B 5ETRA 4ITSA 5D3GA 5CHCB 2IM3A 3RB4A 4GKKF 4E98A 1HNIA 1UMJA 1FNOA 1R6YA 2KTQA 3KJNB 4P2XA 3M4XA 5F8LA 1FRXA 1U45A 2BJEA 1IBMF 1LNQA 1JLFB 3LA0A 4B3TF 1BWEA 2F8HA 3MCOA 5DS7A 3ULHA 4Q44A 1N36J 1U1OA 1JLQA 2IYIA 5F8MA 3OR1A 1HMVB 4LFCJ 4HHJA 2OTJS 2VPZB 2W8LA 3MPVA 2DRAA 3TO8A 4DUYJ 1VQ4S 2NXCA 3AD8C 1AZSB 1RT7B 3PO5A 4WXWA 3HZGA 4G65A 2K7KA 1UWBB 4F4KA 1QSLA 4XPEA 1GMVA 3TANA 1QJHA 4DZDA 4P75A 3DLJA 2AJFE 1RWVB 1S99A 2KN4A 2VJUA 4RNHA 1H6KX 2FGCA 1YZ6A 2ZVIA 1HHSA 3IS9B 1FRKA 2DPIA 3CVKA 1TZ0A 2OEMA 3OL8A 4M94A 2GHPA 4FYWB 2KVIA 2M70A 5KOXA 1HNVB 3FSXA 2VUGA 1LQ9A 1TL3B 4ILRA 1Z4UA 4WK3A 1IBKJ 5L38A 3JAMU 3NGKA 1SL2A 2VONA 5KFKA 1SQGA 2K1RB 1T9UA 3EICA 1RT2B 1CS4A 3P6YC 4C2MA 1VIOA 1WACA 3ADAC 3IP0A 5ETLA 5DJBA 2CG4A 1WELA 1T7PA 4NLTA 3TAQA 1N5YA 4CM0A 2J9CA 1RABB 4JV5J 1C1BA 3MD3A 1JJ2R 1Z2ZA 2ZOMA 5KFQA 1S4EA 1MROA 4OZJA 2KKHA 1RDRA 2XNQA 2CPIA 3J80U 1AB8A 3OTCA 1VQNS 1X4EA 2D1CA 9RUBA 3SZ2A 1QD1A 2QLFB 2C3YA 3VZIA 1RWMB 1IKYA 4LF6F 3RJMB 4DV2F 2GCFA 1S1TA 2FTRA 4R8UB 4QU6A 4I2PA 4CLZA 1OO0B 1F2HA 4FVCA 2Z2ZA 1DTTB 1G2EA 3KHLA 3MURP 3S8SA 3S01A 3MAAB 5E0OA 2R8HA 2DNZA 2HKEA 4DX8H 2V4QA 1GXLA 2ILZA 4PXEA 2BJ7A 3VV2B 2WSCC 2FVPA 2CG8A 1RT6B 2WB1D 3QLHA 2OIHA 4PQUB 1FXRA 3GB0A 2NPIA 3UCUP 4TU9A 2J9EA 4BWMA 1U1QA 1TELA 2IY5B 3IWNC 3RAQA 1KVJA 4DUZJ 3WIVA 4QU7A 3CCRS 1BC6A 4IQMA 1KLMB 3K57A 4DFKA 1UA1A 3FBFA 4ES1A 3RRGA 4YP3A 2EKYA 4OJ3A 2YNIA 2PN6A 5K20B 1JNZB 4CO0A 4QJVA 2CAJA 3SQOP 1OQ6A 2DK2A 4H4MB 4ALZA 3OTEA 2DEIA 5GAEU 4C3KA 5GADU 2FDNA 4HKQA 2MZJA 1F6TA 5D4PA 4L3NA 3OBIA 3P8BB 2ALZA 4QWCA 2DJWA 2ZFHA 2LYVA 2WBMA 3LGHA 2POKA 3D1OA 3HHEA 1MWYA 3VR1A 4F25A 2AV5A 2XLIA 3NGDA 3ITHB 4QR1A 3ENAA 4U8VA 3LWMA 1SKUB 2P2CB 4OZ2A 4JI6J 1FDAA 2GQ2A 4LVOP 3KKFA 1YITS 4LUBA 2UUCF 4HI1A 4ZPCA 1RE1B 1S9EA 4W92B 2YNFB 3T1YJ 4ZVEA 4ZP9A 5I3QA 3ZZYA 3Q86A 2VB6A 1CJUA 2XSJA 1DHMA 5A8RA 2XO7A 5B7WA 3KDNA 4DX7A 1UTAA 3UVJB 3D1QA 4LSNB 1DLOB 1YBAA 5J2QB 1KHVA 1KTVA 1NSPA 4EBEA 1JLBB 1NJIT 1WKLA 4ZVTB 1WDDA 3BF4A 1RTZA 2GV1A 2P6SA 3R1HA 2ZJPQ 2CQHA 3LH2S 1Y5IB 2JLEA 2RUGA 1BXNA 4YQWA 2IAJB 3CJ2A 1EETA 1S1VB 3UDLA 4G1QA 3DLKB 4DPXA 4BC7A 2R7SA 3C16A 3ILJA 2KT5A 2R42A 1TAUA 3BEGB 1KDNA 2R8GA 4UUXA 2AJ4A 5LXYA 1DFDA 4ZKAA 1GXTA 4DR5J 3SCIE 1CC7A 3SSRA 2IIHA 4ZPVR 1M5PC 3IGNA 3Q83A 3MR2A 1X4FA 3T6JA 3IBFB 2MLZA 1SC3B 3G6YA 3H20A 1RSCA 1KQSR 2IMOA 3BGOP 4TXSA 1SJ3P 2B5JA 2ZD1A 4DR6F 2H48B 2AEFA 4H54A 4MKYA 5IOLA 4ECXA 4RR5A 3QT8A 1S12A 5A0YA 2XBPA 3DGPA 4NLUA 3BQ0A 1REVA 2RQCA 3OT9A 4A8WA 4C8KA 3ICLA 1NDCA 2CJYB 3I31A 3W61A 4R25A 4ZVGA 3BO4A 2F8MA 4ILMA 1KQFB 2DVIA 1IXKA 2XY6A 2AYMA 4G3IA 3BV8A 3ZZTA 4DXLA 2OHDA 2HLUA 3Q0AA 1KRPA 5KFAA 3S1TA 3VQTA 3GV7B 1QSYA 4K4YA 1Z2LA 4DV7F 1RT1B 3W7BA 3B78A 1APSA 4LF9F 2HNYB 4JI2J 4F0MA 1YRTA 3C14B 2OO4A 3VVUA 1RYSA 1GTHA 3W60A 2OPSB 1VK3A 2F3JA 5HP1B 3K2YA 5B0BA 3M7VA 5AJ3F 1UZHA 2QT7A 5KFMA 1NHKL 3IRXB 3JYTB 3C46A 3CGIA 1ZA2B 4F36A 1N88A 4KPYA 2UUBJ 1FDDA 4O44A 2RHSB 3C8YA 1X7VA 1TKXA 1CQNA 1FD8A 1DRZA 2U1AA 1R43A 3H8YA 1KD1T 2QN6B 2RF2B 2FVRA 5IQ6A 2DNQA 1U49A 2W4DA 3CCTA 3BYPA 1XR7A 3LWLA 2FGOA 2DHSA 2P6TA 2LDIA 2M0GB 1RCXB 3BKTA 2R7XA 2O3DA 1RT3A 4C98A 2W2PP 3DXBA 3W1YC 4YMEA 3SFGA 5J1NA 1F60B 2E5JA 4X4VA 3QAEA 3O8WA 4AE5A 3IG1B 1CBKA 3LPEA 1IJFB 3CJ8A 1H2TZ 2DGXA 3AA8A 2EBGA 2B0GA 3CDUA 2NPFA 4Q0BB 3H2VE 3PJWA 3K5PA 2E5LF 2LDYA 2PO4A 5E2QA 1UJ6A 2HAIA 2EFPA 4WJBA 1K8AT 1SKWA 4KKOB 1FWKA 2E44A 1I94F 4LBPA 1WDTA 5ETPA 4DFJA 2D74B 4K4UA 1JLFA 1DY3A 1VMBA 5C42B 2JFDA 3ZFVA 4NCGB 4JI4F 4M5LA 4RX6A 1RWUA 1GQEA 2YWKA 1KOHA 3EGZA 2YTCA 1RT7A 2BE2A 3DFEA 2OMOA 1RBAA 4IH7A 2B51A 1F9EB 3MPDA 4ZOSA 1NB7A 2ZBCA 3JXOA 3M9NB 2QFJA 3D7SB 4ZHRB 1PBUA 1EZZB 1KS2A 2EEYA 1D9DA 2OJ3A 2CPHA 1PC5A 3NAHA 4U6PA 3ET6B 4C8LA 1G3OA 2FC8A 3IS9A 1ZBTA 5HMZA 5F9LA 3OLAA 2Y9HA 4WU2A 1KNZA 1T9YA 2CJBA 5MLCV 2HQIA 3SYZA 4RL1A 3BBCA 3UN2A 1BY9A 4NI2A 2RAQA 1HNVA 4DLEA 1AUDA 4M63A 1FDBA 3LP0B 1TL3A 3ENVA 3MM6B 1WC5A 3R9LA 3GZ7A 1NHUA 2K1RA 1WJ9A 1X9SA 1RT2A 2QZ8A 1P9QC 1LXNA 4DR7F 3PO4A 2MZSA 1Y9OA 4N77A 5I4MA 3GCXP 3V6KA 1RKJA 3M8SA 2HWTA 5KOWA 3M9OB 5IV3A 1KTQA 3MHYA 4D3HA 2VPXB 5HAOA 1X8DA 2BYCA 5F8HA 1UA0A 1WSVA 4Y00A 2FY8A 1U1KA 3CEDA 2V9KA 1UJ5A 3D0HE 2J0SD 1DQ9A 2E5GA 2VA2A 2HQGA 2HLTA 1FKPA 2LQJA 2VJVA 5C24B 1Y3KA 2BW7A 3DRYA 2W7AA 1V3SA 4JI1J 2RJZA 4X4PA 3OSNA 3H42A 4D3GA 3LPYA 3L7OA 3PEJA 3WX4A 1RK8A 3FBEA 1HQUB 4DCJB 1XMBA 1K0VA 1O8BA 1RA7A 4ED8A 2M8DB 3NBPA 1FXLA 1BHNA 3MFHA 3W63A 4JOUA 2ZOGA 4OLOA 4NLOA 5A2QU 3PYDA 4QW9A 5H9FJ 2VIHA 3QJPA 2ASJA 1F5BA 2Z2MA 2MY7A 3GYXB 4JI3J 1IKWA 1RT6A 3G9CA 4PQUA 4DPTA 1U0HB 4P2SA 3MEDB 4DSLA 3NMRA 1LFWA 4FDFA 4EWTA 4UQTA 4NRTA 4DV4J 3QGIA 4LF2A 2V69A 4CQ1A 1K1QA 1KLMA 2GMLA 5KFDA 2FZKB 3CDEA 3S7RA 4NZ7A 4ZITA 2DR6A 3DDNA 3PW7A 4FNHA 5H9FK 4FZVA 4AQYJ 3T5LA 4H4MA 4RPFA 2D3ZA 4MFBB 4IFVB 3FK4A 2XGQA 2ZDOA 1HNXF 1HNWJ 3G8SA 1NDPA 2ZVSA 2XB2D 3V4MA 5K14B 3CIMA 4Y3CA 3CMQA 3PTWA 1RHQB 1R0CB 3OVBA 4DPYA 3PW2A 3VVTA 2W4CA 1IBCB 3ITHA 4F0KA 1ICEB 3CJRA 4FYYB 2YKPA 1HBMA 1OPZA 2WZ1A 3R2DJ 4YOEA 4X4QA 1ZZNA 2EPIA 3UFCX 1NJZA 2NS1B 2YNFA 3AD7C 3I9ZA 3CMAS 3T1HJ 4ES3A 2JLGA 3MCNA 4X65F 5GMDA 1JB0C 4LR7A 4DV5F 4LREA 4F3OA 2C2KB 3UVJA 1ZOTA 1F5CA 4LSNA 4YS2A 1DLOA 5RUBA 5J2QA 5ETSA 2EFQA 5I42B 5BYQA 2MQMA 1PGZA 1NK5A 1JLBA 3CJQA 2JLFA 3T9NA 2W9BB 2DR9A 3AB4B 4ZLLA 2X1AA 4P73A 2HFNA 2KH9A 4U8YA 4URQU 2IAJA 4NLYA 4LRDA 5J2PB 4F4XA 4KFBB 4USTA 1RHMB 2L9WA 3DLKA 4OYOA 2CFXA 2DGQA 2W01A 1OY8A 4V19J 2XG8A 1ZTTA 2YX4A 1HYSB 4YB6A 4K4WA 2ROGA 1UVKA 3NGRA 3ZTOA 3D54A 3M2RA 5JVHQ 2RDDA 4V19X 2ATLA 4ED4A 4Y2IA 4WYLA 2C22A 4LF7F 4CCHA 2IBOA 2NXEA 4WZQA 1ACMB 2ZEJA 2HVDA 2PDAA 2VG5B 1D3WA 2VA3A 3HD1A 4NL5A 1L3TA 3W5YA 4O0NA 2CQ0A 4X2BA 3Q8PB 2OAUA 3H90A 1S77D 2CDQA 4DR2F 5BR8F 4FYDA 2AW0A 4PG8A 5F8IA 1RTHB 2PIIA 1T02A 2RD5C 1S6QA 2N3LA 3DI6B 3P45B 4PG6A 4DI6A 2WSEC 1A9NB 2H4WB 2V2ZA 2QRRA 3N9UC 4OQJA 2YWEA 3OTOJ 2D3OR 4V1Ak 1ZTWA 3T19A 1HD1A 2HURA 3PX6A 2HNYA 1QM9A 2XMVA 1JX4A 2Z58B 3U1LA 4AXJA 2QL7B 4HHUA 2OPSA 2XHCA 1N8RT 3P5TL 5D0RA 3QZ8A 1Q95G 4J9MA 1NKEA 1YTYA 4J9OA 2IM2A 1B99A 3IRXA 3M2VB 2BJ9A 4ER8A 2AKWB 1CLFA 3C15B 2X1BA 1SJ1A 4Y0FA 4QWEA 4KC5A 3IM8A 4P2MA 4DL3A 3HMJG 2OH2A 3MM7B 5LJ5Y 2KXFA 4B3MF 3Q2TC 1FO1A 1S1WB 2HVZA 1WNEA 1S57A 3KUEA 4IOCQ 2RF2A 1HW9A 1V6HA 1R8PA 2MSTA 1RT5B 4RLEA 1ZA1B 3MOJB 2B7BB 3OXFA 3QGPA 3K59A 2IRYA 2K3IA 3HSZA 4R0JA 2B7CB 2VF3A 4ID8A 4RWWA 2OUGA 2ZBPA 4DQPA 2HHHF 3HHLD 2HGNA 2AT1B 2DGOA 1FJGJ 3U7JA 2DITA 5HSPA 4FXWA 2HHQA 4NCAA 1SB6A 2BANB 1JLEB 2H54B 4OI4A 3IG1A 1UAWA 5IWAJ 3TAMA 4IFYB 4IRDA 3B54A 1H2VZ 2CJQA 3QAUA 2KHDA 2HSEB 4EZ6A 4I1TA 4Q0BA 2L48A 3UD4P 2DNGA 3HKZD 4EBCA 1HLWA 3D2WA 4XK8C 2JRSA 2E7VA 1IWAA 5KFBA 4XTTA 2D3O1 2R2TA 4KKOA 3JQJA 2B43A 4WCEQ 2I2YA 4UZCA 5C42A 1TL4A 2MHEA 1I1GA 4QWAA 2KO1A 2IVYA 4OI2A 1YK9A 4NCGA 1YZ7A 3EUNA 2J7UA 1Q86T 2YVSA 5I3UA 4OI0A 5H1SV 2G13A 4KHPF 2LECA 2MJUA 2ZOFA 4K50A 3VAKA 5T14A 4DV3J 5T41A 2MQPA 4FXVA 4OX9F 1X5SA 2ACMA 4LMZA 4ZHRA 1JNRB 4RNMA 3MFIA 5CD4A 1B64A 5FLXU 5B0DA 1N33F 1NPPA 3ZC4A 2RDIA 1FFGB 4WYWA 4EU0A 2L08A 4M5DB 4IG0A 4I6YA 2KFYA 1LV5A 1U48A 4CWBA 4K5SA 3AH6A 1EJ7L 4M5JA 1XNRF 4HHHA 3UCGA 1FRHA 3M1VB 3MM6A 5KFFA 2FJAB 1G1XA 4ZCMA 2V4RA 3I5CA 4C11A 4MK8A 2FIUA 1S6OA 4USJC 2XO6A 1RADB 3W5ZA 2C3OA 2HNZB 3B4DA 3MEGB 3BR8A 4DQSA 3CE8A 2IJRA 5CXTA 5HL7Q 4S0MA 1X5PA 1N6QB 3NNAA 4DG1B 4IR1A 4UW2A 1N32J 2CQGA 3DM2B 1W7WA 1F9HA 4OX6A 2RU3A 3M8ZA 2ZNYA 2CA9A 4F3MA 2CJAA 4LF8F 2X7IA 4ETXA 3EGNA 3AOAA 1IBMJ 3PR5B 3A8EA 3Q89A 2HBYB 4M5MA 2FHOB 2QO3A 4CLSA 3TUIC 5C24A 1QVFR 3DRXA 2HMIB 4ED6A 3GONA 1S97A 3K89A 3FEXB 3KWMA 1TR0A 1JXEA 3M8PB 1FVQA 2LQ5A 4ZN1A 1HQUA 1R6VA 2MDAA 4NWBA 4LFAJ 1DBDA 4C0HA 2F1FA 3LOUA 3MMCA 2KU7A 4DFPA 3QJLA 1VLOA 1S9GA 5J1PA 3G87A 5KG1A 4N8OA 3IBCB 3M2UB 3GJSB 1Q16B 1KC8T 4A4JA 3MCSA 1FRLA 4L6V3 2HIYA 2ZH6A 2H3EB 1U0HA 2XMUA 3VF0B 2Y1RI 3BO2A 3MEDA 1D09B 3JSYA 1FX4A 1VJQA 1S5ZA 1S6UA 3KLFA 4YR3A 4DV6J 4Y6IA 1VQYA 2KXNB 5D0GA 5KTQA 3R6LB 1CJTB 1L5UA 4UF4A 2BR0A 1N52B 4MFBA 2E9TA 2RT3A 2HBRB 1SH0A 2DGSA 4J9VA 5K14A 3DU5A 5LMNJ 1VIXA 3TEHB 2GO8A 4DPOA 2O5DA 1RT4A 1VC6A 4YN3B 3QRPA 5HQ8A 1QY7A 1CG2A 2O66A 2CZVC 4MH8A 2K7JA 4NYOA 4FKXA 4RBVA 5KFUA 3MR7A 3KJFB 4XDCA 2RRBA 2F5GA 1WI8A 2R7VA 4ELTA 3E01A 4A8SA 2YWWA 4BLGA 1X0PA 4GC6A 1WF1A 1WC3A 3U27A 2OELA 2MQNA 2ZH5A 3T5HA 1W25A 4YY3F 4LF5F 4CTAB 4DF4A 2X1FA 2WK4A 1MMNA 1ZZFA 2L41A 3PKMA 5KT5A 4I67A 2Z56B 3DMJB 3GILA 4UZBA 5KT7A 3DOLB 2C28A 3LP2B 5I42A 1S0VA 4EI2A 4K7QA 2W9BA 1RHKB 2WTFA 1K9MT 4JV2A 5HLFB 5KG5A 2QL9B 1FESA 1QAYA 2BQ3A 4PCQA 1H73A 2RB7A 1U6BA 2PA8D 2JX2A 4HH0A 4KFBA 3IRWP 4AXIA 3EX7B 2MMYA 3TZZA 2ROPA 5D15A 1JLCA 1HYSA 1Y10A 4C4WA 5HJYA 2BJ8A 4OHXA 1Q5YA 3J7AN 4Y2MA 2BUNA 1GK8A 3GSIA 4B9NA 3SEOA 2OSRA 2N4CA 2FJDB 2J76E 2YWHA 3AB2B 1PYSB 2RDJA 1P8GA 1U24A 4NXNF 4LF1A 4ZIVA 4F04B 1LK7A 2YXLA 4HACA 3W2VB 2IJNA 1U6FA 3MAHA 4XDDA 2VG5A 4QIFA 2J9DE 2UXBJ 4FPRA 2B4UA 3FCWA 3UD3P 1U1MA 1D0EA 4OHZA 1SCJB 3GIMA 3SV4A 3HT0A 3EXCX 2GAGC 1PAEX 4DUTA 3VTIA 3J81U 1RTHA 4JBCA 4J9SA 3DHWC 3AXKA 4DF8A 1C0UB 1H2UX 3DI6A 1FWLA 3C6TB 3BGLA 2MYFA 4YR2A 1RACB 3R5GA 1F3FA 4ENOA 4ES2A 1FJ7A 1VQ9S 2DB1A 3K58A 3MWBA 2A6MA 5KFXA 2QLBB 4CLLA 1IN0A 2XZDB 2ZM6J 4JI8F 1D8YA 2D9OA 4RO0A 3Q8RB 2CQBA 2YQ1A 4CH1A 1Q7YT 4IOAQ 3D6MB 2V34A 4CH7A 4RNFA 2ZBIA 3K0JA 5IT4A 3G8QA 4JP8A 3DC2A 2OFGX 1F5AA 2KHCA 1RAOA 4PAAA 3GFHA 3R1LA 2F4VJ 4FBTA 4UQGA 3UNGC 1AROP 2J6UA 4L3KA 1XQIA 3KLEB 4IRKA 5CH7B 4WFNQ 2AD9A 1WOPA 3OL6A 3C15A 3NY0A 1CULB 4HH1A 2OKQA 3IAM9 4NXMF 3RAMA 1HPZB 4DHVA 3MM7A 2K2PA 1WF2A 3GYNA 2HBQB 1SJQA 3OXGA 1S1WA 2XZWA 4NLDA 2PSZA 3WZ0A 1FTCA 1HBOA 5KAKA 1RT5A 1Q8IA 2IYGA 2OI2A 1TV6B 1JXVA 1MNEA 4OLPA 2JHEA 2JVOA 4DQQA 4W98A 3EGWB 3EE3A 1GMWD 4LBIA 1HNIB 5D4NA 4OJHA 5EX0A 2BXJA 2BANA 2ATCB 1TTHB 5IQQA 1JLEA 4MYTA 1R0AB 2NR0A 2ZUAA 4EEYA 4IFYA 3DRSB 3PM9A 1TL1B 3M32B 2RRAA 1JLQB 4P2FA 4X4NA 1PG5B 2MQ8A 1WORA 2J7WA 1KHWA 4LF9J 4JUZA 2KJWA 3SDEA 2EC2A 3CCSS 3IA0A 2RQ4A 1TVRB 3L09A 2FLPA 4X4OA 2O01C 1PYTA 5FIIA 4AL6A 4ZVSB 2DPJA 3KJVB 2FHJD 3UN3A 2LU1A 4A47A 4R5PB 4K0KJ 2D41A 3CTRA 2BABA 1WKKA 1FE0A 1YJUA 4C3LA 2WSFC 4NA1A 2OEKA 1GFWB 1M1GA 4WKRA 3E3XA 3CDBA 1Y7PA 2N3OA 2LA6A 1Q53A 2E7WA 3A3OB 4M5DA 1D1UA 1FJEB 3N79A 3IR6B 5J2NB 3NS6A 2F63A 3D5MA 4DV1F 2E1RA 2H51B 2VZ9A 5AXLA 3O44A 2UUAF 4GMKA 1N5YB 4O3RA 3M1VA 4WP3A 2VHGA 1B7YB 1SPBP 1C1BB 1MU2B 2NUUG 1J5OB 3N28A 2E29A 3RR8A 4RW7B 1MROB 3MEGA 4JI5J 4RW8A 5FJ4A 4N5SA 1UKUA 1S76D 1N6QA 5D78A 4DG1A 2CQIA 1NBEB 4DR3J 4QQBA 1VBYA 3DM2A 3CW2C 2APOA 2Y1LB 2HAFA 5F3ZA 1BQXA 1WHWA 2RHQB 4I2PB 1SQFA 1OY9A 3PV8A 1ROFA 4OYXA 2HS4A 2XI2A 5ETOA 4OYZA 2BKNA 5FDLB 3UCZP 4F2SA 3H2UB 2EK6A 3PG9A 3HVAA 4NMXA 3QQCD 7FD1A 1WC6A 4DL7A 2BKOA 3M8PA 2ASDA 2A2CA 1C1CA 3MOZA 3ZXWA 8ATCB 3HHLB 3TW0A 3EDQB 5KFWA 4IR9A 1X4CA 5LL6d 5G4DA 2AF6A 4M8LA 2LKZA 1OQ3A 5KFIA 5KFLA 4KTQA 2G2ZA 2FLOA 3OFGA 3CD7A 4LFCF 2AHOB 2IA0A 4JI0J 5DM7Q 1SL1A 5EHHA 1ZPVA 1U26A 2VV5A 5SUHA 3HHDA 3GU0A 4TLRA 1TAQA 1Y5LB 4PWWA 2JVRA 2H5JB 4IQXA 4WE1B 4GKJJ 1I3OB 1WF0A 1UWAA 1Y11A 2UXCJ 4ECZA 4WBFA 2OPPB 1HQEA 4CLPA 2PFDA 4DR7J 1GNKA 4O23A 4XIUA 1TL5A 3TWZA 1S1XB 3ILIA 1YWXA 1CJTA 4Q2LA 2YNGB 2GX8A 3BGRB 2VPWB 2DTJA 2CPYA 5DM6Q 4BC9A 1IBKF 4JI7J 2BV3A 3QBCA 3R5JB 4DR1J 2ZE2B 2B9EA 4ZVUB 2K8GA 3I0SB 5B0AA 2Q1LA 2G9OA 3SXLA 3DYAB 4HVZA 2DXFA 3CULA 2ADBA 2VL1A 4JYAJ 5DGBA 4ED5A 1KKHA 4TU7A 4Q45A 4J9QA 2WHOA 4OV1A 1U25A 5HQMA 1PKUA 3QWPA 3HLUA 4JV5F 3TR5A 2QA4S 3DCAA 5F8GA 1ZM3A 4MJKA 1W2BR 4CTAA 2GQCA 1EAYC 1VQ5S 4C3MA 4FYXB 3DMJA 2XWXA 3X1LB 2FHMA 3PDNA 5LSRA 3C16B 3DOLA 4W90B 2EW9A 2HWIA 4X62J 2BRLA 4M5KA 3KG1A 1S7HA 3W9JA 4ECTA 3MM8A 5HLFA 1T03B 3ZZZA 1MN7A 3PJ9A 1TFWA 3FEYB 1IBLJ 1VGYA 1FT8A 1H98A 2H4YB 4ZJOA 4CO1A 4ZCLA 4HTJA 4ZMMA 4B9SA 3ZTQA 2R7OA 1W2IA 1R0BG 3HSJA 2M4MA 2RRNA 4CNYA 1ZPWX 3GLJA 5B08A 3CB4A 4EUVA 2CADA 4F7VA 3RU0A 4DLGA 5IT9Y 2P9CA 5LJ3Y 3H7HB 1K0TA 4DUZF 3OL7A 2BZ2A 3PW5A 1FD2A 2DGWA 2XS7A 3TVYA 2RQMA 1OS5A 2BJ1A 2ZC3A 3D0IE 3DKDA 1J27A 4B17A 2VASA 3HK2A 1X5OA 3OFHA 4KGKA 3CMES 3W2VA 1JJHA 4USIA 1RQ0A 4UUWA 2QIFA 2IVMA 2DCLA 3EVOA 2VKZG 4A8YA 1VBXA 3MAQA 3GP9A 4ZPDA 2XEXA 1URNA 1HQ2A 2QL5B 4QBUA 2PMZD 1U4BA 2R7UA 1YBUA 5KFVA 3V81A 4ZIWA 1SH2A 1C4AA 3D1HA 1VQ8S 1DTQA 4C97A 2ZH3A 1TUVA 3E2EA 3KK2A 1C0UA 1O51A 4H4KA 4Q8EA 3MTJA 4JI6F 4N7TA 4LRFA 3SQGA 3ZZ0A 2CRLA 2N7YA 4O4GB 4GC7A 2DNKA 3VQSA 4TQSA 1HA1A 1OYEA 1DQAA 2AEJA 3K5OA 4PEOA 3EJMA 3OJSA 1RWXB 2P5VA 2ABYA 1VJWA 1R89A 1LEOA 3ZZRA 4ECSA 3W5XA 3DDIA 2CZ9A 3K7RA 2CPFA 4ECRA 4KB7A 1N54B 4DZ6A 1X5TA 5KFCA 5EUHA 4FXDA 2UVVA 1BLUA 3WIUA 4I4BA 3MXHP 3KLEA 1KOOA 2NQPA 3RB6A 2CJ9A 1CULA 3T3FA 3CC7S 2YH1A 5IT0A 1XMQJ 1HPZA 4NEZA 2C2ZB 3KLVA 2NSBA 1EX8A 3K8WA 2J9DA 3NS7B 5HJXA 4ED7A 1KVKA 4W4MA 2E1CA 2LCWA 3MR3A 1SC6A 5ETKA 2QFIA 4GVBB 4DR5F 3DRPB 2HHUA 1TQLA 2B4PA 2LQBA 1TV6A 5KFOA 4PXBA 1ZAWA 1YJWS 1KR4A 2EFOA 2R2RA 2A3JA 5ETNA 4TU8A 2XSFA 4WTYA 3N6LA 1IKXB 4N47A 5B09A 3JAMY 2UXDF 4NYPA 2B3TB 1R0AA 1VC0A 3ZTPA 2W2MP 2V50A 3DRSA 3MM5A 3W64A 2KT3A 3TI0A 2ERRA 1TL1A 1S10A 3M32A 2PMHA 4L73A 2R7RA 3WX8A 1PJ5A 3MEEB 2JDJA 3TZWA 3KK3B 2V8PA 4P7TA 3JSRA 2ZITA 2M8HA 1Q0NA 1X4AA 3KLGB 2MKHA 3T6BA 3HVWA 2BE2B 4K5RA 1S59A 2WVDA 3KMQA 2DH7A 4RNNA 4B3RJ 1IM6A 1S48A 3CCQS 2EWHA 3GMGA 2FUG9 4A48A 3PRVA 1TVRA 2XMKA 1X4DA 2HFVA 3M05A 2XY5A 4KJIA 4PXDA 3VGTA 3KG0A 2F8EX 3OSPA 3KJVA 1KP6A 2DNYA 4R5PA 3VHQA 3BGFA 5KFRA 5A76A 2DHHA 3J80Y 3BDPA 2JEJA 5F8JA 4NI2B 4FS2A 4UOCA 5AE3A 2PI4A 3VAHA 5K9FA 4MIAA 2AYGA 3AA9A 3QFWA 2OFHX 3G6XA 2RE1A 2CPDA 4M1KA 5JXSA 1CPZA 1H38A 4RKUC 2Z4PA 3DLHA 3RB3A 3PX4A 5J2NA 2DHXA 4DQIA 1RTJB 2GHWA 3GFYA 4UOFA 5CABA 2VQFJ 2HGLA 4C8ZA 5E7OB 1RWOB 4OHWA 2UUBF 2M52A 1RLDA 1XWLA 1R8CA 3NOCA 2COLA 2XGPA 2BVZA 3UW1A 1MU2A 3H4BA 1J5OA 5K8OA 1SQEA 2MZQA 4RW7A 1PJ7A 2QX0A 4DL6A 4U7CA 4QWBA 4IH6A 3BO3A 2PFFB 1FKPB 2BOPA 4ZP7A 2HQDA 4DDFA 2LEBA 5DETA 1RTDA 1FHTA 5MAOA 2DR7A 1WWHA 3G71S 5LSLA 4K4VA 4DU7A 4F4YA 3FCHA 2ACYA 3I87A 1T9VA 4DR4J 5AE1A 4EO8A 3AY0A 7AT1B 3NBPB 2QG9B 1GEHA 1HFEL 5FDLA 2XLKA 4RBTA 2GVDB 4DOZA 4E0DA 4I2QB 2DNOA 4LIWA 5EDWA 2YH0A 2BM0A 1M5HA 2NREA 4OJGA 1M5OC 4QOTA 1IKWB 3HHLA 3NP5A 4PR6A 4K4XA 3NEKA 3WDOA 2R8KA 1U2FA 2GC8A 4NZ6A 4DSFA 1RI7A 4NMLA 2ZJRQ 3VAFA 1KN6A 2EFGA 2QC3A 4YR0A 1YG0A 1WTBA 3SFUA 4ZJQA 1WEXA 4MIWA 4K59A 5KG3A 2KM8C 3HX9A 1EIYB 3BKUA 2Q43A 3FGVA 2N7CA 1T9XA 2WW4A 4WE1A 1AFJA 1JLAA 2HK2A 2NZ4A 4UT4A 2PEHA 4HI2A 4F0HA 2R7QA 3IFEA 2G2YA 3F44A 1SIZA 3DHXA 5ETQA 3DOKA 1NJWA 2OPPA 4CYUB 3R3TA 4IYQA 1CJKB 3Q23A 1FVSA 5DQHA 2VC1A 4A46A 2HRYA 4DV0J 3PYGA 3IBWA 2J6TA 2YWGA 1S1XA 4AL7A 3MGJA 4DPUA 1OY6A 4B3SJ 4URGA 2YNGA 3BGRA 2KG1A 2OLWA 3UQSA 3L9ZA 1HBMB 2WONB 2IA6A 1BQNB 4MIBA 2KT2A 3HHNB 3DRRA 4PG7A 3TZYA 3UWTA 2ZE2A 2IBKA 1FX2A 1AT1B 3I0SA 3O6QA 1JKHB 3CJ5A 1VI7A 3DYAA 2DGUA 1KVIA 2VQEJ 3NNCA 2NUHA 2YX7A 3FFIB 3TRGA 2FHKA 3JSBA 3N6MA 1TUWA 2ZH8A 1FF2A 2EK1A 4KO0B 2ZKTA 2PMWA 2M9KA 4RW9B 5D8HB 2XC9A 4O3SA 2I5JB 2R7TA 1HL6A 4HDGA 1LWFB 4F4AA 5IZHA 4ZP8A 2MKKA 4QPTA 2H1YA 2FLLA 2OPRA 3R7SB 1PBAA 3CO9A 3GPAA 1TU0B 5U47A 1YKWA 2EXUA 3O1LA 4WU3A 4RW4B 2VOPA 5CZXA 2CDRB 4NLXA 2HVIA 4LRBA 1RISA 4MT1A 1YJNS 1U7LA 3VGVA 4JI1F 3QT6A 3W3SA 4OZ3A 2B9WA 2MKYA 1EQ0A 4PUOA 2VDHA 3UN5A 2XZTB 4U7UK 3M2RB 2BE9B 1T03A 2I8EA 2MZRA 3BN4A 2V4JB 2XULA 2V0NA 1IVZA 2HFOA 3RRKA 2N4DA 4PYAA 5HROB 4P74A 4KAIA 4X64J 4I0WA 3D6HB 3L3CA 5HBMB 1LWEA 3C66A 2FLNA 3D3CJ 1MLAA 4G1IA 2AJ1A 4E8UA 2ZWOA 3BDEA 2VG7B 4C0BA 1HWLA 3HDSA 4PWUA 3R7BB 3NGSA 4Q43A 2KG0A 2D7SA 4ELUA 3I56S 3OPKA 3RAXA 4I56A 2MY8A 3MMAB 3ZO7A 4IDKA 2A18A 1DARA 4OYPA 3W2WA 3MDFA 2MKJA 1HARA 2W7OA 1PCAA 1B4SA 4CO3A 3V4IB 4RW6B 2VFTA 2GMHA 4ECYA 4E2FB 1S6QB 4LVNP 5CD4H 4AQYF 4USWA 2ZBRA 2W4PA 2A10A 2RVJA 3QIPB 4TY8A 3JQKA 3BBFA 3NWRA 1HNWF 4DX5A 4Y2AA 4USHA 1T95A 2CXEA 1GAOA 2G0IA 2DRBA 1NK0A 2IC3A 4X4UA 4OJ1A 1SIWB 2EKNA 5IC4B 3GIIA 3TUZC 3WC2A 4K4TA 2ROEA 1N0UA 4NCBA 3R6GB 3B6BA 1HNZJ 2OSQA 3QRQA 2AZ3A 1VHIA 2M2BA 5KG7A 4KH0B 1GX5A 4FF3A 4CI0B 4LRCA 3U02A 3Q24A 1NH8A 2HG4A 4A8XA 2YKOA 4O4GA 3DDKA 3Q8UA 2JJ4D 3T1HF 1NRKA 1WOOA 1OMSA 3HD2A 3NWGA 3ZTRA 4Z7CA 1RWNB 5F3TA 1VLYA 3NS5A 3P49B 2XS2A 2DH8A 1DZ5A 5AXNA 2BDPA 5CYJA 3RZAA 4C48A 3RR7A 2P8IA 4TNOA 2DR5A 4A8MP 4KRWA 3B4MA 5CAAA 3TQ1A 3TA2A 2IFXA 3CJTA 1GTEA 1F9FA 1ZM2A 3SSSA 3HULA 2VFVA 2YKMA 4URSA 1RWWB 2B8QA 4AYBD 3SV3A 1FEEA 3MM9B 1Q1KA 3RBDA 5KFGA 2RS8A 4NRUA 3J81j 3P96A 5ETTA 1LXJA 3UE2A 1TL7B 2FJEB 3PACA 1SUQB 3X3UA 1J2VA 3E51A 1U1PA 3TAMB 1BD6A 4GVBA 5M2RA 3DRPA 4C0OC 2MGZB 2HFUA 3NGTA 2YNHB 3GR1A 1HWKA 1NSKL 3PX0A 2KYZA 2GVZA 2DNLA 4HTIA 3PCOB 5ITHA 4IO1A 3K5NA 2MQLA 1RWKB 1MMLA 1IKXA 4HYKA 1RGVA 3KLIB 3RBZA 3SCLE 4FNIA 2PA3A 3NLCA 5AXMA 4CP5A 4ECUA 1TMMA 1NB2A 4ECVA 3MEEA 1XC9A 5EWFA 3KK3A 3CDWA 1M5VC 5I3UB 2MKIA 4OZ0A 2BACA 4NE9C 3KLGA 2C2OB 4BBYA 2CQPA 5THWA 3FC9A 5E5NA 4B3OB 3ISND 3Q8YA 1XERA 4WPAA 3OHAA 2ASYA 3W66A 2EVZA 1OSCA 4N56A 4WTOB 3CSKA 3N6NA 4USKA 3ZNJ1 3PW0A 4IG0B 1PSDA 2BQUA 2OMLA 3OTOF 1GH8A 1NXIA 2J0WA 2WBRA 4PXCA 2MXYA 1R3NA 4J9LA 4QIVA 2H5IB 5D0HA 1KBRA 1B0TA 4C11B 1QSSA 4EO6A 2EC0A 4AT1B 3R5DA 5A2QY 1RB0A 1RTJA 4QW8A 2HHXA 1VR6A 2WVCA 2CVIA 1SJFA 3EGVA 1P1LA 2UV8A 3KK1B 2ZZNA 2WB4A 4WFXA 3RYLA 3HJVA 1FRIA 3V6JA 1IR1A 5LSOA 1QLNA 4ED0A 2V2KA 3FZ2A 2RKIB 4DL2A 3DXSX 3KJQB 3EM1A 1IJEB 2W2OP 2JEIA 3N0VA 3C19A 1Y00A 1BE4A 3H5XA 3FVYA 4HR2A 3Q8QB 3GJTB 3J7ZT 4FKYA 2DT9A 1FJGF 5KFNA 2LEPA 2YY3A 3NMAA 3QGHA 2UVUA 2Z2YB 2QYGA 5HVHA 2HNDB
chains in the Genus database with same CATH topology
4CLUA 5IV4A 1CJUA 2BW7A 1CJKA 3C15B 5D0HA 4OYWA 4OYAA 4NI2B 3UVJB 4OYPA 4P2MA 4NI2A 1YBTA 4USUA 5D15A 3G82A 3R5GA 2GVDA 1AB8A 1CJUB 1Y10A 1CJKB 1WC5A 1YK9A 3MR7A 4CM2A 4OYBA 1Y11A 4USTA 4CLYA 4USWA 4CLLA 4OYOA 4OZ3A 2W01A 4CLKA 3G82B 1TL7A 2GVDB 4CLWA 4CLPA 1WC3A 1U0HA 4CLZA 4OYXA 1WC1A 1FX4A 5D0EA 3C16B 4P2XA 4OYZA 2WZ1A 3C16A 4WPAA 1CJTA 1TL7B 3MAAB 1CS4A 1FX2A 1CULA 1U0HB 5IV3A 4P2FA 2QV6A 3MAAA 4OZ2A 1YBUA 1CJVB 1WC6A 4WP9A 4CLTA 5D0GA 1CJVA 4CLSA 4OYMA 4CLFA 3C15A 4WP3A 1CJTB 1WC4A 1CS4B 1WC0A 5D0RA 1AZSB 4CM0A 1CULB 2GVZB 4USVA 3UVJA 4OYIA 3C14B 1AZSA 3ET6B 2GVZA 4WP8A 3C14A 3ET6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLU A;  5IV4 A;  1CJU A;  2BW7 A;  1CJK A;  3C15 B;  5D0H A;  4OYW A;  4OYA A;  4NI2 B;  3UVJ B;  4OYP A;  4P2M A;  4NI2 A;  1YBT A;  4USU A;  5D15 A;  3G82 A;  3R5G A;  2GVD A;  1AB8 A;  1CJU B;  1Y10 A;  1CJK B;  1WC5 A;  1YK9 A;  3MR7 A;  4CM2 A;  4OYB A;  1Y11 A;  4UST A;  4CLY A;  4USW A;  4CLL A;  4OYO A;  4OZ3 A;  2W01 A;  4CLK A;  3G82 B;  1TL7 A;  2GVD B;  4CLW A;  4CLP A;  1WC3 A;  1U0H A;  4CLZ A;  4OYX A;  1WC1 A;  1FX4 A;  5D0E A;  3C16 B;  4P2X A;  4OYZ A;  2WZ1 A;  3C16 A;  4WPA A;  1CJT A;  1TL7 B;  3MAA B;  1CS4 A;  1FX2 A;  1CUL A;  1U0H B;  5IV3 A;  4P2F A;  2QV6 A;  3MAA A;  4OZ2 A;  1YBU A;  1CJV B;  1WC6 A;  4WP9 A;  4CLT A;  5D0G A;  1CJV A;  4CLS A;  4OYM A;  4CLF A;  3C15 A;  4WP3 A;  1CJT B;  1WC4 A;  1CS4 B;  1WC0 A;  5D0R A;  1AZS B;  4CM0 A;  1CUL B;  2GVZ B;  4USV A;  3UVJ A;  4OYI A;  3C14 B;  1AZS A;  3ET6 B;  2GVZ A;  4WP8 A;  3C14 A;  3ET6 A; 
#chains in the Genus database with same CATH topology
 1H0H B;  4RZR A;  1X9M A;  5D4L A;  3M6W A;  5IWA F;  1U47 A;  1UVN A;  4O4R A;  5L1I A;  3MMC B;  5HMX A;  3F73 A;  2PT0 A;  4AL5 A;  2JC0 A;  2LMI A;  1YI2 S;  2XM3 A;  1S9G B;  2B6A B;  3OVA A;  2ILY A;  1QE1 B;  2I38 A;  4UY8 5;  2VFS A;  1NJX A;  3J7Y I;  1PJ6 A;  4WF9 Q;  4DBQ A;  2GVD A;  5BYR A;  4XPC A;  4I2Q A;  5L46 A;  1SKS A;  2DR8 A;  2YX1 A;  2JH3 A;  1QAI A;  2FVQ A;  5A6P A;  1GMW A;  4O3N A;  3G4S S;  1L3K A;  2HZC A;  4O0I A;  2VFU A;  2I0X A;  2Y1I A;  1K1S A;  2XMW A;  6AT1 B;  1KWM A;  3KLF B;  3I82 A;  2V94 A;  2B9X A;  4KT0 C;  3CD5 A;  1FI4 A;  3NOG A;  1ELO A;  3CD6 S;  4DSE A;  3SI8 A;  2QSF A;  2HHP A;  1N0V C;  4ZLJ A;  1FXD A;  1RKI A;  1T3O A;  2K3K A;  3RBX A;  2XHW A;  3GIR A;  1U02 A;  3EXY A;  4OIX A;  3QWU A;  2AZ1 A;  4DPW A;  1VRT A;  2UU9 F;  1SKR A;  1ZM9 A;  4CYU A;  1AFI A;  1RT4 B;  1CQM A;  3QO9 A;  1CJK A;  1KSP A;  2DO0 A;  1O6X A;  3PZP A;  2FHJ A;  1Y5N B;  1HIY A;  4RUH A;  4G6V B;  3FMB A;  5B0C A;  3OR2 B;  3GCW P;  4BHQ A;  1N34 J;  2WON A;  1BQN A;  1V9O A;  2Y0S D;  3E01 B;  4KGV B;  4KPC A;  1V3Z A;  1WG5 A;  3ISN C;  5FD1 A;  1BQM B;  1RTI B;  1PYO B;  1JKH A;  2LVW A;  7FDR A;  3TOQ A;  3DLB A;  4AND A;  2R2U A;  3MPY A;  3FMW A;  3FFI A;  2XMT A;  4J9U E;  2KDO A;  3CT9 A;  4LRA A;  1DJ0 A;  3I5A A;  3IN5 A;  2HFS A;  3BBB A;  3KXD A;  3PKY A;  4KO0 A;  2QA1 A;  4AD6 A;  1N32 F;  4KGX B;  4EBD A;  1JIH A;  4U96 A;  2CPX A;  1VQO S;  4RW9 A;  2ZWP A;  2I5J A;  4FP9 A;  1RAJ A;  1LWF A;  2D3U A;  3NCQ A;  4EFA C;  1SC4 B;  4OHV A;  2AYE A;  1U2C A;  3AAW B;  2PGC A;  5DO2 A;  4RW4 A;  4M5N A;  4ZJL A;  3SCK E;  2UUW A;  3BH7 B;  4QYR A;  4RBU A;  2HS0 A;  1WTF A;  3A8I A;  1JLC B;  5A8W B;  1S9F A;  1VQL S;  5IC6 B;  1Q82 T;  5H9E J;  4HEA 9;  2GFF A;  2QMX A;  4X66 J;  1UJ4 A;  4DCO B;  2DD8 S;  4LFA F;  2V4J A;  1N5Q A;  3BJY A;  3QSY B;  4YB7 A;  2C2D A;  5HRO A;  1JWW A;  1NUE A;  1NK7 A;  2Y8W A;  2MEW A;  5HBM A;  1T94 A;  4U9R A;  3IM9 A;  3G8T A;  4HAC B;  3GYG A;  2GQQ A;  2BJD A;  2DNH A;  4GO7 X;  1GMU A;  2VG7 A;  4ID5 B;  2AEM A;  4YHH J;  2R2S A;  3IR5 B;  3C6U B;  1F2G A;  1ZAV A;  4PPD A;  3AQO A;  4FF4 A;  4I6A A;  2XMM A;  1V5I B;  4RUA A;  5H9E K;  3MMA A;  3C2P A;  3FSI A;  3IC1 A;  1WC0 A;  2LXU A;  4USV A;  5J2M B;  4DV6 F;  4IG3 B;  4F3Q A;  1D9F A;  4C8O A;  4J7C A;  3V4I A;  4RW6 A;  3PR4 A;  1FDN A;  2FC9 A;  1EKS A;  2QMU B;  2GMJ A;  2RS2 A;  3HHK A;  1AXQ A;  4R0E A;  4ELV A;  3AJ2 A;  3QIP A;  3T41 A;  4TYA A;  4J5O A;  5LMN F;  1Q79 A;  2XYP B;  1C0T A;  3MTK A;  3CCV S;  2HHW A;  1KLN A;  1SVD A;  3EZO A;  3J7Y U;  3LP1 B;  4KR0 B;  5C5J A;  5E41 A;  1HHT P;  4P72 A;  2QTW A;  5K8N A;  3MUV P;  2BX6 A;  3AJD A;  1FEH A;  1KEK A;  3CIZ A;  2CZ4 A;  2KRB A;  1F3V A;  5DDQ C;  2Q6C A;  4DS5 A;  2FVS A;  1VCT A;  4ZDN A;  2FJX A;  3TQE A;  2HPU A;  4OX8 A;  1WG1 A;  2AWZ A;  2EFV A;  4C8M A;  4WII A;  2WAQ D;  2GGP A;  4TY9 A;  3PRB A;  2FPH X;  3QRR A;  2WVB A;  5L39 A;  1MG7 A;  1U09 A;  2HFZ A;  3SIP B;  2HZV A;  3FNN A;  3OV7 A;  1HI0 P;  4BCA A;  3BR9 A;  3ILL A;  4ECW A;  3CDA A;  4DSK A;  2P9E A;  2CQC A;  1HBO B;  4K8R A;  1UPM B;  3TVZ A;  5C25 A;  3H5Y A;  1NZA A;  4HL9 A;  1NJY A;  2FD2 A;  3MM9 A;  1NO8 A;  4ANC A;  4ZPT R;  5LMU J;  3Q8S B;  1IKV B;  1UVL A;  4ZVR B;  2GNK A;  1NSQ A;  1S0N A;  3I5B A;  2E1P A;  4DSJ A;  1TL7 A;  5FLX Y;  1AA1 B;  1SUQ A;  1M1K T;  3KLH A;  3D3B J;  2LEA A;  1FNM A;  3BPS P;  1S6P A;  1LW2 B;  3QT5 A;  1L3U A;  2MGZ A;  1S49 A;  5LXR A;  2YNH A;  3D66 A;  1HKA A;  3IO1 A;  2MKC A;  1SC1 B;  5KFH A;  1VC5 A;  3H2L A;  4LFB J;  3SDE B;  1B0P A;  3KLI A;  2QSW A;  1QUP A;  4HT7 A;  1V3R A;  1JJ4 A;  3A12 A;  1VQM S;  3EWG A;  2AMC B;  3O2I A;  4PWD B;  4USM A;  3VWS A;  4B9T A;  2VH7 A;  2YPY A;  1HI8 A;  2UXB F;  3CUN A;  4ZK7 M;  3LF0 A;  3CWJ A;  4NA3 A;  4EK2 A;  2C3M A;  1LWC B;  1OJ4 A;  2CPJ A;  3JS9 A;  2ZJQ Q;  4B3O A;  3PYF A;  5LT5 A;  1XNQ J;  1XK8 A;  3PVX A;  1TUG B;  2W9A A;  3FDS A;  2O67 A;  4N8N A;  2IM1 A;  1IR0 A;  2R4F A;  1SV5 A;  5CYQ B;  2QGF B;  1NKC A;  5JJB A;  1MWQ A;  1URR A;  1S1U B;  2ZM6 F;  5DZ7 A;  4ILL A;  3HP6 A;  2JSX A;  1XMO J;  1CJV A;  1E6V B;  1E6Y B;  2F7V A;  3NCP A;  3LGN A;  2ALY B;  1RCO B;  3D28 A;  4NLV A;  3NRB A;  2AQ4 A;  2B4O A;  4B9L A;  1R7I A;  1TK0 A;  3QFH A;  1J5E J;  3CNQ P;  3UI3 A;  5HQL A;  2F4V F;  3MMJ A;  5EN1 A;  2DNR A;  3HVT B;  4RW8 B;  2DY9 A;  4LF4 F;  4C7Q A;  2D69 A;  4GKK J;  4DL0 C;  2AIR B;  5IXU A;  3AOD A;  1N48 A;  2W25 A;  3KK1 A;  2JZ5 A;  1UEV A;  1RAI B;  2XMJ A;  2Q3P A;  3M6U A;  2PC6 A;  4I68 A;  3GIK A;  1U8W A;  2UXD J;  1LW0 A;  2AYB A;  5F41 A;  1KFD A;  2AJ2 A;  3OTD A;  2CKW A;  3H5S A;  1UZD A;  4P9S A;  4B3T J;  2UUT A;  4N76 A;  2RKI A;  2V8G A;  1BMQ B;  5DGA A;  3F56 A;  1VQS A;  3B8H A;  2V8V A;  3CCE S;  1HWU A;  3RB0 A;  3MUM P;  4NLS A;  2HHT A;  2PI5 A;  2BW2 A;  4Q2M A;  3M8W A;  4NLW A;  1C1C B;  2FY1 A;  1ZYQ A;  1MN9 A;  5CCL A;  3ONQ A;  1TP7 A;  5HMY A;  3KUG A;  2HND A;  3F41 A;  4CT8 A;  3MMB A;  4L72 B;  1NK4 A;  2V63 A;  1UFK A;  4DSI A;  2D9P A;  4QR2 A;  1PO6 A;  4PRF A;  4F8R A;  4XAK A;  2B6A A;  2AJQ A;  1QE1 A;  3BS9 A;  3OFF A;  2RML A;  2PD1 A;  3HSD A;  4B02 A;  3N01 A;  2HVH A;  3N5F A;  3R7N B;  4LIR A;  1B0V A;  3EYZ A;  2W9C B;  5HI7 A;  5L1L A;  4ZCK A;  1FKA F;  2Z2L A;  4BWJ A;  5GME A;  4P6Q A;  2DO4 A;  1RHU B;  1HBU A;  3HO1 A;  1XTZ A;  1AYE A;  5HVG A;  3VAJ A;  1HQE B;  3HVR A;  4KV8 B;  4RWX A;  1Q7L B;  4ERD A;  4TQR A;  4K0K F;  1EP4 B;  1X0F A;  3OLB A;  1NK9 A;  3E8O A;  4OZL A;  2RNE A;  3MCM A;  4LQ3 A;  2QV6 A;  3LW5 C;  2WRM A;  4ZS6 A;  2C3P A;  1AUS L;  4RUC A;  3H4D A;  3TX8 A;  1PC4 A;  2C42 A;  1IM4 A;  5I3P A;  4B08 A;  3CO0 P;  3CCJ S;  4KGM A;  1RU2 A;  4FPI A;  1FKO B;  1FRM A;  4ZVQ B;  1C2P A;  4WFB Q;  3J7Z 5;  3OR2 A;  2KVQ E;  1A7G E;  1FFS B;  3HFZ B;  4P52 A;  4LF6 J;  3VZH A;  3W62 A;  4DV2 J;  4KQZ A;  4USU A;  3J7A 1;  1Y3J A;  1BQM A;  2A2D A;  1RTI A;  2NCK L;  3I9V 9;  3K5M A;  1VDH A;  4JI5 F;  2DYA A;  1S0M A;  1VBK A;  3G82 B;  3LQV A;  1F1B B;  2IDL A;  3P3D A;  4WFY A;  4M5H A;  1NAQ A;  1WC1 A;  3QZ7 A;  1QTM A;  5E3A A;  4C8Y A;  4DR3 F;  3O5T B;  2IRU A;  5K8M A;  2EG1 A;  4F50 A;  1UVJ A;  2BBE A;  2DIV A;  4I7F B;  3MM8 B;  2YPZ A;  3A3N B;  4WP9 A;  2MQQ A;  3OHB A;  1HMV A;  3J81 Y;  1FA0 A;  2JFK A;  1L3V A;  3AHP A;  3TAP A;  3ELH A;  2R8I A;  4J9P A;  3WC0 A;  3MEC B;  2JC1 A;  1AZS A;  3DOM B;  5A8W A;  4ZPB A;  2DIU A;  3U1M A;  3DNC A;  3CCW A;  1NHV A;  1UWB A;  4MK7 A;  4UOH A;  1Q8K A;  1WOS A;  4OYW A;  3L95 X;  2E9R X;  2PE8 A;  2GHV C;  3BGU A;  2L9N A;  3RBE A;  4U95 A;  4DQR A;  3MEK A;  1K73 T;  2OD6 A;  1YSJ A;  2AX0 A;  1T0T V;  5CA5 A;  3HPO A;  4OYB A;  3M8Y A;  2AJ0 A;  4JI0 F;  3EVW A;  2DGV A;  1VQK S;  2DXD A;  4ID5 A;  3T5K A;  3C6U A;  2G0C A;  2FVC A;  4OMF G;  4I69 A;  5EX3 A;  4GKJ F;  2UUC J;  3WBZ A;  2UXC F;  4BS2 A;  1H7X A;  1DQ8 A;  4NX9 A;  2RU9 A;  3V81 B;  3CCZ A;  5J2M A;  4IG3 A;  2R7W A;  3WHI A;  1I5O B;  1DTQ B;  1CSJ A;  3D0G E;  1TKZ B;  2UP1 A;  3KK2 B;  2MSS A;  4LBH A;  4DFM A;  1FE4 A;  4QPX A;  2EG2 A;  3SQG B;  3AOB A;  4JI7 F;  5BYS A;  3M8Q B;  2V2Q A;  2GIR A;  1UVM A;  5GAH I;  4DR1 F;  3HXM A;  1WD6 A;  1MSW D;  4F4Z A;  2GA7 A;  4I6W A;  3LP1 A;  5KFP A;  4JYA F;  4WFA Q;  2VDI A;  1JJC B;  4J9R A;  4KHM A;  3PFO A;  1X4H A;  3PIP Q;  4YB1 P;  4R8U A;  2ZH2 A;  5HO4 A;  2E5H A;  4QIE A;  1WSR A;  2J8S A;  3DLG B;  1RBL A;  3ENW A;  1RUS A;  2O1P A;  3MF5 A;  1DTT A;  1JK9 B;  1FER A;  5KG4 A;  1NZ8 A;  2C2M B;  3MAA A;  3UPF A;  3FRY A;  3EZ5 A;  5LM7 E;  1U1R A;  4HDH A;  4DR6 J;  2HWH A;  5C2C A;  2ZNZ A;  3VGU A;  5L9N A;  4L76 A;  4X62 F;  2OTL S;  4DX6 A;  2HVE A;  1UW9 A;  5DG9 A;  1N56 A;  2Z30 B;  5AE2 A;  1RBO B;  5IM0 B;  1IBL F;  1TKT B;  4YEA A;  1Q78 A;  1IKV A;  2W7P A;  1N4L A;  4Y2C A;  1SXL A;  2WOM B;  2ZC4 A;  3SBM A;  3GV8 B;  2DY1 A;  1RAH B;  2DRD A;  4EMD A;  1NPK A;  5KT3 A;  1T05 B;  2M7S A;  3MM5 B;  2ZUG A;  1RAF B;  5K8P A;  4PAB A;  1LW2 A;  4OL8 A;  1SJ4 P;  3BSO A;  2Z0G A;  1VK8 A;  2VD3 A;  3PY8 A;  1VQP S;  3US5 A;  2CNK B;  4DV7 J;  2AU0 A;  1RAA B;  2G1H A;  5DQI A;  3IR7 B;  3KMS A;  4WXO A;  2F9J A;  3IWL A;  1K44 A;  1HR0 F;  1VQ7 S;  4F67 A;  4DCP B;  5A8K B;  3VGS A;  4ZCI A;  2Q6B A;  5B0G A;  2LXF A;  1RXO B;  3GIJ A;  4YDD B;  2LXI A;  4PWD A;  5AJ3 J;  1VOM A;  3BPD A;  5B0E A;  5KFJ A;  1IQT A;  1I6J A;  2UV8 G;  1VFJ A;  3NXZ A;  5T7L B;  2JL9 A;  2J7K A;  2CNL B;  4HT5 A;  1VIS A;  2VG6 B;  2W2Q P;  1QTN B;  2QEX S;  1LWC A;  5HAN A;  4QWD A;  5KFY A;  4RUB A;  3WQP A;  2F4F A;  2W24 A;  3FKB A;  2CQ3 A;  4B9V A;  2DKO B;  3G6V A;  1YHQ S;  2WCX A;  3OD2 A;  5CYQ A;  4RU2 A;  4NOH A;  2R8J A;  3TP2 A;  3IXQ A;  2Z57 B;  2G0J A;  1N5S A;  1S1U A;  2CWX A;  2EI5 A;  2HEK A;  4WZM A;  3D6T B;  5F0W A;  1E6Y A;  1E6V A;  1S1V A;  3JB9 k;  1XJW B;  2LU2 A;  1YQH A;  4CRJ A;  4IO9 Q;  2UZA A;  3Q8V A;  1NSA A;  5J1E B;  2CWK A;  4ATN A;  3RW6 A;  2ZHO A;  2CQD A;  9ATC B;  3HVT A;  1X4B A;  5M2P A;  2E5L J;  5L1K A;  3JTP A;  3L4B C;  2X3D A;  3LUY A;  1XMQ F;  4CIO A;  2G4B A;  3THP A;  1RTD B;  1UW4 A;  3C3L A;  2RUS A;  2PEB A;  3H59 A;  2B56 A;  1I94 J;  4NAS A;  4MTP A;  2V8D A;  2AGQ A;  1GX6 A;  3PHE A;  2XNR A;  2CVE A;  4TVA B;  2ADC A;  3BQ2 A;  4JI4 J;  5DLF A;  2KJV A;  4PG4 A;  4J9K A;  3KHR A;  2NXN A;  5DDR C;  1BUX A;  2OPQ B;  5GAH U;  2VBZ A;  3DLE B;  2QLX A;  2CNN B;  1REG X;  2MTL A;  5KT6 A;  1K47 A;  5ETV A;  5CZV A;  4MAK A;  3FZB A;  3VAL A;  1D9A A;  4G1P A;  3TX0 A;  3H40 A;  5C7P A;  2NXU A;  3MPU B;  4O3O A;  3CXC R;  1N36 F;  2GJF A;  1KQG B;  2MPU A;  2NLW A;  3I55 S;  1S72 S;  2AX1 A;  2WW8 A;  5E3Q A;  2CQ2 A;  1RT1 A;  3CC2 S;  3TAR A;  4DUY F;  5D4O A;  4MKB A;  4MKV A;  2YKN B;  4A8K A;  4KBI A;  1IWG A;  5JMN A;  3C14 A;  2J8A A;  4B3R F;  2W9C A;  4YDX A;  3VAI A;  3DN9 A;  1JLA B;  1IR2 A;  2G2O A;  1ZS6 A;  5HP1 A;  3QNW B;  2FZG B;  4H4K C;  3V5R A;  5SZT A;  2OGU A;  3R2C J;  4FS1 A;  3DOK B;  1DAX A;  2FJB B;  4ANE A;  4DN0 A;  4KV8 A;  2DGT A;  3IMQ J;  3HSG A;  1B70 B;  3JYT A;  3EMT A;  1X31 C;  2F9D A;  2HQ3 A;  1EP4 A;  4KYZ A;  4KE5 A;  4ZLN A;  5KFE A;  1P27 B;  2ZH7 A;  2ZDP A;  2GIQ A;  3ZZU A;  3V2U C;  1QAX A;  2KXH A;  2HRU A;  5G0R B;  4DWI A;  3DRR B;  4YFU A;  3OVS A;  2OD4 A;  3ETO A;  3TVK A;  2NXJ A;  3W9I A;  3R8Y A;  1RHR B;  2FJW A;  2KL8 A;  3CCU S;  1FKO A;  2VQF F;  3SSQ A;  3POT B;  1JMT A;  2ZH4 A;  3NCR A;  1MWZ A;  4WK1 A;  3R5A A;  2FYX A;  1RA6 A;  3KYL A;  3CCM S;  1SL0 A;  3KHH A;  1KFS A;  2BQR A;  2G1D A;  3D68 A;  4U7U D;  1UEU A;  2I1R A;  2NYI A;  4ZPW R;  2OPR B;  5CQG A;  5HK4 A;  4ZVP B;  4Z2X A;  3D67 A;  2CQ4 A;  1BGX T;  2W2N P;  5KG6 A;  3G82 A;  3R5B A;  4RJV A;  2E1A A;  1UVI A;  4OI6 A;  2BM1 A;  2A6O A;  3QPI A;  3MI7 X;  1TK5 A;  1FK9 B;  2XI3 A;  4PUO B;  3G86 A;  1NDK A;  1T3N A;  4I7F A;  1JQG A;  4AFF A;  4DR4 F;  2Q66 A;  1KQK A;  1U6Z A;  4Z7Y A;  5GVQ A;  3JSM B;  4J90 A;  3IAS 9;  3KNG A;  5BJR A;  3HZE A;  2VBY A;  4KY3 A;  1CVJ A;  4GO5 X;  2W8K A;  2FJV A;  3AT1 B;  3MEC A;  1Z1Z A;  1UFW A;  3DOM A;  1NCL A;  1LWE B;  3GTY X;  2J0X A;  4CLT A;  1LOU A;  4ZP6 A;  2DEJ A;  3B82 A;  5KFZ A;  1Q81 T;  4A8F A;  1HNX J;  2E1M C;  3QAT A;  2MLX A;  3M30 B;  3R27 A;  1T9T A;  5EGY A;  4GVL A;  3BQ1 A;  4NLR A;  3L7P A;  4IDK B;  3EPI A;  2UU9 J;  3ET6 A;  5EWE A;  2QA2 A;  3LAN A;  3T1A A;  3W2W B;  3K8V A;  3HCX A;  4OYA A;  3ZTS A;  1M1H A;  3DLL Q;  3TJ8 A;  1ZM4 A;  2CYY A;  2X1G A;  4MK9 A;  5F0U A;  1F0X A;  5KFT A;  4Q7A A;  2WVE A;  3N5B A;  3LP0 A;  3R97 A;  1FJC A;  1QVG R;  4TY8 B;  1WHX A;  2KRR A;  2R9L A;  1Q4R A;  3BKF A;  2IC3 B;  2M5Y A;  1FCA A;  4DJB A;  2CJX B;  3FUY A;  8RUC A;  4X65 J;  1NLK L;  3H5U A;  3K5L A;  5GAG I;  4DV5 J;  4DV0 F;  3CJ3 A;  4L75 A;  1TKZ A;  1UPP A;  1PIL A;  3PFE A;  3EDR B;  2BJ3 A;  4B3S F;  3NGU A;  2VU5 A;  5K5M A;  4ZLP A;  2HQF A;  1M90 T;  4NA2 A;  3OJU A;  5HVF A;  3V6H A;  4DL4 A;  1M0S A;  3KOA A;  1XIQ A;  4PG5 A;  3M8Q A;  2V2V A;  3ISZ A;  2LLZ A;  3T1Y F;  2KFZ A;  2V6A A;  4KH1 B;  2P9G A;  5E3R A;  1RLC L;  5KT2 A;  2VQE F;  1NH7 A;  4OHY A;  1Y0H A;  2QE5 A;  4IRC A;  2QMW A;  3UNY A;  1U2R A;  5F8N A;  2VFR A;  3FBC A;  1VRU B;  1HBN B;  2L9D A;  2LQ8 A;  1U0S A;  2ZH1 A;  2GIF A;  1UFL A;  1HW8 A;  2YKM B;  3DLG A;  4X84 A;  2MZ1 A;  4LR8 A;  3ETM A;  5DG8 A;  3M9M B;  3CF5 Q;  4LF7 J;  2Y1J A;  3I32 A;  3D9B A;  3G2X A;  1IQZ A;  4ZVF A;  1WUU A;  4P71 A;  3QMQ A;  1S7I A;  3TEG A;  3U1N A;  2CPE A;  2ZH9 A;  1QAJ A;  3IWX A;  4OI3 A;  3HHL C;  1IUJ A;  3AD9 C;  2ZKU A;  5IM0 A;  4CNZ A;  4RU9 A;  4DR2 J;  1TKT A;  2GVZ B;  1LWX A;  5BR8 J;  3GG1 A;  2B4V A;  4P10 A;  4X64 F;  4ETZ A;  2WOM A;  3R5C A;  2H65 B;  3NAI A;  1R27 B;  1T05 A;  1SJR A;  2BE7 D;  3S6E A;  4IFV A;  2KB2 A;  1H72 C;  4L74 A;  5EWG A;  3OQ2 A;  1EKR A;  2XQC A;  3GWC A;  3RW7 A;  4ZVO B;  3TJA A;  3VCD A;  4JV0 A;  1RU1 A;  3FJ2 A;  3AXM A;  3VAG A;  1XR5 A;  1RYR A;  1VQ6 S;  3CJK B;  4Y28 C;  2HRT A;  4ECQ A;  5F9N A;  1H3D A;  5A8K A;  2QYC A;  2GAH C;  4OZ5 A;  4FF1 A;  1WHV A;  2MB0 B;  4OZ1 A;  1SBR A;  3HM9 A;  2HZA A;  2Z8Q A;  3AOC A;  8AT1 B;  2N82 B;  1B3T A;  5KT4 A;  2IM0 A;  3IGV A;  4NLQ A;  3OXL A;  3ENQ A;  5T7L A;  3P4U B;  2IPO B;  1PAU B;  4UY8 T;  5DQG A;  4KGZ B;  4B9U A;  1FNX H;  3HF5 A;  2VG6 A;  3OUY B;  3BM7 A;  4JI2 F;  2HGM A;  1HNZ F;  4B3M J;  4WP8 A;  1QDU B;  2VBW A;  4M5I A;  4A8Q A;  4ED3 A;  4IOB A;  2H9Z A;  4TYB A;  1TK8 A;  1NND A;  2YQ3 A;  5DDO C;  2JEF A;  4I64 A;  4DN9 A;  3GQC A;  1SH3 A;  1VHF A;  2HHH J;  2RQK A;  2JEG A;  4DS4 A;  5J2P A;  1CEZ A;  4DL5 A;  2KFN A;  3L7U A;  1BWV A;  2HW3 A;  3EZU A;  1X60 A;  3D6F B;  5J1E A;  4QZV B;  1YJ7 A;  2W1B A;  3FRZ A;  3NNH A;  4FN5 A;  1RZM A;  1TMJ A;  1KON A;  4UOG A;  1FRJ A;  3GSD A;  4EYH B;  3QT7 A;  2DHA A;  5GAG U;  1JLG B;  1EAR A;  2GO9 A;  4IUF A;  3LAL A;  1EQM A;  2VPY B;  3BN7 A;  4Y34 A;  4F02 A;  1R8B A;  2MKS A;  2M3D A;  1H7W A;  1YX2 A;  1C4C A;  3FSY A;  4JV1 A;  3AFG A;  3I6P A;  3H98 A;  2IMW P;  4X4S A;  2DHG A;  1W26 A;  2OPQ A;  2NZC A;  4HLB A;  2NYH A;  4CT9 A;  3DLE A;  1P9Y A;  2Y0B B;  3I0R B;  4QIG A;  4KHP J;  2J6S A;  2GJ2 A;  2J0Q D;  4FYV B;  2RIJ A;  4OX9 J;  3BYR A;  3M8R A;  2YBV A;  2C2N A;  4LSL B;  4K4Z A;  3PYE A;  5GMK a;  3HI9 A;  1N33 J;  1P1T A;  4CO4 A;  4F2R A;  4PYD A;  2OP5 A;  5CYM B;  3BSN A;  3LAM A;  2KZM A;  3QGG A;  1UEK A;  4FVM A;  2X3G A;  3FQL A;  2KI2 A;  1XNR J;  5ADZ A;  2YKN A;  5E3P A;  3UO0 A;  2VOD A;  4FBU A;  3N4W A;  1H74 A;  4NEY A;  4OX7 A;  1X4G A;  2XTJ P;  1RAE B;  4C8N A;  1NPR A;  1HD0 A;  2EBE A;  1VRT B;  2B8P A;  4QR0 A;  1GT8 A;  2KZZ A;  3QO9 B;  3V6D B;  1UP1 A;  3M2V A;  4H4O B;  4LF4 J;  2DNP A;  5C2G A;  3QSI A;  1ZET A;  2MLY A;  2BEF A;  2ASL A;  1OSD A;  5G0R A;  4LF8 J;  3CD0 A;  2C3U A;  4ICL B;  1M5S A;  3CCL S;  3NG8 A;  3HT3 A;  2V8H A;  1NME B;  1Q8B A;  5D3G B;  3H25 A;  1AW0 A;  3POT A;  3EVM A;  3DU6 A;  4NPO A;  5L9X A;  4IH5 A;  4KIA A;  1S4F A;  2F65 A;  4OV6 A;  1NEE A;  2DCU B;  2JNJ A;  1O5J A;  1XBW A;  3OR1 B;  3DGV A;  2VC0 A;  3KHG A;  5E33 A;  4K2X A;  3G96 A;  3KNA A;  1HHQ A;  2QJ3 A;  2E5I A;  4O3P A;  4Q8F A;  2I6W A;  2HBZ B;  4ZVH A;  4NYZ A;  1FK9 A;  1LKZ A;  2V5H G;  1Q8L A;  2VIC A;  2E66 A;  2HS3 A;  3I4P A;  2CUY A;  4Q5V A;  2CPZ A;  2UVW A;  1UET A;  2DNN A;  2Q79 A;  1FFW B;  1YJV A;  4CO5 A;  5L8R C;  3JSM A;  3ZZO A;  2ZZM A;  4C6A A;  3QID A;  3K17 A;  4CZC A;  4RNO A;  1LK5 A;  3CJS A;  1VS3 A;  3TYT A;  2HHV A;  3GFZ A;  1R8A A;  4M5G A;  3A4T A;  4JI3 F;  4OI1 A;  4CO2 A;  2K06 A;  3OTB A;  5D77 A;  5KG2 A;  4DMZ A;  3P5B P;  2MJN A;  4WKY A;  3M30 A;  2VOO A;  2ZZT A;  1NM2 A;  5KFS A;  2J5A A;  4C9D A;  4DV4 F;  2YKA A;  1WEZ A;  2SXL A;  2YWF A;  3F0N A;  1CS4 B;  2A1B A;  3O3L A;  4OYI A;  4LR9 A;  1HI1 A;  3UDV A;  2ZHA A;  2XLJ A;  2QLW A;  1RHJ B;  4Y2K A;  4MKA A;  3UR3 C;  2GZO A;  4CLU A;  2C2R A;  1XN9 A;  3PIO Q;  2AP6 A;  1U1L A;  1L3S A;  1T8E A;  4F26 A;  3OL9 A;  3LGM A;  3W8G A;  3VAM A;  3KUH A;  2HQC A;  4YY3 J;  3CJ4 A;  1RP5 A;  3LTO A;  4LF5 J;  1N5T A;  2DBB A;  1C0T B;  2CQ1 A;  3KDO A;  3SCJ E;  5DRK A;  1A6L A;  2HNZ A;  4NZ0 A;  4K4S A;  3I96 A;  3TUP A;  1FTR A;  2BMB A;  2BOA A;  2YKQ A;  2XS5 A;  2XWY A;  1VBZ A;  1PIE A;  4LT6 A;  4CDI A;  2RSQ A;  4DEZ A;  4Y65 A;  1N34 F;  4A8O A;  3HFK A;  3ILO A;  1IKY B;  1YGY A;  2A0F B;  1YJ9 S;  3RRH A;  1S1T B;  2NSC A;  4M95 A;  2IJF A;  3FCV A;  2UVR A;  2GGP B;  1EHW A;  4GRS A;  3THV A;  5CCM A;  2M88 A;  3AQP A;  4U67 Q;  1LFP A;  2L3M A;  2HMI A;  1B7F A;  2EFN A;  1OPI A;  1NU4 A;  3PJX A;  1T9W A;  4DU8 A;  2IHR 1;  3TZX A;  3LO3 A;  1VRU A;  1HBN A;  3QLH B;  3ZZP A;  3FBB A;  2E7X A;  4FF2 A;  5C25 B;  3I4H X;  3BRE A;  1MW7 A;  3EPG A;  2XCP A;  3ZNU A;  2V9W A;  1DUR A;  4O3Q A;  2XYG B;  3BZQ A;  4UTG A;  4NXN J;  1G7C B;  1OWX A;  2ZBQ A;  2OEJ A;  2MHN A;  1YJR A;  1T11 A;  2LP4 A;  3M2U A;  4XO0 A;  2YNI B;  1YIJ S;  3MZI A;  1HWI A;  3KLH B;  3PXG a;  3HJF A;  3TUJ C;  1S6P B;  3PRD A;  3NL0 A;  4X66 F;  4ED1 A;  5M2U A;  4NLG A;  2I9S A;  3Q22 A;  1P6T A;  1NKB A;  3NKY A;  1S79 A;  1G4C A;  3QYY A;  5JUM A;  2BKP A;  4ZN3 A;  3GR0 A;  5AXK A;  1YVF A;  1Q5V A;  4OYM A;  2U2F A;  4YUD A;  5DZ6 A;  2DIS A;  5JVG Q;  3GJR B;  4OFZ A;  2DH9 A;  4YHH F;  3OFE A;  1WHY A;  1RJJ A;  4IKA A;  4YB5 A;  5IV4 A;  1WI6 A;  4Z37 A;  3CJ0 A;  3RTV A;  1S9E B;  2CNO B;  5ETM A;  3W9H A;  3BSA A;  2B9Y A;  2QLJ B;  4KHR A;  3AJ1 A;  4NLP A;  4JI8 J;  4LJM A;  2YQ0 A;  1A0O B;  3CJK A;  1YBT A;  4PKD B;  1ITP A;  1R8H A;  4ZA1 A;  4ED2 A;  2C1E B;  4ZPA A;  4PZV A;  2LQ9 A;  1CJU B;  2JWN A;  2DXE A;  2XSJ B;  5A8R B;  3THT A;  4CM2 A;  2BRK A;  4CLY A;  1FWP A;  2GW8 A;  3GFX A;  2H5E A;  1TFY A;  3RG6 A;  2AGO A;  2IDE A;  3QJJ A;  4QCL A;  2JOQ A;  1TKD A;  4N41 A;  1SV5 B;  4LSZ B;  2E9Z A;  1UCN A;  3BSC A;  2GJI A;  2FB0 A;  2Y3Y A;  2HYI B;  1V5V A;  4NXM J;  3OUY A;  3MUT P;  6FD1 A;  1CC8 A;  1EET B;  1CJV B;  2WVF A;  4G1Q B;  2MQO A;  2Y8Y A;  5IFM A;  1NK6 A;  3LP2 A;  4CLF A;  1YRU A;  4QYZ J;  3BB5 A;  1GXU A;  4OZN A;  2XMA A;  2DNM A;  3H0P A;  2XYH B;  2ZHB A;  1ZH5 A;  2V67 A;  3LAK A;  3T9Z A;  3KG4 A;  1N5V A;  4TN2 A;  4MMO A;  5BXI A;  1NDL A;  1QUV A;  3KTQ A;  3A8J A;  3GV5 B;  3D4J A;  4CH0 S;  2BA9 A;  1LW0 B;  1ZAX A;  2B5J B;  3A13 A;  1JXL A;  2ZD1 B;  2F40 A;  1XR6 A;  4TKT A;  3UD5 A;  3A1Y G;  2VBX A;  5HN0 A;  2CIM A;  4X4R A;  1U8S A;  5A0Y B;  2HIQ A;  2X51 A;  4CLK A;  3CPW R;  4CLW A;  1YJT A;  4QYZ K;  3HFV A;  4EYI B;  2GS8 A;  5KG0 A;  3W65 A;  3DGP B;  5HAT A;  1REV B;  1O0P A;  3KFW X;  5D0E A;  3TJ9 A;  4WWS A;  1JLG A;  5LMU F;  4PQA A;  1I51 B;  3PW4 A;  3MR5 A;  1EB0 A;  1HR0 J;  5L1J A;  1YDL A;  1WEY A;  3GJQ B;  1VRQ C;  3BH6 B;  3M6V A;  5LOQ A;  3MMB B;  3HKW A;  3MD1 A;  3JTO A;  2LFV A;  3Q2S C;  4J91 A;  1WG4 A;  3PEH A;  3T5J A;  1WC4 A;  5DDP C;  4B9M A;  2IRX A;  5DG7 A;  3OW2 R;  1NK8 A;  3I0R A;  2XY7 A;  3RGI A;  2R3V A;  2RIL A;  3A8K A;  6FDR A;  2KM8 B;  1S0O A;  1UL3 A;  4WIQ A;  3FQK A;  2FQQ B;  3TA1 A;  4LFB F;  2LA4 A;  5HMW A;  1OYD A;  5A6W A;  5DLG A;  4MYU A;  4LSL A;  3M6X A;  3CC4 S;  2AGP A;  3C6T A;  3GE9 A;  5D6G A;  1U1N A;  1RAG B;  4EZ9 A;  5CYM A;  3G6E S;  4KSE B;  2MZT A;  1HBU B;  3RUB L;  2CJK A;  5IT9 U;  3TNV A;  4TLQ A;  4QIW D;  2VKR A;  3JTN A;  3UDC A;  4X4T A;  3PNI A;  4BDP A;  5E3C A;  4DV1 J;  3GG0 A;  4WFZ A;  2FZC B;  3W8P A;  1G6B A;  1M5K C;  2UUA J;  3MPW A;  4DV3 F;  4O44 B;  3UR0 A;  5IS2 A;  4J9N A;  1TKX B;  4K2J A;  1YLX A;  1XNQ F;  1RWP B;  1D8Z A;  1WKJ A;  2IVF B;  3JQM A;  1YRX A;  4PPZ A;  1HWJ A;  3V6D A;  3A3P B;  4H4O A;  3MR6 A;  4AUK A;  2C2E A;  3UDE A;  4LQ9 A;  2XCA A;  1RT3 B;  1SI9 A;  2HK3 A;  5B0F A;  1R31 A;  4J37 A;  4P7V A;  1Y4Z B;  2KYX A;  1VYA A;  1XMO F;  1X9W A;  2V68 A;  4EGL A;  5GAE I;  2HHS A;  5GAD I;  3TA0 A;  1XEZ A;  3PHT A;  2RH3 A;  4ICL A;  2QA4 G;  3SMZ A;  1J5E F;  1ULR A;  3FEZ A;  4JB8 B;  4F4W A;  1MMD A;  1OIA A;  5AT1 B;  5ETR A;  4ITS A;  5D3G A;  5CHC B;  2IM3 A;  3RB4 A;  4GKK F;  4E98 A;  1HNI A;  1UMJ A;  1FNO A;  1R6Y A;  2KTQ A;  3KJN B;  4P2X A;  3M4X A;  5F8L A;  1FRX A;  1U45 A;  2BJE A;  1IBM F;  1LNQ A;  1JLF B;  3LA0 A;  4B3T F;  1BWE A;  2F8H A;  3MCO A;  5DS7 A;  3ULH A;  4Q44 A;  1N36 J;  1U1O A;  1JLQ A;  2IYI A;  5F8M A;  3OR1 A;  1HMV B;  4LFC J;  4HHJ A;  2OTJ S;  2VPZ B;  2W8L A;  3MPV A;  2DRA A;  3TO8 A;  4DUY J;  1VQ4 S;  2NXC A;  3AD8 C;  1AZS B;  1RT7 B;  3PO5 A;  4WXW A;  3HZG A;  4G65 A;  2K7K A;  1UWB B;  4F4K A;  1QSL A;  4XPE A;  1GMV A;  3TAN A;  1QJH A;  4DZD A;  4P75 A;  3DLJ A;  2AJF E;  1RWV B;  1S99 A;  2KN4 A;  2VJU A;  4RNH A;  1H6K X;  2FGC A;  1YZ6 A;  2ZVI A;  1HHS A;  3IS9 B;  1FRK A;  2DPI A;  3CVK A;  1TZ0 A;  2OEM A;  3OL8 A;  4M94 A;  2GHP A;  4FYW B;  2KVI A;  2M70 A;  5KOX A;  1HNV B;  3FSX A;  2VUG A;  1LQ9 A;  1TL3 B;  4ILR A;  1Z4U A;  4WK3 A;  1IBK J;  5L38 A;  3JAM U;  3NGK A;  1SL2 A;  2VON A;  5KFK A;  1SQG A;  2K1R B;  1T9U A;  3EIC A;  1RT2 B;  1CS4 A;  3P6Y C;  4C2M A;  1VIO A;  1WAC A;  3ADA C;  3IP0 A;  5ETL A;  5DJB A;  2CG4 A;  1WEL A;  1T7P A;  4NLT A;  3TAQ A;  1N5Y A;  4CM0 A;  2J9C A;  1RAB B;  4JV5 J;  1C1B A;  3MD3 A;  1JJ2 R;  1Z2Z A;  2ZOM A;  5KFQ A;  1S4E A;  1MRO A;  4OZJ A;  2KKH A;  1RDR A;  2XNQ A;  2CPI A;  3J80 U;  1AB8 A;  3OTC A;  1VQN S;  1X4E A;  2D1C A;  9RUB A;  3SZ2 A;  1QD1 A;  2QLF B;  2C3Y A;  3VZI A;  1RWM B;  1IKY A;  4LF6 F;  3RJM B;  4DV2 F;  2GCF A;  1S1T A;  2FTR A;  4R8U B;  4QU6 A;  4I2P A;  4CLZ A;  1OO0 B;  1F2H A;  4FVC A;  2Z2Z A;  1DTT B;  1G2E A;  3KHL A;  3MUR P;  3S8S A;  3S01 A;  3MAA B;  5E0O A;  2R8H A;  2DNZ A;  2HKE A;  4DX8 H;  2V4Q A;  1GXL A;  2ILZ A;  4PXE A;  2BJ7 A;  3VV2 B;  2WSC C;  2FVP A;  2CG8 A;  1RT6 B;  2WB1 D;  3QLH A;  2OIH A;  4PQU B;  1FXR A;  3GB0 A;  2NPI A;  3UCU P;  4TU9 A;  2J9E A;  4BWM A;  1U1Q A;  1TEL A;  2IY5 B;  3IWN C;  3RAQ A;  1KVJ A;  4DUZ J;  3WIV A;  4QU7 A;  3CCR S;  1BC6 A;  4IQM A;  1KLM B;  3K57 A;  4DFK A;  1UA1 A;  3FBF A;  4ES1 A;  3RRG A;  4YP3 A;  2EKY A;  4OJ3 A;  2YNI A;  2PN6 A;  5K20 B;  1JNZ B;  4CO0 A;  4QJV A;  2CAJ A;  3SQO P;  1OQ6 A;  2DK2 A;  4H4M B;  4ALZ A;  3OTE A;  2DEI A;  5GAE U;  4C3K A;  5GAD U;  2FDN A;  4HKQ A;  2MZJ A;  1F6T A;  5D4P A;  4L3N A;  3OBI A;  3P8B B;  2ALZ A;  4QWC A;  2DJW A;  2ZFH A;  2LYV A;  2WBM A;  3LGH A;  2POK A;  3D1O A;  3HHE A;  1MWY A;  3VR1 A;  4F25 A;  2AV5 A;  2XLI A;  3NGD A;  3ITH B;  4QR1 A;  3ENA A;  4U8V A;  3LWM A;  1SKU B;  2P2C B;  4OZ2 A;  4JI6 J;  1FDA A;  2GQ2 A;  4LVO P;  3KKF A;  1YIT S;  4LUB A;  2UUC F;  4HI1 A;  4ZPC A;  1RE1 B;  1S9E A;  4W92 B;  2YNF B;  3T1Y J;  4ZVE A;  4ZP9 A;  5I3Q A;  3ZZY A;  3Q86 A;  2VB6 A;  1CJU A;  2XSJ A;  1DHM A;  5A8R A;  2XO7 A;  5B7W A;  3KDN A;  4DX7 A;  1UTA A;  3UVJ B;  3D1Q A;  4LSN B;  1DLO B;  1YBA A;  5J2Q B;  1KHV A;  1KTV A;  1NSP A;  4EBE A;  1JLB B;  1NJI T;  1WKL A;  4ZVT B;  1WDD A;  3BF4 A;  1RTZ A;  2GV1 A;  2P6S A;  3R1H A;  2ZJP Q;  2CQH A;  3LH2 S;  1Y5I B;  2JLE A;  2RUG A;  1BXN A;  4YQW A;  2IAJ B;  3CJ2 A;  1EET A;  1S1V B;  3UDL A;  4G1Q A;  3DLK B;  4DPX A;  4BC7 A;  2R7S A;  3C16 A;  3ILJ A;  2KT5 A;  2R42 A;  1TAU A;  3BEG B;  1KDN A;  2R8G A;  4UUX A;  2AJ4 A;  5LXY A;  1DFD A;  4ZKA A;  1GXT A;  4DR5 J;  3SCI E;  1CC7 A;  3SSR A;  2IIH A;  4ZPV R;  1M5P C;  3IGN A;  3Q83 A;  3MR2 A;  1X4F A;  3T6J A;  3IBF B;  2MLZ A;  1SC3 B;  3G6Y A;  3H20 A;  1RSC A;  1KQS R;  2IMO A;  3BGO P;  4TXS A;  1SJ3 P;  2B5J A;  2ZD1 A;  4DR6 F;  2H48 B;  2AEF A;  4H54 A;  4MKY A;  5IOL A;  4ECX A;  4RR5 A;  3QT8 A;  1S12 A;  5A0Y A;  2XBP A;  3DGP A;  4NLU A;  3BQ0 A;  1REV A;  2RQC A;  3OT9 A;  4A8W A;  4C8K A;  3ICL A;  1NDC A;  2CJY B;  3I31 A;  3W61 A;  4R25 A;  4ZVG A;  3BO4 A;  2F8M A;  4ILM A;  1KQF B;  2DVI A;  1IXK A;  2XY6 A;  2AYM A;  4G3I A;  3BV8 A;  3ZZT A;  4DXL A;  2OHD A;  2HLU A;  3Q0A A;  1KRP A;  5KFA A;  3S1T A;  3VQT A;  3GV7 B;  1QSY A;  4K4Y A;  1Z2L A;  4DV7 F;  1RT1 B;  3W7B A;  3B78 A;  1APS A;  4LF9 F;  2HNY B;  4JI2 J;  4F0M A;  1YRT A;  3C14 B;  2OO4 A;  3VVU A;  1RYS A;  1GTH A;  3W60 A;  2OPS B;  1VK3 A;  2F3J A;  5HP1 B;  3K2Y A;  5B0B A;  3M7V A;  5AJ3 F;  1UZH A;  2QT7 A;  5KFM A;  1NHK L;  3IRX B;  3JYT B;  3C46 A;  3CGI A;  1ZA2 B;  4F36 A;  1N88 A;  4KPY A;  2UUB J;  1FDD A;  4O44 A;  2RHS B;  3C8Y A;  1X7V A;  1TKX A;  1CQN A;  1FD8 A;  1DRZ A;  2U1A A;  1R43 A;  3H8Y A;  1KD1 T;  2QN6 B;  2RF2 B;  2FVR A;  5IQ6 A;  2DNQ A;  1U49 A;  2W4D A;  3CCT A;  3BYP A;  1XR7 A;  3LWL A;  2FGO A;  2DHS A;  2P6T A;  2LDI A;  2M0G B;  1RCX B;  3BKT A;  2R7X A;  2O3D A;  1RT3 A;  4C98 A;  2W2P P;  3DXB A;  3W1Y C;  4YME A;  3SFG A;  5J1N A;  1F60 B;  2E5J A;  4X4V A;  3QAE A;  3O8W A;  4AE5 A;  3IG1 B;  1CBK A;  3LPE A;  1IJF B;  3CJ8 A;  1H2T Z;  2DGX A;  3AA8 A;  2EBG A;  2B0G A;  3CDU A;  2NPF A;  4Q0B B;  3H2V E;  3PJW A;  3K5P A;  2E5L F;  2LDY A;  2PO4 A;  5E2Q A;  1UJ6 A;  2HAI A;  2EFP A;  4WJB A;  1K8A T;  1SKW A;  4KKO B;  1FWK A;  2E44 A;  1I94 F;  4LBP A;  1WDT A;  5ETP A;  4DFJ A;  2D74 B;  4K4U A;  1JLF A;  1DY3 A;  1VMB A;  5C42 B;  2JFD A;  3ZFV A;  4NCG B;  4JI4 F;  4M5L A;  4RX6 A;  1RWU A;  1GQE A;  2YWK A;  1KOH A;  3EGZ A;  2YTC A;  1RT7 A;  2BE2 A;  3DFE A;  2OMO A;  1RBA A;  4IH7 A;  2B51 A;  1F9E B;  3MPD A;  4ZOS A;  1NB7 A;  2ZBC A;  3JXO A;  3M9N B;  2QFJ A;  3D7S B;  4ZHR B;  1PBU A;  1EZZ B;  1KS2 A;  2EEY A;  1D9D A;  2OJ3 A;  2CPH A;  1PC5 A;  3NAH A;  4U6P A;  3ET6 B;  4C8L A;  1G3O A;  2FC8 A;  3IS9 A;  1ZBT A;  5HMZ A;  5F9L A;  3OLA A;  2Y9H A;  4WU2 A;  1KNZ A;  1T9Y A;  2CJB A;  5MLC V;  2HQI A;  3SYZ A;  4RL1 A;  3BBC A;  3UN2 A;  1BY9 A;  4NI2 A;  2RAQ A;  1HNV A;  4DLE A;  1AUD A;  4M63 A;  1FDB A;  3LP0 B;  1TL3 A;  3ENV A;  3MM6 B;  1WC5 A;  3R9L A;  3GZ7 A;  1NHU A;  2K1R A;  1WJ9 A;  1X9S A;  1RT2 A;  2QZ8 A;  1P9Q C;  1LXN A;  4DR7 F;  3PO4 A;  2MZS A;  1Y9O A;  4N77 A;  5I4M A;  3GCX P;  3V6K A;  1RKJ A;  3M8S A;  2HWT A;  5KOW A;  3M9O B;  5IV3 A;  1KTQ A;  3MHY A;  4D3H A;  2VPX B;  5HAO A;  1X8D A;  2BYC A;  5F8H A;  1UA0 A;  1WSV A;  4Y00 A;  2FY8 A;  1U1K A;  3CED A;  2V9K A;  1UJ5 A;  3D0H E;  2J0S D;  1DQ9 A;  2E5G A;  2VA2 A;  2HQG A;  2HLT A;  1FKP A;  2LQJ A;  2VJV A;  5C24 B;  1Y3K A;  2BW7 A;  3DRY A;  2W7A A;  1V3S A;  4JI1 J;  2RJZ A;  4X4P A;  3OSN A;  3H42 A;  4D3G A;  3LPY A;  3L7O A;  3PEJ A;  3WX4 A;  1RK8 A;  3FBE A;  1HQU B;  4DCJ B;  1XMB A;  1K0V A;  1O8B A;  1RA7 A;  4ED8 A;  2M8D B;  3NBP A;  1FXL A;  1BHN A;  3MFH A;  3W63 A;  4JOU A;  2ZOG A;  4OLO A;  4NLO A;  5A2Q U;  3PYD A;  4QW9 A;  5H9F J;  2VIH A;  3QJP A;  2ASJ A;  1F5B A;  2Z2M A;  2MY7 A;  3GYX B;  4JI3 J;  1IKW A;  1RT6 A;  3G9C A;  4PQU A;  4DPT A;  1U0H B;  4P2S A;  3MED B;  4DSL A;  3NMR A;  1LFW A;  4FDF A;  4EWT A;  4UQT A;  4NRT A;  4DV4 J;  3QGI A;  4LF2 A;  2V69 A;  4CQ1 A;  1K1Q A;  1KLM A;  2GML A;  5KFD A;  2FZK B;  3CDE A;  3S7R A;  4NZ7 A;  4ZIT A;  2DR6 A;  3DDN A;  3PW7 A;  4FNH A;  5H9F K;  4FZV A;  4AQY J;  3T5L A;  4H4M A;  4RPF A;  2D3Z A;  4MFB B;  4IFV B;  3FK4 A;  2XGQ A;  2ZDO A;  1HNX F;  1HNW J;  3G8S A;  1NDP A;  2ZVS A;  2XB2 D;  3V4M A;  5K14 B;  3CIM A;  4Y3C A;  3CMQ A;  3PTW A;  1RHQ B;  1R0C B;  3OVB A;  4DPY A;  3PW2 A;  3VVT A;  2W4C A;  1IBC B;  3ITH A;  4F0K A;  1ICE B;  3CJR A;  4FYY B;  2YKP A;  1HBM A;  1OPZ A;  2WZ1 A;  3R2D J;  4YOE A;  4X4Q A;  1ZZN A;  2EPI A;  3UFC X;  1NJZ A;  2NS1 B;  2YNF A;  3AD7 C;  3I9Z A;  3CMA S;  3T1H J;  4ES3 A;  2JLG A;  3MCN A;  4X65 F;  5GMD A;  1JB0 C;  4LR7 A;  4DV5 F;  4LRE A;  4F3O A;  2C2K B;  3UVJ A;  1ZOT A;  1F5C A;  4LSN A;  4YS2 A;  1DLO A;  5RUB A;  5J2Q A;  5ETS A;  2EFQ A;  5I42 B;  5BYQ A;  2MQM A;  1PGZ A;  1NK5 A;  1JLB A;  3CJQ A;  2JLF A;  3T9N A;  2W9B B;  2DR9 A;  3AB4 B;  4ZLL A;  2X1A A;  4P73 A;  2HFN A;  2KH9 A;  4U8Y A;  4URQ U;  2IAJ A;  4NLY A;  4LRD A;  5J2P B;  4F4X A;  4KFB B;  4UST A;  1RHM B;  2L9W A;  3DLK A;  4OYO A;  2CFX A;  2DGQ A;  2W01 A;  1OY8 A;  4V19 J;  2XG8 A;  1ZTT A;  2YX4 A;  1HYS B;  4YB6 A;  4K4W A;  2ROG A;  1UVK A;  3NGR A;  3ZTO A;  3D54 A;  3M2R A;  5JVH Q;  2RDD A;  4V19 X;  2ATL A;  4ED4 A;  4Y2I A;  4WYL A;  2C22 A;  4LF7 F;  4CCH A;  2IBO A;  2NXE A;  4WZQ A;  1ACM B;  2ZEJ A;  2HVD A;  2PDA A;  2VG5 B;  1D3W A;  2VA3 A;  3HD1 A;  4NL5 A;  1L3T A;  3W5Y A;  4O0N A;  2CQ0 A;  4X2B A;  3Q8P B;  2OAU A;  3H90 A;  1S77 D;  2CDQ A;  4DR2 F;  5BR8 F;  4FYD A;  2AW0 A;  4PG8 A;  5F8I A;  1RTH B;  2PII A;  1T02 A;  2RD5 C;  1S6Q A;  2N3L A;  3DI6 B;  3P45 B;  4PG6 A;  4DI6 A;  2WSE C;  1A9N B;  2H4W B;  2V2Z A;  2QRR A;  3N9U C;  4OQJ A;  2YWE A;  3OTO J;  2D3O R;  4V1A k;  1ZTW A;  3T19 A;  1HD1 A;  2HUR A;  3PX6 A;  2HNY A;  1QM9 A;  2XMV A;  1JX4 A;  2Z58 B;  3U1L A;  4AXJ A;  2QL7 B;  4HHU A;  2OPS A;  2XHC A;  1N8R T;  3P5T L;  5D0R A;  3QZ8 A;  1Q95 G;  4J9M A;  1NKE A;  1YTY A;  4J9O A;  2IM2 A;  1B99 A;  3IRX A;  3M2V B;  2BJ9 A;  4ER8 A;  2AKW B;  1CLF A;  3C15 B;  2X1B A;  1SJ1 A;  4Y0F A;  4QWE A;  4KC5 A;  3IM8 A;  4P2M A;  4DL3 A;  3HMJ G;  2OH2 A;  3MM7 B;  5LJ5 Y;  2KXF A;  4B3M F;  3Q2T C;  1FO1 A;  1S1W B;  2HVZ A;  1WNE A;  1S57 A;  3KUE A;  4IOC Q;  2RF2 A;  1HW9 A;  1V6H A;  1R8P A;  2MST A;  1RT5 B;  4RLE A;  1ZA1 B;  3MOJ B;  2B7B B;  3OXF A;  3QGP A;  3K59 A;  2IRY A;  2K3I A;  3HSZ A;  4R0J A;  2B7C B;  2VF3 A;  4ID8 A;  4RWW A;  2OUG A;  2ZBP A;  4DQP A;  2HHH F;  3HHL D;  2HGN A;  2AT1 B;  2DGO A;  1FJG J;  3U7J A;  2DIT A;  5HSP A;  4FXW A;  2HHQ A;  4NCA A;  1SB6 A;  2BAN B;  1JLE B;  2H54 B;  4OI4 A;  3IG1 A;  1UAW A;  5IWA J;  3TAM A;  4IFY B;  4IRD A;  3B54 A;  1H2V Z;  2CJQ A;  3QAU A;  2KHD A;  2HSE B;  4EZ6 A;  4I1T A;  4Q0B A;  2L48 A;  3UD4 P;  2DNG A;  3HKZ D;  4EBC A;  1HLW A;  3D2W A;  4XK8 C;  2JRS A;  2E7V A;  1IWA A;  5KFB A;  4XTT A;  2D3O 1;  2R2T A;  4KKO A;  3JQJ A;  2B43 A;  4WCE Q;  2I2Y A;  4UZC A;  5C42 A;  1TL4 A;  2MHE A;  1I1G A;  4QWA A;  2KO1 A;  2IVY A;  4OI2 A;  1YK9 A;  4NCG A;  1YZ7 A;  3EUN A;  2J7U A;  1Q86 T;  2YVS A;  5I3U A;  4OI0 A;  5H1S V;  2G13 A;  4KHP F;  2LEC A;  2MJU A;  2ZOF A;  4K50 A;  3VAK A;  5T14 A;  4DV3 J;  5T41 A;  2MQP A;  4FXV A;  4OX9 F;  1X5S A;  2ACM A;  4LMZ A;  4ZHR A;  1JNR B;  4RNM A;  3MFI A;  5CD4 A;  1B64 A;  5FLX U;  5B0D A;  1N33 F;  1NPP A;  3ZC4 A;  2RDI A;  1FFG B;  4WYW A;  4EU0 A;  2L08 A;  4M5D B;  4IG0 A;  4I6Y A;  2KFY A;  1LV5 A;  1U48 A;  4CWB A;  4K5S A;  3AH6 A;  1EJ7 L;  4M5J A;  1XNR F;  4HHH A;  3UCG A;  1FRH A;  3M1V B;  3MM6 A;  5KFF A;  2FJA B;  1G1X A;  4ZCM A;  2V4R A;  3I5C A;  4C11 A;  4MK8 A;  2FIU A;  1S6O A;  4USJ C;  2XO6 A;  1RAD B;  3W5Z A;  2C3O A;  2HNZ B;  3B4D A;  3MEG B;  3BR8 A;  4DQS A;  3CE8 A;  2IJR A;  5CXT A;  5HL7 Q;  4S0M A;  1X5P A;  1N6Q B;  3NNA A;  4DG1 B;  4IR1 A;  4UW2 A;  1N32 J;  2CQG A;  3DM2 B;  1W7W A;  1F9H A;  4OX6 A;  2RU3 A;  3M8Z A;  2ZNY A;  2CA9 A;  4F3M A;  2CJA A;  4LF8 F;  2X7I A;  4ETX A;  3EGN A;  3AOA A;  1IBM J;  3PR5 B;  3A8E A;  3Q89 A;  2HBY B;  4M5M A;  2FHO B;  2QO3 A;  4CLS A;  3TUI C;  5C24 A;  1QVF R;  3DRX A;  2HMI B;  4ED6 A;  3GON A;  1S97 A;  3K89 A;  3FEX B;  3KWM A;  1TR0 A;  1JXE A;  3M8P B;  1FVQ A;  2LQ5 A;  4ZN1 A;  1HQU A;  1R6V A;  2MDA A;  4NWB A;  4LFA J;  1DBD A;  4C0H A;  2F1F A;  3LOU A;  3MMC A;  2KU7 A;  4DFP A;  3QJL A;  1VLO A;  1S9G A;  5J1P A;  3G87 A;  5KG1 A;  4N8O A;  3IBC B;  3M2U B;  3GJS B;  1Q16 B;  1KC8 T;  4A4J A;  3MCS A;  1FRL A;  4L6V 3;  2HIY A;  2ZH6 A;  2H3E B;  1U0H A;  2XMU A;  3VF0 B;  2Y1R I;  3BO2 A;  3MED A;  1D09 B;  3JSY A;  1FX4 A;  1VJQ A;  1S5Z A;  1S6U A;  3KLF A;  4YR3 A;  4DV6 J;  4Y6I A;  1VQY A;  2KXN B;  5D0G A;  5KTQ A;  3R6L B;  1CJT B;  1L5U A;  4UF4 A;  2BR0 A;  1N52 B;  4MFB A;  2E9T A;  2RT3 A;  2HBR B;  1SH0 A;  2DGS A;  4J9V A;  5K14 A;  3DU5 A;  5LMN J;  1VIX A;  3TEH B;  2GO8 A;  4DPO A;  2O5D A;  1RT4 A;  1VC6 A;  4YN3 B;  3QRP A;  5HQ8 A;  1QY7 A;  1CG2 A;  2O66 A;  2CZV C;  4MH8 A;  2K7J A;  4NYO A;  4FKX A;  4RBV A;  5KFU A;  3MR7 A;  3KJF B;  4XDC A;  2RRB A;  2F5G A;  1WI8 A;  2R7V A;  4ELT A;  3E01 A;  4A8S A;  2YWW A;  4BLG A;  1X0P A;  4GC6 A;  1WF1 A;  1WC3 A;  3U27 A;  2OEL A;  2MQN A;  2ZH5 A;  3T5H A;  1W25 A;  4YY3 F;  4LF5 F;  4CTA B;  4DF4 A;  2X1F A;  2WK4 A;  1MMN A;  1ZZF A;  2L41 A;  3PKM A;  5KT5 A;  4I67 A;  2Z56 B;  3DMJ B;  3GIL A;  4UZB A;  5KT7 A;  3DOL B;  2C28 A;  3LP2 B;  5I42 A;  1S0V A;  4EI2 A;  4K7Q A;  2W9B A;  1RHK B;  2WTF A;  1K9M T;  4JV2 A;  5HLF B;  5KG5 A;  2QL9 B;  1FES A;  1QAY A;  2BQ3 A;  4PCQ A;  1H73 A;  2RB7 A;  1U6B A;  2PA8 D;  2JX2 A;  4HH0 A;  4KFB A;  3IRW P;  4AXI A;  3EX7 B;  2MMY A;  3TZZ A;  2ROP A;  5D15 A;  1JLC A;  1HYS A;  1Y10 A;  4C4W A;  5HJY A;  2BJ8 A;  4OHX A;  1Q5Y A;  3J7A N;  4Y2M A;  2BUN A;  1GK8 A;  3GSI A;  4B9N A;  3SEO A;  2OSR A;  2N4C A;  2FJD B;  2J76 E;  2YWH A;  3AB2 B;  1PYS B;  2RDJ A;  1P8G A;  1U24 A;  4NXN F;  4LF1 A;  4ZIV A;  4F04 B;  1LK7 A;  2YXL A;  4HAC A;  3W2V B;  2IJN A;  1U6F A;  3MAH A;  4XDD A;  2VG5 A;  4QIF A;  2J9D E;  2UXB J;  4FPR A;  2B4U A;  3FCW A;  3UD3 P;  1U1M A;  1D0E A;  4OHZ A;  1SCJ B;  3GIM A;  3SV4 A;  3HT0 A;  3EXC X;  2GAG C;  1PAE X;  4DUT A;  3VTI A;  3J81 U;  1RTH A;  4JBC A;  4J9S A;  3DHW C;  3AXK A;  4DF8 A;  1C0U B;  1H2U X;  3DI6 A;  1FWL A;  3C6T B;  3BGL A;  2MYF A;  4YR2 A;  1RAC B;  3R5G A;  1F3F A;  4ENO A;  4ES2 A;  1FJ7 A;  1VQ9 S;  2DB1 A;  3K58 A;  3MWB A;  2A6M A;  5KFX A;  2QLB B;  4CLL A;  1IN0 A;  2XZD B;  2ZM6 J;  4JI8 F;  1D8Y A;  2D9O A;  4RO0 A;  3Q8R B;  2CQB A;  2YQ1 A;  4CH1 A;  1Q7Y T;  4IOA Q;  3D6M B;  2V34 A;  4CH7 A;  4RNF A;  2ZBI A;  3K0J A;  5IT4 A;  3G8Q A;  4JP8 A;  3DC2 A;  2OFG X;  1F5A A;  2KHC A;  1RAO A;  4PAA A;  3GFH A;  3R1L A;  2F4V J;  4FBT A;  4UQG A;  3UNG C;  1ARO P;  2J6U A;  4L3K A;  1XQI A;  3KLE B;  4IRK A;  5CH7 B;  4WFN Q;  2AD9 A;  1WOP A;  3OL6 A;  3C15 A;  3NY0 A;  1CUL B;  4HH1 A;  2OKQ A;  3IAM 9;  4NXM F;  3RAM A;  1HPZ B;  4DHV A;  3MM7 A;  2K2P A;  1WF2 A;  3GYN A;  2HBQ B;  1SJQ A;  3OXG A;  1S1W A;  2XZW A;  4NLD A;  2PSZ A;  3WZ0 A;  1FTC A;  1HBO A;  5KAK A;  1RT5 A;  1Q8I A;  2IYG A;  2OI2 A;  1TV6 B;  1JXV A;  1MNE A;  4OLP A;  2JHE A;  2JVO A;  4DQQ A;  4W98 A;  3EGW B;  3EE3 A;  1GMW D;  4LBI A;  1HNI B;  5D4N A;  4OJH A;  5EX0 A;  2BXJ A;  2BAN A;  2ATC B;  1TTH B;  5IQQ A;  1JLE A;  4MYT A;  1R0A B;  2NR0 A;  2ZUA A;  4EEY A;  4IFY A;  3DRS B;  3PM9 A;  1TL1 B;  3M32 B;  2RRA A;  1JLQ B;  4P2F A;  4X4N A;  1PG5 B;  2MQ8 A;  1WOR A;  2J7W A;  1KHW A;  4LF9 J;  4JUZ A;  2KJW A;  3SDE A;  2EC2 A;  3CCS S;  3IA0 A;  2RQ4 A;  1TVR B;  3L09 A;  2FLP A;  4X4O A;  2O01 C;  1PYT A;  5FII A;  4AL6 A;  4ZVS B;  2DPJ A;  3KJV B;  2FHJ D;  3UN3 A;  2LU1 A;  4A47 A;  4R5P B;  4K0K J;  2D41 A;  3CTR A;  2BAB A;  1WKK A;  1FE0 A;  1YJU A;  4C3L A;  2WSF C;  4NA1 A;  2OEK A;  1GFW B;  1M1G A;  4WKR A;  3E3X A;  3CDB A;  1Y7P A;  2N3O A;  2LA6 A;  1Q53 A;  2E7W A;  3A3O B;  4M5D A;  1D1U A;  1FJE B;  3N79 A;  3IR6 B;  5J2N B;  3NS6 A;  2F63 A;  3D5M A;  4DV1 F;  2E1R A;  2H51 B;  2VZ9 A;  5AXL A;  3O44 A;  2UUA F;  4GMK A;  1N5Y B;  4O3R A;  3M1V A;  4WP3 A;  2VHG A;  1B7Y B;  1SPB P;  1C1B B;  1MU2 B;  2NUU G;  1J5O B;  3N28 A;  2E29 A;  3RR8 A;  4RW7 B;  1MRO B;  3MEG A;  4JI5 J;  4RW8 A;  5FJ4 A;  4N5S A;  1UKU A;  1S76 D;  1N6Q A;  5D78 A;  4DG1 A;  2CQI A;  1NBE B;  4DR3 J;  4QQB A;  1VBY A;  3DM2 A;  3CW2 C;  2APO A;  2Y1L B;  2HAF A;  5F3Z A;  1BQX A;  1WHW A;  2RHQ B;  4I2P B;  1SQF A;  1OY9 A;  3PV8 A;  1ROF A;  4OYX A;  2HS4 A;  2XI2 A;  5ETO A;  4OYZ A;  2BKN A;  5FDL B;  3UCZ P;  4F2S A;  3H2U B;  2EK6 A;  3PG9 A;  3HVA A;  4NMX A;  3QQC D;  7FD1 A;  1WC6 A;  4DL7 A;  2BKO A;  3M8P A;  2ASD A;  2A2C A;  1C1C A;  3MOZ A;  3ZXW A;  8ATC B;  3HHL B;  3TW0 A;  3EDQ B;  5KFW A;  4IR9 A;  1X4C A;  5LL6 d;  5G4D A;  2AF6 A;  4M8L A;  2LKZ A;  1OQ3 A;  5KFI A;  5KFL A;  4KTQ A;  2G2Z A;  2FLO A;  3OFG A;  3CD7 A;  4LFC F;  2AHO B;  2IA0 A;  4JI0 J;  5DM7 Q;  1SL1 A;  5EHH A;  1ZPV A;  1U26 A;  2VV5 A;  5SUH A;  3HHD A;  3GU0 A;  4TLR A;  1TAQ A;  1Y5L B;  4PWW A;  2JVR A;  2H5J B;  4IQX A;  4WE1 B;  4GKJ J;  1I3O B;  1WF0 A;  1UWA A;  1Y11 A;  2UXC J;  4ECZ A;  4WBF A;  2OPP B;  1HQE A;  4CLP A;  2PFD A;  4DR7 J;  1GNK A;  4O23 A;  4XIU A;  1TL5 A;  3TWZ A;  1S1X B;  3ILI A;  1YWX A;  1CJT A;  4Q2L A;  2YNG B;  2GX8 A;  3BGR B;  2VPW B;  2DTJ A;  2CPY A;  5DM6 Q;  4BC9 A;  1IBK F;  4JI7 J;  2BV3 A;  3QBC A;  3R5J B;  4DR1 J;  2ZE2 B;  2B9E A;  4ZVU B;  2K8G A;  3I0S B;  5B0A A;  2Q1L A;  2G9O A;  3SXL A;  3DYA B;  4HVZ A;  2DXF A;  3CUL A;  2ADB A;  2VL1 A;  4JYA J;  5DGB A;  4ED5 A;  1KKH A;  4TU7 A;  4Q45 A;  4J9Q A;  2WHO A;  4OV1 A;  1U25 A;  5HQM A;  1PKU A;  3QWP A;  3HLU A;  4JV5 F;  3TR5 A;  2QA4 S;  3DCA A;  5F8G A;  1ZM3 A;  4MJK A;  1W2B R;  4CTA A;  2GQC A;  1EAY C;  1VQ5 S;  4C3M A;  4FYX B;  3DMJ A;  2XWX A;  3X1L B;  2FHM A;  3PDN A;  5LSR A;  3C16 B;  3DOL A;  4W90 B;  2EW9 A;  2HWI A;  4X62 J;  2BRL A;  4M5K A;  3KG1 A;  1S7H A;  3W9J A;  4ECT A;  3MM8 A;  5HLF A;  1T03 B;  3ZZZ A;  1MN7 A;  3PJ9 A;  1TFW A;  3FEY B;  1IBL J;  1VGY A;  1FT8 A;  1H98 A;  2H4Y B;  4ZJO A;  4CO1 A;  4ZCL A;  4HTJ A;  4ZMM A;  4B9S A;  3ZTQ A;  2R7O A;  1W2I A;  1R0B G;  3HSJ A;  2M4M A;  2RRN A;  4CNY A;  1ZPW X;  3GLJ A;  5B08 A;  3CB4 A;  4EUV A;  2CAD A;  4F7V A;  3RU0 A;  4DLG A;  5IT9 Y;  2P9C A;  5LJ3 Y;  3H7H B;  1K0T A;  4DUZ F;  3OL7 A;  2BZ2 A;  3PW5 A;  1FD2 A;  2DGW A;  2XS7 A;  3TVY A;  2RQM A;  1OS5 A;  2BJ1 A;  2ZC3 A;  3D0I E;  3DKD A;  1J27 A;  4B17 A;  2VAS A;  3HK2 A;  1X5O A;  3OFH A;  4KGK A;  3CME S;  3W2V A;  1JJH A;  4USI A;  1RQ0 A;  4UUW A;  2QIF A;  2IVM A;  2DCL A;  3EVO A;  2VKZ G;  4A8Y A;  1VBX A;  3MAQ A;  3GP9 A;  4ZPD A;  2XEX A;  1URN A;  1HQ2 A;  2QL5 B;  4QBU A;  2PMZ D;  1U4B A;  2R7U A;  1YBU A;  5KFV A;  3V81 A;  4ZIW A;  1SH2 A;  1C4A A;  3D1H A;  1VQ8 S;  1DTQ A;  4C97 A;  2ZH3 A;  1TUV A;  3E2E A;  3KK2 A;  1C0U A;  1O51 A;  4H4K A;  4Q8E A;  3MTJ A;  4JI6 F;  4N7T A;  4LRF A;  3SQG A;  3ZZ0 A;  2CRL A;  2N7Y A;  4O4G B;  4GC7 A;  2DNK A;  3VQS A;  4TQS A;  1HA1 A;  1OYE A;  1DQA A;  2AEJ A;  3K5O A;  4PEO A;  3EJM A;  3OJS A;  1RWX B;  2P5V A;  2ABY A;  1VJW A;  1R89 A;  1LEO A;  3ZZR A;  4ECS A;  3W5X A;  3DDI A;  2CZ9 A;  3K7R A;  2CPF A;  4ECR A;  4KB7 A;  1N54 B;  4DZ6 A;  1X5T A;  5KFC A;  5EUH A;  4FXD A;  2UVV A;  1BLU A;  3WIU A;  4I4B A;  3MXH P;  3KLE A;  1KOO A;  2NQP A;  3RB6 A;  2CJ9 A;  1CUL A;  3T3F A;  3CC7 S;  2YH1 A;  5IT0 A;  1XMQ J;  1HPZ A;  4NEZ A;  2C2Z B;  3KLV A;  2NSB A;  1EX8 A;  3K8W A;  2J9D A;  3NS7 B;  5HJX A;  4ED7 A;  1KVK A;  4W4M A;  2E1C A;  2LCW A;  3MR3 A;  1SC6 A;  5ETK A;  2QFI A;  4GVB B;  4DR5 F;  3DRP B;  2HHU A;  1TQL A;  2B4P A;  2LQB A;  1TV6 A;  5KFO A;  4PXB A;  1ZAW A;  1YJW S;  1KR4 A;  2EFO A;  2R2R A;  2A3J A;  5ETN A;  4TU8 A;  2XSF A;  4WTY A;  3N6L A;  1IKX B;  4N47 A;  5B09 A;  3JAM Y;  2UXD F;  4NYP A;  2B3T B;  1R0A A;  1VC0 A;  3ZTP A;  2W2M P;  2V50 A;  3DRS A;  3MM5 A;  3W64 A;  2KT3 A;  3TI0 A;  2ERR A;  1TL1 A;  1S10 A;  3M32 A;  2PMH A;  4L73 A;  2R7R A;  3WX8 A;  1PJ5 A;  3MEE B;  2JDJ A;  3TZW A;  3KK3 B;  2V8P A;  4P7T A;  3JSR A;  2ZIT A;  2M8H A;  1Q0N A;  1X4A A;  3KLG B;  2MKH A;  3T6B A;  3HVW A;  2BE2 B;  4K5R A;  1S59 A;  2WVD A;  3KMQ A;  2DH7 A;  4RNN A;  4B3R J;  1IM6 A;  1S48 A;  3CCQ S;  2EWH A;  3GMG A;  2FUG 9;  4A48 A;  3PRV A;  1TVR A;  2XMK A;  1X4D A;  2HFV A;  3M05 A;  2XY5 A;  4KJI A;  4PXD A;  3VGT A;  3KG0 A;  2F8E X;  3OSP A;  3KJV A;  1KP6 A;  2DNY A;  4R5P A;  3VHQ A;  3BGF A;  5KFR A;  5A76 A;  2DHH A;  3J80 Y;  3BDP A;  2JEJ A;  5F8J A;  4NI2 B;  4FS2 A;  4UOC A;  5AE3 A;  2PI4 A;  3VAH A;  5K9F A;  4MIA A;  2AYG A;  3AA9 A;  3QFW A;  2OFH X;  3G6X A;  2RE1 A;  2CPD A;  4M1K A;  5JXS A;  1CPZ A;  1H38 A;  4RKU C;  2Z4P A;  3DLH A;  3RB3 A;  3PX4 A;  5J2N A;  2DHX A;  4DQI A;  1RTJ B;  2GHW A;  3GFY A;  4UOF A;  5CAB A;  2VQF J;  2HGL A;  4C8Z A;  5E7O B;  1RWO B;  4OHW A;  2UUB F;  2M52 A;  1RLD A;  1XWL A;  1R8C A;  3NOC A;  2COL A;  2XGP A;  2BVZ A;  3UW1 A;  1MU2 A;  3H4B A;  1J5O A;  5K8O A;  1SQE A;  2MZQ A;  4RW7 A;  1PJ7 A;  2QX0 A;  4DL6 A;  4U7C A;  4QWB A;  4IH6 A;  3BO3 A;  2PFF B;  1FKP B;  2BOP A;  4ZP7 A;  2HQD A;  4DDF A;  2LEB A;  5DET A;  1RTD A;  1FHT A;  5MAO A;  2DR7 A;  1WWH A;  3G71 S;  5LSL A;  4K4V A;  4DU7 A;  4F4Y A;  3FCH A;  2ACY A;  3I87 A;  1T9V A;  4DR4 J;  5AE1 A;  4EO8 A;  3AY0 A;  7AT1 B;  3NBP B;  2QG9 B;  1GEH A;  1HFE L;  5FDL A;  2XLK A;  4RBT A;  2GVD B;  4DOZ A;  4E0D A;  4I2Q B;  2DNO A;  4LIW A;  5EDW A;  2YH0 A;  2BM0 A;  1M5H A;  2NRE A;  4OJG A;  1M5O C;  4QOT A;  1IKW B;  3HHL A;  3NP5 A;  4PR6 A;  4K4X A;  3NEK A;  3WDO A;  2R8K A;  1U2F A;  2GC8 A;  4NZ6 A;  4DSF A;  1RI7 A;  4NML A;  2ZJR Q;  3VAF A;  1KN6 A;  2EFG A;  2QC3 A;  4YR0 A;  1YG0 A;  1WTB A;  3SFU A;  4ZJQ A;  1WEX A;  4MIW A;  4K59 A;  5KG3 A;  2KM8 C;  3HX9 A;  1EIY B;  3BKU A;  2Q43 A;  3FGV A;  2N7C A;  1T9X A;  2WW4 A;  4WE1 A;  1AFJ A;  1JLA A;  2HK2 A;  2NZ4 A;  4UT4 A;  2PEH A;  4HI2 A;  4F0H A;  2R7Q A;  3IFE A;  2G2Y A;  3F44 A;  1SIZ A;  3DHX A;  5ETQ A;  3DOK A;  1NJW A;  2OPP A;  4CYU B;  3R3T A;  4IYQ A;  1CJK B;  3Q23 A;  1FVS A;  5DQH A;  2VC1 A;  4A46 A;  2HRY A;  4DV0 J;  3PYG A;  3IBW A;  2J6T A;  2YWG A;  1S1X A;  4AL7 A;  3MGJ A;  4DPU A;  1OY6 A;  4B3S J;  4URG A;  2YNG A;  3BGR A;  2KG1 A;  2OLW A;  3UQS A;  3L9Z A;  1HBM B;  2WON B;  2IA6 A;  1BQN B;  4MIB A;  2KT2 A;  3HHN B;  3DRR A;  4PG7 A;  3TZY A;  3UWT A;  2ZE2 A;  2IBK A;  1FX2 A;  1AT1 B;  3I0S A;  3O6Q A;  1JKH B;  3CJ5 A;  1VI7 A;  3DYA A;  2DGU A;  1KVI A;  2VQE J;  3NNC A;  2NUH A;  2YX7 A;  3FFI B;  3TRG A;  2FHK A;  3JSB A;  3N6M A;  1TUW A;  2ZH8 A;  1FF2 A;  2EK1 A;  4KO0 B;  2ZKT A;  2PMW A;  2M9K A;  4RW9 B;  5D8H B;  2XC9 A;  4O3S A;  2I5J B;  2R7T A;  1HL6 A;  4HDG A;  1LWF B;  4F4A A;  5IZH A;  4ZP8 A;  2MKK A;  4QPT A;  2H1Y A;  2FLL A;  2OPR A;  3R7S B;  1PBA A;  3CO9 A;  3GPA A;  1TU0 B;  5U47 A;  1YKW A;  2EXU A;  3O1L A;  4WU3 A;  4RW4 B;  2VOP A;  5CZX A;  2CDR B;  4NLX A;  2HVI A;  4LRB A;  1RIS A;  4MT1 A;  1YJN S;  1U7L A;  3VGV A;  4JI1 F;  3QT6 A;  3W3S A;  4OZ3 A;  2B9W A;  2MKY A;  1EQ0 A;  4PUO A;  2VDH A;  3UN5 A;  2XZT B;  4U7U K;  3M2R B;  2BE9 B;  1T03 A;  2I8E A;  2MZR A;  3BN4 A;  2V4J B;  2XUL A;  2V0N A;  1IVZ A;  2HFO A;  3RRK A;  2N4D A;  4PYA A;  5HRO B;  4P74 A;  4KAI A;  4X64 J;  4I0W A;  3D6H B;  3L3C A;  5HBM B;  1LWE A;  3C66 A;  2FLN A;  3D3C J;  1MLA A;  4G1I A;  2AJ1 A;  4E8U A;  2ZWO A;  3BDE A;  2VG7 B;  4C0B A;  1HWL A;  3HDS A;  4PWU A;  3R7B B;  3NGS A;  4Q43 A;  2KG0 A;  2D7S A;  4ELU A;  3I56 S;  3OPK A;  3RAX A;  4I56 A;  2MY8 A;  3MMA B;  3ZO7 A;  4IDK A;  2A18 A;  1DAR A;  4OYP A;  3W2W A;  3MDF A;  2MKJ A;  1HAR A;  2W7O A;  1PCA A;  1B4S A;  4CO3 A;  3V4I B;  4RW6 B;  2VFT A;  2GMH A;  4ECY A;  4E2F B;  1S6Q B;  4LVN P;  5CD4 H;  4AQY F;  4USW A;  2ZBR A;  2W4P A;  2A10 A;  2RVJ A;  3QIP B;  4TY8 A;  3JQK A;  3BBF A;  3NWR A;  1HNW F;  4DX5 A;  4Y2A A;  4USH A;  1T95 A;  2CXE A;  1GAO A;  2G0I A;  2DRB A;  1NK0 A;  2IC3 A;  4X4U A;  4OJ1 A;  1SIW B;  2EKN A;  5IC4 B;  3GII A;  3TUZ C;  3WC2 A;  4K4T A;  2ROE A;  1N0U A;  4NCB A;  3R6G B;  3B6B A;  1HNZ J;  2OSQ A;  3QRQ A;  2AZ3 A;  1VHI A;  2M2B A;  5KG7 A;  4KH0 B;  1GX5 A;  4FF3 A;  4CI0 B;  4LRC A;  3U02 A;  3Q24 A;  1NH8 A;  2HG4 A;  4A8X A;  2YKO A;  4O4G A;  3DDK A;  3Q8U A;  2JJ4 D;  3T1H F;  1NRK A;  1WOO A;  1OMS A;  3HD2 A;  3NWG A;  3ZTR A;  4Z7C A;  1RWN B;  5F3T A;  1VLY A;  3NS5 A;  3P49 B;  2XS2 A;  2DH8 A;  1DZ5 A;  5AXN A;  2BDP A;  5CYJ A;  3RZA A;  4C48 A;  3RR7 A;  2P8I A;  4TNO A;  2DR5 A;  4A8M P;  4KRW A;  3B4M A;  5CAA A;  3TQ1 A;  3TA2 A;  2IFX A;  3CJT A;  1GTE A;  1F9F A;  1ZM2 A;  3SSS A;  3HUL A;  2VFV A;  2YKM A;  4URS A;  1RWW B;  2B8Q A;  4AYB D;  3SV3 A;  1FEE A;  3MM9 B;  1Q1K A;  3RBD A;  5KFG A;  2RS8 A;  4NRU A;  3J81 j;  3P96 A;  5ETT A;  1LXJ A;  3UE2 A;  1TL7 B;  2FJE B;  3PAC A;  1SUQ B;  3X3U A;  1J2V A;  3E51 A;  1U1P A;  3TAM B;  1BD6 A;  4GVB A;  5M2R A;  3DRP A;  4C0O C;  2MGZ B;  2HFU A;  3NGT A;  2YNH B;  3GR1 A;  1HWK A;  1NSK L;  3PX0 A;  2KYZ A;  2GVZ A;  2DNL A;  4HTI A;  3PCO B;  5ITH A;  4IO1 A;  3K5N A;  2MQL A;  1RWK B;  1MML A;  1IKX A;  4HYK A;  1RGV A;  3KLI B;  3RBZ A;  3SCL E;  4FNI A;  2PA3 A;  3NLC A;  5AXM A;  4CP5 A;  4ECU A;  1TMM A;  1NB2 A;  4ECV A;  3MEE A;  1XC9 A;  5EWF A;  3KK3 A;  3CDW A;  1M5V C;  5I3U B;  2MKI A;  4OZ0 A;  2BAC A;  4NE9 C;  3KLG A;  2C2O B;  4BBY A;  2CQP A;  5THW A;  3FC9 A;  5E5N A;  4B3O B;  3ISN D;  3Q8Y A;  1XER A;  4WPA A;  3OHA A;  2ASY A;  3W66 A;  2EVZ A;  1OSC A;  4N56 A;  4WTO B;  3CSK A;  3N6N A;  4USK A;  3ZNJ 1;  3PW0 A;  4IG0 B;  1PSD A;  2BQU A;  2OML A;  3OTO F;  1GH8 A;  1NXI A;  2J0W A;  2WBR A;  4PXC A;  2MXY A;  1R3N A;  4J9L A;  4QIV A;  2H5I B;  5D0H A;  1KBR A;  1B0T A;  4C11 B;  1QSS A;  4EO6 A;  2EC0 A;  4AT1 B;  3R5D A;  5A2Q Y;  1RB0 A;  1RTJ A;  4QW8 A;  2HHX A;  1VR6 A;  2WVC A;  2CVI A;  1SJF A;  3EGV A;  1P1L A;  2UV8 A;  3KK1 B;  2ZZN A;  2WB4 A;  4WFX A;  3RYL A;  3HJV A;  1FRI A;  3V6J A;  1IR1 A;  5LSO A;  1QLN A;  4ED0 A;  2V2K A;  3FZ2 A;  2RKI B;  4DL2 A;  3DXS X;  3KJQ B;  3EM1 A;  1IJE B;  2W2O P;  2JEI A;  3N0V A;  3C19 A;  1Y00 A;  1BE4 A;  3H5X A;  3FVY A;  4HR2 A;  3Q8Q B;  3GJT B;  3J7Z T;  4FKY A;  2DT9 A;  1FJG F;  5KFN A;  2LEP A;  2YY3 A;  3NMA A;  3QGH A;  2UVU A;  2Z2Y B;  2QYG A;  5HVH A;  2HND B; 
#chains in the Genus database with same CATH homology
 4CLU A;  5IV4 A;  1CJU A;  2BW7 A;  1CJK A;  3C15 B;  5D0H A;  4OYW A;  4OYA A;  4NI2 B;  3UVJ B;  4OYP A;  4P2M A;  4NI2 A;  1YBT A;  4USU A;  5D15 A;  3G82 A;  3R5G A;  2GVD A;  1AB8 A;  1CJU B;  1Y10 A;  1CJK B;  1WC5 A;  1YK9 A;  3MR7 A;  4CM2 A;  4OYB A;  1Y11 A;  4UST A;  4CLY A;  4USW A;  4CLL A;  4OYO A;  4OZ3 A;  2W01 A;  4CLK A;  3G82 B;  1TL7 A;  2GVD B;  4CLW A;  4CLP A;  1WC3 A;  1U0H A;  4CLZ A;  4OYX A;  1WC1 A;  1FX4 A;  5D0E A;  3C16 B;  4P2X A;  4OYZ A;  2WZ1 A;  3C16 A;  4WPA A;  1CJT A;  1TL7 B;  3MAA B;  1CS4 A;  1FX2 A;  1CUL A;  1U0H B;  5IV3 A;  4P2F A;  2QV6 A;  3MAA A;  4OZ2 A;  1YBU A;  1CJV B;  1WC6 A;  4WP9 A;  4CLT A;  5D0G A;  1CJV A;  4CLS A;  4OYM A;  4CLF A;  3C15 A;  4WP3 A;  1CJT B;  1WC4 A;  1CS4 B;  1WC0 A;  5D0R A;  1AZS B;  4CM0 A;  1CUL B;  2GVZ B;  4USV A;  3UVJ A;  4OYI A;  3C14 B;  1AZS A;  3ET6 B;  2GVZ A;  4WP8 A;  3C14 A;  3ET6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...