2BWBA

Crystal structure of the uba domain of dsk2 from s. cerevisiae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bwbA00
1EFUB 2DI0A 2JP7A 1T6OA 1P3QQ 2JZ1A 2KNVA 4R71A 2OOBA 1TTEA 1OTRA 1DV0A 2KHHA 5JI2E 2LVAA 1VEGA 2DENA 2HAKA 2LBCA 2OO9A 2RRUA 3FRHA 2L2DA 1G3IA 3GLFE 1OQYA 2JNHA 1IXSA 2JZ0A 3K9OA 2MROB 2LTUA 2DAEA 1WHCA 2HWJA 2WZJA 2DZLA 1ZMVA 1ZMUA 2DAKA 2B3TA 2CWBA 1ZV1A 1T43A 4WP2A 1WGLA 1OAIA 3LCVB 1VDLA 2ZTCA 3F92A 2O25A 2EKFA 1IFYA 2H5XA 2DNAA 2JY5A 3GLHE 2LVNC 2MGWA 1F4IA 1R4GA 3FE3A 4UN2B 3IHPA 2DKLA 3GLIE 2DHYA 5DFLA 1YLAA 2DAMA 1UFZA 2QSFX 2R0IA 2L4FA 2ZTDA 3FRIA 3E46A 2DAGA 1HQYE 1WJ7A 3B89A 1E94E 1JR3E 2QHOB 3IECA 4DBGB 4HEOA 2LVQD 1DO0A 1WGNA 1WR1B 2MR9A 1ZMWA 3K9PA 3T6PA 4G3OA 2BWEA 1V92A 2K9DA 1BVSA 1DO2A 3H4JA 2KNAA 1NV8A 2KNZA 2L4EA 4GEWA 3GLGE 1XB2B 2OOAA 1AIPC 2JY6B 1XXHE 2LVOC 2LVPC 1OKSA 1NV9A 1G4AE 1MN3A 1QZEA 2JY8A 4Q7JA 1HT2E 1VEKA 2EKKA 2MJ5B 1Y8GA 1CUKA 2JY7A 1HT1E 1WIVA 1VG5A 1SG9A 2K0BX 2JUJA 1VEJA 2EJSA 1VQ1A 1HJPA 1A5TA 4F1IA 2DAIA 1Q02A 3MMPA 1G41A 2G3QA 3E21A 1KYIA 1GO5A 1TR8A 2QNJA 1C7YA 2BWBA 3LCUA 2CP8A 1IM2A 4F2LA 1PGYA 3BBZA
chains in the Genus database with same CATH superfamily
1DGHA 3I4VA 2Y20A 4ANRA 2JP7A 2KRUA 1IBMM 3FUWA 2JZ1A 4R71A 4FWHA 3RGSA 5E6JA 2R65A 3RGPA 3DZDA 3WHLA 3GP1A 2VQFM 3U60B 1DV0A 5EXPA 2H1RA 4JYAM 5EXXA 2LVAA 4IJEA 2I7NA 2LBCA 3KOYE 5ITYA 1JB0F 2KW0A 3SASA 2Y21A 3UJNA 4PT5A 3TPZA 3GLGA 2X8AA 1GJTA 3GLFE 4DV7M 3A45A 2QQ8A 5L8RF 2X49A 1N34M 3THGA 1QZMA 2XFSA 1DGGA 2LTUA 5EXTA 4PDIA 5H37D 4DUYM 3U6EA 2HWJA 2C5RA 1K3XA 2WZJA 3AJIB 4OX9M 2YQZA 3C9PA 4NOOB 5KQDA 3AL0C 4GHLA 1Z6TA 1ZMUA 3VK7A 3GLHB 4LFBM 2CE7A 4JI0M 4X65M 1D0KA 1T43A 2Z7JA 2FH0A 4WP2A 2FOIC 1PJSA 2VQEM 4LJ4A 4M9SA 2RGHA 1IBLM 3KDSE 2P5TA 1GJSA 1TH4A 5EP1A 3SYLA 3U6MA 3GRUA 1IFYA 2JY5A 3U5ZB 4KT0F 3I4YA 1D2NA 2KA6B 4L4UA 1FJGM 4AG6A 3IHPA 1JQJC 2D7EA 2C9CA 2DKLA 3ZCBB 1SXJA 1LTMA 4IIWA 5ITUA 4DR7M 1E9RA 2QSFX 4GITA 3AFHA 4A3VB 2ERCA 2R0IA 4DR4M 4XGIA 3FUVA 1X37A 2FE8A 4AKIA 1Z5BA 3GRVA 2KXEA 2R4JA 1NVMA 1QDTA 4NSOB 3NBXX 4LCBA 3JAMS 1IY1A 2CHVA 3U6LA 4LF9M 4GH9A 2UXCM 2C96A 1OAOC 4P16A 2MR9A 3T6PA 1QAOA 1WXQA 2K47A 2L7HA 2DWLA 3CF0A 1PJJA 4FVMA 5LMNM 4RKUF 4LJ8A 2UU9M 4GHAA 1PRBA 1W5TA 3VKHA 2KNAA 2KNZA 2L4EA 4GEWA 1IN5A 3W68A 1D0MA 1AIPC 3CGWA 3HHZA 4XK8F 2LVOC 3D8LA 1I94M 2F4VM 2ZANA 1SXJE 4MGKE 4Y28F 1NV9A 1G4AE 3H4MA 3W67A 1Q3CA 3IG8A 4HL4A 4NRVA 1HT2E 1VEKA 2EKKA 4CIZA 3PVSA 2JY7A 3NBIA 4LRTA 2VF7A 3HJ8A 1HT1E 1NNUC 4R3DA 5IREB 5FTLA 1HNZM 5IWAM 3UMMA 1GKIA 1XHBA 3SYKA 1HJPA 3U61A 1A5TA 1UM8A 3HU1A 3J80S 2EO2A 3HU2A 1G41A 4I8OA 2DZNB 4G4QA 1XC8A 3RFWA 1YSYA 2KZUA 1GABA 4D80A 3LMMA 5FLXS 4RF1A 2KZSA 1N77A 3V76A 3FTFA 3W0LB 4LF4M 2CUZA 1GL6A 4OW0A 1PGYA 1EFUB 5IT9S 5ITRA 1ZAEA 1IXRC 4D81A 3HGIA 1OJLA 4OVZB 2KNVA 4IBBA 1JR3A 2JA2A 2RGOA 2X4AA 2D7HA 4W5WA 5ITTA 2OOBA 3GLFB 3DOAA 4YY3M 4OU7A 2O01F 5FSWA 4CJ6A 2ZBKB 5JI2E 2LHCA 4IBEA 1VEGA 5F3WA 4X62M 1OFIA 2RRUA 4AKHA 1XWIA 3CF2A 3FRHA 2L2DA 4L78A 2GNOA 3KVWA 3K92A 3SFZA 3GRRA 1IXSA 5EP4A 3TQSA 1L8QA 2C98A 4DV5M 4WW0A 1R6BX 5IZ7D 4IBFA 2MROB 4LFAM 2XFTA 3HJSA 1TDHA 2DAEA 2QZ4A 4G4OA 1TF0B 4RF0A 4M0WA 1E32A 4JI3M 3SAWA 1OIZA 2KRKA 4GMQA 3B7QA 4LJ7A 3QYBA 3GLGB 2B3TA 4DV4M 3VKGA 4JI8M 2LHGA 2XSZA 2HHHM 2YFQA 1SXJC 1W5SA 3FUUA 1Z5AA 1NO1A 4IBDA 1SXJD 4S12A 3C58A 4GKJM 3GRYA 4ITQA 3W0FA 2ZAOA 3HWSA 3U6PA 2M5ZA 3GQ4A 1I4WA 4REZA 3RE8A 3VFDA 2D7GA 4CISA 3KS8A 2MGWA 4MB7A 4WURA 3SBJA 3HJQA 2I7PA 4AZFA 2CRUA 3HY5A 1QAMA 4JI7M 3MK6A 2AHMA 5ITXA 3PNYA 4PCZA 3SMSA 4KODA 3FRIA 3LQQA 4IBGA 1TH3A 3CF6E 4II7A 4IBCA 4GC5A 5ITQA 1L2BA 1S3SA 3NWLA 2LVQD 2W82A 2QBYA 3FD9A 3K9PA 1SXJB 2BWEA 4PDGA 2OQ4A 2K9DA 3QYEA 3WHKA 2WSEF 2L6OA 2R6FA 3J7BA 3KS4A 5KPTA 2LH0A 4IBIA 4JI2M 3VDPA 3AOEA 5FTNA 3GLGE 4EIWA 3L26A 1XB2B 4G4RA 3M0EA 1IN6A 2JY6B 2L7IA 2XZUA 1GL7A 1OKSA 1NJGA 3EIEA 3SATA 2FS1A 1MN3A 3KOZE 5LMUM 2Z4RA 2CV2A 4NRWA 3A46A 2F5QA 1IN4A 2DWNA 3SC3A 2R18A 2APLA 3C3EA 3JR5A 1L1TA 4B3SM 1VEJA 2XH9A 2EJSA 1HNXM 4FCWA 2ZM6M 3UZUA 4L16A 4DR1M 4KHPM 5FTKA 1N78A 4LZZA 4BBAA 1Q02A 2XGNA 3LVVA 3MMPA 5FTJA 1FNNA 1IN7A 1JR3D 3HKPA 1NHWC 2UXDM 3KW6A 1C7YA 1N32M 5EP2A 3A42A 4P17A 1IM2A 2Z8YM 2MH8A 3JR4A 3GLIA 3M6AA 4YHHM 3U61B 2BJWA 7CATA 2XLJA 1KSFX 3BBZA 4JI1M 3KSJA 3KXEC 1T6OA 4X66M 4LF5M 1DGBA 1P3QQ 4L8RC 2Z4SA 4CHTB 4DV0M 4D82A 1OTRA 3L25A 2KHHA 2XZFA 1L2DA 3BXWA 3SAVA 2HAKA 1NNJA 4R7GA 3J81S 1G3IA 3FTEA 4MM3B 4L6V6 2M60A 4LGYA 2JNHA 1EIJA 2XSZD 4GRIA 1LV7A 2R45A 3QWLA 1XXHA 4FCTA 1L2CA 1R7RA 4JI5M 3D8BA 2LNHC 1ORYB 1G8PA 2DWMA 3B7ZA 5E26A 3UGJA 3GPXA 2YNMD 1J7KA 3VLFB 5KO3A 4AKGA 2DZLA 1ZMVA 3OTOM 3GQ3A 2DAKA 2C99A 3DFZA 1K82A 2N35A 2QENA 1V34A 4I5SA 2R62A 2CWBA 1IXSB 3U6SA 1R2YA 1ZV1A 3KFUG 4Z8XA 1NSFA 3ZC7B 1H6UA 3R9XB 1OAIA 2Y0QA 3LCVB 4RNAA 3F92A 5GKNA 2O25A 1GVNA 4NXNM 2NQ8C 8CATA 4B3MM 3TWLA 2Q2EB 1DGHB 4PD2A 1MU5A 2A5YB 2HKJA 1KFVA 2J5YA 4BLCA 3T15A 3GPUA 4NXMM 5JI3E 4FD2A 4CGYB 2OPFA 3U6CA 4B08A 4B7FA 3E9SA 1N36M 5DFLA 5DYGA 1MJGM 1IY0A 3FUTA 4AI6A 1T3TA 1AUAA 4QHTA 2Y0TA 5C18A 3E46A 3K2LA 2G8LA 2DAGA 2UXBM 4K0KM 3L28A 4M9ZA 1V33A 1NHGC 3B89A 1E94E 1JR3E 3IECA 4DBGB 3U6DA 2HL7A 1DO0A 4FW9A 3GPPA 4M0DA 1WGNA 1WR1B 1Q3BA 2F5SA 2YR0A 1XNQM 1J5EM 2VDBB 1G71A 5FTMA 4MGHA 3TL4X 1C1KA 2HCBA 3U6OA 1D0LA 1DO2A 3A98B 1QUTA 3CTWB 3H4JA 5A2QS 2J7NA 4QNRA 1NV8A 2CV0A 2R4EA 4GIPA 3ZQJA 2OOAA 1N75A 2KEBA 3KSXA 1NY6A 3FUXA 4GC9A 3KP0E 2QBYB 4MGZE 3SHFA 3ILKA 2KDLA 2DXIA 3SARA 3HHXA 2Z3XA 4DUZM 1Y8GA 1CUKA 3SAUA 4I4LA 5DYIA 4LY6A 4LJ6A 5KPZA 3AV0A 1IQPA 1VG5A 3B74A 2K0BX 4KO8A 4L15A 4DV2M 1HR0M 1NJFA 2DHRA 1VQ1A 3KOXE 4BB9A 1TGUA 2CHGA 3DA1A 4F1IA 2BJVA 4JV5M 4KLNA 5EP3A 1YE9A 3PFIA 5EQTA 4NL4H 3E21A 1E9SA 4NSRA 2UUCM 1KYIA 2V1CA 2QNJA 3U60A 3VK8A 4DR6M 3L2AA 1Q39A 2EA0A 2BWBA 3LCUA 2FNAA 4QHSA 2F5NA 2RKOA 2V1UA 1OFHA 2EUCA 1QAQA 3Q8GA 4F2LA 3T1HM 1XMOM 1QDRA 3SHGB 5ITXE 2DI0A 2WSCF 4QOZC 3GPYA 5DNYA 4AW4A 4LF7M 3PNVA 2F5PA 1TTEA 2L09A 3QAUA 4LJAA 1MX0A 3PXGA 1NY5A 1RU3A 4NC6A 4B7GA 2UUAM 1TH2A 3GLIB 1HQCA 2DENA 2OO9A 3BOSA 2G5GX 3I01M 4LJ5A 2FFJA 2QP9X 1PJIA 4LF6M 3GLHA 1OQYA 2QCUA 4JXJA 4LGMA 2QPAA 4B3RM 2JZ0A 3K9OA 3AOGA 2LWXA 4AG5A 4FCVA 3HX3A 1WHCA 2V6ZM 3J27B 4B7HA 1VDDA 2CV1A 4FWGA 2R44A 5KQ8A 4LF8M 5EXSA 3HHYA 1XMQM 3HZJA 4MGYE 1DGFA 3U5ZA 4DR2M 2UUBM 1J09A 1R5LA 3T1YM 3TWKA 1GLNA 1XXHB 1R2ZA 1PJQA 1WGLA 1K3WA 4LG2A 2ZAMA 1Z59A 1VDLA 2ZTCA 2CHQA 3I04M 5EJCA 4ZPXA 3UK6A 2EKFA 3AKZA 4FWDA 5C1BA 1QYRA 1XNRM 3TE6A 1EE8A 1QQWA 2H5XA 2DNAA 3B9PA 2DZOB 3GLHE 2LVNC 3LVWA 4I81A 2XF3A 4G4NA 1F4IA 1R4GA 3K8ZA 3I51A 3FE3A 4UN2B 3MHVC 2O5RA 3E4RA 4B3TM 3FYDA 3GLIE 2DVWB 1YUBA 2DHYA 4IBJA 1YLAA 4X64M 1UFZA 2DAMA 3R8FA 1OIPA 2L4FA 2XEPA 2ZTDA 2DWZB 1HNWM 1N33M 4DV3M 3ZH9B 1QVRA 4JI6M 1QUSA 4IBKA 3FTCA 1HQYE 1WJ7A 3VDUA 2C9OA 2QHOB 2GQFA 4HEOA 3L27A 4M9XA 4QOSA 4JI4M 3KOWE 4DR3M 1ZMWA 3LW5F 4LRSA 3T38A 4AQYM 4G3OA 1TDZA 1V92A 1BVSA 1IXZA 2R46A 5BPVA 3IG5A 3LQRA 2F5OA 1L1ZA 2K6BA 3HU3A 2VIIA 4HLQA 1IY2A 1PJTA 4Z6YA 4G6ZA 4DR5M 1XXHE 2LVPC 3HHWA 2J7OA 3KP1E 4JN6A 2BNKA 3C3DA 3Q8XA 4LJ9A 4LZJA 1QZEA 4XBOA 3K1JA 3GO8A 2JY8A 4MGIE 3EIHA 4Q7JA 3FTDA 2MJ5B 3AOEC 1QANA 4IJFA 3B7NA 1WIVA 2WSFF 4QNMA 3U6QA 1SG9A 3TWMA 2JUJA 1IN8A 2E5LM 3J7AS 2LXEA 4GKKM 2CEAA 3J2PB 3MJ5A 4MH0E 1PM5A 2DAIA 1IBKM 3FYCA 2G3QA 3FKEA 3M7GA 4OVZA 1ZQ9A 3L29A 5KPRA 4DV6M 2CFOA 3GLFA 1GO5A 1TR8A 4LFCM 4DV1M 3SMPA 1G59A 4TUWA 2CP8A 3GQ5A 1Z5CA 2JWSA 2VF8A 5BR8M 2JXNA
chains in the Genus database with same CATH topology
1EFUB 2DI0A 2JP7A 1T6OA 1P3QQ 2JZ1A 2KNVA 4R71A 2OOBA 1TTEA 1OTRA 1DV0A 2KHHA 5JI2E 2LVAA 1VEGA 2DENA 2HAKA 2LBCA 2OO9A 2RRUA 3FRHA 2L2DA 1G3IA 3GLFE 1OQYA 2JNHA 1IXSA 2JZ0A 3K9OA 2MROB 2LTUA 2DAEA 1WHCA 2HWJA 2WZJA 2DZLA 1ZMVA 1ZMUA 2DAKA 2B3TA 2CWBA 1ZV1A 1T43A 4WP2A 1WGLA 1OAIA 3LCVB 1VDLA 2ZTCA 3F92A 2O25A 2EKFA 1IFYA 2H5XA 2DNAA 2JY5A 3GLHE 2LVNC 2MGWA 1F4IA 1R4GA 3FE3A 4UN2B 3IHPA 2DKLA 3GLIE 2DHYA 5DFLA 1YLAA 2DAMA 1UFZA 2QSFX 2R0IA 2L4FA 2ZTDA 3FRIA 3E46A 2DAGA 1HQYE 1WJ7A 3B89A 1E94E 1JR3E 2QHOB 3IECA 4DBGB 4HEOA 2LVQD 1DO0A 1WGNA 1WR1B 2MR9A 1ZMWA 3K9PA 3T6PA 4G3OA 2BWEA 1V92A 2K9DA 1BVSA 1DO2A 3H4JA 2KNAA 1NV8A 2KNZA 2L4EA 4GEWA 3GLGE 1XB2B 2OOAA 1AIPC 2JY6B 1XXHE 2LVOC 2LVPC 1OKSA 1NV9A 1G4AE 1MN3A 1QZEA 2JY8A 4Q7JA 1HT2E 1VEKA 2EKKA 2MJ5B 1Y8GA 1CUKA 2JY7A 1HT1E 1WIVA 1VG5A 1SG9A 2K0BX 2JUJA 1VEJA 2EJSA 1VQ1A 1HJPA 1A5TA 4F1IA 2DAIA 1Q02A 3MMPA 1G41A 2G3QA 3E21A 1KYIA 1GO5A 1TR8A 2QNJA 1C7YA 2BWBA 3LCUA 2CP8A 1IM2A 4F2LA 1PGYA 3BBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFU B;  2DI0 A;  2JP7 A;  1T6O A;  1P3Q Q;  2JZ1 A;  2KNV A;  4R71 A;  2OOB A;  1TTE A;  1OTR A;  1DV0 A;  2KHH A;  5JI2 E;  2LVA A;  1VEG A;  2DEN A;  2HAK A;  2LBC A;  2OO9 A;  2RRU A;  3FRH A;  2L2D A;  1G3I A;  3GLF E;  1OQY A;  2JNH A;  1IXS A;  2JZ0 A;  3K9O A;  2MRO B;  2LTU A;  2DAE A;  1WHC A;  2HWJ A;  2WZJ A;  2DZL A;  1ZMV A;  1ZMU A;  2DAK A;  2B3T A;  2CWB A;  1ZV1 A;  1T43 A;  4WP2 A;  1WGL A;  1OAI A;  3LCV B;  1VDL A;  2ZTC A;  3F92 A;  2O25 A;  2EKF A;  1IFY A;  2H5X A;  2DNA A;  2JY5 A;  3GLH E;  2LVN C;  2MGW A;  1F4I A;  1R4G A;  3FE3 A;  4UN2 B;  3IHP A;  2DKL A;  3GLI E;  2DHY A;  5DFL A;  1YLA A;  2DAM A;  1UFZ A;  2QSF X;  2R0I A;  2L4F A;  2ZTD A;  3FRI A;  3E46 A;  2DAG A;  1HQY E;  1WJ7 A;  3B89 A;  1E94 E;  1JR3 E;  2QHO B;  3IEC A;  4DBG B;  4HEO A;  2LVQ D;  1DO0 A;  1WGN A;  1WR1 B;  2MR9 A;  1ZMW A;  3K9P A;  3T6P A;  4G3O A;  2BWE A;  1V92 A;  2K9D A;  1BVS A;  1DO2 A;  3H4J A;  2KNA A;  1NV8 A;  2KNZ A;  2L4E A;  4GEW A;  3GLG E;  1XB2 B;  2OOA A;  1AIP C;  2JY6 B;  1XXH E;  2LVO C;  2LVP C;  1OKS A;  1NV9 A;  1G4A E;  1MN3 A;  1QZE A;  2JY8 A;  4Q7J A;  1HT2 E;  1VEK A;  2EKK A;  2MJ5 B;  1Y8G A;  1CUK A;  2JY7 A;  1HT1 E;  1WIV A;  1VG5 A;  1SG9 A;  2K0B X;  2JUJ A;  1VEJ A;  2EJS A;  1VQ1 A;  1HJP A;  1A5T A;  4F1I A;  2DAI A;  1Q02 A;  3MMP A;  1G41 A;  2G3Q A;  3E21 A;  1KYI A;  1GO5 A;  1TR8 A;  2QNJ A;  1C7Y A;  2BWB A;  3LCU A;  2CP8 A;  1IM2 A;  4F2L A;  1PGY A;  3BBZ A; 
#chains in the Genus database with same CATH topology
 1DGH A;  3I4V A;  2Y20 A;  4ANR A;  2JP7 A;  2KRU A;  1IBM M;  3FUW A;  2JZ1 A;  4R71 A;  4FWH A;  3RGS A;  5E6J A;  2R65 A;  3RGP A;  3DZD A;  3WHL A;  3GP1 A;  2VQF M;  3U60 B;  1DV0 A;  5EXP A;  2H1R A;  4JYA M;  5EXX A;  2LVA A;  4IJE A;  2I7N A;  2LBC A;  3KOY E;  5ITY A;  1JB0 F;  2KW0 A;  3SAS A;  2Y21 A;  3UJN A;  4PT5 A;  3TPZ A;  3GLG A;  2X8A A;  1GJT A;  3GLF E;  4DV7 M;  3A45 A;  2QQ8 A;  5L8R F;  2X49 A;  1N34 M;  3THG A;  1QZM A;  2XFS A;  1DGG A;  2LTU A;  5EXT A;  4PDI A;  5H37 D;  4DUY M;  3U6E A;  2HWJ A;  2C5R A;  1K3X A;  2WZJ A;  3AJI B;  4OX9 M;  2YQZ A;  3C9P A;  4NOO B;  5KQD A;  3AL0 C;  4GHL A;  1Z6T A;  1ZMU A;  3VK7 A;  3GLH B;  4LFB M;  2CE7 A;  4JI0 M;  4X65 M;  1D0K A;  1T43 A;  2Z7J A;  2FH0 A;  4WP2 A;  2FOI C;  1PJS A;  2VQE M;  4LJ4 A;  4M9S A;  2RGH A;  1IBL M;  3KDS E;  2P5T A;  1GJS A;  1TH4 A;  5EP1 A;  3SYL A;  3U6M A;  3GRU A;  1IFY A;  2JY5 A;  3U5Z B;  4KT0 F;  3I4Y A;  1D2N A;  2KA6 B;  4L4U A;  1FJG M;  4AG6 A;  3IHP A;  1JQJ C;  2D7E A;  2C9C A;  2DKL A;  3ZCB B;  1SXJ A;  1LTM A;  4IIW A;  5ITU A;  4DR7 M;  1E9R A;  2QSF X;  4GIT A;  3AFH A;  4A3V B;  2ERC A;  2R0I A;  4DR4 M;  4XGI A;  3FUV A;  1X37 A;  2FE8 A;  4AKI A;  1Z5B A;  3GRV A;  2KXE A;  2R4J A;  1NVM A;  1QDT A;  4NSO B;  3NBX X;  4LCB A;  3JAM S;  1IY1 A;  2CHV A;  3U6L A;  4LF9 M;  4GH9 A;  2UXC M;  2C96 A;  1OAO C;  4P16 A;  2MR9 A;  3T6P A;  1QAO A;  1WXQ A;  2K47 A;  2L7H A;  2DWL A;  3CF0 A;  1PJJ A;  4FVM A;  5LMN M;  4RKU F;  4LJ8 A;  2UU9 M;  4GHA A;  1PRB A;  1W5T A;  3VKH A;  2KNA A;  2KNZ A;  2L4E A;  4GEW A;  1IN5 A;  3W68 A;  1D0M A;  1AIP C;  3CGW A;  3HHZ A;  4XK8 F;  2LVO C;  3D8L A;  1I94 M;  2F4V M;  2ZAN A;  1SXJ E;  4MGK E;  4Y28 F;  1NV9 A;  1G4A E;  3H4M A;  3W67 A;  1Q3C A;  3IG8 A;  4HL4 A;  4NRV A;  1HT2 E;  1VEK A;  2EKK A;  4CIZ A;  3PVS A;  2JY7 A;  3NBI A;  4LRT A;  2VF7 A;  3HJ8 A;  1HT1 E;  1NNU C;  4R3D A;  5IRE B;  5FTL A;  1HNZ M;  5IWA M;  3UMM A;  1GKI A;  1XHB A;  3SYK A;  1HJP A;  3U61 A;  1A5T A;  1UM8 A;  3HU1 A;  3J80 S;  2EO2 A;  3HU2 A;  1G41 A;  4I8O A;  2DZN B;  4G4Q A;  1XC8 A;  3RFW A;  1YSY A;  2KZU A;  1GAB A;  4D80 A;  3LMM A;  5FLX S;  4RF1 A;  2KZS A;  1N77 A;  3V76 A;  3FTF A;  3W0L B;  4LF4 M;  2CUZ A;  1GL6 A;  4OW0 A;  1PGY A;  1EFU B;  5IT9 S;  5ITR A;  1ZAE A;  1IXR C;  4D81 A;  3HGI A;  1OJL A;  4OVZ B;  2KNV A;  4IBB A;  1JR3 A;  2JA2 A;  2RGO A;  2X4A A;  2D7H A;  4W5W A;  5ITT A;  2OOB A;  3GLF B;  3DOA A;  4YY3 M;  4OU7 A;  2O01 F;  5FSW A;  4CJ6 A;  2ZBK B;  5JI2 E;  2LHC A;  4IBE A;  1VEG A;  5F3W A;  4X62 M;  1OFI A;  2RRU A;  4AKH A;  1XWI A;  3CF2 A;  3FRH A;  2L2D A;  4L78 A;  2GNO A;  3KVW A;  3K92 A;  3SFZ A;  3GRR A;  1IXS A;  5EP4 A;  3TQS A;  1L8Q A;  2C98 A;  4DV5 M;  4WW0 A;  1R6B X;  5IZ7 D;  4IBF A;  2MRO B;  4LFA M;  2XFT A;  3HJS A;  1TDH A;  2DAE A;  2QZ4 A;  4G4O A;  1TF0 B;  4RF0 A;  4M0W A;  1E32 A;  4JI3 M;  3SAW A;  1OIZ A;  2KRK A;  4GMQ A;  3B7Q A;  4LJ7 A;  3QYB A;  3GLG B;  2B3T A;  4DV4 M;  3VKG A;  4JI8 M;  2LHG A;  2XSZ A;  2HHH M;  2YFQ A;  1SXJ C;  1W5S A;  3FUU A;  1Z5A A;  1NO1 A;  4IBD A;  1SXJ D;  4S12 A;  3C58 A;  4GKJ M;  3GRY A;  4ITQ A;  3W0F A;  2ZAO A;  3HWS A;  3U6P A;  2M5Z A;  3GQ4 A;  1I4W A;  4REZ A;  3RE8 A;  3VFD A;  2D7G A;  4CIS A;  3KS8 A;  2MGW A;  4MB7 A;  4WUR A;  3SBJ A;  3HJQ A;  2I7P A;  4AZF A;  2CRU A;  3HY5 A;  1QAM A;  4JI7 M;  3MK6 A;  2AHM A;  5ITX A;  3PNY A;  4PCZ A;  3SMS A;  4KOD A;  3FRI A;  3LQQ A;  4IBG A;  1TH3 A;  3CF6 E;  4II7 A;  4IBC A;  4GC5 A;  5ITQ A;  1L2B A;  1S3S A;  3NWL A;  2LVQ D;  2W82 A;  2QBY A;  3FD9 A;  3K9P A;  1SXJ B;  2BWE A;  4PDG A;  2OQ4 A;  2K9D A;  3QYE A;  3WHK A;  2WSE F;  2L6O A;  2R6F A;  3J7B A;  3KS4 A;  5KPT A;  2LH0 A;  4IBI A;  4JI2 M;  3VDP A;  3AOE A;  5FTN A;  3GLG E;  4EIW A;  3L26 A;  1XB2 B;  4G4R A;  3M0E A;  1IN6 A;  2JY6 B;  2L7I A;  2XZU A;  1GL7 A;  1OKS A;  1NJG A;  3EIE A;  3SAT A;  2FS1 A;  1MN3 A;  3KOZ E;  5LMU M;  2Z4R A;  2CV2 A;  4NRW A;  3A46 A;  2F5Q A;  1IN4 A;  2DWN A;  3SC3 A;  2R18 A;  2APL A;  3C3E A;  3JR5 A;  1L1T A;  4B3S M;  1VEJ A;  2XH9 A;  2EJS A;  1HNX M;  4FCW A;  2ZM6 M;  3UZU A;  4L16 A;  4DR1 M;  4KHP M;  5FTK A;  1N78 A;  4LZZ A;  4BBA A;  1Q02 A;  2XGN A;  3LVV A;  3MMP A;  5FTJ A;  1FNN A;  1IN7 A;  1JR3 D;  3HKP A;  1NHW C;  2UXD M;  3KW6 A;  1C7Y A;  1N32 M;  5EP2 A;  3A42 A;  4P17 A;  1IM2 A;  2Z8Y M;  2MH8 A;  3JR4 A;  3GLI A;  3M6A A;  4YHH M;  3U61 B;  2BJW A;  7CAT A;  2XLJ A;  1KSF X;  3BBZ A;  4JI1 M;  3KSJ A;  3KXE C;  1T6O A;  4X66 M;  4LF5 M;  1DGB A;  1P3Q Q;  4L8R C;  2Z4S A;  4CHT B;  4DV0 M;  4D82 A;  1OTR A;  3L25 A;  2KHH A;  2XZF A;  1L2D A;  3BXW A;  3SAV A;  2HAK A;  1NNJ A;  4R7G A;  3J81 S;  1G3I A;  3FTE A;  4MM3 B;  4L6V 6;  2M60 A;  4LGY A;  2JNH A;  1EIJ A;  2XSZ D;  4GRI A;  1LV7 A;  2R45 A;  3QWL A;  1XXH A;  4FCT A;  1L2C A;  1R7R A;  4JI5 M;  3D8B A;  2LNH C;  1ORY B;  1G8P A;  2DWM A;  3B7Z A;  5E26 A;  3UGJ A;  3GPX A;  2YNM D;  1J7K A;  3VLF B;  5KO3 A;  4AKG A;  2DZL A;  1ZMV A;  3OTO M;  3GQ3 A;  2DAK A;  2C99 A;  3DFZ A;  1K82 A;  2N35 A;  2QEN A;  1V34 A;  4I5S A;  2R62 A;  2CWB A;  1IXS B;  3U6S A;  1R2Y A;  1ZV1 A;  3KFU G;  4Z8X A;  1NSF A;  3ZC7 B;  1H6U A;  3R9X B;  1OAI A;  2Y0Q A;  3LCV B;  4RNA A;  3F92 A;  5GKN A;  2O25 A;  1GVN A;  4NXN M;  2NQ8 C;  8CAT A;  4B3M M;  3TWL A;  2Q2E B;  1DGH B;  4PD2 A;  1MU5 A;  2A5Y B;  2HKJ A;  1KFV A;  2J5Y A;  4BLC A;  3T15 A;  3GPU A;  4NXM M;  5JI3 E;  4FD2 A;  4CGY B;  2OPF A;  3U6C A;  4B08 A;  4B7F A;  3E9S A;  1N36 M;  5DFL A;  5DYG A;  1MJG M;  1IY0 A;  3FUT A;  4AI6 A;  1T3T A;  1AUA A;  4QHT A;  2Y0T A;  5C18 A;  3E46 A;  3K2L A;  2G8L A;  2DAG A;  2UXB M;  4K0K M;  3L28 A;  4M9Z A;  1V33 A;  1NHG C;  3B89 A;  1E94 E;  1JR3 E;  3IEC A;  4DBG B;  3U6D A;  2HL7 A;  1DO0 A;  4FW9 A;  3GPP A;  4M0D A;  1WGN A;  1WR1 B;  1Q3B A;  2F5S A;  2YR0 A;  1XNQ M;  1J5E M;  2VDB B;  1G71 A;  5FTM A;  4MGH A;  3TL4 X;  1C1K A;  2HCB A;  3U6O A;  1D0L A;  1DO2 A;  3A98 B;  1QUT A;  3CTW B;  3H4J A;  5A2Q S;  2J7N A;  4QNR A;  1NV8 A;  2CV0 A;  2R4E A;  4GIP A;  3ZQJ A;  2OOA A;  1N75 A;  2KEB A;  3KSX A;  1NY6 A;  3FUX A;  4GC9 A;  3KP0 E;  2QBY B;  4MGZ E;  3SHF A;  3ILK A;  2KDL A;  2DXI A;  3SAR A;  3HHX A;  2Z3X A;  4DUZ M;  1Y8G A;  1CUK A;  3SAU A;  4I4L A;  5DYI A;  4LY6 A;  4LJ6 A;  5KPZ A;  3AV0 A;  1IQP A;  1VG5 A;  3B74 A;  2K0B X;  4KO8 A;  4L15 A;  4DV2 M;  1HR0 M;  1NJF A;  2DHR A;  1VQ1 A;  3KOX E;  4BB9 A;  1TGU A;  2CHG A;  3DA1 A;  4F1I A;  2BJV A;  4JV5 M;  4KLN A;  5EP3 A;  1YE9 A;  3PFI A;  5EQT A;  4NL4 H;  3E21 A;  1E9S A;  4NSR A;  2UUC M;  1KYI A;  2V1C A;  2QNJ A;  3U60 A;  3VK8 A;  4DR6 M;  3L2A A;  1Q39 A;  2EA0 A;  2BWB A;  3LCU A;  2FNA A;  4QHS A;  2F5N A;  2RKO A;  2V1U A;  1OFH A;  2EUC A;  1QAQ A;  3Q8G A;  4F2L A;  3T1H M;  1XMO M;  1QDR A;  3SHG B;  5ITX E;  2DI0 A;  2WSC F;  4QOZ C;  3GPY A;  5DNY A;  4AW4 A;  4LF7 M;  3PNV A;  2F5P A;  1TTE A;  2L09 A;  3QAU A;  4LJA A;  1MX0 A;  3PXG A;  1NY5 A;  1RU3 A;  4NC6 A;  4B7G A;  2UUA M;  1TH2 A;  3GLI B;  1HQC A;  2DEN A;  2OO9 A;  3BOS A;  2G5G X;  3I01 M;  4LJ5 A;  2FFJ A;  2QP9 X;  1PJI A;  4LF6 M;  3GLH A;  1OQY A;  2QCU A;  4JXJ A;  4LGM A;  2QPA A;  4B3R M;  2JZ0 A;  3K9O A;  3AOG A;  2LWX A;  4AG5 A;  4FCV A;  3HX3 A;  1WHC A;  2V6Z M;  3J27 B;  4B7H A;  1VDD A;  2CV1 A;  4FWG A;  2R44 A;  5KQ8 A;  4LF8 M;  5EXS A;  3HHY A;  1XMQ M;  3HZJ A;  4MGY E;  1DGF A;  3U5Z A;  4DR2 M;  2UUB M;  1J09 A;  1R5L A;  3T1Y M;  3TWK A;  1GLN A;  1XXH B;  1R2Z A;  1PJQ A;  1WGL A;  1K3W A;  4LG2 A;  2ZAM A;  1Z59 A;  1VDL A;  2ZTC A;  2CHQ A;  3I04 M;  5EJC A;  4ZPX A;  3UK6 A;  2EKF A;  3AKZ A;  4FWD A;  5C1B A;  1QYR A;  1XNR M;  3TE6 A;  1EE8 A;  1QQW A;  2H5X A;  2DNA A;  3B9P A;  2DZO B;  3GLH E;  2LVN C;  3LVW A;  4I81 A;  2XF3 A;  4G4N A;  1F4I A;  1R4G A;  3K8Z A;  3I51 A;  3FE3 A;  4UN2 B;  3MHV C;  2O5R A;  3E4R A;  4B3T M;  3FYD A;  3GLI E;  2DVW B;  1YUB A;  2DHY A;  4IBJ A;  1YLA A;  4X64 M;  1UFZ A;  2DAM A;  3R8F A;  1OIP A;  2L4F A;  2XEP A;  2ZTD A;  2DWZ B;  1HNW M;  1N33 M;  4DV3 M;  3ZH9 B;  1QVR A;  4JI6 M;  1QUS A;  4IBK A;  3FTC A;  1HQY E;  1WJ7 A;  3VDU A;  2C9O A;  2QHO B;  2GQF A;  4HEO A;  3L27 A;  4M9X A;  4QOS A;  4JI4 M;  3KOW E;  4DR3 M;  1ZMW A;  3LW5 F;  4LRS A;  3T38 A;  4AQY M;  4G3O A;  1TDZ A;  1V92 A;  1BVS A;  1IXZ A;  2R46 A;  5BPV A;  3IG5 A;  3LQR A;  2F5O A;  1L1Z A;  2K6B A;  3HU3 A;  2VII A;  4HLQ A;  1IY2 A;  1PJT A;  4Z6Y A;  4G6Z A;  4DR5 M;  1XXH E;  2LVP C;  3HHW A;  2J7O A;  3KP1 E;  4JN6 A;  2BNK A;  3C3D A;  3Q8X A;  4LJ9 A;  4LZJ A;  1QZE A;  4XBO A;  3K1J A;  3GO8 A;  2JY8 A;  4MGI E;  3EIH A;  4Q7J A;  3FTD A;  2MJ5 B;  3AOE C;  1QAN A;  4IJF A;  3B7N A;  1WIV A;  2WSF F;  4QNM A;  3U6Q A;  1SG9 A;  3TWM A;  2JUJ A;  1IN8 A;  2E5L M;  3J7A S;  2LXE A;  4GKK M;  2CEA A;  3J2P B;  3MJ5 A;  4MH0 E;  1PM5 A;  2DAI A;  1IBK M;  3FYC A;  2G3Q A;  3FKE A;  3M7G A;  4OVZ A;  1ZQ9 A;  3L29 A;  5KPR A;  4DV6 M;  2CFO A;  3GLF A;  1GO5 A;  1TR8 A;  4LFC M;  4DV1 M;  3SMP A;  1G59 A;  4TUW A;  2CP8 A;  3GQ5 A;  1Z5C A;  2JWS A;  2VF8 A;  5BR8 M;  2JXN A; 
#chains in the Genus database with same CATH homology
 1EFU B;  2DI0 A;  2JP7 A;  1T6O A;  1P3Q Q;  2JZ1 A;  2KNV A;  4R71 A;  2OOB A;  1TTE A;  1OTR A;  1DV0 A;  2KHH A;  5JI2 E;  2LVA A;  1VEG A;  2DEN A;  2HAK A;  2LBC A;  2OO9 A;  2RRU A;  3FRH A;  2L2D A;  1G3I A;  3GLF E;  1OQY A;  2JNH A;  1IXS A;  2JZ0 A;  3K9O A;  2MRO B;  2LTU A;  2DAE A;  1WHC A;  2HWJ A;  2WZJ A;  2DZL A;  1ZMV A;  1ZMU A;  2DAK A;  2B3T A;  2CWB A;  1ZV1 A;  1T43 A;  4WP2 A;  1WGL A;  1OAI A;  3LCV B;  1VDL A;  2ZTC A;  3F92 A;  2O25 A;  2EKF A;  1IFY A;  2H5X A;  2DNA A;  2JY5 A;  3GLH E;  2LVN C;  2MGW A;  1F4I A;  1R4G A;  3FE3 A;  4UN2 B;  3IHP A;  2DKL A;  3GLI E;  2DHY A;  5DFL A;  1YLA A;  2DAM A;  1UFZ A;  2QSF X;  2R0I A;  2L4F A;  2ZTD A;  3FRI A;  3E46 A;  2DAG A;  1HQY E;  1WJ7 A;  3B89 A;  1E94 E;  1JR3 E;  2QHO B;  3IEC A;  4DBG B;  4HEO A;  2LVQ D;  1DO0 A;  1WGN A;  1WR1 B;  2MR9 A;  1ZMW A;  3K9P A;  3T6P A;  4G3O A;  2BWE A;  1V92 A;  2K9D A;  1BVS A;  1DO2 A;  3H4J A;  2KNA A;  1NV8 A;  2KNZ A;  2L4E A;  4GEW A;  3GLG E;  1XB2 B;  2OOA A;  1AIP C;  2JY6 B;  1XXH E;  2LVO C;  2LVP C;  1OKS A;  1NV9 A;  1G4A E;  1MN3 A;  1QZE A;  2JY8 A;  4Q7J A;  1HT2 E;  1VEK A;  2EKK A;  2MJ5 B;  1Y8G A;  1CUK A;  2JY7 A;  1HT1 E;  1WIV A;  1VG5 A;  1SG9 A;  2K0B X;  2JUJ A;  1VEJ A;  2EJS A;  1VQ1 A;  1HJP A;  1A5T A;  4F1I A;  2DAI A;  1Q02 A;  3MMP A;  1G41 A;  2G3Q A;  3E21 A;  1KYI A;  1GO5 A;  1TR8 A;  2QNJ A;  1C7Y A;  2BWB A;  3LCU A;  2CP8 A;  1IM2 A;  4F2L A;  1PGY A;  3BBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...