2BWBA

Crystal structure of the uba domain of dsk2 from s. cerevisiae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bwbA00
2KNVA 1HQYE 1V92A 4WP2A 1VEKA 1NV8A 1XB2B 1NV9A 1VEJA 1WIVA 2K9DA 3T6PA 2JY7A 2DI0A 2L4EA 2H5XA 4DBGB 5JI2E 2EKFA 1VQ1A 1IFYA 1DO0A 3H4JA 4G3OA 1A5TA 2LBCA 2LVQD 1OQYA 3GLHE 3GLGE 2JY6B 2HAKA 1UFZA 2LVOC 2JP7A 1MN3A 2QNJA 1ZV1A 1Y8GA 2RRUA 1OKSA 2JY5A 3E21A 4GEWA 2JZ1A 1CUKA 2MGWA 3FRHA 2DAMA 2LVPC 1WHCA 2O25A 1SG9A 1T43A 2LVAA 2EJSA 3IECA 2OO9A 1ZMUA 2CWBA 2JZ0A 1VG5A 2CP8A 2ZTCA 3F92A 2JUJA 1EFUB 2B3TA 1PGYA 3LCUA 2L2DA 1DO2A 2DZLA 4HEOA 1R4GA 2DENA 1Q02A 1WR1B 1G3IA 2MJ5B 1GO5A 1BVSA 2JY8A 1ZMWA 1WGLA 2EKKA 1HT2E 1VDLA 1VEGA 3LCVB 3BBZA 2DNAA 2MROB 4R71A 2OOAA 1KYIA 1WJ7A 1IXSA 2L4FA 4UN2B 3GLIE 1YLAA 1G41A 2G3QA 2DAGA 1DV0A 2QSFX 2DAEA 2R0IA 1ZMVA 2DKLA 2HWJA 1WGNA 3E46A 1T6OA 3K9OA 1QZEA 1E94E 2BWBA 2DAKA 4Q7JA 1TTEA 1IM2A 2JNHA 1P3QQ 2KNAA 2MR9A 2WZJA 2DAIA 2LTUA 3MMPA 5DFLA 1HT1E 3IHPA 4F1IA 2LVNC 1OAIA 3B89A 3GLFE 2KNZA 4F2LA 2QHOB 1XXHE 3FRIA 2KHHA 1AIPC 1G4AE 3K9PA 1OTRA 2K0BX 1C7YA 1HJPA 1F4IA 1TR8A 1JR3E 2OOBA 2BWEA 2DHYA 3FE3A 2ZTDA
chains in the Genus database with same CATH superfamily
2ZBKB 2JWSA 4AG5A 1V92A 3VDUA 1E9RA 1PJJA 1NY6A 4IBCA 3U6EA 2JY7A 4FCVA 4IBDA 2L6OA 1D0KA 2H5XA 4L6V6 4M9XA 5DYIA 2P5TA 2QP9X 1QUTA 4FWHA 2CFOA 1SXJB 4JI2M 3SC3A 4AQYM 3HHZA 4PDIA 3JR5A 3GPPA 2V6ZM 1DO0A 3HU1A 3HX3A 3SHGB 4DR3M 2Y0TA 4G3OA 4DR7M 1AUAA 4AKGA 1OQYA 3AOGA 3PFIA 1R2ZA 2KA6B 1ZAEA 4L8RC 2C96A 4R3DA 4XBOA 4BB9A 3SATA 1MN3A 3QAUA 4NSOB 1ZV1A 3CF6E 3M6AA 4GEWA 3SMSA 1IY2A 4LJ7A 2Z7JA 3D8BA 4LJ4A 3J27B 4MH0E 2Z3XA 2L7HA 4JI3M 3J7BA 3FD9A 3GRVA 4CGYB 1L2BA 2O25A 2UUBM 4IBGA 2OO9A 3L29A 1XMOM 1NNUC 1ZMUA 1OAOC 2CWBA 1N75A 3HY5A 5ITXE 3THGA 2EO2A 1VG5A 3F92A 3GP1A 1XNQM 4FVMA 4B7GA 5ITUA 2JUJA 4LZZA 1K82A 2XEPA 3UZUA 2B3TA 1PGYA 2CEAA 5EXSA 4AW4A 3GRUA 2DZLA 3FUWA 3HKPA 1RU3A 1IN4A 7CATA 4S12A 2VQEM 1L2CA 1IBKM 1HR0M 2O5RA 3FUXA 4LZJA 2JY8A 5IREB 3K8ZA 3ZH9B 3AKZA 1DGGA 2QPAA 3L2AA 5EJCA 4OU7A 1LV7A 1N36M 2R4JA 1VEGA 3TE6A 4DUYM 4LFAM 3U5ZB 3TPZA 4GHAA 4I4LA 1KYIA 1MX0A 1IXSB 4NSRA 2QBYB 4FWDA 3MK6A 4AZFA 1XXHA 1G41A 2G3QA 2DAGA 5FTMA 3RE8A 2QSFX 2DWNA 4JV5M 4DR6M 3MHVC 4G4NA 5KPZA 1R7RA 1TF0B 1OIPA 4YHHM 1QANA 4LY6A 1Z6TA 1TDHA 3AOEA 5FTNA 2XSZA 5JI3E 5EP2A 3VKGA 2VF7A 1K3XA 2H1RA 4HL4A 2Y20A 3TWLA 3T1HM 4Q7JA 1SXJC 1P3QQ 1SXJD 3AL0C 3SFZA 2KNAA 4IBJA 3HGIA 2X8AA 5KQDA 4D82A 2APLA 1GJSA 1D0MA 5IZ7D 3TWKA 4FWGA 3LW5F 1PJSA 4DR5M 4F1IA 3U6MA 3I4VA 1D2NA 1L1ZA 1GL6A 4B08A 5DYGA 1HQCA 3GLIB 3R9XB 3VDPA 2XH9A 3U61B 3C58A 3FRIA 4G6ZA 3GLHB 5ITYA 5BR8M 4Z6YA 2D7HA 2DHRA 3KW6A 1DGHB 1G4AE 3M7GA 4FCWA 4OX9M 3KVWA 1HNWM 1HNZM 2L09A 3U6SA 5FSWA 3VFDA 2K0BX 3TWMA 1NNJA 1HJPA 1JR3E 3AFHA 1NHWC 3DZDA 3WHKA 4DR1M 1N78A 5FTLA 4W5WA 2BWEA 4LCBA 5EQTA 4AKHA 1HQYE 3SYKA 4M9SA 1NV8A 2R6FA 2K9DA 4REZA 2R46A 4P16A 4MB7A 4JI7M 4CJ6A 1S3SA 1LTMA 3ZQJA 3VK8A 2Z4RA 3L26A 1PJIA 1WXQA 4JYAM 2VIIA 4L78A 2O01F 3TQSA 3CF2A 1C1KA 3B9PA 1W5SA 4RKUF 4B3SM 1A5TA 3GO8A 1H6UA 2LBCA 1E9SA 5FTJA 1D0LA 2XSZD 1X37A 3VKHA 3GLGE 1QQWA 2HAKA 1UFZA 2LVOC 2JP7A 1JR3D 3HWSA 1IBMM 3RFWA 1FJGM 4GKKM 1QYRA 1Y8GA 2Y0QA 2DZNB 3DOAA 3E21A 4IJFA 4IBEA 2BJVA 1TGUA 4RF1A 2CHQA 4QOZC 2CV0A 3U6QA 5IWAM 5GKNA 2Z8YM 4ITQA 1SG9A 2LVAA 4OVZB 3KDSE 3K1JA 3LQRA 5LMUM 3VLFB 3GLFA 2DWLA 3GRRA 3HHWA 1K3WA 2CRUA 2YQZA 2CV1A 3E4RA 5ITQA 3C3EA 3FTDA 4Y28F 3FTEA 2MH8A 1TH4A 4G4QA 4B7HA 4FW9A 3GLGB 2F5QA 2CE7A 1Q02A 1GO5A 4B3MM 2LWXA 2OQ4A 4ANRA 5C18A 3J81S 4R7GA 4FCTA 1ZMWA 4MGHA 2R45A 1J5EM 3FUTA 1QVRA 1WGLA 1XMQM 4QHTA 3WHLA 1HT2E 1VDLA 3I51A 1Z5CA 3GRYA 3L27A 5FLXS 1TH2A 3EIEA 2DNAA 4M9ZA 1KSFX 3NBIA 4KODA 4LJ5A 2UXBM 3SAWA 1WJ7A 3SBJA 1IXSA 3T15A 2OPFA 4UN2B 2C9CA 3GLIE 1T3TA 1MJGM 4KLNA 1XXHB 4K0KM 4P17A 2Q2EB 3U6OA 2LHCA 3SAUA 4LF9M 2KW0A 3BOSA 3IG8A 4IBKA 4JI5M 1IN5A 3E46A 1QAMA 3HU3A 1QZEA 2BWBA 2XFTA 3UK6A 2DAKA 1N34M 4X66M 2R18A 1NVMA 2V1UA 2JNHA 3U6DA 2C9OA 1OIZA 4EIWA 3L28A 2QCUA 2FOIC 3SMPA 3W0FA 4DV0M 2F5SA 2DAIA 2LTUA 3EIHA 3MMPA 4LF8M 5A2QS 4IBIA 3QYEA 5LMNM 2FE8A 1YE9A 3IHPA 1YUBA 4ZPXA 4DR2M 3IG5A 1OAIA 1J7KA 2KEBA 3FE3A 3B7NA 5E6JA 2DXIA 2XZFA 2YFQA 4NRWA 2A5YB 2KDLA 4LJ6A 1GJTA 1IQPA 3KSJA 4M0DA 1I4WA 3K9PA 3U5ZA 1OTRA 4D80A 1F4IA 3KFUG 3I4YA 3FTCA 1R5LA 4NC6A 4LG2A 1TDZA 2DHYA 2KZSA 1G59A 2X4AA 1QZMA 2M60A 2V1CA 4GITA 4WP2A 1Q3CA 3QYBA 2BJWA 3T1YM 4JN6A 2N35A 1YSYA 2C5RA 1PRBA 4CHTB 2C99A 2CHVA 3AJIB 3CF0A 4KHPM 4LFBM 4DBGB 5JI2E 3UJNA 1R2YA 1W5TA 2LHGA 3GLFB 4GIPA 4YY3M 4JI0M 5BPVA 4AKIA 1JB0F 3H4JA 3KXEC 1E32A 1OFHA 3NWLA 3UGJA 2F5NA 3GPYA 2JY6B 4BBAA 4DV7M 3UMMA 4B3RM 4DV3M 1VDDA 1HNXM 3M0EA 1IY0A 2QNJA 2YNMD 4KO8A 4WW0A 3TL4X 2VQFM 3QWLA 2JZ1A 2F5PA 2LH0A 2ZAOA 2EA0A 4I81A 2QZ4A 3FRHA 2D7EA 2R65A 3U60A 3W0LB 1WHCA 3GQ5A 3I01M 2EJSA 3I04M 2FNAA 4X62M 3KOWE 1NY5A 2JZ0A 3Q8XA 4LJ9A 1SXJE 1R6BX 4MGYE 3LQQA 2Z4SA 3FTFA 2QQ8A 3K92A 2FS1A 3KOYE 3LVWA 4HEOA 1R4GA 2DENA 1EE8A 2HL7A 3HU2A 1G8PA 3JR4A 3U6LA 2KXEA 1G3IA 2MJ5B 2Y21A 1XWIA 1IXRC 1Z59A 2LNHC 2WSCF 5KPRA 2FFJA 3FKEA 2HCBA 4Z8XA 1IN8A 3KOXE 3KOZE 4LGMA 4PCZA 4DR4M 3ZCBB 2G5GX 3KS4A 2ZM6M 1GLNA 1DGBA 3Q8GA 4LGYA 3B7ZA 4MGZE 1DGFA 2W82A 2XGNA 2DWZB 4G4OA 5EP3A 1YLAA 2XFSA 4GC5A 2DAEA 1ZMVA 3H4MA 1NHGC 1NJFA 4TUWA 1WGNA 3L25A 1IY1A 1GKIA 3A98B 2LXEA 1JR3A 4OVZA 4KT0F 5C1BA 2E5LM 1SXJA 2X49A 3HJQA 2EUCA 3GQ3A 2F4VM 3FUVA 1IM2A 4G4RA 2RGHA 4JI1M 2I7PA 3J80S 1NJGA 2G8LA 1UM8A 2DZOB 3C3DA 4GRIA 5EXTA 2UUAM 1IBLM 2JA2A 2VF8A 5E26A 1N77A 3GPXA 3SYLA 1HT1E 2NQ8C 3MJ5A 2J7NA 3B89A 8CATA 4GMQA 3GLFE 1PJTA 4GH9A 1XC8A 4NXNM 4IBFA 2KNZA 3PVSA 2UXCM 3U61A 1QAQA 1AIPC 4I5SA 4NL4H 2UUCM 3DA1A 3PNVA 2K47A 4PD2A 4GC9A 4GKJM 2ZANA 3OTOM 1EIJA 1C7YA 1IN7A 3RGSA 1Z5BA 2CHGA 2FH0A 3HHYA 4IBBA 3C9PA 4GHLA 4QNRA 4R71A 4LF6M 2KNVA 1V34A 4L4UA 5DNYA 3SASA 1VEKA 1XB2B 4IIWA 2J7OA 1NV9A 1VEJA 1WIVA 4MGIE 2XF3A 1QDRA 2DI0A 2L4EA 3T6PA 1PJQA 4IJEA 3GLGA 2L7IA 3U6CA 2WSEF 4RF0A 1XNRM 2EKFA 4D81A 3KSXA 1MU5A 4DV5M 4A3VB 2GNOA 3NBXX 1VQ1A 2GQFA 2XLJA 1IFYA 1QDTA 3ZC7B 3E9SA 1DGHA 3RGPA 2AHMA 2LVQD 4NOOB 3GLHE 3LMMA 4JI6M 1I94M 3GPUA 2JXNA 2QBYA 2DVWB 2KRUA 3A45A 4LJ8A 3SARA 1OJLA 1GABA 5IT9S 2ERCA 1G71A 2RRUA 1OKSA 2JY5A 3LVVA 1Q3BA 3HHXA 5KO3A 1CUKA 4HLQA 2MGWA 4DV2M 3AV0A 3GQ4A 4XK8F 2DAMA 2LVPC 1ORYB 5ITXA 1T43A 1IXZA 4MM3B 3IECA 4QHSA 4LJAA 1L1TA 5KQ8A 2KZUA 3DFZA 4DV1M 5FTKA 1NSFA 4NXMM 2ZTCA 2CP8A 4FD2A 4QNMA 3U6PA 4LF4M 1GL7A 5ITRA 1EFUB 4L15A 3AOEC 3LCUA 3R8FA 2YR0A 2L2DA 3HZJA 3K2LA 1DO2A 5EP1A 4WURA 2KRKA 3A42A 3CTWB 3W67A 4NRVA 1WR1B 4II7A 4M0WA 2UU9M 3D8LA 3V76A 1BVSA 2CV2A 3GLIA 3SAVA 5ITTA 4XGIA 4JI4M 3GLHA 2J5YA 2R44A 3HJSA 2EKKA 1IN6A 3FYDA 1ZQ9A 5H37D 1L2DA 3LCVB 2R62A 2HHHM 3BBZA 3FUUA 2DWMA 2MROB 4PDGA 4CIZA 2OOAA 2RKOA 3HJ8A 2BNKA 2L4FA 3KP0E 3CGWA 4CISA 1TH3A 1DV0A 3SHFA 2M5ZA 4L16A 4MGKE 2R0IA 1KFVA 2QENA 2VDBB 2DKLA 1N32M 4LRTA 2HWJA 1QAOA 5EXPA 1T6OA 3K9OA 3W68A 3U60B 4I8OA 5L8RF 2ZAMA 1E94E 4X65M 3B7QA 4QOSA 2R4EA 3T38A 1XHBA 2CUZA 3J2PB 2UXDM 1TTEA 1OFIA 2D7GA 1NO1A 1L8QA 5EXXA 3A46A 4AG6A 2XZUA 3FYCA 4LFCM 4B3TM 2MR9A 4LF5M 5KPTA 3KS8A 3J7AS 2WZJA 4JXJA 4B7FA 4JI8M 4LF7M 2F5OA 5EP4A 3KP1E 5DFLA 4X64M 1QUSA 2K6BA 1J09A 2LVNC 2WSFF 4DV4M 4DUZM 4BLCA 3PXGA 3VK7A 1PM5A 4F2LA 1JQJC 2QHOB 4RNAA 1XXHE 2KHHA 1Q39A 1FNNA 2I7NA 3JAMS 4AI6A 1GVNA 4LRSA 1TR8A 3BXWA 2RGOA 3ILKA 5F3WA 1N33M 1Z5AA 2HKJA 2C98A 4OW0A 1V33A 3PNYA 2OOBA 4PT5A 4DV6M 3B74A 2ZTDA
chains in the Genus database with same CATH topology
2KNVA 1HQYE 1V92A 4WP2A 1VEKA 1NV8A 1XB2B 1NV9A 1VEJA 1WIVA 2K9DA 3T6PA 2JY7A 2DI0A 2L4EA 2H5XA 4DBGB 5JI2E 2EKFA 1VQ1A 1IFYA 1DO0A 3H4JA 4G3OA 1A5TA 2LBCA 2LVQD 1OQYA 3GLHE 3GLGE 2JY6B 2HAKA 1UFZA 2LVOC 2JP7A 1MN3A 2QNJA 1ZV1A 1Y8GA 2RRUA 1OKSA 2JY5A 3E21A 4GEWA 2JZ1A 1CUKA 2MGWA 3FRHA 2DAMA 2LVPC 1WHCA 2O25A 1SG9A 1T43A 2LVAA 2EJSA 3IECA 2OO9A 1ZMUA 2CWBA 2JZ0A 1VG5A 2CP8A 2ZTCA 3F92A 2JUJA 1EFUB 2B3TA 1PGYA 3LCUA 2L2DA 1DO2A 2DZLA 4HEOA 1R4GA 2DENA 1Q02A 1WR1B 1G3IA 2MJ5B 1GO5A 1BVSA 2JY8A 1ZMWA 1WGLA 2EKKA 1HT2E 1VDLA 1VEGA 3LCVB 3BBZA 2DNAA 2MROB 4R71A 2OOAA 1KYIA 1WJ7A 1IXSA 2L4FA 4UN2B 3GLIE 1YLAA 1G41A 2G3QA 2DAGA 1DV0A 2QSFX 2DAEA 2R0IA 1ZMVA 2DKLA 2HWJA 1WGNA 3E46A 1T6OA 3K9OA 1QZEA 1E94E 2BWBA 2DAKA 4Q7JA 1TTEA 1IM2A 2JNHA 1P3QQ 2KNAA 2MR9A 2WZJA 2DAIA 2LTUA 3MMPA 5DFLA 1HT1E 3IHPA 4F1IA 2LVNC 1OAIA 3B89A 3GLFE 2KNZA 4F2LA 2QHOB 1XXHE 3FRIA 2KHHA 1AIPC 1G4AE 3K9PA 1OTRA 2K0BX 1C7YA 1HJPA 1F4IA 1TR8A 1JR3E 2OOBA 2BWEA 2DHYA 3FE3A 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNV A;  1HQY E;  1V92 A;  4WP2 A;  1VEK A;  1NV8 A;  1XB2 B;  1NV9 A;  1VEJ A;  1WIV A;  2K9D A;  3T6P A;  2JY7 A;  2DI0 A;  2L4E A;  2H5X A;  4DBG B;  5JI2 E;  2EKF A;  1VQ1 A;  1IFY A;  1DO0 A;  3H4J A;  4G3O A;  1A5T A;  2LBC A;  2LVQ D;  1OQY A;  3GLH E;  3GLG E;  2JY6 B;  2HAK A;  1UFZ A;  2LVO C;  2JP7 A;  1MN3 A;  2QNJ A;  1ZV1 A;  1Y8G A;  2RRU A;  1OKS A;  2JY5 A;  3E21 A;  4GEW A;  2JZ1 A;  1CUK A;  2MGW A;  3FRH A;  2DAM A;  2LVP C;  1WHC A;  2O25 A;  1SG9 A;  1T43 A;  2LVA A;  2EJS A;  3IEC A;  2OO9 A;  1ZMU A;  2CWB A;  2JZ0 A;  1VG5 A;  2CP8 A;  2ZTC A;  3F92 A;  2JUJ A;  1EFU B;  2B3T A;  1PGY A;  3LCU A;  2L2D A;  1DO2 A;  2DZL A;  4HEO A;  1R4G A;  2DEN A;  1Q02 A;  1WR1 B;  1G3I A;  2MJ5 B;  1GO5 A;  1BVS A;  2JY8 A;  1ZMW A;  1WGL A;  2EKK A;  1HT2 E;  1VDL A;  1VEG A;  3LCV B;  3BBZ A;  2DNA A;  2MRO B;  4R71 A;  2OOA A;  1KYI A;  1WJ7 A;  1IXS A;  2L4F A;  4UN2 B;  3GLI E;  1YLA A;  1G41 A;  2G3Q A;  2DAG A;  1DV0 A;  2QSF X;  2DAE A;  2R0I A;  1ZMV A;  2DKL A;  2HWJ A;  1WGN A;  3E46 A;  1T6O A;  3K9O A;  1QZE A;  1E94 E;  2BWB A;  2DAK A;  4Q7J A;  1TTE A;  1IM2 A;  2JNH A;  1P3Q Q;  2KNA A;  2MR9 A;  2WZJ A;  2DAI A;  2LTU A;  3MMP A;  5DFL A;  1HT1 E;  3IHP A;  4F1I A;  2LVN C;  1OAI A;  3B89 A;  3GLF E;  2KNZ A;  4F2L A;  2QHO B;  1XXH E;  3FRI A;  2KHH A;  1AIP C;  1G4A E;  3K9P A;  1OTR A;  2K0B X;  1C7Y A;  1HJP A;  1F4I A;  1TR8 A;  1JR3 E;  2OOB A;  2BWE A;  2DHY A;  3FE3 A;  2ZTD A; 
#chains in the Genus database with same CATH topology
 2ZBK B;  2JWS A;  4AG5 A;  1V92 A;  3VDU A;  1E9R A;  1PJJ A;  1NY6 A;  4IBC A;  3U6E A;  2JY7 A;  4FCV A;  4IBD A;  2L6O A;  1D0K A;  2H5X A;  4L6V 6;  4M9X A;  5DYI A;  2P5T A;  2QP9 X;  1QUT A;  4FWH A;  2CFO A;  1SXJ B;  4JI2 M;  3SC3 A;  4AQY M;  3HHZ A;  4PDI A;  3JR5 A;  3GPP A;  2V6Z M;  1DO0 A;  3HU1 A;  3HX3 A;  3SHG B;  4DR3 M;  2Y0T A;  4G3O A;  4DR7 M;  1AUA A;  4AKG A;  1OQY A;  3AOG A;  3PFI A;  1R2Z A;  2KA6 B;  1ZAE A;  4L8R C;  2C96 A;  4R3D A;  4XBO A;  4BB9 A;  3SAT A;  1MN3 A;  3QAU A;  4NSO B;  1ZV1 A;  3CF6 E;  3M6A A;  4GEW A;  3SMS A;  1IY2 A;  4LJ7 A;  2Z7J A;  3D8B A;  4LJ4 A;  3J27 B;  4MH0 E;  2Z3X A;  2L7H A;  4JI3 M;  3J7B A;  3FD9 A;  3GRV A;  4CGY B;  1L2B A;  2O25 A;  2UUB M;  4IBG A;  2OO9 A;  3L29 A;  1XMO M;  1NNU C;  1ZMU A;  1OAO C;  2CWB A;  1N75 A;  3HY5 A;  5ITX E;  3THG A;  2EO2 A;  1VG5 A;  3F92 A;  3GP1 A;  1XNQ M;  4FVM A;  4B7G A;  5ITU A;  2JUJ A;  4LZZ A;  1K82 A;  2XEP A;  3UZU A;  2B3T A;  1PGY A;  2CEA A;  5EXS A;  4AW4 A;  3GRU A;  2DZL A;  3FUW A;  3HKP A;  1RU3 A;  1IN4 A;  7CAT A;  4S12 A;  2VQE M;  1L2C A;  1IBK M;  1HR0 M;  2O5R A;  3FUX A;  4LZJ A;  2JY8 A;  5IRE B;  3K8Z A;  3ZH9 B;  3AKZ A;  1DGG A;  2QPA A;  3L2A A;  5EJC A;  4OU7 A;  1LV7 A;  1N36 M;  2R4J A;  1VEG A;  3TE6 A;  4DUY M;  4LFA M;  3U5Z B;  3TPZ A;  4GHA A;  4I4L A;  1KYI A;  1MX0 A;  1IXS B;  4NSR A;  2QBY B;  4FWD A;  3MK6 A;  4AZF A;  1XXH A;  1G41 A;  2G3Q A;  2DAG A;  5FTM A;  3RE8 A;  2QSF X;  2DWN A;  4JV5 M;  4DR6 M;  3MHV C;  4G4N A;  5KPZ A;  1R7R A;  1TF0 B;  1OIP A;  4YHH M;  1QAN A;  4LY6 A;  1Z6T A;  1TDH A;  3AOE A;  5FTN A;  2XSZ A;  5JI3 E;  5EP2 A;  3VKG A;  2VF7 A;  1K3X A;  2H1R A;  4HL4 A;  2Y20 A;  3TWL A;  3T1H M;  4Q7J A;  1SXJ C;  1P3Q Q;  1SXJ D;  3AL0 C;  3SFZ A;  2KNA A;  4IBJ A;  3HGI A;  2X8A A;  5KQD A;  4D82 A;  2APL A;  1GJS A;  1D0M A;  5IZ7 D;  3TWK A;  4FWG A;  3LW5 F;  1PJS A;  4DR5 M;  4F1I A;  3U6M A;  3I4V A;  1D2N A;  1L1Z A;  1GL6 A;  4B08 A;  5DYG A;  1HQC A;  3GLI B;  3R9X B;  3VDP A;  2XH9 A;  3U61 B;  3C58 A;  3FRI A;  4G6Z A;  3GLH B;  5ITY A;  5BR8 M;  4Z6Y A;  2D7H A;  2DHR A;  3KW6 A;  1DGH B;  1G4A E;  3M7G A;  4FCW A;  4OX9 M;  3KVW A;  1HNW M;  1HNZ M;  2L09 A;  3U6S A;  5FSW A;  3VFD A;  2K0B X;  3TWM A;  1NNJ A;  1HJP A;  1JR3 E;  3AFH A;  1NHW C;  3DZD A;  3WHK A;  4DR1 M;  1N78 A;  5FTL A;  4W5W A;  2BWE A;  4LCB A;  5EQT A;  4AKH A;  1HQY E;  3SYK A;  4M9S A;  1NV8 A;  2R6F A;  2K9D A;  4REZ A;  2R46 A;  4P16 A;  4MB7 A;  4JI7 M;  4CJ6 A;  1S3S A;  1LTM A;  3ZQJ A;  3VK8 A;  2Z4R A;  3L26 A;  1PJI A;  1WXQ A;  4JYA M;  2VII A;  4L78 A;  2O01 F;  3TQS A;  3CF2 A;  1C1K A;  3B9P A;  1W5S A;  4RKU F;  4B3S M;  1A5T A;  3GO8 A;  1H6U A;  2LBC A;  1E9S A;  5FTJ A;  1D0L A;  2XSZ D;  1X37 A;  3VKH A;  3GLG E;  1QQW A;  2HAK A;  1UFZ A;  2LVO C;  2JP7 A;  1JR3 D;  3HWS A;  1IBM M;  3RFW A;  1FJG M;  4GKK M;  1QYR A;  1Y8G A;  2Y0Q A;  2DZN B;  3DOA A;  3E21 A;  4IJF A;  4IBE A;  2BJV A;  1TGU A;  4RF1 A;  2CHQ A;  4QOZ C;  2CV0 A;  3U6Q A;  5IWA M;  5GKN A;  2Z8Y M;  4ITQ A;  1SG9 A;  2LVA A;  4OVZ B;  3KDS E;  3K1J A;  3LQR A;  5LMU M;  3VLF B;  3GLF A;  2DWL A;  3GRR A;  3HHW A;  1K3W A;  2CRU A;  2YQZ A;  2CV1 A;  3E4R A;  5ITQ A;  3C3E A;  3FTD A;  4Y28 F;  3FTE A;  2MH8 A;  1TH4 A;  4G4Q A;  4B7H A;  4FW9 A;  3GLG B;  2F5Q A;  2CE7 A;  1Q02 A;  1GO5 A;  4B3M M;  2LWX A;  2OQ4 A;  4ANR A;  5C18 A;  3J81 S;  4R7G A;  4FCT A;  1ZMW A;  4MGH A;  2R45 A;  1J5E M;  3FUT A;  1QVR A;  1WGL A;  1XMQ M;  4QHT A;  3WHL A;  1HT2 E;  1VDL A;  3I51 A;  1Z5C A;  3GRY A;  3L27 A;  5FLX S;  1TH2 A;  3EIE A;  2DNA A;  4M9Z A;  1KSF X;  3NBI A;  4KOD A;  4LJ5 A;  2UXB M;  3SAW A;  1WJ7 A;  3SBJ A;  1IXS A;  3T15 A;  2OPF A;  4UN2 B;  2C9C A;  3GLI E;  1T3T A;  1MJG M;  4KLN A;  1XXH B;  4K0K M;  4P17 A;  2Q2E B;  3U6O A;  2LHC A;  3SAU A;  4LF9 M;  2KW0 A;  3BOS A;  3IG8 A;  4IBK A;  4JI5 M;  1IN5 A;  3E46 A;  1QAM A;  3HU3 A;  1QZE A;  2BWB A;  2XFT A;  3UK6 A;  2DAK A;  1N34 M;  4X66 M;  2R18 A;  1NVM A;  2V1U A;  2JNH A;  3U6D A;  2C9O A;  1OIZ A;  4EIW A;  3L28 A;  2QCU A;  2FOI C;  3SMP A;  3W0F A;  4DV0 M;  2F5S A;  2DAI A;  2LTU A;  3EIH A;  3MMP A;  4LF8 M;  5A2Q S;  4IBI A;  3QYE A;  5LMN M;  2FE8 A;  1YE9 A;  3IHP A;  1YUB A;  4ZPX A;  4DR2 M;  3IG5 A;  1OAI A;  1J7K A;  2KEB A;  3FE3 A;  3B7N A;  5E6J A;  2DXI A;  2XZF A;  2YFQ A;  4NRW A;  2A5Y B;  2KDL A;  4LJ6 A;  1GJT A;  1IQP A;  3KSJ A;  4M0D A;  1I4W A;  3K9P A;  3U5Z A;  1OTR A;  4D80 A;  1F4I A;  3KFU G;  3I4Y A;  3FTC A;  1R5L A;  4NC6 A;  4LG2 A;  1TDZ A;  2DHY A;  2KZS A;  1G59 A;  2X4A A;  1QZM A;  2M60 A;  2V1C A;  4GIT A;  4WP2 A;  1Q3C A;  3QYB A;  2BJW A;  3T1Y M;  4JN6 A;  2N35 A;  1YSY A;  2C5R A;  1PRB A;  4CHT B;  2C99 A;  2CHV A;  3AJI B;  3CF0 A;  4KHP M;  4LFB M;  4DBG B;  5JI2 E;  3UJN A;  1R2Y A;  1W5T A;  2LHG A;  3GLF B;  4GIP A;  4YY3 M;  4JI0 M;  5BPV A;  4AKI A;  1JB0 F;  3H4J A;  3KXE C;  1E32 A;  1OFH A;  3NWL A;  3UGJ A;  2F5N A;  3GPY A;  2JY6 B;  4BBA A;  4DV7 M;  3UMM A;  4B3R M;  4DV3 M;  1VDD A;  1HNX M;  3M0E A;  1IY0 A;  2QNJ A;  2YNM D;  4KO8 A;  4WW0 A;  3TL4 X;  2VQF M;  3QWL A;  2JZ1 A;  2F5P A;  2LH0 A;  2ZAO A;  2EA0 A;  4I81 A;  2QZ4 A;  3FRH A;  2D7E A;  2R65 A;  3U60 A;  3W0L B;  1WHC A;  3GQ5 A;  3I01 M;  2EJS A;  3I04 M;  2FNA A;  4X62 M;  3KOW E;  1NY5 A;  2JZ0 A;  3Q8X A;  4LJ9 A;  1SXJ E;  1R6B X;  4MGY E;  3LQQ A;  2Z4S A;  3FTF A;  2QQ8 A;  3K92 A;  2FS1 A;  3KOY E;  3LVW A;  4HEO A;  1R4G A;  2DEN A;  1EE8 A;  2HL7 A;  3HU2 A;  1G8P A;  3JR4 A;  3U6L A;  2KXE A;  1G3I A;  2MJ5 B;  2Y21 A;  1XWI A;  1IXR C;  1Z59 A;  2LNH C;  2WSC F;  5KPR A;  2FFJ A;  3FKE A;  2HCB A;  4Z8X A;  1IN8 A;  3KOX E;  3KOZ E;  4LGM A;  4PCZ A;  4DR4 M;  3ZCB B;  2G5G X;  3KS4 A;  2ZM6 M;  1GLN A;  1DGB A;  3Q8G A;  4LGY A;  3B7Z A;  4MGZ E;  1DGF A;  2W82 A;  2XGN A;  2DWZ B;  4G4O A;  5EP3 A;  1YLA A;  2XFS A;  4GC5 A;  2DAE A;  1ZMV A;  3H4M A;  1NHG C;  1NJF A;  4TUW A;  1WGN A;  3L25 A;  1IY1 A;  1GKI A;  3A98 B;  2LXE A;  1JR3 A;  4OVZ A;  4KT0 F;  5C1B A;  2E5L M;  1SXJ A;  2X49 A;  3HJQ A;  2EUC A;  3GQ3 A;  2F4V M;  3FUV A;  1IM2 A;  4G4R A;  2RGH A;  4JI1 M;  2I7P A;  3J80 S;  1NJG A;  2G8L A;  1UM8 A;  2DZO B;  3C3D A;  4GRI A;  5EXT A;  2UUA M;  1IBL M;  2JA2 A;  2VF8 A;  5E26 A;  1N77 A;  3GPX A;  3SYL A;  1HT1 E;  2NQ8 C;  3MJ5 A;  2J7N A;  3B89 A;  8CAT A;  4GMQ A;  3GLF E;  1PJT A;  4GH9 A;  1XC8 A;  4NXN M;  4IBF A;  2KNZ A;  3PVS A;  2UXC M;  3U61 A;  1QAQ A;  1AIP C;  4I5S A;  4NL4 H;  2UUC M;  3DA1 A;  3PNV A;  2K47 A;  4PD2 A;  4GC9 A;  4GKJ M;  2ZAN A;  3OTO M;  1EIJ A;  1C7Y A;  1IN7 A;  3RGS A;  1Z5B A;  2CHG A;  2FH0 A;  3HHY A;  4IBB A;  3C9P A;  4GHL A;  4QNR A;  4R71 A;  4LF6 M;  2KNV A;  1V34 A;  4L4U A;  5DNY A;  3SAS A;  1VEK A;  1XB2 B;  4IIW A;  2J7O A;  1NV9 A;  1VEJ A;  1WIV A;  4MGI E;  2XF3 A;  1QDR A;  2DI0 A;  2L4E A;  3T6P A;  1PJQ A;  4IJE A;  3GLG A;  2L7I A;  3U6C A;  2WSE F;  4RF0 A;  1XNR M;  2EKF A;  4D81 A;  3KSX A;  1MU5 A;  4DV5 M;  4A3V B;  2GNO A;  3NBX X;  1VQ1 A;  2GQF A;  2XLJ A;  1IFY A;  1QDT A;  3ZC7 B;  3E9S A;  1DGH A;  3RGP A;  2AHM A;  2LVQ D;  4NOO B;  3GLH E;  3LMM A;  4JI6 M;  1I94 M;  3GPU A;  2JXN A;  2QBY A;  2DVW B;  2KRU A;  3A45 A;  4LJ8 A;  3SAR A;  1OJL A;  1GAB A;  5IT9 S;  2ERC A;  1G71 A;  2RRU A;  1OKS A;  2JY5 A;  3LVV A;  1Q3B A;  3HHX A;  5KO3 A;  1CUK A;  4HLQ A;  2MGW A;  4DV2 M;  3AV0 A;  3GQ4 A;  4XK8 F;  2DAM A;  2LVP C;  1ORY B;  5ITX A;  1T43 A;  1IXZ A;  4MM3 B;  3IEC A;  4QHS A;  4LJA A;  1L1T A;  5KQ8 A;  2KZU A;  3DFZ A;  4DV1 M;  5FTK A;  1NSF A;  4NXM M;  2ZTC A;  2CP8 A;  4FD2 A;  4QNM A;  3U6P A;  4LF4 M;  1GL7 A;  5ITR A;  1EFU B;  4L15 A;  3AOE C;  3LCU A;  3R8F A;  2YR0 A;  2L2D A;  3HZJ A;  3K2L A;  1DO2 A;  5EP1 A;  4WUR A;  2KRK A;  3A42 A;  3CTW B;  3W67 A;  4NRV A;  1WR1 B;  4II7 A;  4M0W A;  2UU9 M;  3D8L A;  3V76 A;  1BVS A;  2CV2 A;  3GLI A;  3SAV A;  5ITT A;  4XGI A;  4JI4 M;  3GLH A;  2J5Y A;  2R44 A;  3HJS A;  2EKK A;  1IN6 A;  3FYD A;  1ZQ9 A;  5H37 D;  1L2D A;  3LCV B;  2R62 A;  2HHH M;  3BBZ A;  3FUU A;  2DWM A;  2MRO B;  4PDG A;  4CIZ A;  2OOA A;  2RKO A;  3HJ8 A;  2BNK A;  2L4F A;  3KP0 E;  3CGW A;  4CIS A;  1TH3 A;  1DV0 A;  3SHF A;  2M5Z A;  4L16 A;  4MGK E;  2R0I A;  1KFV A;  2QEN A;  2VDB B;  2DKL A;  1N32 M;  4LRT A;  2HWJ A;  1QAO A;  5EXP A;  1T6O A;  3K9O A;  3W68 A;  3U60 B;  4I8O A;  5L8R F;  2ZAM A;  1E94 E;  4X65 M;  3B7Q A;  4QOS A;  2R4E A;  3T38 A;  1XHB A;  2CUZ A;  3J2P B;  2UXD M;  1TTE A;  1OFI A;  2D7G A;  1NO1 A;  1L8Q A;  5EXX A;  3A46 A;  4AG6 A;  2XZU A;  3FYC A;  4LFC M;  4B3T M;  2MR9 A;  4LF5 M;  5KPT A;  3KS8 A;  3J7A S;  2WZJ A;  4JXJ A;  4B7F A;  4JI8 M;  4LF7 M;  2F5O A;  5EP4 A;  3KP1 E;  5DFL A;  4X64 M;  1QUS A;  2K6B A;  1J09 A;  2LVN C;  2WSF F;  4DV4 M;  4DUZ M;  4BLC A;  3PXG A;  3VK7 A;  1PM5 A;  4F2L A;  1JQJ C;  2QHO B;  4RNA A;  1XXH E;  2KHH A;  1Q39 A;  1FNN A;  2I7N A;  3JAM S;  4AI6 A;  1GVN A;  4LRS A;  1TR8 A;  3BXW A;  2RGO A;  3ILK A;  5F3W A;  1N33 M;  1Z5A A;  2HKJ A;  2C98 A;  4OW0 A;  1V33 A;  3PNY A;  2OOB A;  4PT5 A;  4DV6 M;  3B74 A;  2ZTD A; 
#chains in the Genus database with same CATH homology
 2KNV A;  1HQY E;  1V92 A;  4WP2 A;  1VEK A;  1NV8 A;  1XB2 B;  1NV9 A;  1VEJ A;  1WIV A;  2K9D A;  3T6P A;  2JY7 A;  2DI0 A;  2L4E A;  2H5X A;  4DBG B;  5JI2 E;  2EKF A;  1VQ1 A;  1IFY A;  1DO0 A;  3H4J A;  4G3O A;  1A5T A;  2LBC A;  2LVQ D;  1OQY A;  3GLH E;  3GLG E;  2JY6 B;  2HAK A;  1UFZ A;  2LVO C;  2JP7 A;  1MN3 A;  2QNJ A;  1ZV1 A;  1Y8G A;  2RRU A;  1OKS A;  2JY5 A;  3E21 A;  4GEW A;  2JZ1 A;  1CUK A;  2MGW A;  3FRH A;  2DAM A;  2LVP C;  1WHC A;  2O25 A;  1SG9 A;  1T43 A;  2LVA A;  2EJS A;  3IEC A;  2OO9 A;  1ZMU A;  2CWB A;  2JZ0 A;  1VG5 A;  2CP8 A;  2ZTC A;  3F92 A;  2JUJ A;  1EFU B;  2B3T A;  1PGY A;  3LCU A;  2L2D A;  1DO2 A;  2DZL A;  4HEO A;  1R4G A;  2DEN A;  1Q02 A;  1WR1 B;  1G3I A;  2MJ5 B;  1GO5 A;  1BVS A;  2JY8 A;  1ZMW A;  1WGL A;  2EKK A;  1HT2 E;  1VDL A;  1VEG A;  3LCV B;  3BBZ A;  2DNA A;  2MRO B;  4R71 A;  2OOA A;  1KYI A;  1WJ7 A;  1IXS A;  2L4F A;  4UN2 B;  3GLI E;  1YLA A;  1G41 A;  2G3Q A;  2DAG A;  1DV0 A;  2QSF X;  2DAE A;  2R0I A;  1ZMV A;  2DKL A;  2HWJ A;  1WGN A;  3E46 A;  1T6O A;  3K9O A;  1QZE A;  1E94 E;  2BWB A;  2DAK A;  4Q7J A;  1TTE A;  1IM2 A;  2JNH A;  1P3Q Q;  2KNA A;  2MR9 A;  2WZJ A;  2DAI A;  2LTU A;  3MMP A;  5DFL A;  1HT1 E;  3IHP A;  4F1I A;  2LVN C;  1OAI A;  3B89 A;  3GLF E;  2KNZ A;  4F2L A;  2QHO B;  1XXH E;  3FRI A;  2KHH A;  1AIP C;  1G4A E;  3K9P A;  1OTR A;  2K0B X;  1C7Y A;  1HJP A;  1F4I A;  1TR8 A;  1JR3 E;  2OOB A;  2BWE A;  2DHY A;  3FE3 A;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...