2BWBA

Crystal structure of the uba domain of dsk2 from s. cerevisiae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bwbA00
2DENA 4F2LA 1Q02A 2MGWA 2MR9A 1AIPC 1VG5A 2L4EA 1WIVA 3H4JA 3T6PA 2EKKA 2JZ1A 1IFYA 3GLFE 2DI0A 2JY8A 2OOBA 2KNZA 2L4FA 1QZEA 2WZJA 2KHHA 1CUKA 1ZMWA 1HT2E 2EKFA 1IM2A 1OAIA 1WJ7A 2LTUA 1GO5A 3FRIA 4Q7JA 1WGLA 1VEKA 1P3QQ 2KNVA 3LCVB 1XB2B 2JY7A 1DO0A 1R4GA 1ZMUA 2KNAA 1UFZA 2RRUA 2JZ0A 3GLIE 4G3OA 1G3IA 1NV8A 1WHCA 3E46A 1WGNA 1WR1B 2JUJA 3FE3A 3BBZA 2DAIA 1T43A 3K9OA 4R71A 2LVOC 4UN2B 2EJSA 1NV9A 1JR3E 1IXSA 2JP7A 2K0BX 3IECA 1G4AE 2H5XA 1HT1E 2DNAA 1VEJA 2DHYA 2LBCA 2LVQD 2OOAA 3LCUA 2QSFX 2OO9A 3F92A 2DKLA 1VQ1A 3GLGE 1TTEA 2L2DA 1TR8A 4WP2A 1HJPA 1DO2A 3IHPA 1BVSA 1MN3A 2CWBA 2QNJA 2DAGA 1HQYE 1YLAA 2BWEA 1V92A 5DFLA 1VDLA 2ZTDA 2ZTCA 2BWBA 2JY5A 3K9PA 5JI2E 1KYIA 1ZMVA 2G3QA 2R0IA 2CP8A 1OQYA 2QHOB 1EFUB 1VEGA 2LVPC 4HEOA 2K9DA 1T6OA 2HAKA 2DAMA 2LVNC 1OTRA 2DZLA 3FRHA 2JNHA 3MMPA 1A5TA 2JY6B 1F4IA 3E21A 1SG9A 1PGYA 4DBGB 2DAEA 3GLHE 4GEWA 2O25A 1DV0A 2DAKA 1XXHE 4F1IA 2LVAA 2B3TA 2HWJA 2MJ5B 1G41A 1E94E 1OKSA 1ZV1A 2MROB 1C7YA 3B89A 1Y8GA
chains in the Genus database with same CATH superfamily
2DENA 3T15A 1TH2A 2M60A 5KPRA 5EJCA 3JR5A 3R8FA 3HU1A 4OVZA 1FJGM 2L4EA 3UGJA 4ITQA 3I51A 3QWLA 2JZ1A 3LQQA 1IFYA 3KOWE 4S12A 3H4MA 2JY8A 1V33A 3GPUA 4OX9M 3RGPA 4I8OA 4LF8M 3E9SA 2AHMA 2DWMA 4JYAM 2KNZA 4KO8A 2CV2A 4CHTB 1NNJA 1X37A 1NO1A 3C3EA 3TL4X 2WZJA 5EXXA 2N35A 4XGIA 3GQ4A 2L6OA 2K47A 2QQ8A 4MGHA 4NXNM 2EO2A 2E5LM 2V1CA 4JI2M 1I4WA 4AW4A 1T3TA 2LTUA 1R2YA 1NNUC 3UMMA 3GRVA 2WSFF 2DXIA 4LCBA 4FW9A 5FTMA 2J5YA 2C99A 5IREB 3A98B 2XLJA 2GNOA 2QENA 4B7HA 2KNVA 4IBFA 3SAUA 3GLFB 3HWSA 2R18A 1XB2B 2XZUA 2OPFA 4JI6M 1PJQA 3UJNA 2Y0TA 4YY3M 1UFZA 4LFCM 3W0LB 2C9OA 1G3IA 1N75A 1NV8A 2XZFA 3D8LA 4PDIA 4K0KM 4GIPA 3W67A 4AKHA 2RKOA 3FUTA 2DHRA 4NOOB 3K9OA 5EP1A 2LVOC 3J2PB 2F5QA 1NV9A 3KXEC 3SHGB 4OU7A 1NJFA 3I4VA 4G4NA 1PM5A 1EE8A 1N78A 3L28A 1IXSA 4REZA 2UUCM 4X64M 3IECA 2G8LA 2H5XA 4PCZA 4TUWA 2R62A 3OTOM 1L2DA 3TQSA 4I5SA 1Z5CA 1VDDA 3LCUA 5FSWA 4FWHA 3RE8A 4FCTA 4G4QA 2DKLA 1VQ1A 4DV2M 1TTEA 2KEBA 3B74A 4GC9A 1DO2A 2MH8A 3Q8XA 3GRYA 2UXDM 3GRRA 3AJIB 5EP4A 4M9ZA 1OAOC 2ZTCA 1HQCA 4B7GA 5EP2A 4D80A 4LF7M 2KRUA 2BWBA 2JY5A 3C58A 3K9PA 3CF6E 1HNWM 2FS1A 2R4JA 3FUVA 4CJ6A 1ZMVA 4IBCA 3E4RA 2R0IA 3PFIA 1PRBA 4RF0A 1OQYA 8CATA 1QUSA 5FLXS 3K92A 3U6QA 1VEGA 2LVPC 1FNNA 2XEPA 2L7IA 3FYCA 4HEOA 1QAQA 2K9DA 2HAKA 3FUXA 1AUAA 4MGIE 2KZSA 2GQFA 1IY0A 1TH4A 4JI3M 1IQPA 3D8BA 5H37D 4DV6M 2CV0A 1QDRA 4FVMA 4MB7A 3L25A 3GQ5A 2FE8A 4GEWA 1ZAEA 2O25A 4LF4M 2W82A 3FUUA 4QHSA 3B9PA 2X49A 2HWJA 1G8PA 4G6ZA 4NXMM 5GKNA 3J81S 1XHBA 1OIPA 4LJ4A 2XSZD 1V34A 3GLGA 1IXSB 1L1TA 3J7AS 1PJSA 2MGWA 2MR9A 4HL4A 1AIPC 4PT5A 4F2LA 1MJGM 3H4JA 2HL7A 1MU5A 3EIEA 2XFTA 5FTNA 3CF0A 4KHPM 4DR6M 4X66M 3GLFE 3BOSA 5KPTA 3NWLA 1SXJE 4HLQA 2CHGA 4B3TM 3WHLA 4W5WA 2DWNA 2CRUA 4IBJA 3ZC7B 2V1UA 4FWGA 1Z5AA 3IG8A 2I7NA 4KT0F 4JXJA 1CUKA 1ZMWA 2QPAA 1HT2E 3HY5A 3HHYA 3SASA 2LHGA 1GO5A 1K3WA 1OIZA 4WURA 2KA6B 3VFDA 5KPZA 1J7KA 4OW0A 1J5EM 5EXTA 2QBYA 2FH0A 1DGHA 2Y0QA 1VEKA 1P3QQ 1R7RA 2JXNA 1ORYB 2Z4RA 2ZBKB 1QUTA 2YNMD 3HX3A 3VKHA 3LCVB 1DGFA 3SHFA 3U5ZB 4Y28F 2RRUA 2UU9M 2JZ0A 3PNYA 5KO3A 1XC8A 5L8RF 4Z8XA 2C96A 1D0MA 3RGSA 3HJSA 1TGUA 3BBZA 2DAIA 3LVVA 1N32M 1T43A 3U6SA 2VIIA 4UN2B 4R71A 4DV7M 3IG5A 2EUCA 3J7BA 3KDSE 2JWSA 5IWAM 4AI6A 5C1BA 2JP7A 4XK8F 1XNRM 2K0BX 1HT1E 3KOYE 4LFAM 5FTLA 3KOZE 4BLCA 1C1KA 1TDHA 4RF1A 2DHYA 2OOAA 2BJVA 1IBKM 4KODA 2QSFX 3JAMS 2OO9A 3F92A 1Q3BA 1OJLA 3KSJA 4B3SM 2UXBM 4NRWA 4DV1M 1TF0B 3GLIB 1HJPA 4R7GA 1D2NA 5EXSA 3U60B 3U6DA 1IBLM 3LQRA 3HZJA 1HQYE 4JI8M 1SXJD 4G4OA 4MH0E 1SXJA 1IN4A 3HHWA 1VDLA 1Q3CA 4IJEA 2H1RA 5JI3E 3AOGA 5JI2E 2VF7A 5ITRA 1IN7A 1KYIA 2LXEA 3KP0E 3HGIA 4M9XA 4NC6A 4NSRA 3B7NA 1XNQM 3R9XB 1L2CA 2G5GX 1XMQM 3FKEA 3AV0A 2QHOB 1Q39A 2L09A 3ZQJA 3GLIA 4JI0M 1RU3A 3U6PA 3B7QA 3KP1E 3KW6A 4LJAA 2DAMA 1PJIA 2C9CA 2QP9X 3SYKA 1W5SA 2C98A 4L16A 4DR7M 5BR8M 2CE7A 2R4EA 4DR3M 1L8QA 2D7HA 2R6FA 4B7FA 2XH9A 2HKJA 5DYGA 3E21A 4KLNA 4LFBM 1SG9A 3FTCA 2VQEM 4DUZM 4AQYM 3UZUA 4DBGB 1Z6TA 2A5YB 2DAKA 1TH3A 2LVAA 2VF8A 2XGNA 2KDLA 3B7ZA 4XBOA 4L15A 1OKSA 1ZV1A 2MROB 3B89A 4QOSA 1Y8GA 3TE6A 3A46A 2QBYB 2HHHM 4D81A 1XXHA 1NHGC 4B3RM 1VG5A 4LGYA 4WW0A 4IBIA 3NBXX 1NSFA 2O01F 3ILKA 3AOEC 2EKKA 3HJ8A 1IN5A 1GVNA 5KQ8A 1D0KA 2VQFM 4II7A 1JQJC 1DGHB 3T1HM 1PJJA 4JV5M 1E32A 2DI0A 4L78A 5IZ7D 3TWLA 1XMOM 3GRUA 2OOBA 3SMPA 1JR3A 1YSYA 5EP3A 4PDGA 3UK6A 5LMNM 1NVMA 2R45A 2Z7JA 4AKIA 3KOXE 3TWMA 1K82A 2XFSA 2L7HA 1GJTA 3KS4A 4LY6A 3THGA 2HCBA 2YR0A 1WJ7A 2WSEF 3SAWA 3KFUG 4B08A 4DR2M 3U60A 4Q7JA 5ITXE 4L4UA 3GP1A 3U61A 3W68A 5ITUA 3U61B 1E9SA 3RFWA 4GMQA 2JY7A 4DV3M 1R4GA 1GL7A 1ZMUA 4QNMA 4LGMA 1HR0M 4BB9A 3SC3A 3DOAA 3HHXA 4G3OA 4NRVA 5C18A 5IT9S 1WHCA 1QQWA 3E46A 4M9SA 1WGNA 1WR1B 4LJ8A 5ITYA 4AZFA 4QOZC 3SBJA 1KFVA 1QDTA 2DWZB 1HNZM 2BJWA 1DGBA 4P16A 2EJSA 4IBKA 1NJGA 3HU2A 4MGZE 3FYDA 2RGHA 2QCUA 1G4AE 4RNAA 2KW0A 3L2AA 3JR4A 3FTFA 4X62M 2DNAA 3DA1A 4GITA 4X65M 2LBCA 2LVQD 4LRTA 7CATA 3MJ5A 1IXRC 1W5TA 5BPVA 2L2DA 2LNHC 4LJ9A 1IN6A 3SMSA 1SXJC 4JI1M 1IY2A 3IHPA 5ITTA 5FTJA 2CWBA 2QNJA 2YFQA 4LJ5A 1OFIA 4R3DA 4DR5M 1EIJA 2Y20A 4RKUF 1G71A 1YLAA 2WSCF 4LZZA 2BWEA 3WHKA 3HKPA 2ZTDA 1Z5BA 3VDPA 3GLFA 3I04M 3DZDA 4MM3B 3SYLA 4GHAA 2I7PA 4LJ7A 2KZUA 4FCVA 2R44A 4EIWA 2ERCA 4L8RC 2G3QA 1R2ZA 2Q2EB 1HNXM 2DZOB 4L6V6 4AG6A 4LG2A 2CV1A 3ZH9B 4JI5M 1UM8A 2O5RA 2DVWB 2J7NA 2EA0A 1L2BA 2F5OA 4ANRA 2D7GA 1JB0F 1KSFX 4IBGA 2X8AA 4LJ6A 1SXJB 3GLGB 5KQDA 4AKGA 4I4LA 4PD2A 3PNVA 2DZNB 1I94M 5E6JA 1A5TA 2CFOA 2QZ4A 3VK7A 2Z4SA 3KS8A 4IBBA 2XSZA 3HHZA 2DAEA 2FNAA 3Q8GA 4NL4H 2CUZA 3W0FA 4NSOB 3U6CA 4CGYB 1GABA 5E26A 4F1IA 1YUBA 5ITXA 2DWLA 2MJ5B 3J27B 4QHTA 1K3XA 1J09A 1E94E 2CHVA 4GKJM 3V76A 3LVWA 4CIZA 1OFHA 3A45A 4Z6YA 2R65A 1Q02A 3FTDA 1GKIA 2XF3A 3GLHA 3GLHB 5DYIA 1WIVA 3BXWA 3T6PA 3U6MA 3KSXA 3I4YA 3C3DA 4LF9M 2K6BA 1IY1A 1QVRA 5EXPA 4JI7M 2ZAOA 3I01M 3U6EA 1S3SA 3EIHA 3HU3A 5EQTA 5FTKA 3SFZA 2Z3XA 4IBEA 3AKZA 1DGGA 4G4RA 2OQ4A 2L4FA 3NBIA 1QZEA 2J7OA 1NHWC 2KHHA 2LHCA 2R46A 3GPXA 1ZQ9A 2Y21A 2P5TA 1IM2A 1OAIA 2EKFA 2V6ZM 4OVZB 3FRIA 3FUWA 3HJQA 4IJFA 4CISA 1WGLA 2FOIC 3MHVC 2UUAM 3SARA 4IIWA 2D7EA 1GLNA 4P17A 1DO0A 4LZJA 1N36M 4JI4M 2F5SA 2CEAA 2KNAA 3CF2A 3K1JA 1PJTA 3GLIE 4LF5M 1Z59A 4GRIA 3J80S 2VDBB 5ITQA 2X4AA 1YE9A 2YQZA 1QANA 2JUJA 3FE3A 3GPPA 4DV4M 3U6OA 3SAVA 1E9RA 2ZAMA 3CGWA 3M7GA 1IXZA 1N33M 2UUBM 1JR3E 3C9PA 3PVSA 3GO8A 1XXHB 3T38A 4YHHM 3PXGA 1NY6A 3LMMA 4LF6M 3T1YM 3DFZA 4A3VB 1XWIA 3MK6A 2UXCM 1R6BX 4QNRA 3U5ZA 1VEJA 4GC5A 3AOEA 3VLFB 3GQ3A 1L1ZA 1G59A 3VKGA 4LRSA 3VDUA 4AG5A 3GLGE 4GKKM 2KXEA 5LMUM 1TR8A 4WP2A 1H6UA 2RGOA 1BVSA 3SATA 2APLA 1MN3A 3GPYA 3QAUA 3TWKA 2DAGA 3ZCBB 3L27A 1GJSA 1LV7A 4M0WA 3QYBA 4BBAA 1V92A 4DR1M 5DFLA 4B3MM 1JR3D 4FCWA 1QZMA 3KVWA 3M0EA 3M6AA 4IBDA 1N34M 3AFHA 4DV5M 3FTEA 2C5RA 1MX0A 2CHQA 4I81A 2BNKA 2CP8A 3VK8A 1N77A 2FFJA 1EFUB 4MGYE 3A42A 1IBMM 1QYRA 1T6OA 2LVNC 3LW5F 3CTWB 3K8ZA 1IN8A 4JN6A 3TPZA 5F3WA 4ZPXA 2ZM6M 2M5ZA 1OTRA 2DZLA 3FRHA 4FWDA 1LTMA 4MGKE 3FD9A 4FD2A 4D82A 2F5PA 1D0LA 2JNHA 4DR4M 2ZANA 1R5LA 2KRKA 2NQ8C 3MMPA 4GHLA 1WXQA 1GL6A 4M0DA 2JY6B 4DUYM 1F4IA 5DNYA 5A2QS 1PGYA 1QAOA 3GLHE 2LH0A 1NY5A 1TDZA 2JA2A 2LWXA 1DV0A 3AL0C 1XXHE 1QAMA 2F4VM 3U6LA 2B3TA 3K2LA 3QYEA 1G41A 3L26A 4DV0M 2Z8YM 3L29A 1C7YA 2F5NA 4GH9A
chains in the Genus database with same CATH topology
2DENA 4F2LA 1Q02A 2MGWA 2MR9A 1AIPC 1VG5A 2L4EA 1WIVA 3H4JA 3T6PA 2EKKA 2JZ1A 1IFYA 3GLFE 2DI0A 2JY8A 2OOBA 2KNZA 2L4FA 1QZEA 2WZJA 2KHHA 1CUKA 1ZMWA 1HT2E 2EKFA 1IM2A 1OAIA 1WJ7A 2LTUA 1GO5A 3FRIA 4Q7JA 1WGLA 1VEKA 1P3QQ 2KNVA 3LCVB 1XB2B 2JY7A 1DO0A 1R4GA 1ZMUA 2KNAA 1UFZA 2RRUA 2JZ0A 3GLIE 4G3OA 1G3IA 1NV8A 1WHCA 3E46A 1WGNA 1WR1B 2JUJA 3FE3A 3BBZA 2DAIA 1T43A 3K9OA 4R71A 2LVOC 4UN2B 2EJSA 1NV9A 1JR3E 1IXSA 2JP7A 2K0BX 3IECA 1G4AE 2H5XA 1HT1E 2DNAA 1VEJA 2DHYA 2LBCA 2LVQD 2OOAA 3LCUA 2QSFX 2OO9A 3F92A 2DKLA 1VQ1A 3GLGE 1TTEA 2L2DA 1TR8A 4WP2A 1HJPA 1DO2A 3IHPA 1BVSA 1MN3A 2CWBA 2QNJA 2DAGA 1HQYE 1YLAA 2BWEA 1V92A 5DFLA 1VDLA 2ZTDA 2ZTCA 2BWBA 2JY5A 3K9PA 5JI2E 1KYIA 1ZMVA 2G3QA 2R0IA 2CP8A 1OQYA 2QHOB 1EFUB 1VEGA 2LVPC 4HEOA 2K9DA 1T6OA 2HAKA 2DAMA 2LVNC 1OTRA 2DZLA 3FRHA 2JNHA 3MMPA 1A5TA 2JY6B 1F4IA 3E21A 1SG9A 1PGYA 4DBGB 2DAEA 3GLHE 4GEWA 2O25A 1DV0A 2DAKA 1XXHE 4F1IA 2LVAA 2B3TA 2HWJA 2MJ5B 1G41A 1E94E 1OKSA 1ZV1A 2MROB 1C7YA 3B89A 1Y8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DEN A;  4F2L A;  1Q02 A;  2MGW A;  2MR9 A;  1AIP C;  1VG5 A;  2L4E A;  1WIV A;  3H4J A;  3T6P A;  2EKK A;  2JZ1 A;  1IFY A;  3GLF E;  2DI0 A;  2JY8 A;  2OOB A;  2KNZ A;  2L4F A;  1QZE A;  2WZJ A;  2KHH A;  1CUK A;  1ZMW A;  1HT2 E;  2EKF A;  1IM2 A;  1OAI A;  1WJ7 A;  2LTU A;  1GO5 A;  3FRI A;  4Q7J A;  1WGL A;  1VEK A;  1P3Q Q;  2KNV A;  3LCV B;  1XB2 B;  2JY7 A;  1DO0 A;  1R4G A;  1ZMU A;  2KNA A;  1UFZ A;  2RRU A;  2JZ0 A;  3GLI E;  4G3O A;  1G3I A;  1NV8 A;  1WHC A;  3E46 A;  1WGN A;  1WR1 B;  2JUJ A;  3FE3 A;  3BBZ A;  2DAI A;  1T43 A;  3K9O A;  4R71 A;  2LVO C;  4UN2 B;  2EJS A;  1NV9 A;  1JR3 E;  1IXS A;  2JP7 A;  2K0B X;  3IEC A;  1G4A E;  2H5X A;  1HT1 E;  2DNA A;  1VEJ A;  2DHY A;  2LBC A;  2LVQ D;  2OOA A;  3LCU A;  2QSF X;  2OO9 A;  3F92 A;  2DKL A;  1VQ1 A;  3GLG E;  1TTE A;  2L2D A;  1TR8 A;  4WP2 A;  1HJP A;  1DO2 A;  3IHP A;  1BVS A;  1MN3 A;  2CWB A;  2QNJ A;  2DAG A;  1HQY E;  1YLA A;  2BWE A;  1V92 A;  5DFL A;  1VDL A;  2ZTD A;  2ZTC A;  2BWB A;  2JY5 A;  3K9P A;  5JI2 E;  1KYI A;  1ZMV A;  2G3Q A;  2R0I A;  2CP8 A;  1OQY A;  2QHO B;  1EFU B;  1VEG A;  2LVP C;  4HEO A;  2K9D A;  1T6O A;  2HAK A;  2DAM A;  2LVN C;  1OTR A;  2DZL A;  3FRH A;  2JNH A;  3MMP A;  1A5T A;  2JY6 B;  1F4I A;  3E21 A;  1SG9 A;  1PGY A;  4DBG B;  2DAE A;  3GLH E;  4GEW A;  2O25 A;  1DV0 A;  2DAK A;  1XXH E;  4F1I A;  2LVA A;  2B3T A;  2HWJ A;  2MJ5 B;  1G41 A;  1E94 E;  1OKS A;  1ZV1 A;  2MRO B;  1C7Y A;  3B89 A;  1Y8G A; 
#chains in the Genus database with same CATH topology
 2DEN A;  3T15 A;  1TH2 A;  2M60 A;  5KPR A;  5EJC A;  3JR5 A;  3R8F A;  3HU1 A;  4OVZ A;  1FJG M;  2L4E A;  3UGJ A;  4ITQ A;  3I51 A;  3QWL A;  2JZ1 A;  3LQQ A;  1IFY A;  3KOW E;  4S12 A;  3H4M A;  2JY8 A;  1V33 A;  3GPU A;  4OX9 M;  3RGP A;  4I8O A;  4LF8 M;  3E9S A;  2AHM A;  2DWM A;  4JYA M;  2KNZ A;  4KO8 A;  2CV2 A;  4CHT B;  1NNJ A;  1X37 A;  1NO1 A;  3C3E A;  3TL4 X;  2WZJ A;  5EXX A;  2N35 A;  4XGI A;  3GQ4 A;  2L6O A;  2K47 A;  2QQ8 A;  4MGH A;  4NXN M;  2EO2 A;  2E5L M;  2V1C A;  4JI2 M;  1I4W A;  4AW4 A;  1T3T A;  2LTU A;  1R2Y A;  1NNU C;  3UMM A;  3GRV A;  2WSF F;  2DXI A;  4LCB A;  4FW9 A;  5FTM A;  2J5Y A;  2C99 A;  5IRE B;  3A98 B;  2XLJ A;  2GNO A;  2QEN A;  4B7H A;  2KNV A;  4IBF A;  3SAU A;  3GLF B;  3HWS A;  2R18 A;  1XB2 B;  2XZU A;  2OPF A;  4JI6 M;  1PJQ A;  3UJN A;  2Y0T A;  4YY3 M;  1UFZ A;  4LFC M;  3W0L B;  2C9O A;  1G3I A;  1N75 A;  1NV8 A;  2XZF A;  3D8L A;  4PDI A;  4K0K M;  4GIP A;  3W67 A;  4AKH A;  2RKO A;  3FUT A;  2DHR A;  4NOO B;  3K9O A;  5EP1 A;  2LVO C;  3J2P B;  2F5Q A;  1NV9 A;  3KXE C;  3SHG B;  4OU7 A;  1NJF A;  3I4V A;  4G4N A;  1PM5 A;  1EE8 A;  1N78 A;  3L28 A;  1IXS A;  4REZ A;  2UUC M;  4X64 M;  3IEC A;  2G8L A;  2H5X A;  4PCZ A;  4TUW A;  2R62 A;  3OTO M;  1L2D A;  3TQS A;  4I5S A;  1Z5C A;  1VDD A;  3LCU A;  5FSW A;  4FWH A;  3RE8 A;  4FCT A;  4G4Q A;  2DKL A;  1VQ1 A;  4DV2 M;  1TTE A;  2KEB A;  3B74 A;  4GC9 A;  1DO2 A;  2MH8 A;  3Q8X A;  3GRY A;  2UXD M;  3GRR A;  3AJI B;  5EP4 A;  4M9Z A;  1OAO C;  2ZTC A;  1HQC A;  4B7G A;  5EP2 A;  4D80 A;  4LF7 M;  2KRU A;  2BWB A;  2JY5 A;  3C58 A;  3K9P A;  3CF6 E;  1HNW M;  2FS1 A;  2R4J A;  3FUV A;  4CJ6 A;  1ZMV A;  4IBC A;  3E4R A;  2R0I A;  3PFI A;  1PRB A;  4RF0 A;  1OQY A;  8CAT A;  1QUS A;  5FLX S;  3K92 A;  3U6Q A;  1VEG A;  2LVP C;  1FNN A;  2XEP A;  2L7I A;  3FYC A;  4HEO A;  1QAQ A;  2K9D A;  2HAK A;  3FUX A;  1AUA A;  4MGI E;  2KZS A;  2GQF A;  1IY0 A;  1TH4 A;  4JI3 M;  1IQP A;  3D8B A;  5H37 D;  4DV6 M;  2CV0 A;  1QDR A;  4FVM A;  4MB7 A;  3L25 A;  3GQ5 A;  2FE8 A;  4GEW A;  1ZAE A;  2O25 A;  4LF4 M;  2W82 A;  3FUU A;  4QHS A;  3B9P A;  2X49 A;  2HWJ A;  1G8P A;  4G6Z A;  4NXM M;  5GKN A;  3J81 S;  1XHB A;  1OIP A;  4LJ4 A;  2XSZ D;  1V34 A;  3GLG A;  1IXS B;  1L1T A;  3J7A S;  1PJS A;  2MGW A;  2MR9 A;  4HL4 A;  1AIP C;  4PT5 A;  4F2L A;  1MJG M;  3H4J A;  2HL7 A;  1MU5 A;  3EIE A;  2XFT A;  5FTN A;  3CF0 A;  4KHP M;  4DR6 M;  4X66 M;  3GLF E;  3BOS A;  5KPT A;  3NWL A;  1SXJ E;  4HLQ A;  2CHG A;  4B3T M;  3WHL A;  4W5W A;  2DWN A;  2CRU A;  4IBJ A;  3ZC7 B;  2V1U A;  4FWG A;  1Z5A A;  3IG8 A;  2I7N A;  4KT0 F;  4JXJ A;  1CUK A;  1ZMW A;  2QPA A;  1HT2 E;  3HY5 A;  3HHY A;  3SAS A;  2LHG A;  1GO5 A;  1K3W A;  1OIZ A;  4WUR A;  2KA6 B;  3VFD A;  5KPZ A;  1J7K A;  4OW0 A;  1J5E M;  5EXT A;  2QBY A;  2FH0 A;  1DGH A;  2Y0Q A;  1VEK A;  1P3Q Q;  1R7R A;  2JXN A;  1ORY B;  2Z4R A;  2ZBK B;  1QUT A;  2YNM D;  3HX3 A;  3VKH A;  3LCV B;  1DGF A;  3SHF A;  3U5Z B;  4Y28 F;  2RRU A;  2UU9 M;  2JZ0 A;  3PNY A;  5KO3 A;  1XC8 A;  5L8R F;  4Z8X A;  2C96 A;  1D0M A;  3RGS A;  3HJS A;  1TGU A;  3BBZ A;  2DAI A;  3LVV A;  1N32 M;  1T43 A;  3U6S A;  2VII A;  4UN2 B;  4R71 A;  4DV7 M;  3IG5 A;  2EUC A;  3J7B A;  3KDS E;  2JWS A;  5IWA M;  4AI6 A;  5C1B A;  2JP7 A;  4XK8 F;  1XNR M;  2K0B X;  1HT1 E;  3KOY E;  4LFA M;  5FTL A;  3KOZ E;  4BLC A;  1C1K A;  1TDH A;  4RF1 A;  2DHY A;  2OOA A;  2BJV A;  1IBK M;  4KOD A;  2QSF X;  3JAM S;  2OO9 A;  3F92 A;  1Q3B A;  1OJL A;  3KSJ A;  4B3S M;  2UXB M;  4NRW A;  4DV1 M;  1TF0 B;  3GLI B;  1HJP A;  4R7G A;  1D2N A;  5EXS A;  3U60 B;  3U6D A;  1IBL M;  3LQR A;  3HZJ A;  1HQY E;  4JI8 M;  1SXJ D;  4G4O A;  4MH0 E;  1SXJ A;  1IN4 A;  3HHW A;  1VDL A;  1Q3C A;  4IJE A;  2H1R A;  5JI3 E;  3AOG A;  5JI2 E;  2VF7 A;  5ITR A;  1IN7 A;  1KYI A;  2LXE A;  3KP0 E;  3HGI A;  4M9X A;  4NC6 A;  4NSR A;  3B7N A;  1XNQ M;  3R9X B;  1L2C A;  2G5G X;  1XMQ M;  3FKE A;  3AV0 A;  2QHO B;  1Q39 A;  2L09 A;  3ZQJ A;  3GLI A;  4JI0 M;  1RU3 A;  3U6P A;  3B7Q A;  3KP1 E;  3KW6 A;  4LJA A;  2DAM A;  1PJI A;  2C9C A;  2QP9 X;  3SYK A;  1W5S A;  2C98 A;  4L16 A;  4DR7 M;  5BR8 M;  2CE7 A;  2R4E A;  4DR3 M;  1L8Q A;  2D7H A;  2R6F A;  4B7F A;  2XH9 A;  2HKJ A;  5DYG A;  3E21 A;  4KLN A;  4LFB M;  1SG9 A;  3FTC A;  2VQE M;  4DUZ M;  4AQY M;  3UZU A;  4DBG B;  1Z6T A;  2A5Y B;  2DAK A;  1TH3 A;  2LVA A;  2VF8 A;  2XGN A;  2KDL A;  3B7Z A;  4XBO A;  4L15 A;  1OKS A;  1ZV1 A;  2MRO B;  3B89 A;  4QOS A;  1Y8G A;  3TE6 A;  3A46 A;  2QBY B;  2HHH M;  4D81 A;  1XXH A;  1NHG C;  4B3R M;  1VG5 A;  4LGY A;  4WW0 A;  4IBI A;  3NBX X;  1NSF A;  2O01 F;  3ILK A;  3AOE C;  2EKK A;  3HJ8 A;  1IN5 A;  1GVN A;  5KQ8 A;  1D0K A;  2VQF M;  4II7 A;  1JQJ C;  1DGH B;  3T1H M;  1PJJ A;  4JV5 M;  1E32 A;  2DI0 A;  4L78 A;  5IZ7 D;  3TWL A;  1XMO M;  3GRU A;  2OOB A;  3SMP A;  1JR3 A;  1YSY A;  5EP3 A;  4PDG A;  3UK6 A;  5LMN M;  1NVM A;  2R45 A;  2Z7J A;  4AKI A;  3KOX E;  3TWM A;  1K82 A;  2XFS A;  2L7H A;  1GJT A;  3KS4 A;  4LY6 A;  3THG A;  2HCB A;  2YR0 A;  1WJ7 A;  2WSE F;  3SAW A;  3KFU G;  4B08 A;  4DR2 M;  3U60 A;  4Q7J A;  5ITX E;  4L4U A;  3GP1 A;  3U61 A;  3W68 A;  5ITU A;  3U61 B;  1E9S A;  3RFW A;  4GMQ A;  2JY7 A;  4DV3 M;  1R4G A;  1GL7 A;  1ZMU A;  4QNM A;  4LGM A;  1HR0 M;  4BB9 A;  3SC3 A;  3DOA A;  3HHX A;  4G3O A;  4NRV A;  5C18 A;  5IT9 S;  1WHC A;  1QQW A;  3E46 A;  4M9S A;  1WGN A;  1WR1 B;  4LJ8 A;  5ITY A;  4AZF A;  4QOZ C;  3SBJ A;  1KFV A;  1QDT A;  2DWZ B;  1HNZ M;  2BJW A;  1DGB A;  4P16 A;  2EJS A;  4IBK A;  1NJG A;  3HU2 A;  4MGZ E;  3FYD A;  2RGH A;  2QCU A;  1G4A E;  4RNA A;  2KW0 A;  3L2A A;  3JR4 A;  3FTF A;  4X62 M;  2DNA A;  3DA1 A;  4GIT A;  4X65 M;  2LBC A;  2LVQ D;  4LRT A;  7CAT A;  3MJ5 A;  1IXR C;  1W5T A;  5BPV A;  2L2D A;  2LNH C;  4LJ9 A;  1IN6 A;  3SMS A;  1SXJ C;  4JI1 M;  1IY2 A;  3IHP A;  5ITT A;  5FTJ A;  2CWB A;  2QNJ A;  2YFQ A;  4LJ5 A;  1OFI A;  4R3D A;  4DR5 M;  1EIJ A;  2Y20 A;  4RKU F;  1G71 A;  1YLA A;  2WSC F;  4LZZ A;  2BWE A;  3WHK A;  3HKP A;  2ZTD A;  1Z5B A;  3VDP A;  3GLF A;  3I04 M;  3DZD A;  4MM3 B;  3SYL A;  4GHA A;  2I7P A;  4LJ7 A;  2KZU A;  4FCV A;  2R44 A;  4EIW A;  2ERC A;  4L8R C;  2G3Q A;  1R2Z A;  2Q2E B;  1HNX M;  2DZO B;  4L6V 6;  4AG6 A;  4LG2 A;  2CV1 A;  3ZH9 B;  4JI5 M;  1UM8 A;  2O5R A;  2DVW B;  2J7N A;  2EA0 A;  1L2B A;  2F5O A;  4ANR A;  2D7G A;  1JB0 F;  1KSF X;  4IBG A;  2X8A A;  4LJ6 A;  1SXJ B;  3GLG B;  5KQD A;  4AKG A;  4I4L A;  4PD2 A;  3PNV A;  2DZN B;  1I94 M;  5E6J A;  1A5T A;  2CFO A;  2QZ4 A;  3VK7 A;  2Z4S A;  3KS8 A;  4IBB A;  2XSZ A;  3HHZ A;  2DAE A;  2FNA A;  3Q8G A;  4NL4 H;  2CUZ A;  3W0F A;  4NSO B;  3U6C A;  4CGY B;  1GAB A;  5E26 A;  4F1I A;  1YUB A;  5ITX A;  2DWL A;  2MJ5 B;  3J27 B;  4QHT A;  1K3X A;  1J09 A;  1E94 E;  2CHV A;  4GKJ M;  3V76 A;  3LVW A;  4CIZ A;  1OFH A;  3A45 A;  4Z6Y A;  2R65 A;  1Q02 A;  3FTD A;  1GKI A;  2XF3 A;  3GLH A;  3GLH B;  5DYI A;  1WIV A;  3BXW A;  3T6P A;  3U6M A;  3KSX A;  3I4Y A;  3C3D A;  4LF9 M;  2K6B A;  1IY1 A;  1QVR A;  5EXP A;  4JI7 M;  2ZAO A;  3I01 M;  3U6E A;  1S3S A;  3EIH A;  3HU3 A;  5EQT A;  5FTK A;  3SFZ A;  2Z3X A;  4IBE A;  3AKZ A;  1DGG A;  4G4R A;  2OQ4 A;  2L4F A;  3NBI A;  1QZE A;  2J7O A;  1NHW C;  2KHH A;  2LHC A;  2R46 A;  3GPX A;  1ZQ9 A;  2Y21 A;  2P5T A;  1IM2 A;  1OAI A;  2EKF A;  2V6Z M;  4OVZ B;  3FRI A;  3FUW A;  3HJQ A;  4IJF A;  4CIS A;  1WGL A;  2FOI C;  3MHV C;  2UUA M;  3SAR A;  4IIW A;  2D7E A;  1GLN A;  4P17 A;  1DO0 A;  4LZJ A;  1N36 M;  4JI4 M;  2F5S A;  2CEA A;  2KNA A;  3CF2 A;  3K1J A;  1PJT A;  3GLI E;  4LF5 M;  1Z59 A;  4GRI A;  3J80 S;  2VDB B;  5ITQ A;  2X4A A;  1YE9 A;  2YQZ A;  1QAN A;  2JUJ A;  3FE3 A;  3GPP A;  4DV4 M;  3U6O A;  3SAV A;  1E9R A;  2ZAM A;  3CGW A;  3M7G A;  1IXZ A;  1N33 M;  2UUB M;  1JR3 E;  3C9P A;  3PVS A;  3GO8 A;  1XXH B;  3T38 A;  4YHH M;  3PXG A;  1NY6 A;  3LMM A;  4LF6 M;  3T1Y M;  3DFZ A;  4A3V B;  1XWI A;  3MK6 A;  2UXC M;  1R6B X;  4QNR A;  3U5Z A;  1VEJ A;  4GC5 A;  3AOE A;  3VLF B;  3GQ3 A;  1L1Z A;  1G59 A;  3VKG A;  4LRS A;  3VDU A;  4AG5 A;  3GLG E;  4GKK M;  2KXE A;  5LMU M;  1TR8 A;  4WP2 A;  1H6U A;  2RGO A;  1BVS A;  3SAT A;  2APL A;  1MN3 A;  3GPY A;  3QAU A;  3TWK A;  2DAG A;  3ZCB B;  3L27 A;  1GJS A;  1LV7 A;  4M0W A;  3QYB A;  4BBA A;  1V92 A;  4DR1 M;  5DFL A;  4B3M M;  1JR3 D;  4FCW A;  1QZM A;  3KVW A;  3M0E A;  3M6A A;  4IBD A;  1N34 M;  3AFH A;  4DV5 M;  3FTE A;  2C5R A;  1MX0 A;  2CHQ A;  4I81 A;  2BNK A;  2CP8 A;  3VK8 A;  1N77 A;  2FFJ A;  1EFU B;  4MGY E;  3A42 A;  1IBM M;  1QYR A;  1T6O A;  2LVN C;  3LW5 F;  3CTW B;  3K8Z A;  1IN8 A;  4JN6 A;  3TPZ A;  5F3W A;  4ZPX A;  2ZM6 M;  2M5Z A;  1OTR A;  2DZL A;  3FRH A;  4FWD A;  1LTM A;  4MGK E;  3FD9 A;  4FD2 A;  4D82 A;  2F5P A;  1D0L A;  2JNH A;  4DR4 M;  2ZAN A;  1R5L A;  2KRK A;  2NQ8 C;  3MMP A;  4GHL A;  1WXQ A;  1GL6 A;  4M0D A;  2JY6 B;  4DUY M;  1F4I A;  5DNY A;  5A2Q S;  1PGY A;  1QAO A;  3GLH E;  2LH0 A;  1NY5 A;  1TDZ A;  2JA2 A;  2LWX A;  1DV0 A;  3AL0 C;  1XXH E;  1QAM A;  2F4V M;  3U6L A;  2B3T A;  3K2L A;  3QYE A;  1G41 A;  3L26 A;  4DV0 M;  2Z8Y M;  3L29 A;  1C7Y A;  2F5N A;  4GH9 A; 
#chains in the Genus database with same CATH homology
 2DEN A;  4F2L A;  1Q02 A;  2MGW A;  2MR9 A;  1AIP C;  1VG5 A;  2L4E A;  1WIV A;  3H4J A;  3T6P A;  2EKK A;  2JZ1 A;  1IFY A;  3GLF E;  2DI0 A;  2JY8 A;  2OOB A;  2KNZ A;  2L4F A;  1QZE A;  2WZJ A;  2KHH A;  1CUK A;  1ZMW A;  1HT2 E;  2EKF A;  1IM2 A;  1OAI A;  1WJ7 A;  2LTU A;  1GO5 A;  3FRI A;  4Q7J A;  1WGL A;  1VEK A;  1P3Q Q;  2KNV A;  3LCV B;  1XB2 B;  2JY7 A;  1DO0 A;  1R4G A;  1ZMU A;  2KNA A;  1UFZ A;  2RRU A;  2JZ0 A;  3GLI E;  4G3O A;  1G3I A;  1NV8 A;  1WHC A;  3E46 A;  1WGN A;  1WR1 B;  2JUJ A;  3FE3 A;  3BBZ A;  2DAI A;  1T43 A;  3K9O A;  4R71 A;  2LVO C;  4UN2 B;  2EJS A;  1NV9 A;  1JR3 E;  1IXS A;  2JP7 A;  2K0B X;  3IEC A;  1G4A E;  2H5X A;  1HT1 E;  2DNA A;  1VEJ A;  2DHY A;  2LBC A;  2LVQ D;  2OOA A;  3LCU A;  2QSF X;  2OO9 A;  3F92 A;  2DKL A;  1VQ1 A;  3GLG E;  1TTE A;  2L2D A;  1TR8 A;  4WP2 A;  1HJP A;  1DO2 A;  3IHP A;  1BVS A;  1MN3 A;  2CWB A;  2QNJ A;  2DAG A;  1HQY E;  1YLA A;  2BWE A;  1V92 A;  5DFL A;  1VDL A;  2ZTD A;  2ZTC A;  2BWB A;  2JY5 A;  3K9P A;  5JI2 E;  1KYI A;  1ZMV A;  2G3Q A;  2R0I A;  2CP8 A;  1OQY A;  2QHO B;  1EFU B;  1VEG A;  2LVP C;  4HEO A;  2K9D A;  1T6O A;  2HAK A;  2DAM A;  2LVN C;  1OTR A;  2DZL A;  3FRH A;  2JNH A;  3MMP A;  1A5T A;  2JY6 B;  1F4I A;  3E21 A;  1SG9 A;  1PGY A;  4DBG B;  2DAE A;  3GLH E;  4GEW A;  2O25 A;  1DV0 A;  2DAK A;  1XXH E;  4F1I A;  2LVA A;  2B3T A;  2HWJ A;  2MJ5 B;  1G41 A;  1E94 E;  1OKS A;  1ZV1 A;  2MRO B;  1C7Y A;  3B89 A;  1Y8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...