2BWBA

Crystal structure of the uba domain of dsk2 from s. cerevisiae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bwbA00
2K0BX 2JZ1A 1G41A 2HWJA 2JY7A 2ZTCA 3GLIE 2EKFA 1ZMWA 1SG9A 1DO2A 1Q02A 2DI0A 2MJ5B 1HT2E 2LVAA 1V92A 1WGNA 2L4EA 2JUJA 2EJSA 5DFLA 3BBZA 1NV8A 3E46A 2B3TA 2KNVA 3IECA 2DAMA 1PGYA 1TTEA 2LVOC 2RRUA 1DV0A 2OO9A 1OQYA 2KHHA 2R0IA 1WJ7A 4R71A 1WR1B 2JY5A 3F92A 2MGWA 2WZJA 3GLFE 1IFYA 4F2LA 1T6OA 1T43A 1MN3A 1ZMUA 2JP7A 1XXHE 2MROB 2OOBA 1VEGA 1A5TA 2DENA 4WP2A 1QZEA 2QNJA 2QSFX 4HEOA 4DBGB 2LVNC 1VEJA 1E94E 3LCUA 1UFZA 1VQ1A 1C7YA 3IHPA 1ZV1A 2HAKA 3E21A 1F4IA 1G4AE 2LBCA 1AIPC 1OAIA 3FRHA 1VEKA 1BVSA 2LVQD 2EKKA 2DKLA 4GEWA 1EFUB 2DAIA 2MR9A 1JR3E 2K9DA 1ZMVA 3T6PA 2G3QA 1NV9A 3GLHE 1IXSA 2DHYA 2DAGA 2ZTDA 2LTUA 2DAEA 1XB2B 1YLAA 2CWBA 2JY8A 2O25A 3B89A 1TR8A 2CP8A 1KYIA 2DNAA 2QHOB 1DO0A 1WIVA 1HQYE 3MMPA 1G3IA 4F1IA 2DAKA 3K9PA 2L4FA 1HT1E 1VG5A 2BWBA 1OTRA 2DZLA 1HJPA 1P3QQ 2OOAA 2JNHA 4UN2B 1IM2A 4G3OA 3FE3A 2JY6B 1WGLA 2KNZA 3K9OA 3H4JA 1GO5A 1CUKA 5JI2E 2L2DA 2KNAA 2JZ0A 3LCVB 1OKSA 4Q7JA 3GLGE 2LVPC 1Y8GA 3FRIA 2H5XA 1R4GA 1WHCA 1VDLA 2BWEA
chains in the Genus database with same CATH superfamily
3I04M 2K0BX 4L6V6 3W67A 1KFVA 2UUCM 2ZTCA 2RGOA 3VK7A 1ZMWA 2BNKA 2C98A 2QP9X 1H6UA 2J7NA 1WGNA 1IXSB 5FLXS 1XXHB 3AL0C 3JR4A 2QENA 2LHGA 3E46A 3MHVC 2APLA 2KNVA 4LRSA 5KPRA 2EA0A 1XNQM 2JWSA 3GRVA 4JI3M 5EXXA 5DYGA 3RE8A 3U6PA 2UUBM 2CHVA 2R0IA 4R71A 1WJ7A 2D7EA 1WR1B 4GMQA 1HQCA 1IN6A 2MGWA 2BJWA 2WZJA 5IWAM 5BR8M 2R6FA 3T1YM 4OU7A 2F5SA 1T6OA 3U61A 3GLFA 1T43A 2JP7A 2M60A 1XXHE 1X37A 1GL7A 2X4AA 1HNWM 4FW9A 5ITTA 2XZUA 2XZFA 1VEGA 4B08A 2VQEM 3U60B 2KRUA 4JI7M 1A5TA 1FJGM 4LZZA 5KQDA 4IBJA 5E26A 2V1CA 1Z5AA 1NVMA 3DFZA 4WP2A 1Z5CA 2XFTA 3GLHB 4KT0F 1K82A 1PRBA 3SARA 4JI4M 1VEJA 1L1TA 4MH0E 4DV1M 3CF6E 2BJVA 1PJIA 3J7AS 3HHYA 1PJTA 4I5SA 2CE7A 4PCZA 3KSJA 2X8AA 5EQTA 1NY6A 3W0FA 4BLCA 5H37D 2LBCA 3BOSA 2DWLA 2F5QA 1AIPC 4OX9M 1EIJA 1OAIA 2GNOA 1I4WA 4LZJA 1BVSA 2KXEA 4GC9A 4NL4H 2L7HA 3L27A 2DKLA 3I4VA 1G71A 1E32A 1VDDA 1EFUB 3FTDA 4B7GA 1QUTA 2DZOB 1C1KA 2QCUA 3T6PA 2G3QA 3AOGA 1IXRC 1DGFA 3GLHE 1IXSA 3KDSE 1XXHA 2K47A 1R2YA 2LTUA 1XB2B 1TR8A 2QHOB 2DNAA 1OAOC 4DV3M 3MMPA 1NO1A 4LRTA 3TQSA 4F1IA 2R18A 4YHHM 4KHPM 1SXJB 2UXDM 4OVZB 3HHWA 3SAVA 2UUAM 4G4QA 5KQ8A 3GP1A 1IXZA 2O01F 2OOAA 4NSRA 1IM2A 4HL4A 4DV2M 3LMMA 5ITRA 4LF6M 2UU9M 4LF7M 4M0WA 2K6BA 3FKEA 3U60A 5ITUA 1NJGA 3K92A 3GLIB 3HU1A 2XSZA 1GO5A 3LVVA 3SMPA 2FS1A 2ZBKB 4G6ZA 2L6OA 1SXJE 2L2DA 3GLHA 3GPUA 4L78A 1W5SA 3AOEA 3FTCA 1TDHA 2KNAA 1YSYA 4OW0A 4DV0M 5F3WA 2DWMA 3LCVB 4MM3B 1V33A 1Z59A 4M9XA 1Z6TA 2XSZD 2KA6B 1E9SA 1NHWC 2LVPC 4D82A 4CISA 3GLGA 2H5XA 3U6LA 1G8PA 4B7HA 3ZQJA 3AJIB 3VLFB 4D81A 5EP4A 4B3RM 3DOAA 4ZPXA 1PJJA 1E9RA 2ERCA 2JZ1A 3E4RA 2HWJA 3E9SA 4FWGA 4FWDA 4S12A 2EKFA 5FTNA 3GLIE 1DGHB 3U61B 4ITQA 3GLFB 1MX0A 2MJ5B 3UGJA 1XNRM 2LVAA 1V92A 2L4EA 5DFLA 3BBZA 3THGA 4II7A 3IECA 2DAMA 3Q8GA 1PGYA 4RNAA 3R8FA 1TTEA 1HNXM 5IT9S 1SXJA 4K0KM 2OO9A 4I8OA 4OVZA 4YY3M 4GC5A 5DNYA 1KSFX 2L09A 4DUZM 1QAQA 3F92A 4RKUF 4GITA 3GLFE 4F2LA 1SXJD 2LNHC 2VQFM 4LFCM 1IN4A 3HJ8A 4TUWA 1G59A 1MN3A 2I7NA 5ITXE 4DV4M 4G4NA 2DXIA 2MROB 2XGNA 1GJTA 3JAMS 4RF0A 2OOBA 3KP0E 3TE6A 3GLIA 3SAUA 3L25A 2EUCA 4AW4A 3B7ZA 4IBIA 4LJ9A 5FTLA 1QZEA 2QSFX 4DBGB 5FTMA 1N34M 4P16A 2LVNC 2ZANA 2QQ8A 3FUVA 3AKZA 4DR5M 3NBXX 5EXPA 1ZAEA 2LH0A 2P5TA 3KS8A 1VQ1A 2JA2A 1T3TA 3HHZA 5KPTA 1NNUC 1N36M 3IG5A 1R6BX 4EIWA 3IHPA 4M9ZA 1OFIA 3QYBA 4LGYA 2X49A 3ZC7B 3A45A 4JN6A 3FRHA 3WHLA 2CUZA 2LVQD 4CGYB 2EKKA 1HR0M 7CATA 1OIPA 2Z3XA 1DGHA 3FUTA 3UK6A 2CV0A 4B3TM 1JR3E 3EIHA 2HHHM 3FUWA 3HU2A 4IBDA 1OJLA 4HLQA 4MGKE 4M9SA 5ITXA 2G5GX 1TH4A 5LMNM 4NSOB 5EP2A 1QANA 1IN5A 2O25A 2CWBA 2JY8A 3LQQA 4CJ6A 2WSEF 5E6JA 4BBAA 3GQ3A 1DO0A 1WIVA 1HQYE 1K3XA 2F5PA 2M5ZA 1DGGA 3K9PA 3KFUG 1LV7A 2L4FA 2RKOA 3L2AA 3TPZA 1VG5A 1V34A 4LJ4A 3FUUA 1MJGM 2R62A 4Y28F 3GLGB 4AQYM 2QPAA 3J7BA 3UZUA 2JNHA 3M0EA 3C58A 4JI5M 4G3OA 3SYKA 4X62M 3FE3A 2QZ4A 2C99A 2HKJA 3HJSA 2LXEA 5EP1A 1DGBA 1N75A 4KODA 1WGLA 3WHKA 2KNZA 5C18A 3GQ5A 1JR3A 3H4JA 4GKKM 4FCVA 3D8LA 1CUKA 3FD9A 2DHRA 1R7RA 5ITQA 1EE8A 2JZ0A 3C3EA 4AG5A 1OKSA 2NQ8C 1JR3D 1Q39A 1RU3A 4KLNA 3GLGE 4P17A 2EO2A 5KO3A 4FCTA 4GRIA 1R4GA 2XFSA 3GPPA 5LMUM 2BWEA 8CATA 2G8LA 4DR1M 2FE8A 4CIZA 3Q8XA 4LCBA 4LJ5A 3KOYE 4JI6M 1DO2A 4NRWA 3RGSA 1HT2E 4X65M 4GH9A 1QDRA 4LJ7A 3U6DA 4JI1M 2UXBM 3QWLA 1NV8A 2H1RA 3L29A 3FYDA 1IQPA 1GVNA 1QAMA 4WW0A 3HHXA 3HKPA 2CRUA 2LVOC 2R4EA 4LFBM 1XMOM 2Y0TA 3CTWB 5BPVA 3T38A 1NSFA 2KHHA 3IG8A 4I4LA 5EP3A 3TWMA 4AKGA 3KOZE 5IREB 4PDIA 5FSWA 3FYCA 3SAWA 2JY5A 2CHGA 4DR4M 2XH9A 4AI6A 3KXEC 3C9PA 3KOWE 3C3DA 1MU5A 4FVMA 2XEPA 3A46A 1QVRA 2VF8A 1XC8A 2C9OA 1J5EM 3J27B 4GKJM 2R45A 5DYIA 1GJSA 4DV5M 2DENA 5A2QS 4PDGA 3GPYA 1QYRA 4HEOA 4G4OA 4AG6A 1I94M 3PNYA 2F5NA 3MJ5A 3QAUA 3LCUA 4DUYM 4CHTB 2N35A 1UFZA 3FUXA 2A5YB 3B9PA 3HJQA 4L16A 3U6CA 1R2ZA 1C7YA 1Q3CA 3GRRA 3GQ4A 4JV5M 1ZV1A 2HAKA 2VIIA 3E21A 1G4AE 4R7GA 3U6EA 3U5ZA 4L15A 1YE9A 1PJQA 3NWLA 2R65A 4XBOA 3DZDA 3EIEA 2XLJA 2GQFA 1QUSA 3T1HM 4GEWA 2YR0A 4I81A 2DWZB 4W5WA 3K1JA 1OFHA 1ZMVA 3PFIA 1J09A 2AHMA 2KRKA 2YQZA 3CGWA 1NV9A 3LVWA 4GHAA 3AFHA 2Z7JA 3RGPA 1LTMA 4LF4M 2DAEA 4Z8XA 1YLAA 3K2LA 3FTEA 4FWHA 3BXWA 3B89A 2Z4RA 4LF5M 2CP8A 4JXJA 4MGZE 1HNZM 4QOSA 1G3IA 1SXJC 3GRYA 3SBJA 1D0MA 3I01M 3SYLA 4FD2A 3B74A 1OTRA 2LWXA 4JI8M 2Y21A 3LQRA 3TWLA 4B7FA 4IJFA 3TL4X 3KSXA 5FTJA 3GPXA 4IBEA 2Z8YM 2OQ4A 2LHCA 1HJPA 1P3QQ 2J5YA 5FTKA 3W68A 4UN2B 1GLNA 4LJAA 1TF0B 1PJSA 4LG2A 4DV7M 3K8ZA 4IIWA 2WSCF 3PXGA 1L8QA 1TGUA 2D7GA 1F4IA 2VDBB 3I51A 4L4UA 4MGHA 1K3WA 4DR7M 2Q2EB 4QNRA 3W0LB 4LF8M 3UJNA 3SMSA 1IBLM 1N33M 4IBCA 3HU3A 3D8BA 3M7GA 4Q7JA 2VF7A 3SC3A 5JI3E 4DR2M 3FRIA 1IN7A 3KP1E 4DR3M 2O5RA 1L2CA 3KW6A 1VDLA 2R46A 3T15A 4QHSA 4IBBA 4M0DA 5L8RF 4BB9A 1G41A 3AV0A 2JY7A 1J7KA 3A98B 4PT5A 1L2BA 1SG9A 1L1ZA 3RFWA 5GKNA 1IBMM 1Q02A 2DI0A 1TH2A 2ZAOA 3J81S 4JYAM 3J2PB 1OIZA 4NRVA 3U6QA 2JUJA 2EJSA 4X64M 1PM5A 3SFZA 2B3TA 4RF1A 4JI2M 2C96A 2XF3A 1NNJA 4AKHA 2R4JA 3H4MA 1QQWA 2HL7A 3HY5A 2RRUA 4JI0M 1DV0A 1XWIA 1FNNA 2CFOA 3GO8A 3B7QA 3QYEA 1OQYA 2FFJA 2FH0A 4IBKA 2I7PA 4ANRA 4KO8A 2ZAMA 3U5ZB 2RGHA 1IFYA 5IZ7D 1QZMA 4B3MM 4AKIA 2F5OA 2JXNA 5C1BA 2DWNA 1ZMUA 4LJ6A 3ZH9B 5EXSA 1IY2A 3SASA 4L8RC 1JB0F 3SHGB 2DVWB 1N77A 4G4RA 1IY1A 1Z5BA 1ORYB 2QNJA 1NHGC 2V6ZM 3DA1A 4NXMM 1IN8A 3R9XB 2OPFA 1E94E 4XGIA 1TDZA 2Y0QA 3VDUA 4FCWA 2QBYB 3I4YA 5KPZA 4QHTA 3SHFA 1R5LA 2FOIC 3HX3A 2HCBA 3HGIA 4IBGA 2WSFF 1IBKM 3M6AA 4REZA 4MGYE 3KOXE 3CF0A 1VEKA 1TH3A 4R3DA 2CHQA 3L26A 4GHLA 1N78A 2E5LM 4D80A 4DV6M 3U6SA 3HZJA 1YUBA 3LW5F 2DAIA 2KZUA 1Q3BA 1XHBA 4LFAM 2MR9A 4DR6M 2K9DA 1XMQM 4A3VB 4AZFA 3PNVA 3V76A 4WURA 2DHYA 3ILKA 3U6MA 3B7NA 2KDLA 2DAGA 4QNMA 2V1UA 2J7OA 2ZTDA 1D0LA 5EJCA 2Z4SA 3KVWA 2FNAA 4LJ8A 3J80S 5EXTA 1KYIA 4QOZC 3A42A 4MB7A 1JQJC 3AOEC 4XK8F 2D7HA 4NOOB 1S3SA 2DAKA 4LGMA 1QDTA 3OTOM 2DZNB 1HT1E 2BWBA 2Y20A 1L2DA 2F4VM 4B3SM 3ZCBB 4LF9M 1W5TA 4IJEA 5ITYA 3VFDA 2DZLA 2KZSA 1NJFA 3PVSA 4NC6A 3CF2A 3TWKA 1AUAA 3MK6A 4IBFA 1GKIA 4PD2A 1N32M 2JY6B 4X66M 2C9CA 3VDPA 2KW0A 1D2NA 2YFQA 2CEAA 3VKHA 1QAOA 3L28A 3K9OA 3UMMA 4MGIE 4NXNM 1UM8A 5JI2E 4GIPA 3VKGA 2MH8A 2KEBA 2C5RA 2UXCM 2R44A 3NBIA 3JR5A 2CV2A 2QBYA 3KS4A 3GRUA 3VK8A 2ZM6M 3U6OA 3SATA 1ZQ9A 1Y8GA 4Z6YA 1IY0A 2L7IA 3FTFA 2YNMD 1GABA 1NY5A 3HWSA 2W82A 1WHCA 4LY6A 2CV1A 1D0KA 1GL6A 1WXQA
chains in the Genus database with same CATH topology
2K0BX 2JZ1A 1G41A 2HWJA 2JY7A 2ZTCA 3GLIE 2EKFA 1ZMWA 1SG9A 1DO2A 1Q02A 2DI0A 2MJ5B 1HT2E 2LVAA 1V92A 1WGNA 2L4EA 2JUJA 2EJSA 5DFLA 3BBZA 1NV8A 3E46A 2B3TA 2KNVA 3IECA 2DAMA 1PGYA 1TTEA 2LVOC 2RRUA 1DV0A 2OO9A 1OQYA 2KHHA 2R0IA 1WJ7A 4R71A 1WR1B 2JY5A 3F92A 2MGWA 2WZJA 3GLFE 1IFYA 4F2LA 1T6OA 1T43A 1MN3A 1ZMUA 2JP7A 1XXHE 2MROB 2OOBA 1VEGA 1A5TA 2DENA 4WP2A 1QZEA 2QNJA 2QSFX 4HEOA 4DBGB 2LVNC 1VEJA 1E94E 3LCUA 1UFZA 1VQ1A 1C7YA 3IHPA 1ZV1A 2HAKA 3E21A 1F4IA 1G4AE 2LBCA 1AIPC 1OAIA 3FRHA 1VEKA 1BVSA 2LVQD 2EKKA 2DKLA 4GEWA 1EFUB 2DAIA 2MR9A 1JR3E 2K9DA 1ZMVA 3T6PA 2G3QA 1NV9A 3GLHE 1IXSA 2DHYA 2DAGA 2ZTDA 2LTUA 2DAEA 1XB2B 1YLAA 2CWBA 2JY8A 2O25A 3B89A 1TR8A 2CP8A 1KYIA 2DNAA 2QHOB 1DO0A 1WIVA 1HQYE 3MMPA 1G3IA 4F1IA 2DAKA 3K9PA 2L4FA 1HT1E 1VG5A 2BWBA 1OTRA 2DZLA 1HJPA 1P3QQ 2OOAA 2JNHA 4UN2B 1IM2A 4G3OA 3FE3A 2JY6B 1WGLA 2KNZA 3K9OA 3H4JA 1GO5A 1CUKA 5JI2E 2L2DA 2KNAA 2JZ0A 3LCVB 1OKSA 4Q7JA 3GLGE 2LVPC 1Y8GA 3FRIA 2H5XA 1R4GA 1WHCA 1VDLA 2BWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0B X;  2JZ1 A;  1G41 A;  2HWJ A;  2JY7 A;  2ZTC A;  3GLI E;  2EKF A;  1ZMW A;  1SG9 A;  1DO2 A;  1Q02 A;  2DI0 A;  2MJ5 B;  1HT2 E;  2LVA A;  1V92 A;  1WGN A;  2L4E A;  2JUJ A;  2EJS A;  5DFL A;  3BBZ A;  1NV8 A;  3E46 A;  2B3T A;  2KNV A;  3IEC A;  2DAM A;  1PGY A;  1TTE A;  2LVO C;  2RRU A;  1DV0 A;  2OO9 A;  1OQY A;  2KHH A;  2R0I A;  1WJ7 A;  4R71 A;  1WR1 B;  2JY5 A;  3F92 A;  2MGW A;  2WZJ A;  3GLF E;  1IFY A;  4F2L A;  1T6O A;  1T43 A;  1MN3 A;  1ZMU A;  2JP7 A;  1XXH E;  2MRO B;  2OOB A;  1VEG A;  1A5T A;  2DEN A;  4WP2 A;  1QZE A;  2QNJ A;  2QSF X;  4HEO A;  4DBG B;  2LVN C;  1VEJ A;  1E94 E;  3LCU A;  1UFZ A;  1VQ1 A;  1C7Y A;  3IHP A;  1ZV1 A;  2HAK A;  3E21 A;  1F4I A;  1G4A E;  2LBC A;  1AIP C;  1OAI A;  3FRH A;  1VEK A;  1BVS A;  2LVQ D;  2EKK A;  2DKL A;  4GEW A;  1EFU B;  2DAI A;  2MR9 A;  1JR3 E;  2K9D A;  1ZMV A;  3T6P A;  2G3Q A;  1NV9 A;  3GLH E;  1IXS A;  2DHY A;  2DAG A;  2ZTD A;  2LTU A;  2DAE A;  1XB2 B;  1YLA A;  2CWB A;  2JY8 A;  2O25 A;  3B89 A;  1TR8 A;  2CP8 A;  1KYI A;  2DNA A;  2QHO B;  1DO0 A;  1WIV A;  1HQY E;  3MMP A;  1G3I A;  4F1I A;  2DAK A;  3K9P A;  2L4F A;  1HT1 E;  1VG5 A;  2BWB A;  1OTR A;  2DZL A;  1HJP A;  1P3Q Q;  2OOA A;  2JNH A;  4UN2 B;  1IM2 A;  4G3O A;  3FE3 A;  2JY6 B;  1WGL A;  2KNZ A;  3K9O A;  3H4J A;  1GO5 A;  1CUK A;  5JI2 E;  2L2D A;  2KNA A;  2JZ0 A;  3LCV B;  1OKS A;  4Q7J A;  3GLG E;  2LVP C;  1Y8G A;  3FRI A;  2H5X A;  1R4G A;  1WHC A;  1VDL A;  2BWE A; 
#chains in the Genus database with same CATH topology
 3I04 M;  2K0B X;  4L6V 6;  3W67 A;  1KFV A;  2UUC M;  2ZTC A;  2RGO A;  3VK7 A;  1ZMW A;  2BNK A;  2C98 A;  2QP9 X;  1H6U A;  2J7N A;  1WGN A;  1IXS B;  5FLX S;  1XXH B;  3AL0 C;  3JR4 A;  2QEN A;  2LHG A;  3E46 A;  3MHV C;  2APL A;  2KNV A;  4LRS A;  5KPR A;  2EA0 A;  1XNQ M;  2JWS A;  3GRV A;  4JI3 M;  5EXX A;  5DYG A;  3RE8 A;  3U6P A;  2UUB M;  2CHV A;  2R0I A;  4R71 A;  1WJ7 A;  2D7E A;  1WR1 B;  4GMQ A;  1HQC A;  1IN6 A;  2MGW A;  2BJW A;  2WZJ A;  5IWA M;  5BR8 M;  2R6F A;  3T1Y M;  4OU7 A;  2F5S A;  1T6O A;  3U61 A;  3GLF A;  1T43 A;  2JP7 A;  2M60 A;  1XXH E;  1X37 A;  1GL7 A;  2X4A A;  1HNW M;  4FW9 A;  5ITT A;  2XZU A;  2XZF A;  1VEG A;  4B08 A;  2VQE M;  3U60 B;  2KRU A;  4JI7 M;  1A5T A;  1FJG M;  4LZZ A;  5KQD A;  4IBJ A;  5E26 A;  2V1C A;  1Z5A A;  1NVM A;  3DFZ A;  4WP2 A;  1Z5C A;  2XFT A;  3GLH B;  4KT0 F;  1K82 A;  1PRB A;  3SAR A;  4JI4 M;  1VEJ A;  1L1T A;  4MH0 E;  4DV1 M;  3CF6 E;  2BJV A;  1PJI A;  3J7A S;  3HHY A;  1PJT A;  4I5S A;  2CE7 A;  4PCZ A;  3KSJ A;  2X8A A;  5EQT A;  1NY6 A;  3W0F A;  4BLC A;  5H37 D;  2LBC A;  3BOS A;  2DWL A;  2F5Q A;  1AIP C;  4OX9 M;  1EIJ A;  1OAI A;  2GNO A;  1I4W A;  4LZJ A;  1BVS A;  2KXE A;  4GC9 A;  4NL4 H;  2L7H A;  3L27 A;  2DKL A;  3I4V A;  1G71 A;  1E32 A;  1VDD A;  1EFU B;  3FTD A;  4B7G A;  1QUT A;  2DZO B;  1C1K A;  2QCU A;  3T6P A;  2G3Q A;  3AOG A;  1IXR C;  1DGF A;  3GLH E;  1IXS A;  3KDS E;  1XXH A;  2K47 A;  1R2Y A;  2LTU A;  1XB2 B;  1TR8 A;  2QHO B;  2DNA A;  1OAO C;  4DV3 M;  3MMP A;  1NO1 A;  4LRT A;  3TQS A;  4F1I A;  2R18 A;  4YHH M;  4KHP M;  1SXJ B;  2UXD M;  4OVZ B;  3HHW A;  3SAV A;  2UUA M;  4G4Q A;  5KQ8 A;  3GP1 A;  1IXZ A;  2O01 F;  2OOA A;  4NSR A;  1IM2 A;  4HL4 A;  4DV2 M;  3LMM A;  5ITR A;  4LF6 M;  2UU9 M;  4LF7 M;  4M0W A;  2K6B A;  3FKE A;  3U60 A;  5ITU A;  1NJG A;  3K92 A;  3GLI B;  3HU1 A;  2XSZ A;  1GO5 A;  3LVV A;  3SMP A;  2FS1 A;  2ZBK B;  4G6Z A;  2L6O A;  1SXJ E;  2L2D A;  3GLH A;  3GPU A;  4L78 A;  1W5S A;  3AOE A;  3FTC A;  1TDH A;  2KNA A;  1YSY A;  4OW0 A;  4DV0 M;  5F3W A;  2DWM A;  3LCV B;  4MM3 B;  1V33 A;  1Z59 A;  4M9X A;  1Z6T A;  2XSZ D;  2KA6 B;  1E9S A;  1NHW C;  2LVP C;  4D82 A;  4CIS A;  3GLG A;  2H5X A;  3U6L A;  1G8P A;  4B7H A;  3ZQJ A;  3AJI B;  3VLF B;  4D81 A;  5EP4 A;  4B3R M;  3DOA A;  4ZPX A;  1PJJ A;  1E9R A;  2ERC A;  2JZ1 A;  3E4R A;  2HWJ A;  3E9S A;  4FWG A;  4FWD A;  4S12 A;  2EKF A;  5FTN A;  3GLI E;  1DGH B;  3U61 B;  4ITQ A;  3GLF B;  1MX0 A;  2MJ5 B;  3UGJ A;  1XNR M;  2LVA A;  1V92 A;  2L4E A;  5DFL A;  3BBZ A;  3THG A;  4II7 A;  3IEC A;  2DAM A;  3Q8G A;  1PGY A;  4RNA A;  3R8F A;  1TTE A;  1HNX M;  5IT9 S;  1SXJ A;  4K0K M;  2OO9 A;  4I8O A;  4OVZ A;  4YY3 M;  4GC5 A;  5DNY A;  1KSF X;  2L09 A;  4DUZ M;  1QAQ A;  3F92 A;  4RKU F;  4GIT A;  3GLF E;  4F2L A;  1SXJ D;  2LNH C;  2VQF M;  4LFC M;  1IN4 A;  3HJ8 A;  4TUW A;  1G59 A;  1MN3 A;  2I7N A;  5ITX E;  4DV4 M;  4G4N A;  2DXI A;  2MRO B;  2XGN A;  1GJT A;  3JAM S;  4RF0 A;  2OOB A;  3KP0 E;  3TE6 A;  3GLI A;  3SAU A;  3L25 A;  2EUC A;  4AW4 A;  3B7Z A;  4IBI A;  4LJ9 A;  5FTL A;  1QZE A;  2QSF X;  4DBG B;  5FTM A;  1N34 M;  4P16 A;  2LVN C;  2ZAN A;  2QQ8 A;  3FUV A;  3AKZ A;  4DR5 M;  3NBX X;  5EXP A;  1ZAE A;  2LH0 A;  2P5T A;  3KS8 A;  1VQ1 A;  2JA2 A;  1T3T A;  3HHZ A;  5KPT A;  1NNU C;  1N36 M;  3IG5 A;  1R6B X;  4EIW A;  3IHP A;  4M9Z A;  1OFI A;  3QYB A;  4LGY A;  2X49 A;  3ZC7 B;  3A45 A;  4JN6 A;  3FRH A;  3WHL A;  2CUZ A;  2LVQ D;  4CGY B;  2EKK A;  1HR0 M;  7CAT A;  1OIP A;  2Z3X A;  1DGH A;  3FUT A;  3UK6 A;  2CV0 A;  4B3T M;  1JR3 E;  3EIH A;  2HHH M;  3FUW A;  3HU2 A;  4IBD A;  1OJL A;  4HLQ A;  4MGK E;  4M9S A;  5ITX A;  2G5G X;  1TH4 A;  5LMN M;  4NSO B;  5EP2 A;  1QAN A;  1IN5 A;  2O25 A;  2CWB A;  2JY8 A;  3LQQ A;  4CJ6 A;  2WSE F;  5E6J A;  4BBA A;  3GQ3 A;  1DO0 A;  1WIV A;  1HQY E;  1K3X A;  2F5P A;  2M5Z A;  1DGG A;  3K9P A;  3KFU G;  1LV7 A;  2L4F A;  2RKO A;  3L2A A;  3TPZ A;  1VG5 A;  1V34 A;  4LJ4 A;  3FUU A;  1MJG M;  2R62 A;  4Y28 F;  3GLG B;  4AQY M;  2QPA A;  3J7B A;  3UZU A;  2JNH A;  3M0E A;  3C58 A;  4JI5 M;  4G3O A;  3SYK A;  4X62 M;  3FE3 A;  2QZ4 A;  2C99 A;  2HKJ A;  3HJS A;  2LXE A;  5EP1 A;  1DGB A;  1N75 A;  4KOD A;  1WGL A;  3WHK A;  2KNZ A;  5C18 A;  3GQ5 A;  1JR3 A;  3H4J A;  4GKK M;  4FCV A;  3D8L A;  1CUK A;  3FD9 A;  2DHR A;  1R7R A;  5ITQ A;  1EE8 A;  2JZ0 A;  3C3E A;  4AG5 A;  1OKS A;  2NQ8 C;  1JR3 D;  1Q39 A;  1RU3 A;  4KLN A;  3GLG E;  4P17 A;  2EO2 A;  5KO3 A;  4FCT A;  4GRI A;  1R4G A;  2XFS A;  3GPP A;  5LMU M;  2BWE A;  8CAT A;  2G8L A;  4DR1 M;  2FE8 A;  4CIZ A;  3Q8X A;  4LCB A;  4LJ5 A;  3KOY E;  4JI6 M;  1DO2 A;  4NRW A;  3RGS A;  1HT2 E;  4X65 M;  4GH9 A;  1QDR A;  4LJ7 A;  3U6D A;  4JI1 M;  2UXB M;  3QWL A;  1NV8 A;  2H1R A;  3L29 A;  3FYD A;  1IQP A;  1GVN A;  1QAM A;  4WW0 A;  3HHX A;  3HKP A;  2CRU A;  2LVO C;  2R4E A;  4LFB M;  1XMO M;  2Y0T A;  3CTW B;  5BPV A;  3T38 A;  1NSF A;  2KHH A;  3IG8 A;  4I4L A;  5EP3 A;  3TWM A;  4AKG A;  3KOZ E;  5IRE B;  4PDI A;  5FSW A;  3FYC A;  3SAW A;  2JY5 A;  2CHG A;  4DR4 M;  2XH9 A;  4AI6 A;  3KXE C;  3C9P A;  3KOW E;  3C3D A;  1MU5 A;  4FVM A;  2XEP A;  3A46 A;  1QVR A;  2VF8 A;  1XC8 A;  2C9O A;  1J5E M;  3J27 B;  4GKJ M;  2R45 A;  5DYI A;  1GJS A;  4DV5 M;  2DEN A;  5A2Q S;  4PDG A;  3GPY A;  1QYR A;  4HEO A;  4G4O A;  4AG6 A;  1I94 M;  3PNY A;  2F5N A;  3MJ5 A;  3QAU A;  3LCU A;  4DUY M;  4CHT B;  2N35 A;  1UFZ A;  3FUX A;  2A5Y B;  3B9P A;  3HJQ A;  4L16 A;  3U6C A;  1R2Z A;  1C7Y A;  1Q3C A;  3GRR A;  3GQ4 A;  4JV5 M;  1ZV1 A;  2HAK A;  2VII A;  3E21 A;  1G4A E;  4R7G A;  3U6E A;  3U5Z A;  4L15 A;  1YE9 A;  1PJQ A;  3NWL A;  2R65 A;  4XBO A;  3DZD A;  3EIE A;  2XLJ A;  2GQF A;  1QUS A;  3T1H M;  4GEW A;  2YR0 A;  4I81 A;  2DWZ B;  4W5W A;  3K1J A;  1OFH A;  1ZMV A;  3PFI A;  1J09 A;  2AHM A;  2KRK A;  2YQZ A;  3CGW A;  1NV9 A;  3LVW A;  4GHA A;  3AFH A;  2Z7J A;  3RGP A;  1LTM A;  4LF4 M;  2DAE A;  4Z8X A;  1YLA A;  3K2L A;  3FTE A;  4FWH A;  3BXW A;  3B89 A;  2Z4R A;  4LF5 M;  2CP8 A;  4JXJ A;  4MGZ E;  1HNZ M;  4QOS A;  1G3I A;  1SXJ C;  3GRY A;  3SBJ A;  1D0M A;  3I01 M;  3SYL A;  4FD2 A;  3B74 A;  1OTR A;  2LWX A;  4JI8 M;  2Y21 A;  3LQR A;  3TWL A;  4B7F A;  4IJF A;  3TL4 X;  3KSX A;  5FTJ A;  3GPX A;  4IBE A;  2Z8Y M;  2OQ4 A;  2LHC A;  1HJP A;  1P3Q Q;  2J5Y A;  5FTK A;  3W68 A;  4UN2 B;  1GLN A;  4LJA A;  1TF0 B;  1PJS A;  4LG2 A;  4DV7 M;  3K8Z A;  4IIW A;  2WSC F;  3PXG A;  1L8Q A;  1TGU A;  2D7G A;  1F4I A;  2VDB B;  3I51 A;  4L4U A;  4MGH A;  1K3W A;  4DR7 M;  2Q2E B;  4QNR A;  3W0L B;  4LF8 M;  3UJN A;  3SMS A;  1IBL M;  1N33 M;  4IBC A;  3HU3 A;  3D8B A;  3M7G A;  4Q7J A;  2VF7 A;  3SC3 A;  5JI3 E;  4DR2 M;  3FRI A;  1IN7 A;  3KP1 E;  4DR3 M;  2O5R A;  1L2C A;  3KW6 A;  1VDL A;  2R46 A;  3T15 A;  4QHS A;  4IBB A;  4M0D A;  5L8R F;  4BB9 A;  1G41 A;  3AV0 A;  2JY7 A;  1J7K A;  3A98 B;  4PT5 A;  1L2B A;  1SG9 A;  1L1Z A;  3RFW A;  5GKN A;  1IBM M;  1Q02 A;  2DI0 A;  1TH2 A;  2ZAO A;  3J81 S;  4JYA M;  3J2P B;  1OIZ A;  4NRV A;  3U6Q A;  2JUJ A;  2EJS A;  4X64 M;  1PM5 A;  3SFZ A;  2B3T A;  4RF1 A;  4JI2 M;  2C96 A;  2XF3 A;  1NNJ A;  4AKH A;  2R4J A;  3H4M A;  1QQW A;  2HL7 A;  3HY5 A;  2RRU A;  4JI0 M;  1DV0 A;  1XWI A;  1FNN A;  2CFO A;  3GO8 A;  3B7Q A;  3QYE A;  1OQY A;  2FFJ A;  2FH0 A;  4IBK A;  2I7P A;  4ANR A;  4KO8 A;  2ZAM A;  3U5Z B;  2RGH A;  1IFY A;  5IZ7 D;  1QZM A;  4B3M M;  4AKI A;  2F5O A;  2JXN A;  5C1B A;  2DWN A;  1ZMU A;  4LJ6 A;  3ZH9 B;  5EXS A;  1IY2 A;  3SAS A;  4L8R C;  1JB0 F;  3SHG B;  2DVW B;  1N77 A;  4G4R A;  1IY1 A;  1Z5B A;  1ORY B;  2QNJ A;  1NHG C;  2V6Z M;  3DA1 A;  4NXM M;  1IN8 A;  3R9X B;  2OPF A;  1E94 E;  4XGI A;  1TDZ A;  2Y0Q A;  3VDU A;  4FCW A;  2QBY B;  3I4Y A;  5KPZ A;  4QHT A;  3SHF A;  1R5L A;  2FOI C;  3HX3 A;  2HCB A;  3HGI A;  4IBG A;  2WSF F;  1IBK M;  3M6A A;  4REZ A;  4MGY E;  3KOX E;  3CF0 A;  1VEK A;  1TH3 A;  4R3D A;  2CHQ A;  3L26 A;  4GHL A;  1N78 A;  2E5L M;  4D80 A;  4DV6 M;  3U6S A;  3HZJ A;  1YUB A;  3LW5 F;  2DAI A;  2KZU A;  1Q3B A;  1XHB A;  4LFA M;  2MR9 A;  4DR6 M;  2K9D A;  1XMQ M;  4A3V B;  4AZF A;  3PNV A;  3V76 A;  4WUR A;  2DHY A;  3ILK A;  3U6M A;  3B7N A;  2KDL A;  2DAG A;  4QNM A;  2V1U A;  2J7O A;  2ZTD A;  1D0L A;  5EJC A;  2Z4S A;  3KVW A;  2FNA A;  4LJ8 A;  3J80 S;  5EXT A;  1KYI A;  4QOZ C;  3A42 A;  4MB7 A;  1JQJ C;  3AOE C;  4XK8 F;  2D7H A;  4NOO B;  1S3S A;  2DAK A;  4LGM A;  1QDT A;  3OTO M;  2DZN B;  1HT1 E;  2BWB A;  2Y20 A;  1L2D A;  2F4V M;  4B3S M;  3ZCB B;  4LF9 M;  1W5T A;  4IJE A;  5ITY A;  3VFD A;  2DZL A;  2KZS A;  1NJF A;  3PVS A;  4NC6 A;  3CF2 A;  3TWK A;  1AUA A;  3MK6 A;  4IBF A;  1GKI A;  4PD2 A;  1N32 M;  2JY6 B;  4X66 M;  2C9C A;  3VDP A;  2KW0 A;  1D2N A;  2YFQ A;  2CEA A;  3VKH A;  1QAO A;  3L28 A;  3K9O A;  3UMM A;  4MGI E;  4NXN M;  1UM8 A;  5JI2 E;  4GIP A;  3VKG A;  2MH8 A;  2KEB A;  2C5R A;  2UXC M;  2R44 A;  3NBI A;  3JR5 A;  2CV2 A;  2QBY A;  3KS4 A;  3GRU A;  3VK8 A;  2ZM6 M;  3U6O A;  3SAT A;  1ZQ9 A;  1Y8G A;  4Z6Y A;  1IY0 A;  2L7I A;  3FTF A;  2YNM D;  1GAB A;  1NY5 A;  3HWS A;  2W82 A;  1WHC A;  4LY6 A;  2CV1 A;  1D0K A;  1GL6 A;  1WXQ A; 
#chains in the Genus database with same CATH homology
 2K0B X;  2JZ1 A;  1G41 A;  2HWJ A;  2JY7 A;  2ZTC A;  3GLI E;  2EKF A;  1ZMW A;  1SG9 A;  1DO2 A;  1Q02 A;  2DI0 A;  2MJ5 B;  1HT2 E;  2LVA A;  1V92 A;  1WGN A;  2L4E A;  2JUJ A;  2EJS A;  5DFL A;  3BBZ A;  1NV8 A;  3E46 A;  2B3T A;  2KNV A;  3IEC A;  2DAM A;  1PGY A;  1TTE A;  2LVO C;  2RRU A;  1DV0 A;  2OO9 A;  1OQY A;  2KHH A;  2R0I A;  1WJ7 A;  4R71 A;  1WR1 B;  2JY5 A;  3F92 A;  2MGW A;  2WZJ A;  3GLF E;  1IFY A;  4F2L A;  1T6O A;  1T43 A;  1MN3 A;  1ZMU A;  2JP7 A;  1XXH E;  2MRO B;  2OOB A;  1VEG A;  1A5T A;  2DEN A;  4WP2 A;  1QZE A;  2QNJ A;  2QSF X;  4HEO A;  4DBG B;  2LVN C;  1VEJ A;  1E94 E;  3LCU A;  1UFZ A;  1VQ1 A;  1C7Y A;  3IHP A;  1ZV1 A;  2HAK A;  3E21 A;  1F4I A;  1G4A E;  2LBC A;  1AIP C;  1OAI A;  3FRH A;  1VEK A;  1BVS A;  2LVQ D;  2EKK A;  2DKL A;  4GEW A;  1EFU B;  2DAI A;  2MR9 A;  1JR3 E;  2K9D A;  1ZMV A;  3T6P A;  2G3Q A;  1NV9 A;  3GLH E;  1IXS A;  2DHY A;  2DAG A;  2ZTD A;  2LTU A;  2DAE A;  1XB2 B;  1YLA A;  2CWB A;  2JY8 A;  2O25 A;  3B89 A;  1TR8 A;  2CP8 A;  1KYI A;  2DNA A;  2QHO B;  1DO0 A;  1WIV A;  1HQY E;  3MMP A;  1G3I A;  4F1I A;  2DAK A;  3K9P A;  2L4F A;  1HT1 E;  1VG5 A;  2BWB A;  1OTR A;  2DZL A;  1HJP A;  1P3Q Q;  2OOA A;  2JNH A;  4UN2 B;  1IM2 A;  4G3O A;  3FE3 A;  2JY6 B;  1WGL A;  2KNZ A;  3K9O A;  3H4J A;  1GO5 A;  1CUK A;  5JI2 E;  2L2D A;  2KNA A;  2JZ0 A;  3LCV B;  1OKS A;  4Q7J A;  3GLG E;  2LVP C;  1Y8G A;  3FRI A;  2H5X A;  1R4G A;  1WHC A;  1VDL A;  2BWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...