2BWBA

Crystal structure of the uba domain of dsk2 from s. cerevisiae
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
b'LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-LIKE PROTEIN DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bwbA00
1TR8A 1OQYA 2DZLA 1KYIA 1HT2E 2JY7A 2LBCA 3BBZA 2KNAA 3F92A 2QNJA 1G41A 3MMPA 4GEWA 2EJSA 3K9OA 1T6OA 1VDLA 3GLIE 1PGYA 2JY8A 1XXHE 2DKLA 2LVAA 2JP7A 1IFYA 2QSFX 4G3OA 3GLFE 2O25A 1VEGA 1ZV1A 2EKFA 2JNHA 4F2LA 4F1IA 1VEJA 1A5TA 1SG9A 2JZ1A 1OAIA 2G3QA 2KNZA 2ZTCA 2DAEA 1WGNA 2L2DA 2L4EA 1HT1E 3FE3A 5JI2E 2JY5A 2KNVA 2DAMA 1WR1B 1IXSA 2DAIA 2R0IA 1TTEA 3LCVB 1WGLA 3K9PA 1NV9A 1MN3A 2WZJA 2LVPC 2KHHA 3FRIA 1OTRA 1R4GA 1VQ1A 2K9DA 4WP2A 4Q7JA 4UN2B 2BWBA 2DENA 2MROB 3H4JA 2LVQD 2JZ0A 2LVOC 3GLGE 4R71A 1EFUB 1WJ7A 1HQYE 2OO9A 2MGWA 2OOAA 2CP8A 1BVSA 2EKKA 3T6PA 2K0BX 1T43A 3B89A 1C7YA 2JY6B 1OKSA 2H5XA 1G4AE 1E94E 3GLHE 1NV8A 1YLAA 2DHYA 1GO5A 1Q02A 1ZMUA 2HAKA 2ZTDA 1VG5A 2MJ5B 1AIPC 2JUJA 1WHCA 1DO0A 1V92A 4HEOA 4DBGB 1ZMVA 1VEKA 1P3QQ 3E21A 2QHOB 1QZEA 1JR3E 1UFZA 2DAGA 1ZMWA 1CUKA 1WIVA 2L4FA 1F4IA 2LVNC 2B3TA 2DAKA 3LCUA 1HJPA 1DO2A 2OOBA 3IHPA 2BWEA 1IM2A 2RRUA 3E46A 2LTUA 2MR9A 2DI0A 2HWJA 3IECA 1G3IA 1XB2B 5DFLA 1Y8GA 3FRHA 2DNAA 2CWBA 1DV0A
chains in the Genus database with same CATH superfamily
4X65M 1TR8A 4MGYE 2DZNB 4Z8XA 4G4RA 2KNAA 4YY3M 2QNJA 1G41A 3JR4A 2MH8A 3M0EA 4I8OA 4IIWA 2CV0A 1T6OA 3KXEC 1VDLA 4PCZA 1XC8A 3HY5A 3FTCA 2JY8A 5FTNA 5C1BA 4NRWA 3VKHA 2DKLA 2DHRA 2JP7A 1NJFA 4RF1A 1ZQ9A 2QSFX 3D8BA 1IY1A 1HQCA 4XK8F 5ITTA 4IBDA 1L1ZA 3U61B 1VEGA 2EKFA 1SXJB 1D0LA 4WURA 4F2LA 2XEPA 4JXJA 1QYRA 2Y21A 1OJLA 4LF8M 3RGSA 3HU3A 3GLIB 4AQYM 1NHWC 1R6BX 2G3QA 2ZTCA 3W68A 3WHKA 5A2QS 1IQPA 2L2DA 3W0FA 2L4EA 3FE3A 3L25A 2DWLA 5JI2E 1SXJE 2Z4SA 1L2DA 2F5SA 1NJGA 4ANRA 2R0IA 1TTEA 3LCVB 1WGLA 3CF0A 3UZUA 4LJ6A 2M5ZA 2Z7JA 2OQ4A 4A3VB 2Y0QA 1R4GA 4DV6M 1OIPA 2C98A 2KDLA 4WP2A 4YHHM 2R6FA 1GVNA 5EJCA 4IBEA 2CV2A 3TQSA 1MX0A 3AFHA 1TH2A 4LJ8A 4FWDA 4M9ZA 4HL4A 4IBIA 2MGWA 5EP4A 2K47A 2GNOA 1D0KA 3KDSE 3B7QA 3VDUA 1BVSA 4PD2A 3T6PA 2K6BA 1R2YA 4GMQA 4GHAA 1DGHA 1YUBA 4MGHA 3GPUA 2RGHA 3FUXA 1QDTA 4REZA 2JY6B 4JI4M 2BNKA 2KA6B 3NBIA 1G8PA 1G4AE 1OAOC 3U6DA 3MK6A 1V34A 2QCUA 3T1HM 1ORYB 3AJIB 3LQRA 3ZC7B 4GC9A 3FKEA 3FUTA 2DHYA 1N33M 3AL0C 4IBJA 1S3SA 3AV0A 4GC5A 1QAMA 3C3DA 3GLIA 3FTDA 1E32A 2CFOA 5EP3A 2CRUA 3B7ZA 1TDZA 2CV1A 8CATA 2Z3XA 1DO0A 3NWLA 4KT0F 4LGYA 3VK8A 1V92A 2N35A 3HHYA 3V76A 4X64M 2BJWA 2HCBA 5F3WA 2UU9M 3SFZA 1R2ZA 2QHOB 2R45A 2QBYA 1QZEA 4RF0A 1UFZA 2DAGA 3RE8A 3D8LA 1ZMWA 2EO2A 2XH9A 4M9XA 5IREB 3GQ3A 3U6EA 2KW0A 1XNQM 4D80A 1Z5AA 3GRRA 5EP2A 1IXSB 2XFTA 2WSFF 3C3EA 1X37A 4LJ5A 3GQ5A 2G5GX 3SAUA 3VKGA 3TL4X 4IBKA 2UUCM 4B3SM 2D7EA 4NXNM 3THGA 3U6OA 2JA2A 4KO8A 1K82A 3LW5F 4NSOB 1XXHB 3K9PA 1J09A 1LV7A 4G4OA 3TPZA 4LRSA 1KYIA 2CEAA 2JY7A 3F92A 1SXJD 3PNVA 4FD2A 5FTJA 2XLJA 2VQFM 1L2BA 4MGKE 1LTMA 3MMPA 4S12A 3SAWA 3GLGA 4GEWA 2EJSA 3FTFA 3AKZA 2UUAM 3ZH9B 3AOEA 1TF0B 1XXHE 2LWXA 1Z6TA 3SHFA 4DR5M 2VF7A 3TWMA 2C99A 3GLFE 4B7GA 3J27B 2ZM6M 1GKIA 3VDPA 4B08A 4JI5M 1DGFA 3I4VA 1VEJA 3U6SA 4JI7M 1SG9A 1D0MA 2C9OA 1QQWA 2DZOB 5DYIA 3SYLA 1Z5CA 2HL7A 2KNZA 2W82A 3BOSA 3W0LB 3U6LA 3J80S 4JYAM 4XGIA 1HT1E 4NOOB 4D81A 2C5RA 4NXMM 2BJVA 5KPTA 4AKIA 3SASA 2DAMA 3GQ4A 4JI8M 2CUZA 1IXSA 4LFAM 3I01M 2XZFA 1HNZM 2F5PA 3W67A 1MU5A 3E4RA 4M0WA 1YE9A 3GRUA 3R8FA 4HLQA 3TWLA 3EIHA 1T3TA 1N75A 1E9SA 2EUCA 5L8RF 4CISA 4CJ6A 2R4EA 1W5SA 1L8QA 2VQEM 4B3TM 4KHPM 4P16A 3J7BA 4UN2B 2KRKA 2BWBA 2DENA 2FNAA 3IG5A 1GABA 5LMNM 1VDDA 1Z5BA 1HQYE 3PVSA 4QNMA 2FE8A 4LCBA 2O5RA 3GLHB 2CP8A 3KP0E 3JAMS 1XMQM 2R62A 2EKKA 1IN7A 3FUWA 3ZCBB 2XZUA 4LFBM 2F5OA 3DZDA 2E5LM 4EIWA 2YR0A 4LZJA 1KFVA 4LF9M 1KSFX 2H5XA 4X66M 3LQQA 1QAQA 4CHTB 1E94E 3HJSA 5GKNA 3GLHE 2NQ8C 1NV8A 3B7NA 3PXGA 3OTOM 3AOGA 2HKJA 1QUTA 5IWAM 1NNJA 2O01F 2JXNA 4TUWA 1VG5A 5E26A 3HHXA 1FNNA 4Y28F 1QAOA 4GRIA 3M6AA 1GJSA 1OIZA 4X62M 2ERCA 4BB9A 4ITQA 4GKKM 4IBBA 4B7HA 2ZBKB 4DBGB 1ZMVA 3HHZA 2UUBM 3KFUG 3E21A 4FCWA 1PJJA 5FTKA 4XBOA 1DGBA 1XWIA 1JR3E 3K2LA 5KPRA 4JI2M 3C9PA 1JQJC 4ZPXA 4QHTA 4LGMA 3GPYA 2DWNA 3I04M 2RKOA 4FCVA 1F4IA 2DAKA 3LCUA 4OW0A 4M0DA 1QANA 3U61A 1DO2A 2OOBA 1SXJC 2YQZA 3GRYA 3IHPA 1SXJA 1G59A 3HU1A 3HWSA 3KOWE 4DR4M 2VIIA 4NL4H 1EE8A 4II7A 4LG2A 3VFDA 4LJ9A 2HWJA 4LZZA 4GKJM 1XB2B 5DFLA 1N32M 1Y8GA 3FRHA 3K92A 2DNAA 1I94M 5KPZA 1PJQA 3L29A 3CTWB 3BBZA 1WXQA 4K0KM 4I81A 3MJ5A 2UXDM 1IN6A 3LMMA 1R7RA 4AI6A 1IN8A 1OFHA 2V6ZM 4B3MM 3K9OA 4IJEA 4MM3B 1YSYA 4GHLA 4CIZA 3VK7A 3HX3A 1JR3A 2LVAA 1XNRM 1IY0A 3KOYE 4G3OA 1TDHA 3U60B 3FD9A 3KSJA 4AG5A 2O25A 4IBGA 2R18A 5ITQA 4Z6YA 2LXEA 1IBLM 2KRUA 3CF6E 2JNHA 4F1IA 2I7NA 1TGUA 4FW9A 2APLA 1A5TA 2F5QA 4B3RM 2JZ1A 1OAIA 3DOAA 2WSEF 3Q8GA 3LVWA 1L2CA 2DAEA 3QYBA 1WGNA 2UXCM 2LH0A 4G6ZA 3GLFB 2JY5A 2KNVA 4RNAA 4IJFA 2JWSA 3SAVA 1WR1B 4L6V6 4DV1M 4JV5M 3UMMA 4I5SA 2D7GA 2V1UA 4LF6M 1NNUC 2DAIA 3AOEC 2J7NA 5ITXE 2J7OA 1QVRA 5KQDA 1N36M 1NV9A 4GH9A 4JI6M 2FS1A 3B9PA 3PNYA 1XMOM 4MGZE 3HGIA 4AG6A 3I4YA 2R4JA 1C1KA 5EQTA 4QOSA 3SYKA 1NY6A 2CHQA 4OU7A 4Q7JA 2QZ4A 3HJQA 2LVQD 4QHSA 5DYGA 4R71A 1WJ7A 4OVZB 3K8ZA 3Q8XA 4PDIA 4DV4M 2X8AA 4G4QA 1JR3D 5BR8M 3FUVA 2GQFA 1Q39A 3RFWA 1N78A 3J2PB 3R9XB 3SC3A 3HHWA 1I4WA 3KOXE 4LJAA 1PJTA 1PRBA 3B89A 2QP9X 5EXXA 5FTMA 3U60A 4L4UA 5BPVA 1HNXM 1TH3A 2Y20A 2LHCA 2AHMA 3A46A 3U6PA 3FYCA 4NC6A 4GITA 2X49A 1Q02A 2HAKA 5DNYA 3J7AS 2KEBA 2H1RA 2MJ5B 2JUJA 2KZUA 1WHCA 3DFZA 1XXHA 2EA0A 5JI3E 2F4VM 3NBXX 4DR3M 2X4AA 1N77A 3GLFA 4IBFA 4HEOA 1J5EM 3GP1A 1K3XA 4JI1M 2XSZA 2VDBB 4DUYM 3KOZE 3SMPA 3J81S 3VLFB 1NSFA 1NVMA 3T38A 4RKUF 3SARA 2YNMD 4AKHA 2G8LA 4B7FA 2YFQA 3L27A 1QUSA 2L4FA 3L26A 1DGHB 2LVNC 4LY6A 2B3TA 3GRVA 4R7GA 3SMSA 4LF5M 4L15A 2R46A 1H6UA 3H4MA 2BWEA 5E6JA 3FYDA 3FTEA 2I7PA 1IM2A 2R65A 4LJ4A 4WW0A 2RRUA 4JI3M 4OVZA 1EIJA 2MR9A 1PM5A 3U5ZB 2CHGA 2DI0A 1E9RA 3IECA 2LNHC 3SHGB 3UK6A 1W5TA 4L16A 1PJIA 2DWMA 4LRTA 5FSWA 1GL6A 4IBCA 1RU3A 4LJ7A 3U6MA 1DV0A 1OQYA 2DZLA 2LBCA 1GJTA 1HT2E 3B74A 5EXPA 4DUZM 3T1YM 4NRVA 3M7GA 1IXRC 2XF3A 2QBYB 1R5LA 3UGJA 3ZQJA 4KLNA 3QWLA 4OX9M 3JR5A 1L1TA 3GLIE 4KODA 1PGYA 3SBJA 5EXSA 1IFYA 2P5TA 1IY2A 3CF2A 4MH0E 4BBAA 3C58A 3K1JA 5ITRA 1Z59A 2XSZD 4FVMA 3QAUA 5ITYA 1ZV1A 3ILKA 4FWGA 3T15A 3U6CA 2L7IA 5ITUA 3L2AA 2RGOA 4DV0M 4DV5M 4AW4A 3EIEA 3HU2A 3GLHA 3KS4A 1GLNA 4MGIE 3PFIA 4DV7M 2QQ8A 4DR7M 2CE7A 3CGWA 1Q3BA 2XFSA 2D7HA 1AUAA 4P17A 1IN5A 3KS8A 4AZFA 1G71A 1K3WA 4AKGA 5IZ7D 5C18A 1FJGM 1IXZA 2ZAOA 3RGPA 7CATA 3GLGB 2ZAMA 1MN3A 2Q2EB 4PT5A 2WZJA 1ZAEA 2LVPC 3LVVA 5EXTA 5H37D 2KHHA 3FRIA 3QYEA 2M60A 1OTRA 1VQ1A 2K9DA 3GPXA 3U5ZA 2DVWB 4W5WA 1NY5A 1XHBA 2ZANA 2MROB 3H4JA 2CHVA 2JZ0A 2LVOC 1OFIA 3GLGE 4DR1M 1EFUB 2FH0A 3TE6A 4LFCM 1QDRA 2OPFA 2OO9A 3KW6A 5LMUM 1J7KA 2OOAA 1NO1A 1UM8A 1QZMA 2Z4RA 5EP1A 4DR2M 2C9CA 2K0BX 2J5YA 2V1CA 2HHHM 1T43A 3HZJA 4FWHA 1IBMM 1NHGC 2KXEA 2KZSA 3A45A 2FFJA 1OKSA 2L7HA 3L28A 1C7YA 1IN4A 2FOIC 3FUUA 3KP1E 4LF4M 4BLCA 3HKPA 3UJNA 2L09A 3KSXA 4R3DA 2F5NA 4QOZC 1YLAA 5IT9S 1GO5A 1D2NA 4DR6M 1ZMUA 5KQ8A 1HNWM 2ZTDA 1JB0F 2Z8YM 3BXWA 1AIPC 4PDGA 1TH4A 1Q3CA 4QNRA 5FLXS 4L8RC 4GIPA 3DA1A 1V33A 3IG8A 4D82A 4DV2M 3GPPA 1VEKA 1P3QQ 1MJGM 4JN6A 4L78A 2QENA 4NSRA 4G4NA 2XGNA 2L6OA 2QPAA 3KVWA 2LHGA 4I4LA 2DWZB 3HJ8A 4CGYB 3E9SA 5FTLA 4DV3M 1CUKA 1WIVA 2VF8A 2WSCF 1N34M 5KO3A 3U6QA 1GL7A 1HJPA 3GO8A 2R44A 4M9SA 2A5YB 1HR0M 2C96A 4LF7M 2UXBM 2DXIA 1PJSA 3SATA 3MHVC 3E46A 2LTUA 3A42A 3I51A 5ITXA 3TWKA 4JI0M 1G3IA 1IBKM 1DGGA 2Y0TA 4MB7A 3WHLA 3A98B 4FCTA 2CWBA
chains in the Genus database with same CATH topology
1TR8A 1OQYA 2DZLA 1KYIA 1HT2E 2JY7A 2LBCA 3BBZA 2KNAA 3F92A 2QNJA 1G41A 3MMPA 4GEWA 2EJSA 3K9OA 1T6OA 1VDLA 3GLIE 1PGYA 2JY8A 1XXHE 2DKLA 2LVAA 2JP7A 1IFYA 2QSFX 4G3OA 3GLFE 2O25A 1VEGA 1ZV1A 2EKFA 2JNHA 4F2LA 4F1IA 1VEJA 1A5TA 1SG9A 2JZ1A 1OAIA 2G3QA 2KNZA 2ZTCA 2DAEA 1WGNA 2L2DA 2L4EA 1HT1E 3FE3A 5JI2E 2JY5A 2KNVA 2DAMA 1WR1B 1IXSA 2DAIA 2R0IA 1TTEA 3LCVB 1WGLA 3K9PA 1NV9A 1MN3A 2WZJA 2LVPC 2KHHA 3FRIA 1OTRA 1R4GA 1VQ1A 2K9DA 4WP2A 4Q7JA 4UN2B 2BWBA 2DENA 2MROB 3H4JA 2LVQD 2JZ0A 2LVOC 3GLGE 4R71A 1EFUB 1WJ7A 1HQYE 2OO9A 2MGWA 2OOAA 2CP8A 1BVSA 2EKKA 3T6PA 2K0BX 1T43A 3B89A 1C7YA 2JY6B 1OKSA 2H5XA 1G4AE 1E94E 3GLHE 1NV8A 1YLAA 2DHYA 1GO5A 1Q02A 1ZMUA 2HAKA 2ZTDA 1VG5A 2MJ5B 1AIPC 2JUJA 1WHCA 1DO0A 1V92A 4HEOA 4DBGB 1ZMVA 1VEKA 1P3QQ 3E21A 2QHOB 1QZEA 1JR3E 1UFZA 2DAGA 1ZMWA 1CUKA 1WIVA 2L4FA 1F4IA 2LVNC 2B3TA 2DAKA 3LCUA 1HJPA 1DO2A 2OOBA 3IHPA 2BWEA 1IM2A 2RRUA 3E46A 2LTUA 2MR9A 2DI0A 2HWJA 3IECA 1G3IA 1XB2B 5DFLA 1Y8GA 3FRHA 2DNAA 2CWBA 1DV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR8 A;  1OQY A;  2DZL A;  1KYI A;  1HT2 E;  2JY7 A;  2LBC A;  3BBZ A;  2KNA A;  3F92 A;  2QNJ A;  1G41 A;  3MMP A;  4GEW A;  2EJS A;  3K9O A;  1T6O A;  1VDL A;  3GLI E;  1PGY A;  2JY8 A;  1XXH E;  2DKL A;  2LVA A;  2JP7 A;  1IFY A;  2QSF X;  4G3O A;  3GLF E;  2O25 A;  1VEG A;  1ZV1 A;  2EKF A;  2JNH A;  4F2L A;  4F1I A;  1VEJ A;  1A5T A;  1SG9 A;  2JZ1 A;  1OAI A;  2G3Q A;  2KNZ A;  2ZTC A;  2DAE A;  1WGN A;  2L2D A;  2L4E A;  1HT1 E;  3FE3 A;  5JI2 E;  2JY5 A;  2KNV A;  2DAM A;  1WR1 B;  1IXS A;  2DAI A;  2R0I A;  1TTE A;  3LCV B;  1WGL A;  3K9P A;  1NV9 A;  1MN3 A;  2WZJ A;  2LVP C;  2KHH A;  3FRI A;  1OTR A;  1R4G A;  1VQ1 A;  2K9D A;  4WP2 A;  4Q7J A;  4UN2 B;  2BWB A;  2DEN A;  2MRO B;  3H4J A;  2LVQ D;  2JZ0 A;  2LVO C;  3GLG E;  4R71 A;  1EFU B;  1WJ7 A;  1HQY E;  2OO9 A;  2MGW A;  2OOA A;  2CP8 A;  1BVS A;  2EKK A;  3T6P A;  2K0B X;  1T43 A;  3B89 A;  1C7Y A;  2JY6 B;  1OKS A;  2H5X A;  1G4A E;  1E94 E;  3GLH E;  1NV8 A;  1YLA A;  2DHY A;  1GO5 A;  1Q02 A;  1ZMU A;  2HAK A;  2ZTD A;  1VG5 A;  2MJ5 B;  1AIP C;  2JUJ A;  1WHC A;  1DO0 A;  1V92 A;  4HEO A;  4DBG B;  1ZMV A;  1VEK A;  1P3Q Q;  3E21 A;  2QHO B;  1QZE A;  1JR3 E;  1UFZ A;  2DAG A;  1ZMW A;  1CUK A;  1WIV A;  2L4F A;  1F4I A;  2LVN C;  2B3T A;  2DAK A;  3LCU A;  1HJP A;  1DO2 A;  2OOB A;  3IHP A;  2BWE A;  1IM2 A;  2RRU A;  3E46 A;  2LTU A;  2MR9 A;  2DI0 A;  2HWJ A;  3IEC A;  1G3I A;  1XB2 B;  5DFL A;  1Y8G A;  3FRH A;  2DNA A;  2CWB A;  1DV0 A; 
#chains in the Genus database with same CATH topology
 4X65 M;  1TR8 A;  4MGY E;  2DZN B;  4Z8X A;  4G4R A;  2KNA A;  4YY3 M;  2QNJ A;  1G41 A;  3JR4 A;  2MH8 A;  3M0E A;  4I8O A;  4IIW A;  2CV0 A;  1T6O A;  3KXE C;  1VDL A;  4PCZ A;  1XC8 A;  3HY5 A;  3FTC A;  2JY8 A;  5FTN A;  5C1B A;  4NRW A;  3VKH A;  2DKL A;  2DHR A;  2JP7 A;  1NJF A;  4RF1 A;  1ZQ9 A;  2QSF X;  3D8B A;  1IY1 A;  1HQC A;  4XK8 F;  5ITT A;  4IBD A;  1L1Z A;  3U61 B;  1VEG A;  2EKF A;  1SXJ B;  1D0L A;  4WUR A;  4F2L A;  2XEP A;  4JXJ A;  1QYR A;  2Y21 A;  1OJL A;  4LF8 M;  3RGS A;  3HU3 A;  3GLI B;  4AQY M;  1NHW C;  1R6B X;  2G3Q A;  2ZTC A;  3W68 A;  3WHK A;  5A2Q S;  1IQP A;  2L2D A;  3W0F A;  2L4E A;  3FE3 A;  3L25 A;  2DWL A;  5JI2 E;  1SXJ E;  2Z4S A;  1L2D A;  2F5S A;  1NJG A;  4ANR A;  2R0I A;  1TTE A;  3LCV B;  1WGL A;  3CF0 A;  3UZU A;  4LJ6 A;  2M5Z A;  2Z7J A;  2OQ4 A;  4A3V B;  2Y0Q A;  1R4G A;  4DV6 M;  1OIP A;  2C98 A;  2KDL A;  4WP2 A;  4YHH M;  2R6F A;  1GVN A;  5EJC A;  4IBE A;  2CV2 A;  3TQS A;  1MX0 A;  3AFH A;  1TH2 A;  4LJ8 A;  4FWD A;  4M9Z A;  4HL4 A;  4IBI A;  2MGW A;  5EP4 A;  2K47 A;  2GNO A;  1D0K A;  3KDS E;  3B7Q A;  3VDU A;  1BVS A;  4PD2 A;  3T6P A;  2K6B A;  1R2Y A;  4GMQ A;  4GHA A;  1DGH A;  1YUB A;  4MGH A;  3GPU A;  2RGH A;  3FUX A;  1QDT A;  4REZ A;  2JY6 B;  4JI4 M;  2BNK A;  2KA6 B;  3NBI A;  1G8P A;  1G4A E;  1OAO C;  3U6D A;  3MK6 A;  1V34 A;  2QCU A;  3T1H M;  1ORY B;  3AJI B;  3LQR A;  3ZC7 B;  4GC9 A;  3FKE A;  3FUT A;  2DHY A;  1N33 M;  3AL0 C;  4IBJ A;  1S3S A;  3AV0 A;  4GC5 A;  1QAM A;  3C3D A;  3GLI A;  3FTD A;  1E32 A;  2CFO A;  5EP3 A;  2CRU A;  3B7Z A;  1TDZ A;  2CV1 A;  8CAT A;  2Z3X A;  1DO0 A;  3NWL A;  4KT0 F;  4LGY A;  3VK8 A;  1V92 A;  2N35 A;  3HHY A;  3V76 A;  4X64 M;  2BJW A;  2HCB A;  5F3W A;  2UU9 M;  3SFZ A;  1R2Z A;  2QHO B;  2R45 A;  2QBY A;  1QZE A;  4RF0 A;  1UFZ A;  2DAG A;  3RE8 A;  3D8L A;  1ZMW A;  2EO2 A;  2XH9 A;  4M9X A;  5IRE B;  3GQ3 A;  3U6E A;  2KW0 A;  1XNQ M;  4D80 A;  1Z5A A;  3GRR A;  5EP2 A;  1IXS B;  2XFT A;  2WSF F;  3C3E A;  1X37 A;  4LJ5 A;  3GQ5 A;  2G5G X;  3SAU A;  3VKG A;  3TL4 X;  4IBK A;  2UUC M;  4B3S M;  2D7E A;  4NXN M;  3THG A;  3U6O A;  2JA2 A;  4KO8 A;  1K82 A;  3LW5 F;  4NSO B;  1XXH B;  3K9P A;  1J09 A;  1LV7 A;  4G4O A;  3TPZ A;  4LRS A;  1KYI A;  2CEA A;  2JY7 A;  3F92 A;  1SXJ D;  3PNV A;  4FD2 A;  5FTJ A;  2XLJ A;  2VQF M;  1L2B A;  4MGK E;  1LTM A;  3MMP A;  4S12 A;  3SAW A;  3GLG A;  4GEW A;  2EJS A;  3FTF A;  3AKZ A;  2UUA M;  3ZH9 B;  3AOE A;  1TF0 B;  1XXH E;  2LWX A;  1Z6T A;  3SHF A;  4DR5 M;  2VF7 A;  3TWM A;  2C99 A;  3GLF E;  4B7G A;  3J27 B;  2ZM6 M;  1GKI A;  3VDP A;  4B08 A;  4JI5 M;  1DGF A;  3I4V A;  1VEJ A;  3U6S A;  4JI7 M;  1SG9 A;  1D0M A;  2C9O A;  1QQW A;  2DZO B;  5DYI A;  3SYL A;  1Z5C A;  2HL7 A;  2KNZ A;  2W82 A;  3BOS A;  3W0L B;  3U6L A;  3J80 S;  4JYA M;  4XGI A;  1HT1 E;  4NOO B;  4D81 A;  2C5R A;  4NXM M;  2BJV A;  5KPT A;  4AKI A;  3SAS A;  2DAM A;  3GQ4 A;  4JI8 M;  2CUZ A;  1IXS A;  4LFA M;  3I01 M;  2XZF A;  1HNZ M;  2F5P A;  3W67 A;  1MU5 A;  3E4R A;  4M0W A;  1YE9 A;  3GRU A;  3R8F A;  4HLQ A;  3TWL A;  3EIH A;  1T3T A;  1N75 A;  1E9S A;  2EUC A;  5L8R F;  4CIS A;  4CJ6 A;  2R4E A;  1W5S A;  1L8Q A;  2VQE M;  4B3T M;  4KHP M;  4P16 A;  3J7B A;  4UN2 B;  2KRK A;  2BWB A;  2DEN A;  2FNA A;  3IG5 A;  1GAB A;  5LMN M;  1VDD A;  1Z5B A;  1HQY E;  3PVS A;  4QNM A;  2FE8 A;  4LCB A;  2O5R A;  3GLH B;  2CP8 A;  3KP0 E;  3JAM S;  1XMQ M;  2R62 A;  2EKK A;  1IN7 A;  3FUW A;  3ZCB B;  2XZU A;  4LFB M;  2F5O A;  3DZD A;  2E5L M;  4EIW A;  2YR0 A;  4LZJ A;  1KFV A;  4LF9 M;  1KSF X;  2H5X A;  4X66 M;  3LQQ A;  1QAQ A;  4CHT B;  1E94 E;  3HJS A;  5GKN A;  3GLH E;  2NQ8 C;  1NV8 A;  3B7N A;  3PXG A;  3OTO M;  3AOG A;  2HKJ A;  1QUT A;  5IWA M;  1NNJ A;  2O01 F;  2JXN A;  4TUW A;  1VG5 A;  5E26 A;  3HHX A;  1FNN A;  4Y28 F;  1QAO A;  4GRI A;  3M6A A;  1GJS A;  1OIZ A;  4X62 M;  2ERC A;  4BB9 A;  4ITQ A;  4GKK M;  4IBB A;  4B7H A;  2ZBK B;  4DBG B;  1ZMV A;  3HHZ A;  2UUB M;  3KFU G;  3E21 A;  4FCW A;  1PJJ A;  5FTK A;  4XBO A;  1DGB A;  1XWI A;  1JR3 E;  3K2L A;  5KPR A;  4JI2 M;  3C9P A;  1JQJ C;  4ZPX A;  4QHT A;  4LGM A;  3GPY A;  2DWN A;  3I04 M;  2RKO A;  4FCV A;  1F4I A;  2DAK A;  3LCU A;  4OW0 A;  4M0D A;  1QAN A;  3U61 A;  1DO2 A;  2OOB A;  1SXJ C;  2YQZ A;  3GRY A;  3IHP A;  1SXJ A;  1G59 A;  3HU1 A;  3HWS A;  3KOW E;  4DR4 M;  2VII A;  4NL4 H;  1EE8 A;  4II7 A;  4LG2 A;  3VFD A;  4LJ9 A;  2HWJ A;  4LZZ A;  4GKJ M;  1XB2 B;  5DFL A;  1N32 M;  1Y8G A;  3FRH A;  3K92 A;  2DNA A;  1I94 M;  5KPZ A;  1PJQ A;  3L29 A;  3CTW B;  3BBZ A;  1WXQ A;  4K0K M;  4I81 A;  3MJ5 A;  2UXD M;  1IN6 A;  3LMM A;  1R7R A;  4AI6 A;  1IN8 A;  1OFH A;  2V6Z M;  4B3M M;  3K9O A;  4IJE A;  4MM3 B;  1YSY A;  4GHL A;  4CIZ A;  3VK7 A;  3HX3 A;  1JR3 A;  2LVA A;  1XNR M;  1IY0 A;  3KOY E;  4G3O A;  1TDH A;  3U60 B;  3FD9 A;  3KSJ A;  4AG5 A;  2O25 A;  4IBG A;  2R18 A;  5ITQ A;  4Z6Y A;  2LXE A;  1IBL M;  2KRU A;  3CF6 E;  2JNH A;  4F1I A;  2I7N A;  1TGU A;  4FW9 A;  2APL A;  1A5T A;  2F5Q A;  4B3R M;  2JZ1 A;  1OAI A;  3DOA A;  2WSE F;  3Q8G A;  3LVW A;  1L2C A;  2DAE A;  3QYB A;  1WGN A;  2UXC M;  2LH0 A;  4G6Z A;  3GLF B;  2JY5 A;  2KNV A;  4RNA A;  4IJF A;  2JWS A;  3SAV A;  1WR1 B;  4L6V 6;  4DV1 M;  4JV5 M;  3UMM A;  4I5S A;  2D7G A;  2V1U A;  4LF6 M;  1NNU C;  2DAI A;  3AOE C;  2J7N A;  5ITX E;  2J7O A;  1QVR A;  5KQD A;  1N36 M;  1NV9 A;  4GH9 A;  4JI6 M;  2FS1 A;  3B9P A;  3PNY A;  1XMO M;  4MGZ E;  3HGI A;  4AG6 A;  3I4Y A;  2R4J A;  1C1K A;  5EQT A;  4QOS A;  3SYK A;  1NY6 A;  2CHQ A;  4OU7 A;  4Q7J A;  2QZ4 A;  3HJQ A;  2LVQ D;  4QHS A;  5DYG A;  4R71 A;  1WJ7 A;  4OVZ B;  3K8Z A;  3Q8X A;  4PDI A;  4DV4 M;  2X8A A;  4G4Q A;  1JR3 D;  5BR8 M;  3FUV A;  2GQF A;  1Q39 A;  3RFW A;  1N78 A;  3J2P B;  3R9X B;  3SC3 A;  3HHW A;  1I4W A;  3KOX E;  4LJA A;  1PJT A;  1PRB A;  3B89 A;  2QP9 X;  5EXX A;  5FTM A;  3U60 A;  4L4U A;  5BPV A;  1HNX M;  1TH3 A;  2Y20 A;  2LHC A;  2AHM A;  3A46 A;  3U6P A;  3FYC A;  4NC6 A;  4GIT A;  2X49 A;  1Q02 A;  2HAK A;  5DNY A;  3J7A S;  2KEB A;  2H1R A;  2MJ5 B;  2JUJ A;  2KZU A;  1WHC A;  3DFZ A;  1XXH A;  2EA0 A;  5JI3 E;  2F4V M;  3NBX X;  4DR3 M;  2X4A A;  1N77 A;  3GLF A;  4IBF A;  4HEO A;  1J5E M;  3GP1 A;  1K3X A;  4JI1 M;  2XSZ A;  2VDB B;  4DUY M;  3KOZ E;  3SMP A;  3J81 S;  3VLF B;  1NSF A;  1NVM A;  3T38 A;  4RKU F;  3SAR A;  2YNM D;  4AKH A;  2G8L A;  4B7F A;  2YFQ A;  3L27 A;  1QUS A;  2L4F A;  3L26 A;  1DGH B;  2LVN C;  4LY6 A;  2B3T A;  3GRV A;  4R7G A;  3SMS A;  4LF5 M;  4L15 A;  2R46 A;  1H6U A;  3H4M A;  2BWE A;  5E6J A;  3FYD A;  3FTE A;  2I7P A;  1IM2 A;  2R65 A;  4LJ4 A;  4WW0 A;  2RRU A;  4JI3 M;  4OVZ A;  1EIJ A;  2MR9 A;  1PM5 A;  3U5Z B;  2CHG A;  2DI0 A;  1E9R A;  3IEC A;  2LNH C;  3SHG B;  3UK6 A;  1W5T A;  4L16 A;  1PJI A;  2DWM A;  4LRT A;  5FSW A;  1GL6 A;  4IBC A;  1RU3 A;  4LJ7 A;  3U6M A;  1DV0 A;  1OQY A;  2DZL A;  2LBC A;  1GJT A;  1HT2 E;  3B74 A;  5EXP A;  4DUZ M;  3T1Y M;  4NRV A;  3M7G A;  1IXR C;  2XF3 A;  2QBY B;  1R5L A;  3UGJ A;  3ZQJ A;  4KLN A;  3QWL A;  4OX9 M;  3JR5 A;  1L1T A;  3GLI E;  4KOD A;  1PGY A;  3SBJ A;  5EXS A;  1IFY A;  2P5T A;  1IY2 A;  3CF2 A;  4MH0 E;  4BBA A;  3C58 A;  3K1J A;  5ITR A;  1Z59 A;  2XSZ D;  4FVM A;  3QAU A;  5ITY A;  1ZV1 A;  3ILK A;  4FWG A;  3T15 A;  3U6C A;  2L7I A;  5ITU A;  3L2A A;  2RGO A;  4DV0 M;  4DV5 M;  4AW4 A;  3EIE A;  3HU2 A;  3GLH A;  3KS4 A;  1GLN A;  4MGI E;  3PFI A;  4DV7 M;  2QQ8 A;  4DR7 M;  2CE7 A;  3CGW A;  1Q3B A;  2XFS A;  2D7H A;  1AUA A;  4P17 A;  1IN5 A;  3KS8 A;  4AZF A;  1G71 A;  1K3W A;  4AKG A;  5IZ7 D;  5C18 A;  1FJG M;  1IXZ A;  2ZAO A;  3RGP A;  7CAT A;  3GLG B;  2ZAM A;  1MN3 A;  2Q2E B;  4PT5 A;  2WZJ A;  1ZAE A;  2LVP C;  3LVV A;  5EXT A;  5H37 D;  2KHH A;  3FRI A;  3QYE A;  2M60 A;  1OTR A;  1VQ1 A;  2K9D A;  3GPX A;  3U5Z A;  2DVW B;  4W5W A;  1NY5 A;  1XHB A;  2ZAN A;  2MRO B;  3H4J A;  2CHV A;  2JZ0 A;  2LVO C;  1OFI A;  3GLG E;  4DR1 M;  1EFU B;  2FH0 A;  3TE6 A;  4LFC M;  1QDR A;  2OPF A;  2OO9 A;  3KW6 A;  5LMU M;  1J7K A;  2OOA A;  1NO1 A;  1UM8 A;  1QZM A;  2Z4R A;  5EP1 A;  4DR2 M;  2C9C A;  2K0B X;  2J5Y A;  2V1C A;  2HHH M;  1T43 A;  3HZJ A;  4FWH A;  1IBM M;  1NHG C;  2KXE A;  2KZS A;  3A45 A;  2FFJ A;  1OKS A;  2L7H A;  3L28 A;  1C7Y A;  1IN4 A;  2FOI C;  3FUU A;  3KP1 E;  4LF4 M;  4BLC A;  3HKP A;  3UJN A;  2L09 A;  3KSX A;  4R3D A;  2F5N A;  4QOZ C;  1YLA A;  5IT9 S;  1GO5 A;  1D2N A;  4DR6 M;  1ZMU A;  5KQ8 A;  1HNW M;  2ZTD A;  1JB0 F;  2Z8Y M;  3BXW A;  1AIP C;  4PDG A;  1TH4 A;  1Q3C A;  4QNR A;  5FLX S;  4L8R C;  4GIP A;  3DA1 A;  1V33 A;  3IG8 A;  4D82 A;  4DV2 M;  3GPP A;  1VEK A;  1P3Q Q;  1MJG M;  4JN6 A;  4L78 A;  2QEN A;  4NSR A;  4G4N A;  2XGN A;  2L6O A;  2QPA A;  3KVW A;  2LHG A;  4I4L A;  2DWZ B;  3HJ8 A;  4CGY B;  3E9S A;  5FTL A;  4DV3 M;  1CUK A;  1WIV A;  2VF8 A;  2WSC F;  1N34 M;  5KO3 A;  3U6Q A;  1GL7 A;  1HJP A;  3GO8 A;  2R44 A;  4M9S A;  2A5Y B;  1HR0 M;  2C96 A;  4LF7 M;  2UXB M;  2DXI A;  1PJS A;  3SAT A;  3MHV C;  3E46 A;  2LTU A;  3A42 A;  3I51 A;  5ITX A;  3TWK A;  4JI0 M;  1G3I A;  1IBK M;  1DGG A;  2Y0T A;  4MB7 A;  3WHL A;  3A98 B;  4FCT A;  2CWB A; 
#chains in the Genus database with same CATH homology
 1TR8 A;  1OQY A;  2DZL A;  1KYI A;  1HT2 E;  2JY7 A;  2LBC A;  3BBZ A;  2KNA A;  3F92 A;  2QNJ A;  1G41 A;  3MMP A;  4GEW A;  2EJS A;  3K9O A;  1T6O A;  1VDL A;  3GLI E;  1PGY A;  2JY8 A;  1XXH E;  2DKL A;  2LVA A;  2JP7 A;  1IFY A;  2QSF X;  4G3O A;  3GLF E;  2O25 A;  1VEG A;  1ZV1 A;  2EKF A;  2JNH A;  4F2L A;  4F1I A;  1VEJ A;  1A5T A;  1SG9 A;  2JZ1 A;  1OAI A;  2G3Q A;  2KNZ A;  2ZTC A;  2DAE A;  1WGN A;  2L2D A;  2L4E A;  1HT1 E;  3FE3 A;  5JI2 E;  2JY5 A;  2KNV A;  2DAM A;  1WR1 B;  1IXS A;  2DAI A;  2R0I A;  1TTE A;  3LCV B;  1WGL A;  3K9P A;  1NV9 A;  1MN3 A;  2WZJ A;  2LVP C;  2KHH A;  3FRI A;  1OTR A;  1R4G A;  1VQ1 A;  2K9D A;  4WP2 A;  4Q7J A;  4UN2 B;  2BWB A;  2DEN A;  2MRO B;  3H4J A;  2LVQ D;  2JZ0 A;  2LVO C;  3GLG E;  4R71 A;  1EFU B;  1WJ7 A;  1HQY E;  2OO9 A;  2MGW A;  2OOA A;  2CP8 A;  1BVS A;  2EKK A;  3T6P A;  2K0B X;  1T43 A;  3B89 A;  1C7Y A;  2JY6 B;  1OKS A;  2H5X A;  1G4A E;  1E94 E;  3GLH E;  1NV8 A;  1YLA A;  2DHY A;  1GO5 A;  1Q02 A;  1ZMU A;  2HAK A;  2ZTD A;  1VG5 A;  2MJ5 B;  1AIP C;  2JUJ A;  1WHC A;  1DO0 A;  1V92 A;  4HEO A;  4DBG B;  1ZMV A;  1VEK A;  1P3Q Q;  3E21 A;  2QHO B;  1QZE A;  1JR3 E;  1UFZ A;  2DAG A;  1ZMW A;  1CUK A;  1WIV A;  2L4F A;  1F4I A;  2LVN C;  2B3T A;  2DAK A;  3LCU A;  1HJP A;  1DO2 A;  2OOB A;  3IHP A;  2BWE A;  1IM2 A;  2RRU A;  3E46 A;  2LTU A;  2MR9 A;  2DI0 A;  2HWJ A;  3IEC A;  1G3I A;  1XB2 B;  5DFL A;  1Y8G A;  3FRH A;  2DNA A;  2CWB A;  1DV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...