2BWCA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose (5 minute soak)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwcA00
3VZJA 2JEMA 1XNDA 4HKLA 3VL8A 2QZ3A 4IXLA 1KS4A 1M4WA 2F6BA 1QH6A 2DCZA 2NLRA 3AKRA 3B7MA 3WQ7A 1XNBA 1BVVA 2DCYA 3VHPA 2BWCA 3WP4A 4XQDA 4XPVA 5HXVA 3VZLA 5K9YA 3LB9A 2B46X 1UU5A 1XNKA 1QH7A 1XNCA 3RI8A 2JICA 1W2UA 1F5JA 3AMMA 1C5HA 1PVXA 3VHNA 4HK8A 3M4FA 4H7MA 1HV0A 1IGOA 3MFCA 3WP6A 3AMHA 3VL9A 1OA2A 1REFA 3VZOA 3VZMA 1XXNA 3WXPA 2B42B 2DCJA 4NPRA 1T6GC 2Z79A 3O7OA 1REEA 1UU4A 3AKTA 2BVVA 2BW8A 3AMQA 2D98A 2BWAA 4XQWA 3LGRA 2QZ2A 3VGIA 2C1FA 1OLRA 1UKRA 1XYOA 1ENXA 3VHOA 1H8VA 4S2GA 1UU6A 3VZNA 1TE1B 3EXUA 1OA4A 1HIXA 1H4HA 1REDA 3MF9A 3WP3A 2VULA 1H1AA 3RI9A 1BK1A 2VGDA 1OA3A 2NQYA 2B45X 3ZSEA 1HV1A 3MF6A 4S2DA 4S2FA 3MFAA 1OLQA 3WP5A 3WR0A 3AMPA 3HD8B 3WY6A 3WQ1A 1BCXA 3B5LB 5EJ3A 1XYPA 2JENA 1H0BA 3AKPA 5K7PA 1KS5A 2VG9A 1AXKA 2DFBA 3AKSA 1C5IA 2D97A 3WT3A 4HK9A 4HKOA 2DFCA 3VZKA 1NLRA 4XQ4A 3WQ0A 1H4GA 3AMNA 1XYNA 3WX5A 2VUJA 2DCKA 3VLBB 3AKQA 4S2HA 1YNAA 4HKWA
chains in the Genus database with same CATH superfamily
2OPKA 2R073 5EHDA 4NHYA 4FAGA 4OMCA 4XFAA 4MGKE 1D2SA 4P5YA 5AVPA 4M4RA 4E2GA 4CSWA 2Q1FA 3VB9A 4YYOA 2O8QA 3OD4A 4ZU5A 4Z2AA 2VZVA 4AHYA 4YVSB 4LK7A 1R081 1TME2 3GYDA 5FIXA 1BJQA 4K40A 2AUYA 2PMWB 4RHV2 4IGOA 3JBG2 5L7OA 3OCPA 2TBVA 2HWC2 3MW4A 1OF4A 1MZ5A 1PMJX 4LIVA 3ROUA 3IKWA 3N7MA 3OBZA 1EV12 2C0ZA 1WCKA 3LEKA 3O12A 4CP0A 1LGBA 2XLFA 3OY8A 1H2LA 2AREA 2WWSA 1VBE2 3GBGA 3VHNA 2VC9A 3DKQA 1Z7S1 4W8JA 4JTOA 3ZSMA 2R7EB 3V0AA 2I74A 5I0UA 4DY5A 1ONAA 3VBRA 2RS12 1UYYA 3I3BA 5FP3A 3M3IA 1GZWA 5JI9A 5EYXA 3ZSLA 2J1SA 5FUNA 4OFGA 5LA0A 2PTMA 4AI1A 4L9BA 1ASJ3 4FPYA 4A6OA 2ZGLA 5ABJC 4B29A 3B9IA 2DBIA 2D6PA 2VZOA 3H1YA 4B1MA 4O7XA 1EAH2 4NMIA 4FFHA 2O8OA 2YHJA 4IEWA 4RS5B 5CISA 4DUXA 4XETA 1AYN1 1VRH2 2W2IA 3N7JA 3ZSKA 1TNRA 3AXEA 2HEWF 2YYOA 3ILNA 5L7OC 3P3PA 1Y9GA 2Y6KA 3NV3A 2R16A 5FR3A 5L7OB 3WG4A 3MIFA 2J1VA 1E5IA 4N7IA 1FPN2 3I3DA 2RR12 1MZEA 1A8MA 1RUC3 2D7FA 2ZKNA 3HAGA 4A44A 3J7HA 4D6RA 5A3PA 4AQSA 4XF0A 2F4LA 1RMU1 1UY4A 4CUAA 2W9XA 4V2VA 3CQOA 1OSGA 2CAVA 5E16A 1JW6A 3H50A 5FP7A 5FYTA 3UL2A 2G19A 5A6YA 3ZYIB 3NNLA 4DZGA 2ETEA 3TBDA 4WM8C 1ND3A 1WLWA 5E1RA 3VD9A 4JX0A 1IS5A 3MIGA 5BUVA 1TMF1 1VBC1 4I0WB 1JYWA 4YGDA 3PUAA 1JYCA 2VL4A 3IAPA 4OHWA 5DDJ3 1GOFA 5FQ0A 5IHRA 3U14A 2WL1A 3HD8B 1ULFA 3AJYA 3B5LB 3NNJA 4QHBA 3T09A 3L9JT 2VVDA 1MS9A 5FJKA 1POV0 1U5XA 4Y20B 1NCQB 5AFBA 2R063 3ES4A 3LPGA 4OHXA 5EYYA 3H1WA 2G9FA 4MO3M 2G9ZA 3R4SA 5EJZB 5CFCB 4ASLA 5C4WA 3I2HA 2WRAA 2ZKLA 4CXYA 2JG9C 2VPVA 3WF2A 2QE3A 1MQTA 3K4AA 4OUMA 5GKAC 5JPMB 1V9U3 3ZYHA 3T2PA 4JCKA 2HJIA 4Y5Z0 4N9IA 4PT6A 1AVBA 3DGTA 2PLV1 4HANA 4Y22A 1JZ5A 2OYZA 3K4ZA 3ZDVA 3N9QA 3VD3A 4YVWA 4FPKA 2CYFA 5FYYA 2JDUA 1LTEA 3IWZA 2J1RA 3KV6A 1QOSA 3LE0A 5IK5A 1UOGA 4PLOA 1CX4A 4A42A 3LDRA 2VY0A 1DU3D 1X50A 5CFDA 4CU7A 2FD8A 4BLJA 1WUVA 2GMMA 4HOOA 4QHZA 3WP4A 4QKFA 4YM3A 1LHVA 3FUQA 1JYIA 1QWRA 4BYYA 2ZGKA 4LOSA 3ACLA 5FTTC 4EN9B 3V56A 4AVVA 4ZONA 1Q43A 3GCWA 1SACA 4D0QA 2ZAHA 3W5MA 2VBDA 2WC2A 2E63A 2UWCA 2WBKA 2WABA 2WIIB 3AP7A 1JUHA 4UFKA 4H7MA 1WW4A 4IUGA 1RB8G 3MYXA 3KLSA 4KI5M 3E97A 4LO8A 3NAPB 4OQ8A 1AL21 2FBEA 1LHUA 4Q29A 2RHPA 4R4ZA 3EQEA 3ZFFA 5CFCC 1UMZA 1FMD1 2YPDA 2VUAA 3KCXA 1AYM2 3MI8A 5FXXA 5J96B 2R042 1LU1A 2DV9A 3VKLA 1R092 3Q8CA 2AACA 4D69A 4L0PA 1UWWA 2VNOA 4QT6A 4JZRA 1DIWA 5FZKA 2JIGA 1NQDA 1IKQA 2BJSA 3MLKA 5JMCA 5CFDC 2JE8A 4N53A 1ALYA 2ARCA 3VBSA 4BCUA 3MPBA 5CG9A 4U36A 1JU3A 1S2KA 4CUCA 4KGQA 4LUKA 1CAXA 3K77A 2O14A 3TOJA 1N3OA 1HXS2 1W9FA 3OGSA 2VZUA 3VDDA 1JZ4A 3U0ZA 2JIJA 4QPGC 3BCWA 4IESA 5FY7A 2A3XA 3NJYA 3AK0A 5IFPA 4FOQA 1A8DA 4LIUA 4OVEA 5KC6A 4AHZA 2JKXA 2O0OA 3E5UA 1LJ7A 2VAUA 2WN2A 3FX3A 1REDA 2BGOA 1DGWA 2F17A 5F5AA 4YZ1A 1JH5A 3AFGA 3PDQA 5K0UA 2XVKA 2VECA 4DINB 1AF9A 1ZBE3 3HN3A 1SDDB 1G9AA 1QDOA 1LHOA 4C0BA 1SLLA 1CAVB 1ZRRA 2WUHA 1MEC3 3NSTA 1F5FA 5DDJ1 1OQDA 3OJBA 4ZY9A 1ZRFA 4L97A 4URTA 2ZGQA 1FMD3 1W0OA 1X82A 1BHGA 2VG9A 2K0GA 2DFBA 4AQ2A 1CZTA 4COWA 2V5YA 3CDZB 4E2SA 2HEVF 1VMHA 1QMJA 1WCUA 1RJ7A 4QQ2A 2GP5A 4RQPA 3WHUA 3ZN6B 1CJPA 2A6YA 4UXAA 5JOXA 3NWKA 3POEA 2JG8A 2B8MA 2JDZA 4MG2A 3KM5A 5JSPA 1UX6A 2ZGMA 4K7JA 3VBUA 2B9UA 2RS32 5B4NA 1DF0A 1UY0A 4Y1ZA 4PIXA 4B7KA 4DRVA 1PZ8A 5KXCA 3VLBB 2IWGB 1TME3 3ORJA 4GAZA 4QPGB 1RUD1 1WW7A 1W0PA 1XNDA 2XXZA 4GZ9A 4COYA 5FBJA 2W1SA 4CDQA 2UU8A 1JZ2A 1JYVA 4GKXA 1QJZA 1RUE1 3G7DA 1JZ3A 4MHUA 2CWMA 1Q5OA 2RDQA 2Z2SB 2DCZA 1DQ5A 2FZ1A 4TYSA 5FPZA 1LOGA 4GH4A 1IPJA 4XOGA 3W9AA 2WYFA 3J7LA 4AHWA 2DCYA 1LOAA 3VHPA 1X36A 2P3IA 3GGLA 2TNFA 1LOBA 2ZMNA 3ZYBA 1ZZCA 1S0JA 2ZBJA 4XFGA 4YLZA 1P8JA 4YM0A 1R1A3 4RR3C 2EXKA 3FN9A 4QQHA 4GXLA 4KNCA 2E53A 4DUVA 1W3VA 3FUOA 4XW3A 1VLNA 5C8CC 4FTEA 4QDQA 4A7ZA 1W90A 3T2OA 1D2QA 1HB4A 1WLDA 4KWUA 2CDPA 3C7OA 1SLCA 1W6PB 3ES1A 3KGLA 1J1TA 5AFEA 1DGWX 1TNFA 1QOTA 4D7SA 3LOIA 2DCJA 1GYKA 5F8PA 4EJRA 3FFZA 1TZOA 2RDSA 2WS92 1SMVA 3M8LA 2XL9A 4MXWA 3IIIA 5FZ0A 1UOJA 3ZN6A 3POBA 3J8F3 2X5IA 3T1LA 3AZWA 3HJRA 4LEJA 1AYN3 5L73A 1PO23 2ZX0A 2YBKA 3DV8A 3KGZA 2IFRA 4XFBA 1D7PM 1HKDA 4MYEA 4AVTA 1QY4A 5JOYA 5C8CB 4XUTA 5FY8A 4CCMA 4GWNA 4CP9B 4M3CE 1L7LA 1X8MA 4CCDA 3WNOA 4FVVA 1VBB3 1KDKA 4O9EA 4KMQA 3LFIA 5CVRA 4N9HA 1CAUB 1D0HA 3LPFA 4J6GA 4EQVA 1RMU3 1S0DA 2QNKA 1BVP1 3LSEA 5FZ8A 3I2JA 4XUPA 1OKOA 1Y4WA 1UYZA 2VMEA 2WS91 2JE7A 3I2IA 3FL7A 1H4HA 1HIXA 2NYYA 4NPMA 2GSYA 3ETPA 1RUNA 1DG6A 5KC5A 3L2HA 3E5QA 4QD2A 2FCTA 2ZEXA 2ZEYA 4QM8A 4IV3A 4Q26A 2R32A 4XYXA 4RL7A 1LULA 4AZZA 5BNPC 2XKPA 3RFRA 1FX5A 3VD4A 1HRI1 4LOTA 5JOWA 1DYPA 3CF6E 3MF6A 4Q4V3 4EYUA 3HN1A 2E6VA 5FZAA 3MFAA 5HPOA 2QQLA 4WZCA 3PLQA 1LENA 1KD7A 5GZGA 3UJOA 1C28A 1NA1A 4ZS2A 2HYKA 4BHPA 2JB4A 5JZGB 4MGYE 3R05A 3S5QA 4ARYA 4MLOA 3ZFEB 3OYWB 4UI9L 5T5PA 4DO0A 2BDRA 2VMCA 2DVFA 5ANQA 4MVTA 3VZKA 2VQTA 2QDRA 3I3MA 2WZEA 3IDAA 2B5HA 3ZR5A 4BK5A 1DFQA 4GQ7A 5IUQA 3H3UA 1OVPA 1JODA 4A2UA 5DZFA 1YXWA 2XVLA 4FTBA 3Q8AA 2WFPA 2WA4A 5C3RA 2OX0A 3V0AB 2WWUA 4BISA 4AE2A 1F15A 1O91A 1QNYA 1TE1B 1WGPA 2RS13 4JC1A 4XIOA 3SCGA 2E7AA 3TEZA 4C90A 5APAA 4Q2FA 4CEWC 4QPIC 4XHXA 4D3WA 1KS4A 5A1LA 3QLQA 5BNPA 3B93A 4XBNA 1JMUB 1QH6A 1YCIA 1YLLA 3K48A 4IE6A 5D8AA 2EXJA 2BWCA 2VH9A 4ES9A 2A3YA 1ULEA 4GWMA 4NUBA 3ZIWA 1CGPA 1W06A 2R043 3O1VA 4RHV3 1C8M2 4A4AA 1STMA 3Q9OA 1POV1 1PX4A 1A3KA 2W47A 2QQVA 5JI7A 3D0JA 3WQBA 5DPNA 2EXHA 5LK5A 3ZPYA 2GNMA 1O3SA 3SXWA 3ZYFA 1IGOA 4JV4A 3WNNA 1L7QA 4FPGA 4RYDA 1RTVA 1NX9A 2GMEA 2WAAA 5FPUA 1L3JA 1S1AA 1DZRA 2RS52 2RS31 3DUIA 1K45A 2WNUC 1YO8A 2Z79A 3A0KA 1RUG1 3ZFEA 1DGRA 1NG0A 1C8M1 3BOWA 4ISRA 2VCAA 5A7SA 5FY0A 4ZU4A 3UESA 5A32A 3AP6A 5BNNB 5FP4A 1LOFC 3T4VA 5GLZA 5JWPA 2ES3A 4WVZA 3VGIA 3TN93 3VBHB 1H2KA 4QWNA 3DEMA 3RS6A 3KSCA 3NMBA 2JWPA 5EPAA 2YFZA 5A3MA 5F1RA 2ARBA 2LW8A 3GCXA 4NAMA 4QPIB 5LY2A 4I09A 4UAPA 3H8XA 3MV01 1GQGA 1OOPA 2WO2A 3WDTA 4J25A 2BV4A 3BALA 1AX2A 1R1A2 5LA2A 4BQ4A 2OZ6A 5CYYA 2QQUA 2RMU3 1SHWB 3WW2A 2R041 2XLGA 3CZUA 1QOOA 1GU3A 3RYKA 4AI3A 4XJUA 1XU2A 3PVNA 1Z78A 3RZHA 4LA2A 3O1PA 2KR2A 4QU2A 3RZZA 1XNTA 2C26A 5DABA 3JQWA 1Z7S3 1OLQA 2Q8DA 3T0DA 2FDFA 3RWKX 1C3HA 3ZN5A 1W6MA 2WNUA 5BNOC 4J1WA 5DUWA 1XYPA 1YC61 3NO8A 4Y33A 3DXUA 1V0AA 1AXKA 3WCSA 1MZFA 4WVWA 3AYEA 3PU8A 1N1TA 1RUG3 3SCFA 1DYOA 1PVC3 2DU1A 1DQ2A 1GBGA 2X09A 4HN0A 5DZGA 4HK9A 3HQRA 4YW5A 4P9LA 5E88A 1WMDA 4XQ4A 2WZR1 1F4HA 4ONUA 2GN3A 3K3OA 1PO22 3J9SA 5HCBA 3I2OA 2VCCA 2VUJA 2VOVA 1XJAA 2CGPA 1XPWA 3J8F2 1G9BA 5H9RA 1JZ8A 3EJKA 2C5DA 3I54A 1YEWA 1PK6A 3AYAA 3Q8EA 4BQ1A 4M4PA 1AR83 1BBT2 2QQWA 1GP6A 3A21A 1ODNA 5CKNA 1G7YA 4OCTA 5FZDA 2E26A 1NA1B 5DG2A 1HRI2 1NZIA 4X8PA 4CP1A 1KITA 1NZCA 2AZ5A 1RGSA 4DFSA 2EIEA 1RUJ2 4GJYA 5CNAA 2RM23 1U5IA 2BUKA 2W95A 4YW6A 4CA9A 1G9FA 2WNVA 3LB9A 3OG2A 1UZZA 4LPLA 5FPLA 3J7MA 4CPBA 4E4DX 3O1TA 4N8MA 1OT5A 3HQXA 1YJLA 1XNCA 4IEVA 1XOYA 4FPJA 1UKGA 4H7LA 4LKEA 4LHKA 2D6NA 3RVHA 3VKFC 4ES8A 2BOIA 3ZIXA 1HXS3 1VAMA 4HK8A 5A70A 4HSLA 3X29B 1HV0A 3ZDSA 2C4XA 4D6SA 1W0NA 1NY72 1GNYA 1XRUA 4SLIA 4Y1UA 5D21A 3LA7A 2EIGA 3VBSB 1C57A 2Q0AA 3DPRB 1ENSA 1WLTA 3WDUA 4EN0A 2DVGA 2YGLA 3USUB 3GZUC 4XJ8A 2WO1A 4QX7A 5GM0A 3H8OA 4N43B 2WZR3 4BIFA 2IVIB 1V6OA 2NZ9A 2I45A 2WT1A 3PVBB 4HPKB 5FMOS 4ZXEA 5T50A 3VBFB 2XL7A 5K4LA 3W58A 3HNBM 4F83A 2V5DA 4FPCA 5F7UA 2E7QA 1I9RA 1QJEA 3AKTA 4XDOA 4AEKA 5HV0A 1RMU2 4FPOB 1UQXA 2BW8A 5T5JA 3WCRA 3J8F1 1NT0A 4MZUA 1W99A 1C8M3 3LGRA 3UETA 1W8FA 5BNNA 4YGEA 5F9TA 3NAPA 2Y33A 2WINB 3CEWA 5DUVA 4Q4Y1 4LHSA 3AZVA 1AR81 5C3PA 2A6XA 2WZR2 3PUIA 2QQIA 5LZ6A 1QXJA 1WD3A 2GN7A 2Y6LA 1AYN2 1VRH1 1QJU2 4XF4A 4XF9A 3ZKUA 1X33A 4INDA 1AR61 1UZVA 1YI7A 2XHNA 1PMIA 1EYBA 4XEZA 4Z82A 3OUIA 5KBFA 5JXGA 3RQ0A 1AJKA 1GR3A 4GD4A 1H1AA 4AG4A 3MGUA 3CJIC 1O5LA 1X8EA 5LEJA 4YARA 5JLVA 3TB0A 1BZWA 2YB7A 5C9AC 2ZX2A 5KXDA 2A3WA 2ORZA 1O3TA 5G05L 2RS51 4JRAA 4LULA 3RWNA 3MEPA 1N1SA 4ET7A 4R9BA 5EIYB 4WM7A 4LR4A 1EV11 4QKDA 1E57A 1V6NA 4A6SA 1GP4A 1HN0A 2JDNA 1RL3A 4QGMA 1DQ0A 5LY1A 1W9TA 3CJXA 1PO12 4P5HA 3UNPA 2H6CA 3I97A 3NAPC 4PQ9A 1EY2A 2BERA 4NOTA 5JOZA 1RHI3 1WZXA 3SISA 5I0TA 3VBHA 1PHMA 5LWBA 1H4GA 1HX6A 1T6BX 3WF0A 4TLFA 1SFPA 2HWD2 5FLJA 5JXJA 4XTPA 3VKNA 1PIV1 1ZZ6A 1ZM1A 3ZYPA 3HT2A 2OKXA 1ODMA 3F95A 4FO9A 4RQPB 4UW3A 3LA3A 1ND3C 4K21A 5DDJ2 3C7FA 1W2OA 3VBOA 3BKZA 4IXLA 3BI3A 4NHKA 5LASA 1OPOA 5DAQA 1M06G 1S2EA 3TNQA 4Z2WA 1VBB2 1VPHA 4WM8A 2WQ8A 4XF1A 2BGPA 2Y6GA 3ILFA 1FV2A 4XTMA 1ZX5A 5FDBA 5EWSA 4I0BA 1URXA 4QQOA 4I0AA 5FZ4A 5K9YA 1ENQA 3B01A 4UF0B 1O59A 2W3JA 3IMNA 1VALA 1N3PA 2ZMKA 4UBGA 1XSQA 3E6CC 1HRV2 1GSLA 1ND2B 3RI8A 1JXNA 4XJZA 4IV1B 4AVBA 3KWVA 1O5UA 4W65A 3WF3A 1UOBA 3B02A 3MW2A 2EIBA 5I91A 4P9GA 4AF9A 2E7TA 3BPSA 1DLCA 2XUEA 1F9KA 4GB31 4WBBA 3O1MA 5FZ7A 4CYDA 1CPMA 1H8TA 1HXS1 5A3LA 1YQ6A 4IV1A 4OHVA 3U10A 1CWPA 1ND2A 2A75A 3O14A 4FP3A 2VD7A 1BXHA 5CU1A 5CEHA 4O9GA 3NV1A 4E8CA 2IXCA 3WXPA 4BQWA 1RYYA 5A33A 2DUOA 4Y24A 2W1WA 2QQMA 4CEWB 2LRPA 2OT7A 2IXKA 2CV6A 3S5AA 4B3NA 1LODA 2VCMA 4U2AA 4P00B 1MS3A 4WZFA 1LESA 2HWE1 1QF3A 2W92A 5A3NA 5GLVA 3D0SA 5FPVA 1QJX1 2VXJA 1S0BA 2CU5A 2OUHA 5E6HA 5ACA3 1GWMA 3IN9A 1F35A 3NJVA 1JU4A 1JYNA 3AP5A 1Q56A 4N43A 3UYJA 2K46A 2HEYF 5FKBA 3T2QA 2JG8C 3ZX7A 4RGAA 4S2GA 3W5NA 4KQ7A 2R062 5J09A 5FZ1A 5FYMA 5F6LB 5J7MA 2GALA 4CE8A 4R9DA 3NRUA 1H1MA 1COV1 2P1BA 3A0NA 4YPJA 4QB6A 3WP3A 1ZZBA 3VBFA 1ND2C 1V6MA 3AFKA 4NRQA 5FCCA 3RI9A 4ATFA 3OGVA 4NHLA 4F8AA 1WMXA 3M3OA 3ZXAC 2ATFA 3UT0A 4CDQC 1J84A 4UBHA 3OBTA 3THTA 4XMIA 4AEDA 5I8YA 4FI9A 4N90A 4ASKA 1HV1A 3ME2A 4XVHA 5FWJA 2QJVA 1TQ5A 2R071 4S2FA 4S2DA 3WP5A 1PZ9A 2Z42A 5A3UA 4GALA 2XJQA 3IBMA 4ISQA 1BCXA 4M3CF 1C4RA 2Z4FA 2YC2A 1YQ5A 2HWB3 4IEPA 4AEDB 5G04L 3G6JB 3ECQA 5GZEA 4F7ZA 3K46A 4JDOA 1YHFA 4RR3A 4I3GA 5BNOA 2RR13 1QJY2 1FPN3 5DAVA 3ZXLA 4QPGA 4E2QA 2XWBB 1FOD1 1LEMA 3JB8A 2DBNA 2BPA2 3AP4A 1UZWA 5JXHA 2JDKA 1YI9A 3POFA 1YRZA 1O7FA 1SDWA 1IKPA 4Q4W3 3WG3A 4UOJA 4CDWA 3FBYA 3GZAA 2WLQA 1WCDJ 2ZMLA 5BXXA 2JG8B 5A6QA 3VZJA 1B35C 5A3WA 2MEV2 2JJ6A 4HKLA 4KWLA 3THPA 3D8CA 1O3QA 1MS0A 1G8WA 1ZZ7A 4DEQA 4LO4B 2Y6HA 4A3ZA 4I2OA 4EE2A 1LRHA 3CU7A 1UY1A 1VBC2 1N3QA 3IDEA 4FXKB 3AXDA 5FUPA 4DOUA 4YZ5A 1NQJA 1CONA 3GM8A 1K5MA 2BFUL 1OHFA 2CAUA 4NRMA 4PBPA 4PJYA 4OI1A 3VZLA 4E9KA 4Y1XA 1XNKA 4W4ZA 4CRQA 2VOWA 2OW4A 1KDMA 5GZDA 4AVAA 2J7MA 2VMHA 3DPRA 4Y5TA 5E8AA 3MV11 1W2UA 1NE4A 1F5JA 1GOGA 1WW5A 1DQ6A 1D4M2 2VUDA 1R093 3RJRA 5I0DA 4COUA 1UO9A 3LEIA 1RIRA 1NAEA 2CHHA 2HBTA 2XQRA 1AYM3 2FMDA 3MFCA 2DVBA 4HVRA 5KR7A 2WN3A 2WT0A 2EA7A 1H2MA 4ITCA 4C1XA 5DZEA 3S6PA 2UURA 2D6OX 5JAXA 4EZ4A 1ULGA 2FDIA 3PMEA 5LBEA 3ACIA 5LBFA 1AR92 1OXCA 5BYNA 4UW6A 1Y43B 4D8MA 1SQ4A 1RUD2 1SLIA 3SEEA 4Y3OA 3BIEA 3RDIA 4LO5B 4LXLA 2D98A 5FLIA 1CPNA 5A32B 2R30A 4UFIA 4JAAA 4CEYC 4D6QA 1UIKA 1FNZA 3E6BA 1LAJA 5FZEA 2X05A 3TWIA 2RMU2 4QAWA 3ASIA 1JOBA 2KM2A 2RS11 4I30A 4Y4RA 4YZ2A 5ACA1 5JR7B 1I3HA 2HBUA 1W6QB 1K5MC 3JZVA 2P5BA 3OD0A 3FBMA 4K9SA 4URAA 2ZCWA 3AP9A 3N3HA 1SPPA 4CXXA 2C24A 2V72A 2WAOA 1HB2A 2PFWA 4N7UA 5HCAA 4A41A 2FDGA 4IEUA 3U11A 3TN92 2MPFA 4Q8KA 4LMFA 5FZOA 4CEWA 1COV3 3NV4A 2ENRA 3FHQA 3KT1A 1V9U1 3PIJA 3NNFA 2JD9A 3ZMOA 2R0HA 5DAXA 4P08A 1L7RA 1O8SA 2B45X 1AYM1 3ZSEA 4GMP3 1VIWB 3BTYA 1CQ9A 3AX4A 4BPZA 1Q8SA 5JCTA 4QKBA 2VM9A 4BB3A 1QJU3 4BK4A 2W5FA 4BH9A 2VZ3A 4FFGA 1GOHA 4FQZA 3H42B 4HVOA 3RYRA 3ZYGA 3QACA 2W52A 4H14A 2HWB1 2ZZJA 2XVGA 4Y4YA 5E89A 5T55A 4E8DA 2FZ2A 3H3LA 1RUC1 2DUQA 3DECA 1CX1A 4PBOA 5F5CA 4MGQA 3IMMA 1NLRA 2P6HA 4Y22B 3WQ0A 4NN0A 2BGCA 1V6KA 5A7WB 3T2TA 3KF5A 3KVAA 3LIGA 5FZCA 1G86A 2VOXA 3BOPA 4CU9A 1GWLA 4FPHA 4AQTA 4UFHA 5FMBA 4JTNA 4XHBA 2V73A 5J1XA 3DYPA 3RGBA 4R8HA 3WNPA 2QQNA 5FXWA 4NHMA 3CL1A 3SLIA 4Q4W1 4RGGA 3WQ1A 1H6XA 1FT9A 1JHNA 3NQHA 3VL8A 3ITQA 4YM1A 5JVVA 2X8KA 3ZN4A 1UXXX 2R49A 3AVRA 4IEOA 5AC93 2BU9A 1M4WA 2F6BA 3UGFA 5IK7A 2VO5A 3I3EA 3PMSA 2DVDA 4QX0A 3SC7X 2JDYA 2NLRA 2WFF2 3C2UA 3PVEA 3LF7A 4GJZA 1OOPC 4XQDA 1CAWA 4MV2A 3VBRC 5C6CA 3BIWE 3H0OA 1WA6X 3SMHA 3VDCA 3EMRA 1QH7A 3I2GA 4GA9A 4L11A 4LE4A 4NWWA 3ZXGA 3GF6A 3LSDA 3LEGA 3C3VA 1D4VB 3JB4C 2E31A 3WOGA 2Q8CA 3PUSA 3JQXA 4C91A 2RE9A 2YPJA 5ABJA 4GH4C 1GQHA 3MIEA 1BBT3 2EIDA 1XE8A 2W68A 2JDHA 2ZHMA 1OLME 1OA2A 3J4UH 3K75B 1QKQA 2WFF3 1ZRDA 4JGZA 3OGRA 4YZ3A 2G1MA 5FYUA 5AC92 2YZ4A 3BTAA 3LZZA 3KB5A 1AXZA 2QBXA 2CY6A 4E4SA 1E5SA 2WNEA 3KVBA 2Z5WA 4EWEA 3DN7A 4QPIA 1UYXA 3WF4A 3V0BB 4Y1VA 4JVAA 2C9KA 5ISLA 1KFUL 4JKMA 4XQWA 3RYPA 2X29A 5JMOA 3I49A 1MACA 5J3UA 2LTNA 1QXPA 2PHXA 1QQP1 3H8UA 3ZFGC 2C1FA 2GP3A 5C4WB 1OPMA 4IEQA 1ZREA 1UOFA 4HBNA 4LBQD 2D3RA 3P3NA 5D8AC 1XYOA 2JXAA 3EB7A 4K6BA 4KG0A 2XONA 3WW1A 4Z07A 3UGHA 2PAKA 3U78A 5C9AA 1PGL2 3IM0A 2I07B 2VBBA 4ARXA 1I1EA 3O0VA 3A22A 4B7EA 3GJBA 1C1LA 4AXOA 2P2KA 4NE9A 1W39A 1HQNA 1HLCA 5CADA 3EYPA 2VTXJ 1ZZ9A 4LBOA 2VJXA 3UKTA 4CDXB 4QX2A 2D3SA 4TZDA 1YFXA 1OLMA 4C0HA 1UCXA 2QQPA 1FNYA 2Q4SA 3VDBA 3MW3A 4IE5A 1I5ZA 1UN1A 3HQUA 3R4DB 2AC1A 5FAXA 4LO6B 1PM7A 1HQWA 2NMOA 1PGSA 1RUOA 1PMHX 4X6RB 1AX0A 2W91A 4AOCA 1FATA 2A1XA 4DS0A 5K0UC 1MQTC 5JUVA 1RC6A 2WNVC 2XJPA 1H0BA 3WDYA 5JDBA 3ACGA 1Z0HA 5LRRA 4UFJA 1O6UA 3L2YA 3AKSA 2ORXA 1LGNA 2J1AA 1C5IA 1R64A 1ULPA 2HWF2 4XUOA 3ZKYA 4BZ4A 5F3CA 3TEWA 1QXRA 2J22A 3BB6A 2BYVE 4FSJA 4QKNA 2BBAA 2I2SA 5KHGA 1R083 1V9U2 1WA4A 2WJSA 4FP2A 4IEZA 5FO9B 5FWEA 3KMHA 3C7GA 1R1A1 1AL0G 3THDA 3WDXA 5JR2A 3VKMA 1UPSA 4YSFA 2W08A 1PX3A 4LO7A 4LTAA 2XJTA 1F31A 3TRSB 1IHMA 3PHMA 2JEMA 3WVJA 4CU8A 1O3RA 2CSGA 1YJKA 2XDVA 4AFAA 2WDBA 2X5IB 5IK8A 1VMJA 4WVMB 3KHBA 5C9AB 1OQ1A 4CDWC 5A7WA 3ST7A 2WSUA 2XKOA 3DPRC 4DUWA 4LK6A 3HPNA 3R6SA 4FQ4A 3DL3A 2YFUA 4QXHA 4LA3A 5CB7A 3HVDA 4Q0PA 4DXTA 1NE6A 1G9DA 3BTZA 3KQ4B 2PAMA 1W04A 3AB0A 3WHTA 3AZXA 2VXRA 1C8NA 1EPZA 5FZGA 1NCRB 1VBA2 3S57A 1H2NA 2VMGA 1AR91 4NIDA 1UAIA 3M4FA 2VTXA 5A7PA 4CP2A 3J26N 1H30A 4M0NA 4B4PA 2TUNA 2BNNA 5T3NA 1YIPA 2X5IC 1LHWA 2IZWA 1UNBA 3KF3A 2ZGTA 3D82A 3IT8A 5DQ0A 1HN1A 1PK6C 3M3CA 1OKQA 1OI6A 2DTYA 2W46A 2VMFA 1REEA 2JX9A 3B3QE 4D7YA 4DMIA 2RM22 3OPWA 5IFTA 5IK4A 1AR62 1HRI3 1KEXA 5FZMA 5EXOA 1PO11 4BQ3A 5B2GB 2Y6FA 3POWA 3JCIA 1PGW2 1UKRA 3NV2A 1QHDA 3WW3A 1WWYA 5BY5A 1AR82 1LR5A 4GIQA 5FZOB 2JG9A 5BPXA 3FMGA 3GZTB 2OPWA 4W6YA 2PHRA 4CDWB 4EWAA 5JPNB 1XNAA 4AWDA 3U1XA 3WSOA 2ET7A 1POQA 4QB1A 1J3RA 1HB3A 1UU6A 2MEV1 5I0RA 5FXZA 4XFCA 1GZ9A 3RMXA 5D8AB 4AFBA 1LOFA 5F39A 3QH7A 4HMZA 5LCWL 1W6QA 1W8WA 1JZ6A 1QQP2 5DUUA 4AEMA 1AHSA 2VULA 1JI6A 2MHFA 5FOBB 3OB8A 2YUEA 4KU7A 4XCAA 4CCEA 2R0FA 1PNGA 1RXGA 2PAEA 2YU1A 2WNOA 3PUQA 5LBBA 1OA3A 2HWC3 4B4QA 5JZGA 3N9LA 4G3YC 4MSVA 3PTYA 1W9SA 2YG0A 1CAVA 2YXSA 4GB33 1YQ2A 5H9QA 3WR0A 1QJU1 1MZ6A 4Z1VA 5DAWA 4DIQA 2RJLA 3POJA 3CMGA 2EAKA 1WW6A 5FBZA 3EHKA 3UV9A 2XJRA 3I8TA 3NW4A 1K5MB 4WM7B 5IATA 3RSJA 1RXFA 4NJ4A 1SLBA 4LKDA 4E4ZA 1TMF3 2WSVA 5D1IA 4C8DA 1CESA 2GNDA 2WS93 4RA0A 3R0RA 2E32A 3S7EA 4XXAA 5GLTA 3A23A 2DUPA 5EFUA 2YMZA 1GP5A 2VCBA 4H2AA 4MXWB 1W28A 1JOPA 1CAXB 1COV2 2GC0A 5CFCA 2W1QA 3H3ZA 2D43A 4CDUA 1MEC1 1Q8QA 2G9GA 3CJIA 3FLTA 1GZCA 1LCLA 1XE7A 4HETA 2R061 5FPAA 5I8TA 5FK8A 2A6VA 2C6SA 3VKOA 2L9LA 4X6QB 1OMIA 5I8SA 4WVMA 1ZYBA 1KQRA 3ZVXA 5L36A 4FPFA 2A5ZA 2VU9A 3OBRA 1W05A 3CLPA 3VD7A 1BLZA 1PZ7A 3BYWA 4YFWA 3O0WA 1VB2A 2LALA 1W2AX 2UWAA 4WM7C 3HMYA 5FMOL 3HR9A 3WV6A 3GALA 3CIHA 4Q4X3 3IIAA 1TMF2 1Y9MA 5CA6A 4TXWA 3THCA 3LFMA 3USSA 1JYXA 3AMMA 4MX3A 1BYHA 2ZAAA 5CBLA 4QMAA 1CIYA 1PVXA 1RUD3 2OXBA 3LKJA 1BBT1 1AR93 1EP0A 2VVFA 4GWIA 3H1MA 3T3YA 2IVJA 2OUJA 2VMDA 3UKVA 2WFF1 3VZOA 5L19A 1U0AA 3OPZA 3USUA 1GFF2 4ZPIA 2OQ6A 4BIOA 2WZPP 4GB32 1TEIA 2VZTA 3DYOA 2B42B 1HJGA 1LB2A 1RUF2 2Y8KA 2R1DA 2RR11 3PIGA 1FPN1 4OZXA 4RFRB 3RZGA 1UYPA 4IW3A 2WYSA 3ELNA 4ORFA 3RRDA 1RVF2 4YVWC 4A45A 1GKBA 4LHNA 5FRAA 4CCJA 4RS5A 3PVOA 4PDWB 3MIHA 1AUYA 2FCVA 2QZ2A 3ACFA 4BM8A 2UY9A 4CDQB 1PK6B 4EN6B 4IETA 2E9QA 3VDAA 4OYUA 2UYAA 4LQRA 1CAWB 4QDRA 1XC6A 5A6XA 5J37A 1O4TA 2VZPA 3KCCA 2DVAA 5L9RA 4CU6A 3VBUB 4XF3A 5F32A 3SITA 1K12A 3IDBB 4Q1PA 3VBUC 1EUTA 1JS9A 5ANNA 5FYZA 1B35A 1OF3A 1Q8OA 1W6NB 5F3IA 1OUSA 3A7QA 5FZLA 4YG0A 2CWSA 4BQ2A 5GJ6A 2WZ8A 4PIYA 4FOYA 2VGDA 1ASJ2 1BEV2 2WO3A 1LOEA 4OLLA 3KT7A 1HDKA 1PM4A 4IQPA 5FYBA 1U5YA 3K4DA 4MGZE 3JBG1 1UZYA 2VMIA 2ZGNA 3BVCA 5SV5A 3O1UA 3TN91 3AVSA 3UK9A 5T5LA 3N35A 2DTWA 4JDMA 2IXLA 4PDWA 5IW0A 4AYUA 4YRDA 2HWD1 2O1QA 3O5SA 3BODA 4LKFA 5CZKA 3T08A 3WT3A 5F6KA 2SBAA 5IVEA 2RDRA 4Q27A 2P34A 5EQUA 1D0GA 1SBDA 2CL2A 2D5HA 2IC1A 4FPLA 4OQ9A 1XYNA 3ZLIA 4YM2A 3BGAA 5KXEA 2EF6A 4FCAA 2DCKA 2VZSA 1C1FA 3M2MA 4UF0A 3KV5A 2AENA 5DMYA 1KJLA 2JDPA 4V2WA 5FZ6A 3AL5A 2Y26A 3ZFFB 3FC0A 4YW7A 2LS6A 1RUH3 4XFFA 5GLUA 4HN1A 2RJKA 3V65A 4AGGA 5ERLA 3MIBA 4QGLA 2Q8EA 1RUF1 4TSVA 4AI2A 2RVAA 2ADEA 1HQLA 1W6OA 1W8OA 2D6MA 2GC2A 2PHWA 1S0GA 1UU5A 2FDJA 2GH2A 1IS6A 1UY2A 3PTRB 3H9AA 4XACA 3ZXKA 3RZMA 5LA9A 4RQPC 1QJFA 1SCSA 3OTFA 5FZHA 3O1SA 3ENRA 4Q4X1 3ZPOA 2ZS6B 1QU0A 1WKYA 3B00A 2Y64A 4V1PA 2DURA 4PI2A 2AH2A 5FV3A 3MUZ1 3RZKA 4QXCA 1IG3A 3WW4A 4IL7A 1NUKA 1CZVA 3O1OA 4Q4Y2 2Q5TA 4NPLA 4XJAA 2H6BA 2N7GA 4EWDA 2K2SA 4YZ4A 2P4EA 4EZHA 2ID4A 1E5HA 5K8SA 2Z69A 2ADDA 4LITA 2NPIA 1GNHA 3WNLA 3D3AA 5C70A 2ZOEB 2GNBA 4XAAA 5FYSA 1RJ8A 5FO8B 5C5UA 1POV3 2WA3A 4XIKA 5FKCA 3E6DA 3UGGA 4OI2A 2Y60A 2EAAA 3WEZA 3MUY1 3URFA 3FZ3A 2YV8A 3HT1A 3K2OA 4AK3A 2VNRA 1ENXA 1FI2A 1NY71 1PNFA 4K1ZA 4MOAA 4PQQA 4QU1A 1ZRIA 3T1MA 2IXHA 1H8VA 4WM8B 1GNZA 5AC91 4UT5A 4ZXKA 1T2XA 1A6CA 1ZBA2 1JOJA 2ZTNA 2ZHKA 3EXUA 3SCHA 3BU0A 3IPVA 5EZWA 5FREA 2ZEWA 1MS8A 4AI0A 5FQ0B 1WBFA 2LROA 1VMFA 1W8NA 4PIZA 4OI4A 4BWOA 3GDBA 4F3JA 4BLIA 5FYVA 2XGXA 1OD3A 3JD71 3KT4A 3ZXDA 1Q8PA 4Y20A 4P9IA 2VTFA 2YY1A 1V70A 2W87A 3BN6A 3EO6A 1GLHA 1JYTA 1US2A 3MO4A 3INAA 4HONA 1N1VA 5GALA 4E4HA 1IZ3A 4CCKA 1ST8A 1XBFA 1SLTA 4OZOA 4B1LA 3NJXA 1LU2A 4QB2A 3WNKA 2CNAA 3VBFC 2VZRA 2ET1A 3WLUA 4AVCA 1RUE3 3IAQA 4EROA 2XJUA 3KCYA 1VRH3 1UY3A 2D97A 5FOJB 3Q8FA 1O8PA 3KS7A 5FUIA 4Q4W2 2VW0A 1DGLA 2QUOA 4G9SB 1WCSA 1EAH3 4AI9A 4CCLA 2XBO2 3VD5A 2NM1A 4COVA 1MS5A 4QX3A 2BFUS 4P9XA 4GH4B 1ZA4A 1VE0A 2VNGA 2XMLA 4HG6B 3ZYRA 4CCCA 4R9AA 4PDWC 3W59A 4L99A 3E5XA 1VP6A 3AKQA 5FY5A 4UFLA 2CGOA 5LBCA 3N9MA 1NCRA 2A6ZA 4NRPA 1V6IA 4YG6A 3MDPA 2YBSA 2HWB2 2AYHA 4MUVA 3EBRA 3B7MA 4GWJA 3WQ7A 4JHTA 1VAKA 2W0XA 4CDUC 4FAHA 2XJSA 5JSRA 1EV13 4GMP0 3CJIB 4TN7A 4QX1A 4XXPA 2B7YA 4AGRA 2IUWA 1OVSA 5BNQA 5C3QA 1LGCA 3LIHA 2C9AA 3IPVB 4FXGB 5HXMA 1ZBA3 1QJX3 4QQLA 2J42A 1UW8A 1UPIA 2ZXQA 3JU9A 4UFMA 5LK7B 5CAZA 1WBLA 2P3KA 1HRV1 4W6XA 5FP8A 2VE1A 2W94A 1UF2C 4NAOA 5C5TA 2PLV3 2GC3A 3AC0A 4Q8LA 1WCQA 3UKNA 2GH8A 1XQNA 5FYHA 4OHYA 2J1TA 2QFEA 1JBCA 3CKHA 1VBB1 2GC1A 4BU2A 3RPQA 4EN8B 4QGNA 5IYYA 2OS2A 4DB5A 2D93A 4RHV1 4AFCA 1JTZX 4LBMA 2ILMA 1MVEA 4XUNA 5ACA2 1H8TC 5J48A 1PIV2 1AJOA 2E51A 5HCFA 5FP9A 2RMU1 5CIRA 1O4ZA 2Q30A 5IT6A 1OC1A 4M01A 1SG3A 4BQYA 1ULDA 3SH5A 2DDUA 2D6KA 1XB9A 2UY8A 4Q4V1 1K42A 1RUJ3 3B94A 4Z92B 2DYCA 4CPBD 4CEYB 2FDKA 2W1UA 4I3PA 4N53B 3N36A 1Y7BA 3RJ2X 4KU8A 3B69A 3VZNA 2FQPA 1SPPB 1SZBA 2ARXA 4CDXA 1VJ2A 1QIQA 5HI0A 1GV9A 4M3CB 2ZGOA 1IQAA 4WV8A 5T54A 2VBPA 1VBD2 2JKBA 2R6QA 2ZA9A 3Q8BA 4XZPA 4NO4A 3M1HA 5FXVA 2HWF1 2VOKA 2ZHNA 2VUCA 4JKLA 3CNAA 1B09A 1HRV3 4FBFA 4BJ0A 2VW2A 1W8TA 3T0AA 1CD3G 2XBO1 4IERA 3AYCA 2NQYA 3HEIA 1BK0A 1KXGA 4HL0A 4BMEA 2HWE3 5A7OA 3ZR6A 2WT2A 3CHXA 3ILRA 3OGGA 3VBHC 5FPBA 1N47A 4GULA 2VOTA 3T30A 4D7TA 4IEXA 5EJ3A 4LUMA 4XFHA 5K7PA 1ZA7A 5GZFA 3I59B 2BNOA 4YG3A 1RUI1 1XU1A 4CUBA 3KV4A 4XE9A 4AEDC 2VZQA 1OH3A 2JD4A 3I2FA 4UW4A 4BXFA 1MS1A 1H8TB 3HBZA 2AEYA 3DYMA 5DN2A 1W6MB 2WNUB 2XG3A 5LATA 3WNXA 1S4CA 4KBZA 4DNYA 5IVVA 4DXRA 4Y26A 3VBOC 3RNSA 3LDKA 1GWKA 3JD72 4IGQA 2Q8OA 1U12A 1DHKB 2D44A 4DY3A 1YQ8A 3WG2A 3OEBA 1FMD2 2H0BA 3JUUA 4LBLA 3ZO0B 1RUJ1 4ASMB 1GUIA 2BVBA 1MEC2 4Q0VA 1IG0A 5DAPA 3B9CA 4M0HA 2YC0A 3C7HA 4HKWA 4YNIA 1OH4A 1VBD3 2FDHA 1VB4A 2WQZC 4AVSA 1LKNA 1BEV3 3GHNA 4XCBA 2MEV3 3LQCA 4HZFA 1QGLA 2PXJA 4J1XA 4LBQA 3WINE 1OOPB 2QCSB 3FLPA 5JIUA 4NROA 2BZDA 3AYDA 2B39A 1UIJA 3K51A 3OYWA 4RFT0 2VQUA 1LOCA 1B35B 1N1YA 1PO21 1W6NA 4YFZA 4LBNA 2CDOA 1NYWA 4QXKA 5A1FA 1NCQC 4NIGA 2LUWA 4CCNA 4R4XA 4LLOA 3WF1A 5I0SA 2CGNA 1ZBA1 4W50A 4CZSA 3CO2A 2VQAA 2WR9A 3D5OA 4QHOA 1SFNA 1C5HA 1W6OB 1PIV3 3K3NA 1J58A 3T4HB 4BQXA 5FZFA 2J1UA 4KL1A 3WP6A 1RUI2 1UMIA 4PF5A 3N7KA 4IE7A 4COZA 2Y0OA 4MXVA 1U5ZA 5EP9A 4ZKTB 4LLFA 2EVXA 4LBKA 2XHKA 1NOVA 5FZ3A 1XXNA 5F2SA 2MNGA 1RUH2 3ATGA 1CN1A 5DG1A 5JZGC 3OEAA 4MHRA 4CEYA 4NWVA 1RVF3 2PHFA 4NIIA 5CFDB 3U75A 4JDNA 2BQPA 1UU4A 4NVPA 2TEPA 2XR4A 2BVVA 2ZX3A 4XMAA 2HH9A 5FPXA 4A3XA 2NMNA 2AEZA 4HLTA 1J3QA 3HOBA 1QJX2 4XAEA 4WVVA 1YWKA 2KA3A 3TYJA 5FK7A 1OQEA 1VBD1 3RZJA 3CBNA 4TLGA 1OLRA 1DZQA 5FZIA 1A34A 5FFOC 4JGYC 4YWAA 5B4XA 3WD5A 3S30A 5IWFA 1IS3A 5JIAA 5L9BA 4FFIA 4BDVB 4XUQA 2ZABA 5A6ZA 1DP0A 1FV3A 3MHZA 4JQRA 4Q4X2 4B4RA 4GKYA 1EUUA 4LKSA 5IJRA 1YUDA 5L9VA 4AGVA 4CP9A 3FHIB 2YROA 1FXZA 5CG8A 5F2WA 3KD4A 2PHUA 3D6EA 2QKDA 4M00A 4ATEA 5I93A 1BK1A 4YW2A 3RZLA 4Q4Y3 4YW3A 2DCTA 3KZ4C 5A1AA 3QOPA 3E1F1 1J1LA 4X8NA 1WMEA 4XURA 1RHI1 2YU2A 1OD5A 2PHLA 4RN5A 4HPKA 4Q1RA 2UYBA 1DQ1A 3AMPA 3WY6A 5A7QA 3HBKA 2XOMA 3I2DA 5H9SA 4LBJA 2JENA 3PJYA 2JDAA 1KS5A 5FJHA 3U4SA 4NR1A 5F5IA 4KG8A 2GNTA 5K0UB 2Q1ZB 1OBNA 2KXLA 2PHDA 3V0BA 1ASJ1 4HKOA 1W8ZA 1EAH1 3BU7A 4Q4V2 1R1ZA 4QPYA 4KBBA 3O0XA 4QDSA 3GJAA 5D2AA 3PURA 1BQPA 3GHMA 5KHKA 4JGZB 1LEDA 2OZJA 5A7NA 2WNVB 1DLLA 1XE0A 3P6BA 1V6LA 2PYTA 1RUG2 2QTWB 4IEYA 5IAXA 4TTGA 2HYXA 2RS33 3RMYA 2YDEA 2P17A 4GMP1 3VV1A 1DZTA 2PELA 4OULA 4N53C 5SV8A 3GZEA 4Y1YA 1D4M3 4YW1A 1BEV1 3FJSA 1XNBA 1WLCA 1Q3EA 4DXZA 3VBOB 4PHZA 1ZRCA 5HXVA 2HLEA 3SH3A 2VR4A 2XQXA 3MLLA 3WDWA 2EICA 1RHI2 5DUXA 1X9TA 3NVCA 2FCUA 4FT8A 5LEKA 1W9WA 4JGZC 4BOWA 2RV9A 2JG9B 5KHIA 1GQPA 2K9ZA 3C7EA 3NJZA 5GLWA 5F3GA 3I2KA 2WWJA 2SLIA 3RG0A 1S0FA 1ZBE2 3NNMA 3VL9A 4A7KA 4LHLA 3VZMA 1F4AA 1W6PA 4P9WA 2P3JA 1GZWB 1AX1A 3P1IA 5IVJA 1AR63 1QNWA 3MPPG 4HFSA 1T6GC 2ZEZA 4I01A 3ON7A 4BA6A 1GZTA 2E33A 3DKWA 5FZ9A 4JKKA 4YGBA 1RVF1 2A71A 1SFYA 2VQ0A 1KRIA 4YW4A 4RSUA 3PL0A 2W39A 1VR3A 3DCQA 3OSDA 2XPJA 5FLHA 1UD1A 4K8RB 2RS53 5KHJA 1SLAA 2PHTA 4K8FA 1YFWA 1ZVFA 2P3YA 3WDVA 1H9WA 4LT5A 1RITA 4L8QA 1PVC1 3R4UA 1S0CA 1VBA3 2D6LX 4LJHA 1RUH1 4OI0A 1X7NA 3LA2A 3MBWA 1WMFA 2RDNA 4DPNA 3MLJA 3PUHA 2P37A 5FY9A 5FY4A 2PLV2 5EV7A 2WQ4A 5FZBA 1JZ7A 1OA4A 2ZX4A 2AR6A 2RJ2A 1AR72 1RUF3 4OUEA 1LHNA 4JGYA 1K5JA 1K3IA 2CTVA 2Y6JA 4IE0A 4AQ6A 3CZJA 4EV0A 4KGGA 4MGSA 1OFNA 4Q5OA 3PJQA 5C33A 4XBLA 3ETQA 3ZFFC 4JGYB 1UZ0A 1Y9QA 4PCRA 4AI8A 2R072 4MH0E 1NXMA 1PGL1 4FOVA 4YVSC 5J98B 3S7IA 3LAGA 1QQP3 3SNMA 1NKGA 4PLMA 4QX8A 3TEYA 4XABA 1RUI3 2BTVC 2QVSB 4E27A 1RINA 1ZZ8A 1DQ4A 2OQ7A 5IVFA 2IXJA 4DQAA 4XDPA 1AR71 2X53S 2Y0IA 3GBFA 3N9PA 3AZYA 4LORA 3VBSC 1NLQA 2DFCA 4XDQA 4CVUA 1J59A 5C8WA 5A33B 4Q0UA 4KWKA 3AL6A 1IPKA 2P6CA 1VAVA 3AMNA 3U37A 1O4YA 2DWRA 3WNMA 2PA7A 4CXWA 4RD7A 4LE3A 2ERFA 4QXBA 2VVEA 4AAXA 1YNAA 2WO7A 1OURA 4P14A 1RUE2 3SKVA 4ZHNA 3SQOA 1V00A 4K3UA 4XC9A 4JRLA 4ZU7A 2ZGPA 3OUHA 3HWJA 5BNPB 5FYCA 2F4PA 4JQTA 5H9PA 2XB6C 1KGYA 2IFWA 3M7AA 4Q0SA 3UJQA 3GXUA 2YBPA 4XBQA 2Q1MA 2VNVA 4AR2A 4XPVA 3NKTA 4NHXA 4BQ5A 2JE9A 4CUGA 1JN2P 3ALQA 3JD73 4FFFA 1LNSA 2JICA 2R1BA 3IB3A 3AJZA 3FHAA 1MQTB 3I3QA 3FLRA 1H6YA 2XWJB 5FMDA 1BMV2 2D5FA 1KJRA 4L2NA 3QCWA 2GMPA 5F37A 5HCHA 4PI0A 3SHRA 4C1WA 2OVUA 4AFMA 2QQOA 4NIHA 1G6NA 1SCRA 2BEOA 2EXIA 3VHRA 1PGW1 1IOAA 1S0EA 4ZS3A 2XUMA 1HJFA 1Z7S2 2DU0A 3IDCB 1OFSA 5C3OA 4MGIE 2FHRA 1APNA 4TWTA 1S55A 1US3A 3LOBA 3HNMA 2RM21 2JDMA 3H8RA 5BNOB 5M0TA 4RR3B 5T52A 4M3CA 3KHCA 3J7NA 1NXD1 1QDCA 5C7GA 1BKZA 1S2BA 3WUDA 2QQJA 1RUC2 3F2ZA 1GMMA 1GICA 1W3XA 4IE4A 4Q0QA 1R082 1TME1 4H3WA 4DRRA 4PLNA 2OA2A 2PQSA 3PNAA 1ENRA 4META 5DXDA 4AFDA 2V09A 5FMCA 3H7JA 1UX7A 2FMYA 2GZWA 3LD8A 5BNNC 2BBVA 5IVYA 1I5PA 1OUXA 4IV3B 5KHHA 4ZZ5A 3LDBA 1VBA1 3QD6A 4QM9A 5C8CA 2BP6A 3LWCA 3BUCA 1W03A 3FWEA 1HW5A 3PU3A 3SKJE 5LA1A 2UWBA 1NCRC 2XH6A 2YGMA 3DXTA 3D4KA 3MF9A 3BPZA 4UWDA 3TAYA 1A78A 1QJY3 1ULCA 3AM2A 4XJWA 1S0IA 3N9OA 2EALA 2KD7A 3LEMA 2AGSA 1IQDC 2OIIA 3POGA 3WG1A 3TEXA 4I02A 4R9CA 3ZM8A 1CJDA 1KFXL 4DEVA 3OPTA 3U4XA 5F3EA 4HSJA 5J36A 4HVQA 4G4FA 4LBQB 3H7YA 2A73B 5A80A 4K1YA 5HBAA 2V4AA 2GU9A 3HIFA 3QBQA 4OMDA 5HV4A 5FO7B 3VBRB 2LM3A 4HT1T 4Y5SA 1JHJA 5JXIA 1W8UA 1EPWA 3OUJA 4CDUB 3W20A 1HB1A 1AR73 1ULOA 4YVSA 2D3PA 5EJ1B 1ACCA 1E5RA 1QEXA 3KV9A 3S0MA 1YYNA 1WD4A 3NKGA 3WX5A 4HXCA 1CIWA 2PN5A 3VN4A 1F8VA 4XJ9A 3V64A 3ZXFA 5A3OA 4KWJA 3GBWA 3QH6A 2BOJA 3APBA 4P9YA 3ZFEC 3TNPB 5IVCA 1R091 4BXSV 1CZSA 2A70A 2J1EA 2ZACA 3LCPA 1G9CA 2VW1A 1W2TA 2ZGRA 3OBAA 2JB8A 1AXYA 2HKXA 2ZGUA 4IV3C 2QZ3A 1Y3TA 1F2NA 4XFIA 3ZMNA 4EN7B 4NIAA 5IVBA 3T0BA 1UL9A 4O65A 1D4M1 1IS4A 3AZZA 5FYIA 1BMV1 3AKRA 3I59A 1NLSA 1AL22 1BVVA 1QJY1 3N9NA 4JHZA 4CTEA 1YFUA 2ZJCA 2HWF3 3ZYJB 5BV6A 1NA1C 3GNEA 5ABJB 1MPXA 5KWRA 1H1IA 1JUIA 2B46X 5A3TA 2D40A 2ZZQA 2XBO3 4IV1C 4R52A 4CDXC 4OUSA 1DYKA 2RG4A 1TVGA 4L92A 4UW5A 1AZDA 3C8XA 5F5QA 1DCSA 4D94A 3ZXJA 3O1RA 2Y34A 3OF1A 3MICA 2A7AA 1UMHA 2ZPXA 4XZUG 4BMBA 4AL9A 3AMHA 2NN8A 4O61A 4QPWA 5T5OA 5AVAA 2B9VA 1REFA 3SH4A 1AL23 2ARAA 2PQQA 4KH9A 2XJVA 4RS5C 1J83A 4FOWA 4NPRA 2ZX1A 5KXBA 4MADA 1Q8VA 3O7OA 1FOD2 1VBE3 4FPEA 1SBEA 4LNVA 2X10A 3OY8B 1YQCA 3POSA 1IPSA 3MIDA 1FYUA 4N43C 3MZHA 3A4UA 3AMQA 4QX5A 2BWAA 5CKMA 5TSWA 1GANA 2DF7A 2VZ1A 3NL1A 1DDLA 2B4KA 1PVC2 2A6WA 3ACHA 2GDFA 1LECA 1ZNPA 5JSOA 5C3SA 1CVNA 3JBG3 4Z8BA 1UXZA 1TG7A 4ZZ8A 5LW9A 1W9YA 1XSRA 3M70A 3P5BA 3W21A 2V4VA 3VHOA 1MVQA 4H55A 4K20A 4AHXA 3M3EA 1MS4A 1H9PA 4YGCA 4AEJA 2BNMA 1DBNA 2HWD3 2NP0A 5CKQA 5LB6A 2HWE2 4CCOA 1CAUA 5GZCA 1SBFA 3OOXA 1FOD3 4YVWB 3VDDB 4DXSA 3WUCA 2WKKA 3VDDC 3SEPA 2IXIA 3ZOIA 3ZSJA 1FAYA 2ZHLA 4QQPA 2BRTA 4FTSA 1VBC3 3OGJA 1PO13 3POYA 1ZBE1 1SEFA 2QDNA 3DF0A 4RGKA 1MR5A 5FY1A 3U07A 4A7YA 1W2NA 4BE3A 1V6JA 1VRBA 4AAPA 3ZFGB 1CR7A 3N7LA 5C4WC 4P02B 3BTXA 3HNYM 1DGRN 3FE5A 4XILA 3ZXEA 3AKPA 3FFQA 2XLAA 4P9JA 3M3QA 1NCQA 3POIA 2ZGSA 2YC4A 1VBE1 4IDZA 4PF1A 3VUOA 2G4IA 2WLPA 3ZFGA 1I6XA 1J3PA 1YFYA 3NNGA 2GAUA 2Y38A 3ABZA 4OHZA 5C71A 3N4MA 5LRSA 3JXSA 2HWC1 2JECA 2H0VA 3I4IA 3KQRA 4UYBA 1X9PA 3I7DA 1ND3B 1YIFA 2QQKA 4IGPA 3IZOA 4MGTA 4SBVA 4B8EA 1W8HA 4W6WA 3WZ1A 5IAVA 4S2HA 4AW7A
chains in the Genus database with same CATH topology
2OPKA 2R073 4FAGA 4XFAA 4MGKE 1D2SA 5AVPA 4E2GA 4YYOA 2O8QA 3OD4A 4ZU5A 4AHYA 4YVSB 1R081 1TME2 3GYDA 1BJQA 4K40A 2AUYA 4RHV2 5L7OA 3JBG2 3OCPA 2TBVA 2HWC2 3MW4A 1MZ5A 3ROUA 3IKWA 3N7MA 1EV12 2C0ZA 1WCKA 3O12A 4CP0A 1LGBA 2XLFA 3OY8A 1H2LA 2WWSA 2AREA 1VBE2 3GBGA 3VHNA 1Z7S1 4JTOA 3ZSMA 3V0AA 2I74A 5I0UA 4DY5A 1ONAA 3VBRA 2RS12 3M3IA 1GZWA 5JI9A 5EYXA 3ZSLA 4OFGA 2PTMA 4AI1A 4L9BA 1ASJ3 4FPYA 2ZGLA 5ABJC 4B29A 3B9IA 2D6PA 3H1YA 1EAH2 2O8OA 2YHJA 4IEWA 4RS5B 4XETA 1AYN1 1VRH2 3N7JA 3ZSKA 1TNRA 3AXEA 2HEWF 2YYOA 3ILNA 5L7OC 3P3PA 3NV3A 2R16A 5L7OB 3WG4A 3MIFA 4N7IA 1FPN2 2RR12 1MZEA 1A8MA 1RUC3 2D7FA 2ZKNA 3HAGA 4AQSA 4XF0A 1RMU1 1OSGA 2CAVA 5E16A 1JW6A 3H50A 3UL2A 3ZYIB 4DZGA 2ETEA 3TBDA 4WM8C 1ND3A 1WLWA 5E1RA 1IS5A 3MIGA 5BUVA 1TMF1 1VBC1 4I0WB 4YGDA 1JYCA 4OHWA 5DDJ3 5FQ0A 2WL1A 3HD8B 1ULFA 3AJYA 3B5LB 4QHBA 3L9JT 2VVDA 1MS9A 1POV0 1U5XA 4Y20B 1NCQB 5AFBA 2R063 3ES4A 4OHXA 5EYYA 3H1WA 2G9FA 5CFCB 3R4SA 4ASLA 5C4WA 2ZKLA 2JG9C 2VPVA 2QE3A 1MQTA 4OUMA 5GKAC 5JPMB 1V9U3 4JCKA 2HJIA 4Y5Z0 4N9IA 1AVBA 3DGTA 2PLV1 4HANA 4Y22A 2OYZA 4YVWA 4FPKA 2CYFA 1LTEA 3IWZA 1QOSA 5IK5A 4PLOA 1CX4A 2VY0A 1DU3D 1X50A 5CFDA 4BLJA 1WUVA 2GMMA 3WP4A 4YM3A 1LHVA 3FUQA 1JYIA 1QWRA 4BYYA 2ZGKA 3ACLA 5FTTC 4EN9B 3V56A 4AVVA 1Q43A 1SACA 2ZAHA 2WC2A 2E63A 2UWCA 2WIIB 3AP7A 1JUHA 4H7MA 1WW4A 1RB8G 3MYXA 3KLSA 3E97A 4LO8A 3NAPB 1AL21 2FBEA 1LHUA 4Q29A 2RHPA 4R4ZA 3EQEA 3ZFFA 5CFCC 1UMZA 1FMD1 2VUAA 3KCXA 1AYM2 3MI8A 5J96B 2R042 1LU1A 2DV9A 3VKLA 1R092 4D69A 4QT6A 2VNOA 1DIWA 1NQDA 1IKQA 3MLKA 5JMCA 5CFDC 4N53A 1ALYA 3VBSA 4BCUA 3MPBA 5CG9A 4U36A 1S2KA 4KGQA 4LUKA 1CAXA 3U0ZA 3TOJA 1N3OA 1HXS2 3VDDA 4QPGC 3BCWA 4IESA 2A3XA 3AK0A 4FOQA 1A8DA 4OVEA 5KC6A 4AHZA 2O0OA 3E5UA 1LJ7A 3FX3A 1REDA 1DGWA 4YZ1A 1JH5A 3AFGA 5K0UA 2XVKA 2VECA 4DINB 1AF9A 1ZBE3 1G9AA 1QDOA 1LHOA 4C0BA 1SLLA 1CAVB 1ZRRA 1MEC3 3NSTA 1F5FA 5DDJ1 1OQDA 3OJBA 1ZRFA 4L97A 4URTA 2ZGQA 1FMD3 1W0OA 1X82A 2VG9A 2K0GA 2DFBA 4AQ2A 4COWA 2V5YA 4E2SA 2HEVF 4RQPA 1QMJA 4QQ2A 1RJ7A 3WHUA 3ZN6B 1CJPA 2A6YA 4UXAA 5JOXA 3NWKA 2JG8A 2B8MA 2JDZA 3KM5A 5JSPA 1UX6A 2ZGMA 4K7JA 3VBUA 2B9UA 2RS32 1DF0A 4B7KA 4DRVA 4PIXA 1PZ8A 5KXCA 3VLBB 2IWGB 1TME3 4QPGB 1RUD1 1WW7A 1W0PA 1XNDA 4COYA 4CDQA 2UU8A 4GKXA 1QJZA 1RUE1 3G7DA 2CWMA 1Q5OA 2Z2SB 2DCZA 1DQ5A 2FZ1A 4TYSA 5FPZA 1LOGA 4GH4A 1IPJA 4XOGA 3W9AA 4AHWA 2DCYA 1LOAA 3VHPA 1X36A 2P3IA 2TNFA 1LOBA 2ZMNA 1ZZCA 1S0JA 2ZBJA 4XFGA 4YLZA 4YM0A 1R1A3 4RR3C 2EXKA 4QQHA 4GXLA 4KNCA 2E53A 5C8CC 3FUOA 4XW3A 1VLNA 4FTEA 4A7ZA 1D2QA 1WLDA 1SLCA 1W6PB 3ES1A 3KGLA 1J1TA 5AFEA 1DGWX 1TNFA 1QOTA 4D7SA 3LOIA 2DCJA 1GYKA 4EJRA 3FFZA 2WS92 1SMVA 3M8LA 2XL9A 4MXWA 3ZN6A 3J8F3 2X5IA 3T1LA 3AZWA 4LEJA 1AYN3 5L73A 1PO23 2ZX0A 3DV8A 3KGZA 2IFRA 4XFBA 4AVTA 1HKDA 4MYEA 1QY4A 5JOYA 5C8CB 4GWNA 4M3CE 1X8MA 4FVVA 1VBB3 1KDKA 4O9EA 5CVRA 4N9HA 1CAUB 1D0HA 4J6GA 1RMU3 1S0DA 2QNKA 1BVP1 3LSEA 2WS91 2JE7A 1H4HA 1HIXA 2NYYA 2GSYA 1RUNA 1DG6A 5KC5A 3L2HA 3E5QA 4QD2A 4QM8A 4IV3A 4Q26A 2R32A 4XYXA 4RL7A 1LULA 5BNPC 2XKPA 1FX5A 1HRI1 5JOWA 1DYPA 3CF6E 3MF6A 4Q4V3 3HN1A 2E6VA 3MFAA 4WZCA 3PLQA 1LENA 1KD7A 5GZGA 3UJOA 1C28A 1NA1A 2HYKA 4BHPA 5JZGB 4MGYE 3R05A 4MLOA 3ZFEB 3OYWB 5T5PA 2DVFA 4MVTA 3VZKA 2QDRA 2B5HA 1DFQA 4GQ7A 5IUQA 3H3UA 4A2UA 5DZFA 1YXWA 2XVLA 4FTBA 2WFPA 2WA4A 3V0AB 4AE2A 1O91A 1WGPA 1QNYA 1TE1B 2RS13 4JC1A 4XIOA 3SCGA 2E7AA 4C90A 4Q2FA 4CEWC 4QPIC 4XHXA 4D3WA 1KS4A 5BNPA 3QLQA 3B93A 4XBNA 1QH6A 1YCIA 1YLLA 3K48A 5D8AA 2EXJA 2BWCA 2VH9A 4ES9A 2A3YA 1ULEA 4GWMA 3ZIWA 1CGPA 2R043 4RHV3 1C8M2 3Q9OA 1POV1 1A3KA 5JI7A 3D0JA 2EXHA 5LK5A 3ZPYA 2GNMA 1O3SA 3SXWA 1IGOA 4JV4A 4FPGA 1RTVA 2GMEA 1L3JA 1S1AA 1DZRA 2RS52 2RS31 3DUIA 2WNUC 2Z79A 3A0KA 1YO8A 1RUG1 3ZFEA 1DGRA 1NG0A 1C8M1 3BOWA 4ISRA 4ZU4A 5A32A 3AP6A 5BNNB 1LOFC 5GLZA 5JWPA 2ES3A 4WVZA 3VGIA 3TN93 3VBHB 1H2KA 3RS6A 3KSCA 5A3MA 5F1RA 2ARBA 4QPIB 4I09A 1GQGA 1OOPA 3WDTA 3BALA 1AX2A 1R1A2 2OZ6A 2RMU3 3WW2A 2R041 2XLGA 1QOOA 3RYKA 4AI3A 4XJUA 1XU2A 3PVNA 1Z78A 4LA2A 4QU2A 3RZZA 3JQWA 1Z7S3 1OLQA 3ZN5A 1C3HA 5BNOC 1W6MA 2WNUA 4J1WA 5DUWA 1XYPA 3NO8A 1AXKA 3WCSA 1MZFA 4WVWA 3AYEA 1N1TA 1RUG3 3SCFA 1PVC3 2DU1A 1DQ2A 1GBGA 4HN0A 5DZGA 4HK9A 4YW5A 4P9LA 5E88A 1WMDA 4XQ4A 2WZR1 4ONUA 2GN3A 1PO22 3J9SA 5HCBA 2VUJA 2VOVA 2CGPA 3J8F2 1G9BA 5H9RA 3EJKA 2C5DA 3I54A 1PK6A 3AYAA 4BQ1A 1AR83 1BBT2 1G7YA 1NA1B 5DG2A 1HRI2 4CP1A 4X8PA 1KITA 1NZCA 2AZ5A 1RGSA 4DFSA 5CNAA 1RUJ2 2RM23 1U5IA 2BUKA 1G9FA 2WNVA 3LB9A 1UZZA 4E4DX 3HQXA 1YJLA 1XNCA 4IEVA 4FPJA 1UKGA 4H7LA 4LHKA 2D6NA 3VKFC 4ES8A 3ZIXA 1HXS3 1VAMA 4HK8A 4HSLA 3X29B 1HV0A 3ZDSA 1XRUA 1NY72 4SLIA 4Y1UA 3LA7A 2EIGA 3VBSB 1C57A 2Q0AA 3DPRB 1ENSA 1WLTA 3WDUA 4EN0A 2DVGA 2YGLA 3USUB 3GZUC 4XJ8A 5GM0A 4N43B 2WZR3 4BIFA 1V6OA 2NZ9A 2I45A 2WT1A 3PVBB 4HPKB 5FMOS 5T50A 3VBFB 4F83A 2XL7A 3W58A 4FPCA 2E7QA 1I9RA 3AKTA 4AEKA 1RMU2 4FPOB 5T5JA 2BW8A 3WCRA 3J8F1 4MZUA 1C8M3 3LGRA 5BNNA 4YGEA 5F9TA 3NAPA 3CEWA 2WINB 5DUVA 4Q4Y1 3AZVA 1AR81 2A6XA 2WZR2 1QXJA 1WD3A 2GN7A 1AYN2 1VRH1 1QJU2 4XF4A 4XF9A 1X33A 4INDA 1AR61 1YI7A 1PMIA 1EYBA 4XEZA 4Z82A 5KBFA 3RQ0A 1AJKA 1GR3A 1H1AA 4AG4A 3MGUA 3CJIC 1O5LA 1X8EA 5LEJA 4YARA 5JLVA 3TB0A 1BZWA 5C9AC 2ZX2A 5KXDA 2A3WA 1O3TA 2RS51 4JRAA 4LULA 3RWNA 3MEPA 1N1SA 4R9BA 4WM7A 4LR4A 1EV11 1E57A 1V6NA 1RL3A 4QGMA 1DQ0A 3CJXA 1PO12 4P5HA 2H6CA 3NAPC 4PQ9A 1EY2A 4NOTA 5JOZA 1RHI3 3VBHA 3SISA 5I0TA 1PHMA 1H4GA 1HX6A 4TLFA 2HWD2 5FLJA 4XTPA 3VKNA 1PIV1 1ZZ6A 1ZM1A 3ZYPA 3HT2A 5I91A 4RQPB 5DDJ2 4FO9A 4UW3A 3LA3A 1ND3C 4K21A 3VBOA 4IXLA 4NHKA 1OPOA 1M06G 4Z2WA 3TNQA 1VBB2 4WM8A 4XF1A 4XTMA 3ILFA 1FV2A 1ZX5A 5FDBA 5EWSA 4I0BA 1URXA 4QQOA 4I0AA 5K9YA 1ENQA 3B01A 3IMNA 1VALA 1N3PA 2ZMKA 4UBGA 3E6CC 1HRV2 1GSLA 1ND2B 3RI8A 1JXNA 4XJZA 4IV1B 4AVBA 1O5UA 4W65A 3B02A 3MW2A 4P9GA 4AF9A 2E7TA 4GB31 1F9KA 4WBBA 4CYDA 1CPMA 1H8TA 1HXS1 5A3LA 4OHVA 4IV1A 3U10A 1ND2A 2A75A 3O14A 4FP3A 1BXHA 5CU1A 4O9GA 3NV1A 2IXCA 3WXPA 5A33A 2DUOA 4Y24A 4CEWB 2IXKA 2CV6A 4B3NA 1LODA 4U2AA 4WZFA 1MS3A 1LESA 2HWE1 1QF3A 5GLVA 3D0SA 1QJX1 1S0BA 2OUHA 5ACA3 3IN9A 3AP5A 1Q56A 4N43A 2HEYF 2JG8C 3ZX7A 4RGAA 4S2GA 4KQ7A 2R062 5J09A 5J7MA 5F6LB 2GALA 4R9DA 1H1MA 1COV1 3A0NA 3WP3A 1ZZBA 3VBFA 1ND2C 1V6MA 3AFKA 5FCCA 3RI9A 4ATFA 4NHLA 4F8AA 3M3OA 3ZXAC 2ATFA 4CDQC 4UBHA 3OBTA 3THTA 4XMIA 4AEDA 5I8YA 4N90A 1HV1A 3ME2A 2QJVA 1TQ5A 2R071 4S2FA 4S2DA 3WP5A 1PZ9A 2Z42A 4GALA 2XJQA 3IBMA 4ISQA 1BCXA 4M3CF 1C4RA 3WQ1A 4IEPA 2HWB3 4AEDB 3G6JB 3ECQA 5GZEA 4F7ZA 4JDOA 1YHFA 4RR3A 4I3GA 5BNOA 2RR13 1QJY2 1FPN3 3ZXLA 4QPGA 4E2QA 2XWBB 1FOD1 1LEMA 3JB8A 2BPA2 3AP4A 1YI9A 1YRZA 1O7FA 1SDWA 1IKPA 4Q4W3 3WG3A 4CDWA 3FBYA 3GZAA 2WLQA 1WCDJ 2ZMLA 5BXXA 2JG8B 3VZJA 1B35C 2MEV2 2JJ6A 4HKLA 4KWLA 3THPA 3D8CA 1O3QA 1MS0A 1G8WA 1ZZ7A 4LO4B 4I2OA 1LRHA 3CU7A 1VBC2 1N3QA 3IDEA 4FXKB 3AXDA 4DOUA 4YZ5A 1NQJA 1CONA 1K5MA 2BFUL 1OHFA 2CAUA 4PBPA 4PJYA 4OI1A 3VZLA 4E9KA 4Y1XA 1XNKA 4CRQA 2VOWA 2OW4A 1KDMA 5GZDA 4AVAA 2VMHA 3DPRA 5E8AA 1W2UA 1NE4A 1F5JA 1WW5A 1DQ6A 1D4M2 1R093 3RJRA 4COUA 1RIRA 3MFCA 1AYM3 2FMDA 4HVRA 2DVBA 4ITCA 2WT0A 2EA7A 1H2MA 4C1XA 5DZEA 3S6PA 2UURA 2D6OX 5JAXA 1ULGA 3PMEA 5BYNA 1AR92 4UW6A 1Y43B 1SQ4A 1RUD2 1SLIA 3RDIA 4LO5B 2D98A 5FLIA 1CPNA 5A32B 2R30A 4JAAA 4CEYC 1UIKA 1FNZA 3E6BA 3TWIA 2RMU2 3ASIA 2KM2A 2RS11 4I30A 4YZ2A 5ACA1 5JR7B 1I3HA 1W6QB 1K5MC 3JZVA 3OD0A 3FBMA 4K9SA 2ZCWA 3AP9A 3N3HA 2PFWA 4N7UA 5HCAA 4IEUA 3U11A 3TN92 2MPFA 4Q8KA 4CEWA 1COV3 3NV4A 2ENRA 3KT1A 1V9U1 3ZMOA 2R0HA 2B45X 1AYM1 3ZSEA 4GMP3 1VIWB 1CQ9A 3AX4A 4BPZA 1Q8SA 5JCTA 1QJU3 4BH9A 4FQZA 4HVOA 3RYRA 3ZYGA 3QACA 2W52A 4H14A 2HWB1 2ZZJA 2XVGA 4Y4YA 5E89A 5T55A 2FZ2A 1RUC1 2DUQA 4PBOA 1NLRA 4Y22B 3WQ0A 4NN0A 2BGCA 1V6KA 3T2TA 1G86A 2VOXA 3BOPA 4FPHA 4AQTA 4JTNA 4XHBA 2V73A 4R8HA 4NHMA 3CL1A 3SLIA 4Q4W1 4RGGA 1FT9A 1JHNA 3VL8A 4YM1A 5JVVA 2X8KA 3ZN4A 2R49A 4IEOA 3N4MA 5AC93 1M4WA 2F6BA 5IK7A 3PMSA 2DVDA 2NLRA 2WFF2 3C2UA 3PVEA 1OOPC 4XQDA 1CAWA 4MV2A 3VBRC 5C6CA 3BIWE 3H0OA 3SMHA 1QH7A 4GA9A 4L11A 4LE4A 4NWWA 3ZXGA 3GF6A 3LSDA 3C3VA 1D4VB 3JB4C 3WOGA 4C91A 3JQXA 2RE9A 2YPJA 5ABJA 4GH4C 1GQHA 3MIEA 1BBT3 1XE8A 2W68A 2ZHMA 3J4UH 1OA2A 1QKQA 2WFF3 1ZRDA 4JGZA 4YZ3A 5AC92 2YZ4A 3BTAA 3LZZA 3KB5A 1AXZA 2CY6A 4E4SA 4EWEA 2WNEA 2Z5WA 3DN7A 4QPIA 3V0BB 4Y1VA 4JVAA 1KFUL 4XQWA 3RYPA 2X29A 1MACA 5J3UA 2PHXA 1QXPA 2LTNA 1QQP1 3H8UA 3ZFGC 2C1FA 5C4WB 1OPMA 4IEQA 1ZREA 4HBNA 4LBQD 2D3RA 3P3NA 5D8AC 1XYOA 2JXAA 4K6BA 4KG0A 3WW1A 4Z07A 5C9AA 2PAKA 1PGL2 3IM0A 2I07B 1I1EA 3O0VA 4B7EA 1C1LA 4AXOA 2P2KA 1W39A 1HQNA 1HLCA 5CADA 4LBOA 1ZZ9A 3UKTA 4CDXB 2QQPA 2D3SA 4TZDA 1YFXA 4C0HA 1UCXA 1FNYA 2Q4SA 3MW3A 1I5ZA 1UN1A 3R4DB 5FAXA 4LO6B 1PM7A 1HQWA 2NMOA 1PGSA 1RUOA 4X6RB 1AX0A 1FATA 4DS0A 5K0UC 1MQTC 1RC6A 2WNVC 2XJPA 1H0BA 3WDYA 5JDBA 1Z0HA 5LRRA 3L2YA 3AKSA 1LGNA 1C5IA 2HWF2 4BZ4A 1QXRA 3BB6A 4FSJA 2BYVE 2I2SA 5KHGA 1R083 1V9U2 1WA4A 2WJSA 4FP2A 4IEZA 5FO9B 3KMHA 1R1A1 1AL0G 3WDXA 3VKMA 1UPSA 4YSFA 2W08A 4LO7A 4LTAA 2XJTA 1F31A 3TRSB 1IHMA 3PHMA 2JEMA 3WVJA 1O3RA 1YJKA 4AFAA 2X5IB 5IK8A 4WVMB 5C9AB 1OQ1A 4CDWC 3ST7A 2WSUA 2XKOA 3DPRC 3R6SA 4FQ4A 3DL3A 4LA3A 5CB7A 4Q0PA 1NE6A 1G9DA 2PAMA 3AB0A 3WHTA 3AZXA 2VXRA 1C8NA 1EPZA 1NCRB 1VBA2 1H2NA 2VMGA 1AR91 1UAIA 3M4FA 4CP2A 3J26N 1H30A 4M0NA 4B4PA 2TUNA 2BNNA 5T3NA 1YIPA 2X5IC 1LHWA 2IZWA 2ZGTA 3D82A 3IT8A 1PK6C 3M3CA 1OKQA 1OI6A 2DTYA 3B3QE 1REEA 2JX9A 4D7YA 4DMIA 2RM22 5IK4A 1AR62 1HRI3 5EXOA 1PO11 5B2GB 3POWA 3JCIA 1PGW2 1UKRA 3NV2A 1QHDA 3WW3A 5BY5A 1AR82 1LR5A 4GIQA 2JG9A 5BPXA 3FMGA 3GZTB 4EWAA 4W6YA 2PHRA 4CDWB 5JPNB 4AWDA 2ET7A 1J3RA 2MEV1 1UU6A 5I0RA 4XFCA 1GZ9A 3RMXA 4AFBA 1LOFA 3QH7A 4HMZA 1W6QA 1QQP2 5DUUA 4AEMA 1AHSA 2VULA 2MHFA 5FOBB 2YUEA 4KU7A 2R0FA 1PNGA 2PAEA 4B4QA 1OA3A 2HWC3 5JZGA 4G3YC 4MSVA 3PTYA 1CAVA 2YXSA 4GB33 5H9QA 3WR0A 1QJU1 1MZ6A 4Z1VA 2RJLA 2EAKA 1WW6A 5FBZA 3EHKA 3UV9A 2XJRA 3I8TA 3NW4A 1K5MB 4WM7B 3RSJA 4E4ZA 1SLBA 1TMF3 2WSVA 5D1IA 1CESA 2GNDA 2WS93 4RA0A 3R0RA 3S7EA 4XXAA 5GLTA 2DUPA 5EFUA 2YMZA 4MXWB 2GC0A 1CAXB 1COV2 5CFCA 3H3ZA 2D43A 4CDUA 1MEC1 1Q8QA 2G9GA 3CJIA 3FLTA 1GZCA 1LCLA 1XE7A 4HETA 2R061 5I8TA 2A6VA 3VKOA 4X6QB 1OMIA 5I8SA 4WVMA 1ZYBA 1KQRA 3ZVXA 5L36A 4FPFA 2A5ZA 2VU9A 3OBRA 3CLPA 1PZ7A 4YFWA 3O0WA 1VB2A 2LALA 4WM7C 2UWAA 3HMYA 5FMOL 3HR9A 3WV6A 3GALA 4Q4X3 3IIAA 1TMF2 5CA6A 3USSA 3AMMA 4MX3A 1BYHA 2ZAAA 5CBLA 4QMAA 1PVXA 1RUD3 3LKJA 1BBT1 1AR93 1EP0A 2VVFA 3H1MA 2OUJA 3UKVA 2WFF1 3VZOA 5L19A 1U0AA 3OPZA 3USUA 1GFF2 4BIOA 2WZPP 4GB32 1TEIA 2B42B 1LB2A 1RUF2 2R1DA 2RR11 1FPN1 4OZXA 3ELNA 4ORFA 3RRDA 1RVF2 4YVWC 1GKBA 4LHNA 5FRAA 4RS5A 3PVOA 4PDWB 3MIHA 1AUYA 2QZ2A 4BM8A 2UY9A 4CDQB 1PK6B 4EN6B 4IETA 2E9QA 2UYAA 1CAWB 5J37A 1O4TA 3KCCA 2DVAA 3VBUB 4XF3A 3SITA 4Q1PA 3IDBB 3VBUC 1B35A 1Q8OA 1W6NB 4YG0A 2CWSA 5GJ6A 4PIYA 4FOYA 2VGDA 1ASJ2 1BEV2 4OLLA 1LOEA 3KT7A 1HDKA 4IQPA 1U5YA 4MGZE 3JBG1 1UZYA 2VMIA 2ZGNA 5SV5A 3TN91 3UK9A 5T5LA 3N35A 2DTWA 4JDMA 2IXLA 4PDWA 4AYUA 4YRDA 2HWD1 2O1QA 3O5SA 3BODA 3WT3A 5F6KA 2SBAA 4Q27A 2P34A 1D0GA 1SBDA 2CL2A 2D5HA 2IC1A 4FPLA 1XYNA 4YM2A 5KXEA 2EF6A 4FCAA 2DCKA 1C1FA 3M2MA 2AENA 1KJLA 2Y26A 3ZFFB 3FC0A 4XFFA 1RUH3 5GLUA 4HN1A 2RJKA 3V65A 4AGGA 3MIBA 4QGLA 1RUF1 4TSVA 4AI2A 1HQLA 1W6OA 2D6MA 2GC2A 2PHWA 1S0GA 1UU5A 2GH2A 3ZXKA 1IS6A 3H9AA 4RQPC 1SCSA 3OTFA 3ENRA 4Q4X1 2ZS6B 1QU0A 4V1PA 3B00A 2DURA 2AH2A 3WW4A 4IL7A 4Q4Y2 2Q5TA 4XJAA 2H6BA 2N7GA 4EWDA 2K2SA 4YZ4A 5K8SA 2Z69A 2NPIA 1GNHA 2ZOEB 2GNBA 1RJ8A 5FO8B 1POV3 2WA3A 4XIKA 3E6DA 4OI2A 2EAAA 3URFA 3FZ3A 2YV8A 3HT1A 4AK3A 2VNRA 1ENXA 1FI2A 1NY71 1PNFA 4K1ZA 3T1MA 2IXHA 1H8VA 4WM8B 1GNZA 5AC91 4ZXKA 1A6CA 1ZBA2 1JOJA 2ZTNA 2ZHKA 3EXUA 3SCHA 3IPVA 5EZWA 5FREA 1MS8A 4AI0A 5FQ0B 1WBFA 4PIZA 4OI4A 4BWOA 4F3JA 4BLIA 2XGXA 3JD71 3KT4A 3ZXDA 1Q8PA 4Y20A 4P9IA 2YY1A 1V70A 3EO6A 1GLHA 3INAA 1N1VA 5GALA 1IZ3A 1SLTA 1LU2A 2CNAA 3VBFC 2ET1A 3WLUA 4AVCA 1RUE3 4EROA 2XJUA 3KCYA 1VRH3 2D97A 5FOJB 3KS7A 4Q4W2 2VW0A 1DGLA 2QUOA 4G9SB 1WCSA 1EAH3 4COVA 2XBO2 2NM1A 1MS5A 2BFUS 4P9XA 4GH4B 1ZA4A 2VNGA 3ZYRA 4R9AA 4PDWC 3W59A 4L99A 3E5XA 1VP6A 3AKQA 2CGOA 1NCRA 2A6ZA 1V6IA 4YG6A 3MDPA 2HWB2 2AYHA 4MUVA 3EBRA 3B7MA 3WQ7A 4FAHA 1VAKA 2W0XA 4CDUC 5JSRA 2XJSA 1EV13 4GMP0 3CJIB 4AGRA 4XXPA 2B7YA 5BNQA 1LGCA 2C9AA 3IPVB 4FXGB 1ZBA3 1QJX3 4QQLA 1UW8A 1UPIA 3JU9A 5LK7B 5CAZA 1WBLA 2P3KA 1HRV1 4W6XA 1UF2C 2PLV3 2GC3A 4Q8LA 3UKNA 2GH8A 1XQNA 4OHYA 2QFEA 1JBCA 1VBB1 2GC1A 3RPQA 4EN8B 4QGNA 4DB5A 2D93A 4RHV1 4AFCA 1JTZX 4LBMA 2ILMA 1MVEA 5ACA2 5J48A 1H8TC 1PIV2 1AJOA 2E51A 5HCFA 2RMU1 5CIRA 1O4ZA 2Q30A 5IT6A 4M01A 1ULDA 3SH5A 2D6KA 2UY8A 4Q4V1 1RUJ3 3B94A 4Z92B 2DYCA 4CEYB 4I3PA 4N53B 3N36A 1Y7BA 3RJ2X 4KU8A 3B69A 3VZNA 2FQPA 2ARXA 4CDXA 1VJ2A 5HI0A 1GV9A 4M3CB 2ZGOA 1IQAA 4WV8A 5T54A 1VBD2 2JKBA 2R6QA 2ZA9A 4XZPA 4NO4A 3M1HA 2HWF1 2VOKA 2ZHNA 3CNAA 1B09A 1HRV3 4FBFA 2VW2A 1CD3G 2XBO1 4IERA 3AYCA 2NQYA