2BWCA

Structure of endoglucanase 12a (cel12a) from rhodothermus marinus in complex with cellopentaose (5 minute soak)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
226
structure length
226
Chain Sequence
b'TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRVQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDWNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE
publication title Dimerisation and an increase in active site aromatic groups as adaptations to high temperatures: X-ray solution scattering and substrate-bound crystal structures of Rhodothermus marinus endoglucanase Cel12A.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 61
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2bwcA00
1XNDA 3WP6A 4NPRA 1M4WA 4HKOA 2DCKA 3VHPA 2BVVA 3MF9A 1QH7A 3WP5A 5HXVA 4HKLA 3VZKA 1AXKA 1C5HA 1HV1A 3AKQA 1H0BA 1T6GC 3O7OA 3VHNA 2VUJA 3VZLA 2DFCA 1H1AA 2B45X 2Z79A 5EJ3A 2BWAA 2B46X 2DCJA 1BVVA 4XQDA 3MF6A 3WR0A 3WQ0A 3B7MA 3MFCA 4S2GA 3VGIA 3VL9A 1OA3A 3WXPA 4IXLA 3VZOA 1H4HA 3VLBB 4HK8A 2JICA 4HKWA 2JEMA 4H7MA 3WP3A 3WY6A 3VHOA 1QH6A 3RI8A 3AKRA 2F6BA 3M4FA 1XNCA 3HD8B 3WP4A 1KS4A 2VG9A 1NLRA 3WQ1A 1KS5A 3RI9A 1XYNA 1OLQA 1XNKA 2D97A 1W2UA 3B5LB 4S2FA 2QZ2A 2D98A 1OA2A 2BWCA 2DFBA 3AMPA 3WX5A 1XNBA 1HV0A 4S2DA 3AMMA 3AKTA 1C5IA 3VZJA 2NLRA 2VULA 3AMQA 1XYOA 3WT3A 3ZSEA 2C1FA 1REEA 3AMHA 1H4GA 1BK1A 1F5JA 3LGRA 2BW8A 3VL8A 4XQWA 1REFA 3LB9A 2DCYA 4S2HA 4XQ4A 1UU6A 1BCXA 1UU5A 1OA4A 4XPVA 3AKSA 2VGDA 1H8VA 3AMNA 5K9YA 1TE1B 1YNAA 1ENXA 1HIXA 1XYPA 4HK9A 3VZNA 1REDA 3MFAA 1IGOA 1OLRA 2NQYA 5K7PA 2B42B 3VZMA 1UKRA 1UU4A 1PVXA 3EXUA 2DCZA 3AKPA 2QZ3A 2JENA 3WQ7A 1XXNA
chains in the Genus database with same CATH superfamily
2B8MA 4I0AA 5KBFA 1XE7A 3LF7A 3CZUA 1RHI1 2WDBA 3U4XA 2W91A 3MIHA 1VRH2 4IETA 4LE3A 3B00A 2GC3A 1O3TA 4QQOA 1ODMA 4Y5TA 1AR82 4HVOA 2RS31 5FZMA 3SEEA 3UJQA 3PU3A 4Z8BA 1UYYA 4GH4C 4Q4V2 1IS6A 2DFCA 4MGTA 4GAZA 4MADA 1WCKA 1F8VA 3VBFA 4P9WA 1GQHA 4AE2A 3I3EA 3FZ3A 4OI4A 1YQ2A 1AYN3 1C8M1 1NX9A 4XURA 1VMJA 3P3NA 4ZZ8A 3VDBA 4CYDA 1VBD1 3NQHA 3K4ZA 4PCRA 4PDWA 1RUE3 3BU7A 1B35B 2W87A 1W2OA 2ZKLA 2HBUA 1VBB3 1V6MA 4AF9A 1OF4A 1YLLA 3W58A 3ETQA 4OHWA 3K3NA 5FZ1A 2XR4A 2BQPA 4NWWA 2RS12 5KWRA 1AX1A 4FPYA 4LBQD 4AL9A 4CSWA 1NXMA 1AZDA 2HYXA 1OPOA 3K48A 1S2EA 5D1IA 2FD8A 5FZCA 1G9BA 3ETPA 3KT7A 4D8MA 3DYMA 3BODA 1CD3G 2D98A 1OA2A 4ZHNA 4FQZA 1QJY1 2YY1A 3ECQA 4PIXA 5LK5A 2JG8A 2C4XA 1W39A 4CDXC 5I0SA 4Y4YA 3RZJA 3ZFEC 1SEFA 4K1ZA 3M3CA 4NHYA 3WUCA 2PLV3 1Y9QA 2WT2A 1UNBA 3EHKA 3BTAA 1HDKA 4GJZA 3NNMA 1J3QA 1NT0A 2QQMA 5AC93 5L7OA 3WF1A 3IPVA 1V6JA 4QGLA 2ZPXA 3AP7A 5FPAA 2ZX3A 2YU1A 3GZAA 4DB5A 5ERLA 4DRVA 4MUVA 1U5IA 4R4ZA 2A6WA 4HANA 2BZDA 5DN2A 1A6CA 2HWF2 4YM2A 5DDJ2 2UY9A 5A33A 5BXXA 1AYM2 2EALA 4GH4B 2VZPA 4GALA 4LBQB 2VNVA 2R1DA 2MEV2 1DLCA 3ZKUA 3ZYBA 5IVBA 3AMNA 4K21A 4AWDA 1SLIA 4K1YA 4YW2A 1MZ6A 2FZ2A 3MFAA 3CU7A 3MIBA 2FZ1A 4ZU7A 1DBNA 5FZLA 5IAVA 2Z4FA 3VZMA 1UU4A 1DDLA 1F31A 3NSTA 3CO2A 3K4AA 4XMIA 1PX4A 3WF3A 2JENA 4RS5C 1ZBE1 1YFYA 1PIV1 2VZOA 3Q8FA 4J1XA 4M3CB 5IJRA 4LNVA 2JE7A 2KR2A 4RD7A 4GIQA 1I5PA 4CP0A 1XNDA 3OEBA 2BNMA 5F32A 4NPRA 2W3JA 4N8MA 3W20A 5EJZB 3CF6E 3TN91 4JZRA 1WMXA 1QH7A 3WP5A 1LHUA 2ZX2A 4IQPA 1C1FA 5C9AC 4Q4X1 3IB3A 5CISA 5DUXA 1F4HA 3IN9A 4YZ3A 1YIPA 4DUVA 1T2XA 5DQ0A 4LIUA 3ZXJA 1RC6A 3LIHA 3MPPG 3T1LA 5CKNA 4CDXB 1JOBA 1STMA 1AJOA 1VBC2 2WNVA 3ZFEB 1RUNA 4FFGA 2G9GA 1UY3A 4COUA 1L3JA 1OKQA 3MF6A 3KGZA 1V6IA 2WO1A 2OA2A 4S2GA 4Y33A 3KHCA 4I0BA 1QDOA 4XBQA 1RUD3 2DU0A 2VZTA 3KCYA 4LO6B 2BDRA 4Y20A 5M0TA 2WS93 3U37A 4AAXA 3WF4A 2RE9A 2NPIA 3WW3A 1VP6A 4XF1A 2PTMA 2Y33A 1GOHA 4GD4A 5A7OA 1APNA 3VHRA 2H0BA 4JVAA 2CYFA 1NYWA 2TUNA 2FMDA 2VCBA 4GZ9A 4QU1A 5FY1A 2CAVA 4E4DX 2DUQA 1UL9A 4NO4A 2QDNA 2PQQA 3LA3A 2X5IA 1PO11 3S5AA 1XYNA 1W2NA 3HT1A 2QQPA 4MV2A 1PGW2 1XE8A 4IW3A 3ZYPA 3I3BA 2R041 3B3QE 3HR9A 3NV4A 3M2MA 1W2AX 3QBQA 3W9AA 2A3YA 4QB1A 2C6SA 4LIVA 4CP1A 2OW4A 3FC0A 1WW4A 3AMQA 3E6CC 1W8WA 2SBAA 1YQ6A 1RHI3 1SLCA 4WZFA 3V0AA 2BFUL 4E4SA 4AI3A 4QDSA 5JUVA 4NRQA 1HJFA 4R9CA 1DG6A 2VAUA 2ZMLA 3FHQA 5A3UA 3ZLIA 4N53A 2AACA 3PIGA 4CP2A 2RS33 5F6KA 4ES9A 1LR5A 3OCPA 2G19A 5C9AB 4WZCA 4BCUA 1J3PA 3PU8A 4H7LA 1AJKA 1JU3A 2P5BA 3C2UA 3JBG2 2D43A 1QJU2 1ZRIA 2ARAA 1DQ4A 2AUYA 4BQXA 1Y43B 1H8VA 2VMFA 1UQXA 3DV8A 5FIXA 4OUSA 2O1QA 3RZLA 3VDDC 4YNIA 2UYBA 4FOYA 3ZDVA 4YYOA 3I2DA 4QPWA 4NAOA 3FLTA 2RM23 4URAA 1W0OA 4D7SA 1BLZA 1RMU2 1W05A 4WM8A 4CXWA 2AH2A 4AQ6A 4KU7A 1KFUL 1ENQA 1OBNA 4WBBA 3SKJE 1VBD3 3CDZB 3T4VA 3AP5A 4RR3C 2YZ4A 3WNOA 3H7YA 3RZGA 2ZHKA 2EF6A 5BNNA 2D6OX 1I5ZA 4LR4A 1MR5A 3H3UA 3ZXFA 5FY8A 3FE5A 2H6BA 1RUG3 4HKOA 5LCWL 5FO9B 1JI6A 1SBEA 5LBCA 3EYPA 3USSA 1SLTA 2WABA 3IMNA 4LEJA 4BB3A 1XPWA 4LULA 3HN1A 2IZWA 3B94A 4HKLA 5EYXA 5IWFA 3ZYRA 1WWYA 3POFA 4D7TA 3H50A 3LA7A 4RL7A 4EN9B 5AFBA 5IK5A 3B9IA 4MOAA 3H9AA 4XJZA 4A3XA 1W6MA 3LDRA 3JQWA 3S6PA 4IE0A 1HW5A 4QT6A 3ZXKA 5CB7A 5H9SA 3VBHC 2AEZA 1SACA 1ZYBA 5FJKA 5H9RA 3URFA 2CAUA 3H7JA 2RVAA 5FXVA 1HN1A 4AEDC 1XE0A 2FDFA 2R30A 3WR0A 3VGIA 1K3IA 3PUAA 4XF9A 2WZR1 4IXLA 3TBDA 2GC0A 3OYWA 4HPKA 1PGL2 1GMMA 5FKCA 2PHXA 1AYN2 4B3NA 4CUGA 4KG0A 4LO7A 2PELA 3IAPA 1IPSA 1WMFA 1UMIA 1ULEA 3H8UA 5C8WA 2HWF1 3WW4A 1RUE2 2W1WA 4B4QA 1YCIA 1SMVA 1JTZX 2IXIA 4BXSV 4ASMB 1LNSA 3I2FA 1VBB2 5IYYA 3PNAA 4FFFA 2P3KA 3O12A 5FP8A 3MLKA 3ZIWA 4CCLA 2DUPA 4LOTA 3VDDB 5FMOS 3NJVA 4DPNA 3RI9A 1VAVA 2XJUA 2A70A 5GZCA 1OLQA 4BMEA 4OHYA 5FYSA 2VQUA 1GICA 4UFJA 5CAZA 1XNBA 3O1MA 2E63A 2R1BA 1H2MA 3MEPA 1ZBE3 4Q0VA 1PIV3 3J26N 4S2DA 2VM9A 4YFWA 5J37A 4FT8A 3VDAA 4Y24A 4Y3OA 1NA1A 1BMV1 3ACGA 2W9XA 3O0VA 1L7QA 4LBKA 3PDQA 1N1YA 5C8CC 5A7WA 2PLV2 4XJWA 5LBEA 3ZYIB 1YFUA 4XZPA 4BOWA 5AC92 1UYXA 3TN93 3H0OA 3AMHA 1CONA 1F5JA 2HWD3 3LGRA 4XFHA 1EUUA 2FDKA 3T30A 3LD8A 3GZEA 1H30A 1B09A 3BOWA 5KHGA 1ZRFA 1F15A 2Q5TA 2VBPA 3S7EA 4EN0A 4XQ4A 4ATEA 4XZUG 1YQ8A 1QWRA 4WM7C 4BA6A 2Q1MA 1IPJA 2XG3A 4X6QB 3VBHB 3WF0A 4BK4A 5J3UA 3X29B 3NW4A 3DYPA 4OZOA 3H3ZA 1EP0A 3E5XA 1V0AA 3I59A 1ULCA 4AEDB 2XBO3 3ZMNA 5AFEA 1V9U1 5HI0A 3BUCA 3TEXA 4YM1A 1YRZA 1XNAA 1HXS3 3R4UA 5CFDB 3RYPA 4FOWA 5JWPA 3VD9A 2FHRA 3OB8A 4N9HA 3LOBA 3P5BA 5GKAC 5JSOA 4TSVA 4XF0A 4LO8A 3O1PA 4A7KA 1Q43A 4JX0A 2WJSA 3DCQA 4MHUA 4CPBA 4CRQA 1HQLA 4NHLA 2XQXA 5L9BA 2WO3A 1JW6A 1LAJA 3ENRA 3NWKA 5HV4A 1CWPA 2XLFA 1W99A 4OUEA 3RNSA 1LU2A 1UZWA 4AVBA 1KDMA 2D3PA 4AAPA 1JZ2A 5JIUA 4AQTA 2FMYA 4UFMA 1N3OA 5CYYA 3CQOA 1GQPA 5F8PA 5KHKA 3DKWA 3GCXA 3PUSA 5HXVA 5A7NA 1VMHA 5FZ0A 1PO13 4EROA 5C4WC 2IXJA 1WMDA 1ZX5A 2VZVA 3OBTA 4AHXA 5BNPB 5GLUA 1HB4A 2UYAA 2W46A 4QHBA 2WLQA 3O7OA 3ON7A 5FJHA 3IBMA 4GWMA 2R043 3VZLA 3WW2A 4E2GA 3WZ1A 4OLLA 4C8DA 2V09A 3FFZA 2DV9A 1LTEA 1CAWA 2GP5A 3JZVA 4GB33 1IZ3A 2HWE1 4JGYC 1H2LA 4U36A 5KXEA 2X29A 4DXTA 2ZZJA 5GALA 1FX5A 1W6QA 2K46A 5C8CB 3VL9A 1RUC1 1M06G 4FOQA 4KWJA 4KGGA 1GNHA 2OYZA 4AQSA 2JDMA 2OIIA 2VBBA 2VBDA 2P6CA 2ZEXA 5FP9A 2VMDA 1RUD2 3VN4A 4WVVA 1IQDC 2WS92 1LOFA 4HSLA 3AXDA 3IDAA 2IXLA 3JBG1 2QTWB 1LODA 4K8RB 4WM7B 2V73A 4CE8A 4Q1PA 1POV0 2XHNA 4LHLA 1IOAA 2CWSA 4TYSA 4HSJA 1XU2A 3WD5A 4P9LA 1OPMA 1GQGA 4L0PA 1IPKA 4IERA 1FV2A 4FQ4A 4Y22B 4GMP0 1MS9A 3ZPOA 4DS0A 2PN5A 3KLSA 3KV4A 2AR6A 3EMRA 1WLDA 3VD4A 2DVAA 1MS4A 1W90A 4IE7A 1WBLA 3PVOA 5GJ6A 4BQ2A 2LUWA 3VBUA 2RMU3 2A6YA 4ISQA 5DG2A 2D5HA 1F9KA 5EIYB 4INDA 3C7GA 4UXAA 3QACA 4LJHA 5G04L 4QXCA 3O0XA 2YGLA 2JXAA 5IHRA 2VNRA 5C70A 1E5IA 1RHI2 2OX0A 3HQRA 3N9LA 2PHFA 3NAPA 5FWJA 3N9OA 4ASKA 2IFRA 2XVLA 3LE0A 3MV01 4L8QA 1DQ0A 4GKXA 5CZKA 4FBFA 3I3DA 3F95A 5JOXA 2GP3A 1LOCA 3JD71 4LK7A 2RS32 3H8XA 3ZM8A 1DGRN 2D3SA 4OUMA 4QU2A 4LHKA 1PM4A 1OA4A 2J1TA 1UOJA 3FBMA 4QPIB 2R063 4EN7B 2V5DA 3NNFA 3VB9A 4JGYB 1GWKA 2VW1A 3LEMA 4V2VA 4XF3A 2J22A 1BQPA 4AVSA 3LEIA 2NQYA 1CJPA 2XJTA 1UX7A 3K46A 1AYN1 2B7YA 3WDUA 4A3ZA 3AP4A 4B4RA 1RL3A 2RM22 3AYAA 5BNOB 2P2KA 1CESA 4P9JA 5T5LA 5KXDA 4O9EA 4IEPA 2Y6HA 2EIDA 2YC0A 1MPXA 5E8AA 1OQ1A 1VBD2 2VUCA 4AHYA 4YVWA 1FATA 2VZRA 1UPSA 5JAXA 3KSCA 4WV8A 1VBB1 2Z69A 2VOTA 1JS9A 3FFQA 1AL21 2Q8OA 4RGAA 3VHPA 4J1WA 5ABJC 4OMCA 2D7FA 3PURA 2YYOA 2NZ9A 2ZA9A 4JRAA 3PJYA 4Q0UA 4H3WA 5B4XA 4Y26A 2JD4A 2VZQA 4BZ4A 5HCBA 2BV4A 4FFHA 1Q8SA 3HOBA 3L2YA 2VL4A 1OMIA 4QM9A 3TEYA 4Z92B 2WINB 3LZZA 1ZM1A 4QD2A 3OGSA 4N7UA 1UZYA 5FPBA 5LRSA 4MH0E 4NIHA 4E8CA 4A7YA 5SV8A 5D21A 3WUDA 5F7UA 2B46X 2XUMA 5FYVA 2ZAAA 3V56A 2CDOA 3BKZA 4YVSA 1MEC1 2D44A 5AC91 1W28A 2LM3A 5FY0A 2YPDA 2NMOA 1ZNPA 3WCSA 4MO3M 4RYDA 1D2SA 1YFXA 5EV7A 1ULGA 4CDQA 2JWPA 1CR7A 3AYCA 4QWNA 2JEMA 3NV2A 4W50A 3VDCA 4AVAA 2PFWA 2A6ZA 2ZACA 2JG9C 3CJIA 4Q4W3 3WY6A 5LEJA 2B9UA 4JGZA 5J36A 3EBRA 3N9PA 3DPRC 4N9IA 3QLQA 5F2SA 5FYIA 3BGAA 1S0FA 4D6QA 2J1VA 1KDKA 5L9VA 3BVCA 3Q9OA 4Q1RA 3CJXA 1G86A 4DINB 5FUNA 1V9U3 2VU9A 5DZFA 1Q8QA 2AGSA 3OJBA 4JC1A 4CDUA 4COZA 1EPZA 3QH7A 1PX3A 4GA9A 2W1UA 3OOXA 5AVAA 3FN9A 4B7EA 5BNQA 2P17A 2EIGA 1WLWA 2LRPA 1CZVA 1OF3A 1UN1A 4QGMA 3O0WA 3OBZA 2D5FA 4LOSA 3LDKA 4IGOA 1ZBE2 1PIV2 4R9BA 4NPLA 5CG9A 4XOGA 3UKVA 3WNKA 5FYZA 2GNDA 4CEWC 1X33A 5CFCA 2AEYA 3ROUA 4XW3A 4P02B 5JI7A 1LEDA 2HYKA 5T52A 2RHPA 2I2SA 5IUQA 4DO0A 4ZZ5A 5ABJB 2VO5A 3AFKA 4XQWA 3ZXLA 3TN92 2E7TA 3WEZA 3GJAA 2ATFA 2HWD2 4EJRA 3KQRA 4DY5A 2QQJA 1OI6A 1K5MA 3B93A 5F3IA 2QQLA 2D40A 3RWKX 3TEWA 1GOGA 1IQAA 1ND3C 1WW6A 2QNKA 4G4FA 3ZN6B 5JZGA 1OFNA 1RVF1 4FTEA 4NUBA 4PT6A 3UGFA 1ZZ8A 5A6QA 3MIGA 4JKMA 1SPPA 2VGDA 2F4PA 2PHWA 5DG1A 2HWE3 4RGGA 1DU3D 1UOGA 5FMCA 2RJKA 2VCCA 5FP4A 1RUC3 1XNTA 3OY8B 2G4IA 1MQTB 2XBO2 3NNGA 2LALA 4RQPA 5FXXA 4OHVA 3RWNA 5FPXA 4AQ2A 1HXS2 3C7EA 3D8CA 3DF0A 2CL2A 2WN3A 2IUWA 4YZ5A 2WAOA 2AZ5A 1W6OB 4QXKA 3NJXA 3V65A 3HAGA 1ASJ1 5F39A 1VR3A 3A21A 4QB2A 5KXCA 4HG6B 2JG9B 5A70A 2O8OA 1HLCA 2DVDA 1GP5A 3DPRB 1J3RA 3PL0A 4OQ9A 2WQZC 5FZ6A 3ZN4A 3GDBA 4IEQA 1JXNA 3A0NA 1EV13 3AP9A 3FLPA 4XFGA 5J48A 1G9DA 3VKFC 4XHBA 1HX6A 2BFUS 1LESA 2WFPA 1AXKA 2VCAA 1HV1A 1W9SA 2DF7A 4NROA 1PO12 4XCBA 2WNUC 4WVZA 1H8TA 5LA1A 2Y6GA 2ZEYA 4DXZA 4BHPA 5FY5A 3D5OA 3GNEA 2R042 1PGSA 3PVNA 2WWJA 1EUTA 3RYRA 2GH2A 2C9KA 2VECA 2ZZQA 4KWUA 1JYTA 3E5QA 4GB32 1ULPA 4ARYA 1LEMA 1U5XA 3HNYM 2WIIB 4CEWB 4EN8B 5CEHA 1ND2A 3O5SA 3ZXGA 1YFWA 2JJ6A 2EXIA 3OEAA 4UF0B 1QNYA 2LTNA 4DNYA 4QPYA 5KC6A 4QQ2A 4L9BA 4CEYA 1QU0A 3KMHA 1JZ4A 1VMFA 5FXWA 5KHHA 4OHXA 3KT1A 3JD73 2F17A 3TOJA 3O1OA 4RHV1 1L7RA 3T3YA 3RVHA 1ND3B 1EY2A 1US3A 2J1UA 1U12A 4YWAA 1JUIA 2ZGPA 3IDCB 2XWJB 4GKYA 3WNNA 4CU7A 1EAH3 1UY1A 3OBRA 3VBFC 3AXEA 1TVGA 5C3SA 3POIA 4YW3A 1RUH3 1AX2A 2D97A 3B5LB 3ME2A 4WVWA 2RM21 2AREA 1D0HA 4QHOA 1CAXA 4ISRA 5A80A 1O4YA 4PLOA 1HV0A 3LEKA 1OD5A 1E5SA 3AMMA 1YQ5A 1W8OA 4MYEA 5K0UA 2ERFA 4YZ4A 1BXHA 1OOPC 5T5OA 4PLNA 4QKBA 3EJKA 2RG4A 1NXD1 4K8FA 1ZZ6A 3FUQA 1UKGA 4QB6A 5EP9A 3ST7A 4QHZA 3LA2A 1QJZA 1F35A 2KA3A 2XKOA 1H6YA 1S0DA 3CMGA 2RMU2 4X8PA 1AL23 5C6CA 2E7AA 1I9RA 3ZR6A 2I07B 1PMJX 1REEA 1SCSA 1AR91 1KQRA 1RUG1 3AVRA 1OKOA 3ALQA 4MZUA 4PIZA 2CNAA 3WNXA 4D94A 3BB6A 1UW8A 3MDPA 1KGYA 2VE1A 4XUPA 1BCXA 4NHMA 2WNUB 4QPGC 4SBVA 4YZ1A 2ZMKA 2OT7A 5HPOA 2LROA 2OUHA 4M3CA 2Q4SA 1BKZA 2JG8C 3ILNA 3ILFA 4JRLA 1NE6A 3N7JA 3AJYA 5I8SA 5FO8B 3FHAA 2R062 1CAUB 5FV3A 4B4PA 2PHRA 1W6NB 1PO21 1MEC3 5GZFA 1X50A 2Y38A 1DYKA 3SC7X 4XMAA 1XSQA 3UV9A 5CKQA 1PVXA 2HEWF 4JKLA 2Q0AA 3A23A 3GCWA 3C3VA 3UYJA 2WZR2 4H55A 1OUXA 4C1XA 2Q1FA 1ZZBA 2VZ3A 2DUOA 2RDRA 2ZGTA 1YEWA 3GBGA 4PF1A 5IAXA 4KG8A 5E1RA 3T2QA 4QX5A 3WG3A 2WYFA 2XJPA 4H14A 2JIGA 3W5MA 5BUVA 4JTOA 5HCFA 2ID4A 1UWWA 3NO8A 1D0GA 4KI5M 4LPLA 3ZFEA 2O14A 2KXLA 4L97A 3ELNA 3VBFB 4P9GA 4HOOA 1F2NA 4JQTA 3VZKA 2GMMA 1GZTA 4XXAA 1XC6A 3OGGA 4AW7A 3ZPYA 2VUJA 4F7ZA 3S57A 2FDGA 1IS4A 1UZ0A 2OVUA 4P5YA 1KRIA 4F83A 3CHXA 3T0DA 5FMDA 2TNFA 2WRAA 1OOPB 2QQIA 1ZA4A 3PTYA 4LITA 3WDTA 1TG7A 2UURA 2ZMNA 4RFRB 1ZRCA 1S0BA 3MIDA 2WZPP 1LOGA 4AGGA 4C0HA 4BQ4A 3MFCA 3UETA 3H8RA 3LFMA 1BMV2 2BTVC 3AX4A 1DIWA 1SQ4A 1XU1A 3BYWA 2JE9A 3FWEA 4ET7A 5IK8A 4XDPA 4XDQA 4F8AA 2B5HA 2DYCA 2HWD1 3Q8BA 3ZVXA 2WR9A 4DFSA 2GMPA 1JMUB 3JUUA 3GALA 4Q8LA 1AR73 1O3SA 1MVQA 4IL7A 3LSDA 3RI8A 4QXHA 2ZBJA 3AJZA 1GWLA 2ZGKA 3ITQA 4Q4W2 1H6XA 1RVF3 2DU1A 2WLPA 4QPGB 1VJ2A 3CZJA 4RS5A 3ZFGC 1NCRC 2JDUA 3WOGA 2JG8B 2D6PA 1CIWA 1J1TA 3OBAA 2BJSA 2EXJA 2ZAHA 4LKFA 3TEZA 3TAYA 2HBTA 2VR4A 3OUIA 5C5TA 1E57A 4GWNA 2XBO1 3GBWA 2JX9A 4QDQA 3T2OA 1V9U2 1HXS1 1S0GA 2QJVA 2ILMA 3IPVB 3BPSA 2RDSA 4TWTA 5CNAA 3RMYA 4MGKE 3RSJA 1K5JA 2JIJA 2YBPA 2DTYA 4J6GA 3NV1A 1ODNA 2PA7A 3AKTA 1ASJ3 3DUIA 4HZFA 2W68A 1WW5A 1UF2C 3BALA 4IEVA 5DXDA 5FZHA 2A6XA 2C24A 5L73A 3UGGA 3Q8CA 4O9GA 1GR3A 1YI9A 2IVJA 2VNOA 2VOVA 4QX8A 3RRDA 1X36A 1RB8G 3GJBA 4OI2A 5ACA2 4XFCA 4Y1VA 3G6JB 1MZ5A 1DYPA 1J59A 2X5IC 2BERA 1G9FA 2JDAA 1T6BX 1VALA 3SCGA 1K42A 1FI2A 1BVP1 4K3UA 4OFGA 3HPNA 2P4EA 4NRMA 5J09A 2J7MA 3RZHA 4AG4A 5DAQA 2LW8A 5K9YA 4CCNA 2ZGRA 2BBVA 2R073 2Y6FA 1Z7S1 4GB31 4MXVA 5FZDA 4MGIE 2HWE2 2Y60A 1IGOA 1W3VA 3MPBA 4UBHA 3MW2A 5D8AC 5FKBA 2VPVA 4ATFA 3FJSA 4XJ8A 1UCXA 1MZEA 4CCJA 1O8SA 5EZWA 1RUC2 3OPTA 3WG2A 1QQP1 1A78A 5F2WA 2G9FA 3N9MA 1OD3A 1KJRA 4HFSA 4N53C 2ES3A 1VBA1 2GC2A 1QOOA 1XBFA 4G9SB 5GLTA 3RYKA 4RHV3 3D4KA 4CCCA 3HEIA 4KBZA 2CU5A 5LBFA 2JDPA 3OGJA 3AZYA 3IAQA 2ZGOA 4L11A 4D0QA 3WG1A 3I2GA 2DCKA 3ZFGB 4LUMA 4FAHA 1NCRB 5JSRA 2YFZA 3THPA 1A8DA 3WV6A 1EV12 4IV1C 1CZSA 2W1QA 5IVVA 3HQUA 4NN0A 4YRDA 5DAXA 4JHZA 5FFOC 2WO7A 2WO2A 1H0BA 1WBFA 3AM2A 1KEXA 1UX6A 1YC61 3HWJA 1QOTA 1UY0A 2VOXA 4WM8C 4Y20B 1BEV1 4EZHA 5IFPA 3GGLA 4A7ZA 2WWUA 2ZS6B 4N7IA 2W2IA 2NN8A 3IIAA 3NJZA 4META 3APBA 2Y34A 1FMD1 2RMU1 3WQ0A 3NL1A 5BNNC 4ZS2A 1N1SA 1SFPA 3Q8EA 5LBBA 3VZOA 1V70A 3OPZA 1AR93 5GM0A 4EQVA 1GOFA 2RDNA 2K0GA 2YB7A 5FYTA 1VBE1 4KWLA 2Q8DA 2E7QA 3VDDA 5A1LA 2D93A 4EN6B 2X5IB 1NLQA 1KD7A 2D6LX 2D6NA 4UFLA 1RUI3 5FMBA 4M4RA 2UWBA 4LBLA 3AKRA 3WNMA 1OLMA 1JZ6A 1XNCA 3JD72 3FX3A 5DABA 2MPFA 4YARA 2GNBA 2VZSA 4RR3A 5FBJA 5FZ3A 2R061 2NMNA 1DFQA 1YI7A 4FAGA 1Q5OA 1TME3 4O65A 1DQ2A 1PO23 1EAH2 5KR7A 1KXGA 2XHKA 5D8AB 5ACA3 5CFDC 2XLGA 3EQEA 4LK6A 4XIOA 4UI9L 2UY8A 1GBGA 3H1MA 2Y26A 1ZRDA 1PZ7A 3GM8A 5FY7A 3I2KA 1H2NA 1K12A 1D7PM 4N53B 1O4TA 4LBJA 4GQ7A 5FQ0A 3UK9A 1I6XA 4UFHA 4BQWA 2Q8EA 2PHTA 5JXIA 2HWB1 3VBHA 1QOSA 1QNWA 3BOPA 5DZEA 5FYCA 5F9TA 2AYHA 5FZEA 1Q56A 3HVDA 1AL22 4IEZA 3PTRB 3RPQA 3LB9A 4IV1B 1XQNA 5F3GA 1QEXA 4NOTA 3POSA 4CDWC 5BNPC 1JYIA 4DOUA 1JBCA 1HB3A 2GU9A 3KV9A 4FFIA 4DXRA 4WM8B 1OUSA 1WMEA 3QCWA 4B1MA 1SDDB 2HJIA 3M3OA 1JHJA 2V72A 5EPAA 3K77A 3GBFA 5BNNB 1POV3 1D4M1 4YLZA 1LB2A 4Y5Z0 1NE4A 4N90A 4FPFA 4UBGA 1FV3A 1MEC2 3EXUA 2DCZA 2IC1A 2ZOEB 1H2KA 2ARBA 3OD0A 4IDZA 4PI2A 2CGPA 2A73B 2DVBA 5J96B 4GMP3 2EAKA 5JPMB 2VQTA 3M70A 4K9SA 4XAEA 1O59A 1GU3A 4Z2WA 1FAYA 4Q4W1 2FQPA 4LKSA 1W6MB 2WKKA 5KHJA 4P00B 3VBOA 1IKPA 3I49A 3MF9A 5FY9A 1G9CA 5JR7B 3T1MA 1LECA 2R32A 2Z5WA 5DZGA 1PMIA 5C8CA 4D7YA 3QOPA 3LEGA 2V5YA 2WSVA 5D2AA 3O1RA 2JKXA 2W5FA 2IVIB 5IT6A 3M7AA 4FOVA 3OYWB 4HPKB 4AGRA 1H1AA 4DEQA 4DQAA 1S1AA 5IK7A 1W04A 5JPNB 2DVFA 3L2HA 1GANA 3IMMA 2BRTA 1L7LA 1OVPA 1VAMA 2X10A 3HNBM 2E26A 3B7MA 1VRBA 3MW4A 1UXZA 3JCIA 1OA3A 2LS6A 5C71A 3P3PA 5FZFA 3OGVA 4HK8A 2WBKA 5APAA 5ACA1 1QY4A 1QXPA 2ZX1A 4L99A 3WCRA 2RR13 3WNPA 3WG4A 3U0ZA 1RXGA 2W1SA 4Z2AA 1TNFA 1AR61 1WA4A 4A2UA 2YPJA 4V1PA 1ST8A 2ZGLA 5LATA 4CDWB 5I8YA 4N43C 5C3QA 1CAVA 2HWC1 1AR72 1Z0HA 3M4FA 5FAXA 3KCXA 5FXZA 3WP4A 4EYUA 2QQOA 5CA6A 3CLPA 4QPIC 2P6HA 1RVF2 1CPNA 1Z7S3 3VKMA 4QAWA 4OI1A 1KITA 1V6NA 2OQ7A 3UNPA 1MS5A 3V0BA 4BIFA 2AENA 2YGMA 3OF1A 4A4AA 5JIAA 4AI0A 5L19A 3WX5A 3VBRC 4AR2A 4E8DA 3VUOA 4M0HA 2B4KA 1GZCA 1TEIA 1QQP3 5BNOC 1DF0A 5C4WA 3USUA 1BHGA 2QQUA 5FWEA 5CADA 5HCAA 1NZCA 1VBA3 1X8EA 1ZRRA 2XH6A 3DXUA 2P3IA 5FLHA 5FYMA 3N7LA 4QDRA 1ASJ2 2E9QA 1YYNA 3FMGA 4YW1A 3ZSKA 2VNGA 1FOD1 5BY5A 1NCQC 1UY4A 3GXUA 5GLZA 5C7GA 4FPCA 1H4GA 4LO4B 4JGYA 1EV11 5I93A 4HN1A 4IGQA 4XEZA 5LASA 4QMAA 3E6DA 1MS8A 2BGCA 2RDQA 4TZDA 1J1LA 3ZFFA 1GZWA 3I59B 4YM3A 3J4UH 1NAEA 1MS1A 1Y9MA 3H3LA 3N35A 1JH5A 3BTXA 1UOBA 5T5PA 1NOVA 2VMIA 1QJEA 4PHZA 5CKMA 4CUAA 1NKGA 3CNAA 1BEV3 4O61A 4CP9B 5I91A 2XJSA 2ZX0A 4FPGA 2V4VA 4GXLA 2VTXJ 1TE1B 3AL5A 4Q4Y3 3JXSA 4R9DA 5F3EA 1FMD3 2ZKNA 3ZO0B 2G9ZA 2BP6A 2R072 5JSPA 2BYVE 1O6UA 1UKRA 2IXCA 2L9LA 1ONAA 3GZUC 3ORJA 1UMZA 5FZAA 5JI9A 1LHWA 1UXXX 5A6ZA 5JMCA 5T55A 4GWIA 1H9PA 2EA7A 1VBE3 3NNJA 2R0FA 3NAPC 4W6XA 4DEVA 3I3QA 4QX7A 2R49A 4BU2A 1OVSA 2PMWB 4BXFA 3AYEA 2CV6A 1LHVA 2ZABA 1ZZ7A 1R1A1 3WSOA 4N43B 5FR3A 1UIJA 2ZGMA 4AI9A 1W06A 3AL6A 4RHV2 5FOJB 4PI0A 4LXLA 4Y5SA 3ZXAC 5LWBA 4R4XA 5LZ6A 4Y4RA 5FZKA 1CAWB 1RUJ1 3ILRA 2R6QA 1YHFA 1EAH1 3RS6A 1DGWA 1PK6A 4D6RA 5A6XA 2RS13 1RUF3 2QVSB 3SCFA 3ZOIA 3SITA 2X09A 1GWMA 2Q30A 2SLIA 4IE4A 4XDOA 1RUH1 2ORZA 3HT2A 4AHZA 5DAPA 2BNOA 5LA9A 2ET1A 3VBRB 2WNEA 4BQ5A 3DGTA 4JAAA 4XHXA 5C3OA 3KV5A 4B1LA 4YSFA 3PUHA 1RJ8A 3MLLA 1S2BA 1V6OA 5FZBA 2A5ZA 3MUY1 4XFBA 1YJKA 1QJX1 2I74A 3GF6A 4AGVA 3N7KA 1NCQB 1JYCA 3CIHA 5I0UA 2HWB3 3VLBB 4A42A 1YIFA 3WDWA 3WW1A 5LEKA 3D6EA 1QF3A 4BWOA 1UD1A 5FZ9A 3W21A 1AR92 1RUG2 3U07A 4BISA 4M00A 4AFCA 3ZXEA 3AC0A 1QHDA 3VHOA 3R6SA 4AFBA 4UFIA 2Y6JA 4TLGA 5C3PA 2HLEA 1RUI2 3A22A 4YGCA 1PZ8A 1G6NA 1WCQA 2VG9A 1KJLA 3O1SA 4M4PA 2XXZA 1AYM3 2C0ZA 1KS5A 3VBUB 3AYDA 1NZIA 2XVGA 1D4M3 1PMHX 4HN0A 1IG3A 1AL0G 1TME2 1LOAA 3J8F3 4Y1YA 1PO22 1JOJA 2OZ6A 5FBZA 1MQTC 1Z78A 5ABJA 3N4MA 1JN2P 3IKWA 4K7JA 1NY72 1TNRA 3NAPB 4CDQC 4XUTA 5B2GB 4XVHA 4DRRA 3J7LA 4TN7A 1MVEA 3I2IA 4OULA 3D0JA 3JB8A 1VE0A 2FCUA 3GZTB 3VKNA 3GHMA 4XFFA 4ONUA 2PAEA 4UAPA 1DHKB 1W6PA 1HRI3 4IEWA 2DDUA 4XXPA 3N9NA 5FUIA 4NIAA 1QJFA 1REFA 5LA0A 4A6SA 1DGRA 4XYXA 1OXCA 3MGUA 3A4UA 3OY8A 4CDUC 2RV9A 4B7KA 5FY4A 3S0MA 3AZZA 4AVTA 1ACCA 2VMCA 5DMYA 2QQVA 3M8LA 4CU8A 5FZOB 5BV6A 5A1FA 1Q8PA 2VMHA 4IEUA 1W2TA 5KHIA 1W9TA 2JG9A 2QQNA 4HK9A 2WSUA 4MSVA 3DYOA 3DPRA 1WA6X 3RFRA 5CBLA 2GC1A 2Z42A 2ZEWA 4KNCA 3A7QA 2FCVA 2BU9A 1V6KA 2W08A 1AX0A 4ZXEA 5FYYA 1AHSA 1WKYA 1XB9A 4M3CF 4EWAA 1AXYA 1PZ9A 2XLAA 1AR63 2DVGA 3BIEA 5FZ7A 3P6BA 4URTA 4LBOA 4K20A 3DEMA 3MUZ1 1AR71 3RZMA 4QXBA 2HWC3 5DUVA 3CL1A 1FNYA 5JZGC 4HLTA 4AYUA 1SFYA 2IXKA 4WVMB 2BVVA 2YDEA 4CA9A 4AOCA 1JYNA 5DAVA 1HKDA 4CCOA 3HBKA 5F5AA 2O0OA 3VBSA 4DIQA 1OC1A 4R9AA 4YG6A 4IV3C 2A6VA 2VC9A 3HN3A 4NPMA 5LB6A 5JLVA 3DXTA 3R0RA 2W47A 4RQPC 3S30A 4UF0A 4DUWA 1AXZA 4NRPA 2GSYA 3RJRA 2XWBB 2Z79A 5A3PA 2EIEA 4CDQB 4MXWB 5JXGA 4CXYA 1WD3A 5A32B 4ZXKA 2BVBA 4CUCA 2XDVA 2VTFA 4GWJA 4NHXA 4UOJA 1ND3A 5LRRA 1FOD3 2GMEA 4AFMA 1W8UA 2XL7A 4FSJA 2E53A 1GYKA 1HQWA 4XAAA 1HB2A 4KH9A 4AFDA 1O4ZA 2WZ8A 4JCKA 4LHNA 4BQYA 2B39A 3D0SA 3PLQA 4Q27A 3KGLA 1W8HA 5J1XA 1IG0A 2GN7A 3KV6A 2WAAA 3OSDA 1ZBA3 2XJVA 5T5JA 4CDUB 5HCHA 2WN2A 5A7SA 3HMYA 3VV1A 4AI8A 3ZYJB 4M3CE 2KM2A 3S5QA 3ZKYA 1H8TC 1OT5A 3D82A 4UW3A 1B35A 2DCTA 3UKTA 5G05L 1N1VA 3J9SA 2R071 5FDBA 2GNTA 1AVBA 5FPZA 1CN1A 5B4NA 4AHWA 1Z7S2 3CEWA 1W2UA 4A44A 2WL1A 3S7IA 5CFCB 4P9YA 1TMF1 1D4VB 2VVFA 5FPVA 1CQ9A 5F3CA 4UFKA 2VUDA 5IVCA 1JYWA 4IUGA 1LENA 2YG0A 4CU9A 1QQP2 2VOKA 2BUKA 2NLRA 4MGZE 1R1A3 4PJYA 3N3HA 1Q3EA 5HV0A 1VBA2 2HEVF 5ISLA 3MYXA 4MHRA 5JZGB 2RJLA 4RGKA 1UAIA 3B02A 4NE9A 1BBT3 4I3GA 3W5NA 1JUHA 1SPPB 3HQXA 1RUJ3 2EXKA 4MG2A 2ZEZA 3AVSA 1W6NA 1X82A 2B9VA 2Y0IA 3MI8A 1LHOA 2JB8A 2YC2A 4HMZA 1SBDA 1WCUA 4IV3B 4S2HA 2YV8A 4O7XA 5DAWA 2DBIA 4RN5A 1VIWB 4RQPB 1A8MA 5ANNA 1A3KA 3BIWE 4AI1A 4MLOA 5FZ4A 5K0UC 3ZSMA 4EWEA 1BEV2 4PDWC 5IVEA 4OQ8A 1QDCA 2CHHA 3SNMA 2ZGQA 1QKQA 1QJX3 4QKNA 3K3OA 4Q4Y2 1GV9A 1ULDA 2EICA 2R0HA 2B42B 5EYYA 4CXXA 1FMD2 4GH4A 1SLAA 4ASLA 3ZX7A 2Y64A 4LBQA 2QZ3A 4IEYA 5FYHA 3POWA 2ZTNA 2A1XA 2NP0A 3PUQA 3G7DA 5C33A 1VBE2 2VVEA 4LMFA 2J1SA 2XB6C 3KVBA 1AUYA 3LCPA 1RUI1 5LY1A 1Q8OA 2GALA 1LOBA 1H8TB 1OOPA 1R1ZA 2FDJA 3QD6A 2Q8CA 3U4SA 1X7NA 4AEMA 4C0BA 2HH9A 5GLVA 1TME1 2WT1A 4QM8A 3AKQA 1ZZ9A 5DPNA 3T0BA 2V4AA 5HXMA 1DGLA 1ND2B 3PMSA 3VHNA 5L7OC 1RUF2 1NY71 4XUQA 2B45X 2PHUA 2VW0A 3OGRA 3C7OA 3PUIA 5EJ3A 1RUOA 4E27A 2BWAA 3H8OA 5FYUA 1PVC1 2C9AA 5FYBA 4CEYB 5FZGA 2DCJA 3LPGA 1VPHA 1X8MA 3R05A 5A7QA 1IS3A 4NIDA 2GNMA 4BLJA 3KS7A 5AVPA 4QPGA 2IWGB 3FHIB 3JQXA 4LO5B 4C91A 2E51A 4CU6A 2PQSA 1CVNA 3IZOA 5C5UA 5F6LB 4CDXA 1J58A 2HWB2 3BN6A 3I2HA 3VBSC 2RS51 3K2OA 3IDBB 3SHRA 4B8EA 4CCDA 1ULFA 3K4DA 1UY2A 1R081 3ZN5A 2J1RA 1YQCA 3TWIA 1WUVA 1QH6A 3LSEA 1JYXA 1LULA 4XABA 4LQRA 1CX4A 5A7PA 1CAXB 4W4ZA 4FTSA 4DUXA 2BGOA 3I2JA 3THDA 4IE6A 1GSLA 5K0UB 1W8ZA 2ENRA 4PDWB 2HEYF 1COV3 1NLRA 1O5LA 5FOBB 4GULA 2MHFA 4Q5OA 1DGWX 2P37A 1XNKA 3FBYA 3OD4A 4S2FA 3UJOA 1UOFA 1POV1 1ZZCA 2VW2A 4XBNA 1GLHA 1D4M2 1HRV1 2ZX4A 5EWSA 4BDVB 3J8F2 3OPWA 1XRUA 2BOJA 2H0VA 3OUHA 1S2KA 4BM8A 3J7NA 4GMP1 1FPN3 3BCWA 3L9JT 1QGLA 2ET7A 4YGBA 3RG0A 3T09A 5E6HA 3U11A 4BMBA 2X53S 2YC4A 2KD7A 3WDYA 5FK7A 4P9IA 1DP0A 3VL8A 2WC2A 2WFF1 4FO9A 1EYBA 2JDYA 1SCRA 2WNVC 4HT1T 2XKPA 1HRI2 4AVCA 1J83A 1QXJA 2JDNA 1UZVA 2OUJA 5L7OB 1QIQA 4Q8KA 2ARXA 1W9WA 5C4WB 4LORA 3ATGA 4XFAA 1CZTA 4G3YC 2EAAA 3NRUA 1S55A 2BGPA 2K9ZA 1WGPA 2ZGSA 1HIXA 1XYPA 3J7HA 4AEJA 2OPWA 3VZNA 1YJLA 5C9AA 4B29A 2J1AA 1DYOA 4KU8A 2NYYA 5K8SA 1OLRA 1S4CA 4HVRA 3KWVA 4NAMA 3ZFGA 5FPUA 5IVYA 5A33B 1NCRA 4ORFA 1XOYA 2FDIA 4E2QA 2YUEA 2UU8A 3DN7A 4COYA 2DURA 3MICA 3WQ7A 4ZU4A 1SDWA 5A3TA 5IK4A 5IVJA 2RR11 3R4DB 4JKKA 4MGYE 1Y9GA 4FPEA 4AVVA 4NHKA 1NQJA 1PNGA 3B9CA 2DWRA 4I3PA 1BYHA 1OLME 4QX1A 5FLJA 5L9RA 1AR62 4HONA 4LBMA 4NWVA 1SBFA 5I0TA 5JXHA 4HXCA 2VXRA 1RXFA 3ZDSA 4AK3A 2HWC2 5FLIA 4YZ2A 5EHDA 4MGQA 3NV3A 2YU2A 4ZONA 4KWKA 4OYUA 1PNFA 3ES4A 1RJ7A 2WYSA 3H1WA 3ZIXA 2XJRA 1GNZA 1U0AA 1R093 2BOIA 3OG2A 4L92A 4OCTA 4LTAA 3A0KA 3FLRA 1SZBA 1GZ9A 1JU4A 2Y6LA 1TMF3 4MX3A 1JZ3A 1S0JA 1H9WA 4FP3A 2A71A 1HB1A 2N7GA 2R7EB 3GYDA 1HJGA 3TNQA 1C3HA 3VD3A 1UIKA 4TLFA 3SKVA 1F4AA 1YUDA 2JKBA 3MIEA 1J84A 5BPXA 4Q26A 2VJXA 1H4HA 3E5UA 4XIKA 4W8JA 2JICA 4RS5B 1FOD2 4OMDA 3SLIA 4IEOA 2WA3A 3FUOA 5I0DA 3ZSLA 1TZOA 3MV11 3SH3A 2WNVB 4K40A 3N7MA 4OZXA 3WP3A 5A3OA 4JHTA 5D8AA 2E33A 3ZYGA 2A3WA 2WZEA 3LDBA 1VRH1 2VVDA 1QMJA 2E31A 1ZBA2 1SLLA 2EVXA 3AZVA 2PAMA 1ULOA 3PIJA 4A6OA 1AR81 4MVTA 1O5UA 1W03A 5EFUA 2VCMA 4W6YA 4QQLA 3WQ1A 4BLIA 1CX1A 1LCLA 4Q4Y1 4JDOA 2RJ2A 2FBEA 1I3HA 4Q4V1 2ORXA 3WHUA 2XGXA 4KGQA 3VKLA 2OZJA 2P3JA 1JODA 4IEXA 4Y1UA 5GLWA 4FCAA 5LY2A 4BK5A 1C8NA 4JQRA 4IV1A 1G7YA 3KF3A 4J25A 4QKDA 2ZCWA 1MS0A 3MW3A 2IFWA 2W52A 4Z07A 1C8M3 1RGSA 5A3NA 2ZHLA 3TRSB 1DCSA 4QQHA 2C1FA 1RTVA 4HVQA 4I30A 2VD7A 1C57A 1R1A2 4UT5A 5FZIA 4FTBA 1BK1A 2DBNA 2QQWA 1OHFA 4C1WA 1H1MA 1HQNA 1BBT2 2WUHA 3D3AA 4Q29A 2I45A 1RUJ2 1SLBA 5EJ1B 3IWZA 2RS11 2XVKA 1RUF1 1VLNA 2YXSA 4FPJA 1JYVA 2CWMA 1UU5A 3V0AB 1N3PA 2F4LA 1JOPA 4QX3A 2D6KA 1LHNA 4YGEA 3THCA 3IIIA 4XF4A 1RUH2 4XPVA 2WT0A 4E4ZA 1PVC3 2YMZA 4LA2A 3F2ZA 2Y8KA 4HL0A 4MGSA 4ITCA 3U78A 1ENXA 1IS5A 1UZZA 5LK7B 1US2A 3HBZA 1QJY3 1W3XA 5F5CA 3VD7A 4BJ0A 1QJX2 4JDMA 3RZKA 3MBWA 4UW4A 1ALYA 2PYTA 3NNLA 4PF5A 2RS53 2YHJA 4AI2A 1Y7BA 1R083 2P3YA 1R64A 3ZSJA 2J1EA 4AEDA 3C7FA 3I7DA 3ZXDA 3H1YA 3DECA 3INAA 5CFDA 3WP6A 1JZ8A 2UWCA 2QUOA 2Y0OA 4TTGA 1UYPA 1W9YA 2W95A 5GZGA 2OXBA 5A3WA 1WCSA 2TEPA 4ZPIA 3CKHA 5FCCA 1BJQA 3WDXA 3EB7A 3MZHA 4XC9A 5J7MA 5DDJ1 1VAKA 4PBPA 1AYM1 5DUWA 2MNGA 1NA1C 3KZ4C 4P5HA 2ADEA 4K6BA 3SH4A 2MEV1 4ZKTB 2ZGUA 4XUOA 4KL1A 3ABZA 1HRV3 3J8F1 4NIIA 3KT4A 3MO4A 4CVUA 1ENSA 5FZ8A 3GHNA 3NMBA 4E4HA 4JDNA 1A34A 2VQAA 3I8TA 2A3XA 2VMGA 3K51A 4SLIA 4V2WA 4CDWA 4CUBA 5BNPA 4XQDA 4OVEA 5I0RA 4BQ3A 4LKEA 4UYBA 2ARCA 1MZFA 2CTVA 3KM5A 5A3MA 4QX0A 1LU1A 1UPIA 2X05A 3WXPA 1O3QA 4CTEA 1DQ1A 4YG3A 1W8FA 3T0AA 4R8HA 3VBOC 4XILA 4DZGA 1ENRA 1GKBA 1RIRA 4RR3B 4XJAA 2WFF3 5CG8A 1HRI1 3QH6A 2VMEA 4PIYA 3T08A 4LLOA 4M01A 3KCCA 4D69A 4XACA 1YWKA 1U5YA 4FPHA 3HD8B 2CY6A 1BK0A 1JHNA 5L36A 4LHSA 1RITA 1Q8VA 1W9FA 4EWDA 2QKDA 1X9PA 5GZDA 3ES1A 3POJA 3ZYHA 3E6BA 4Q4X3 4AZZA 4YM0A 1N1TA 4CCMA 2JE8A 1OQEA 3KHBA 1COV2 2NM1A 4LE4A 5FQ0B 1WLTA 2OS2A 5F5IA 2BWCA 4P9XA 1D2QA 4WM7A 2A7AA 2GZWA 4CCKA 1IHMA 1VBC1 5E16A 4ZU5A 3ACHA 3WDVA 4XCAA 3RQ0A 3SEPA 4KMQA 5C3RA 1C5IA 3J7MA 2VOWA 3VZJA 1ZVFA 5IFTA 2VULA 4Y22A 5J98B 4D6SA 2E32A 1GP4A 3WT3A 3ZSEA 1AF9A 1FPN2 2CDPA 2A75A 4CP9A 2W94A 4M0NA 3KB5A 5JOZA 2VH9A 2WQ4A 3POGA 4KBBA 4XBLA 5TSWA 4A45A 3AK0A 4JV4A 4CPBD 1U5ZA 3NKTA 5IW0A 1S0EA 2VY0A 1N3QA 5BYNA 4E2SA 1NA1B 2C26A 5JMOA 3I3MA 5A7WB 4LT5A 3VKOA 2BNNA 4NVPA 2EIBA 4NJ4A 4RSUA 1DZTA 3UT0A 5LW9A 3SCHA 1NLSA 1S0CA 2J42A 1PGW1 1NG0A 4N43A 1LOFC 2Y6KA 4BIOA 4DXSA 1DQ6A 3NJYA 4FI9A 4GJYA 3RMXA 4ZS3A 4Q0QA 4Z1VA 4QPIA 3VBOB 2ZXQA 2XQRA 5CU1A 5A1AA 1N47A 3ZYFA 1MS3A 4PLMA 3RGBA 3MHZA 3ZFFC 3MIFA 2ETEA 1C4RA 1GFF2 3RZZA 2QCSB 5FP3A 3PHMA 2D3RA 1OH3A 3AB0A 1ZBA1 1VRH3 2PAKA 2JDKA 5CVRA 3VBRA 3BU0A 4PQ9A 1M4WA 3I97A 3W59A 5BNOA 4P14A 1WLCA 5SV5A 4L2NA 3ZR5A 3PVBB 3UL2A 1AR83 3LQCA 3T2PA 2ZHNA 2VUAA 1JZ5A 1O3RA 4Q4V3 3VBUC 2YFUA 1NCQA 1QJU1 5IVFA 1DZRA 1LRHA 2QFEA 4Q2FA 3O14A 2XONA 1R092 5GZEA 3RDIA 1OSGA 5FO7B 1TMF2 3U75A 4E9KA 2XL9A 4FVVA 1RMU1 4W6WA 3IT8A 2GN3A 1UMHA 2OQ6A 2OPKA 3U10A 1O91A 2BBAA 1CAVB 2XJQA 2W0XA 4HBNA 1CGPA 3E97A 4X8NA 5ANQA 4HKWA 3C8XA 1BBT1 1V6LA 5EXOA 1CIYA 1W0PA 3HJRA 2BPA2 4H7MA 4FXKB 4D3WA 4I01A 1PK6C 3T2TA 3VD5A 2R16A 1F5FA 2ADDA 4BYYA 1W6QB 2F6BA 4XTMA 4YPJA 3I54A 3TB0A 3TYJA 4XTPA 3P1IA 1KS4A 1E5HA 1Y4WA 2AC1A 5F5QA 3IM0A 4I2OA 4QGNA 5FPLA 1NQDA 3USUB 3VBSB 1JZ7A 3BI3A 2C5DA 2O8QA 4UW6A 3PMEA 1VB4A 4XJ9A 4P08A 4XFIA 3SH5A 4YVWC 2JB4A 4HETA 2YROA 2E6VA 1RYYA 2DFBA 3AMPA 4FPKA 4U2AA 5JVVA 3SXWA 4BPZA 1LKNA 1IKQA 2FDHA 2W92A 4ARXA 1BZWA 2Q1ZB 1FYUA 3LIGA 4XJUA 3ZFFB 3N9QA 4BH9A 1GZWB 1S0IA 4LKDA 1O8PA 1YO8A 3LFIA 2WZR3 1SG3A 4LA3A 1PGL1 1XYOA 3V64A 5E88A 1C8M2 5FZOA 4UW5A 1CPMA 2CSGA 5DUUA 4LLFA 3WQBA 4BE3A 1GNYA 1YXWA 3DKQA 1RUE1 2HWF3 3AP6A 3OTFA 1C1LA 2H6CA 4X6RB 5DDJ3 5HBAA 2DCYA 4AEKA 5FK8A 3SMHA 1GP6A 5A3LA 2Z2SB 2MEV3 1OFSA 4YVSC 3WNLA 3ACIA 5JOWA 1FXZA 2XMLA 4QQPA 1XSRA 3AKSA 5FTTC 2VTXA 2X8KA 3NKGA 3NVCA 1CJDA 1H1IA 4FPOB 4YW5A 1PVC2 5FREA 3RJ2X 2ZHMA 3U14A 5JCTA 3O1TA 3CJIC 1UO9A 3EO6A 3JB4C 4RFT0 2GAUA 4IESA 4JGZC 3H42B 3ZN6A 4WVMA 1ZA7A 4LBNA 4W65A 4LUKA 3R4SA 1QJY2 2WA4A 3E1F1 1XXNA 2EXHA 2JDZA 2WWSA 2PLV1 1PK6B 3HIFA 3K75B 2RS52 3AZWA 5JOYA 5E89A 3POBA 4XUNA 4EE2A 4F3JA 1R082 5FMOL 1MQTA 1I1EA 3I2OA 3LWCA 4NR1A 3UKNA 5CIRA 2ZJCA 1PM7A 1TQ5A 2D6MA 4QKFA 3LAGA 2JD9A 3C7HA 3ACFA 4MXWA 1W6OA 5H9QA 2VQ0A 3SISA 3UGHA 1LOEA 3KF5A 1MACA 2PXJA 2OKXA 5A32A 5KC5A 4CZSA 4Q0SA 4XE9A 3KVAA 1COV1 5F1RA 3M3EA 3POYA 4XETA 4I09A 1C5HA 2CGOA 1QXRA 4YVWB 2XPJA 1RINA 5I8TA 1X9TA 1T6GC 3O1UA 3T4HB 3O1VA 3BTZA 1C28A 1VB2A 2JDHA 3KQ4B 1VBC3 4EV0A 4YW7A 3ASIA 3ZMOA 5CFCC 5H9PA 1SHWB 1V00A 3LKJA 4FXGB 5T50A 1HRV2 4AFAA 2HKXA 5KXBA 2CGNA 5K4LA 1BVVA 2YBSA 3I4IA 3AFGA 1G9AA 1FPN1 4Y1XA 5EQUA 1W0NA 1K5MC 5LA2A 2G1MA 4YFZA 4ZY9A 5F37A 1EPWA 2W39A 3WLUA 2UWAA 4DMIA 1DLLA 1SFNA 4FP2A 4AXOA 2QBXA 1WD4A 4H2AA 3DL3A 3JU9A 2FCTA 2K2SA 3M3IA 3MLJA 2P1BA 3POEA 4QX2A 2WFF2 4COVA 5JXJA 1ZREA 3B01A 1W8TA 3CBNA 5FP7A 1LJ7A 4CEWA 3N36A 4YVSB 3V0BB 2WQ8A 2WNOA 3M3QA 2P34A 3BPZA 1LGNA 2PHDA 4Z82A 1DQ5A 1WW7A 5T54A 3SQOA 1LGBA 2XOMA 2GDFA 3PJQA 1KFXL 3WINE 4YW6A 1UYZA 3WHTA 1PHMA 4EZ4A 1DZQA 3CJIB 4RA0A 5FRAA 2GH8A 1K45A 1OQDA 1POQA 1XJAA 2QZ2A 3B69A 3KD4A 4JGZB 4Q4X2 4NIGA 1HN0A 1URXA 4IE5A 3PVEA 4C90A 1Y3TA 3LPFA 3WF2A 4DY3A 1W6PB 2QQKA 5IATA 3LOIA 3FL7A 4I0WB 4IV3A 4NMIA 4PQQA 2RR12 5JDBA 2XUEA 3UESA 2TBVA 2BEOA 3AZXA 2VZ1A 4Y1ZA 1WZXA 3IDEA 4A41A 5A6YA 2JECA 1RUD1 1OURA 4CCEA 1O7FA 2WS91 2BW8A 2PHLA 3OUJA 1B35C 3M1HA 1FT9A 1NUKA 4Q0PA 4KQ7A 4COWA 5FUPA 3JBG3 4FPLA 2IXHA 4I02A 1QJU3 4PBOA 1UU6A 4TXWA 5T3NA 1E5RA 3U1XA 4ES8A 1OH4A 1R091 4OI0A 1LGCA 1WCDJ 4BQ1A 1GUIA 3HNMA 1ND2C 4JTNA 2QDRA 4YW4A 2QE3A 1YNAA 1RMU3 1FNZA 4YGDA 4CEYC 2YBKA 1P8JA 1REDA 4R52A 2DTWA 3Q8AA 4OHZA 5K7PA 1K5MB 2WNUA 4YG0A 2VXJA 2ZGNA 3TNPB 5JR2A 3BTYA 3ACLA 3AKPA 3WVJA 4UWDA 1G8WA 2VZUA 4IGPA 1W8NA 1CAUA 3THTA
chains in the Genus database with same CATH topology
2B8MA 4I0AA 5KBFA 1XE7A 1RHI1 3U4XA 3MIHA 1VRH2 4IETA 4LE3A 3B00A 2GC3A 1O3TA 4QQOA 1AR82 4HVOA 2RS31 3UJQA 4Z8BA 4GH4C 4Q4V2 1IS6A 2DFCA 1WCKA 1F8VA 3VBFA 4P9WA 1GQHA 4AE2A 3FZ3A 4OI4A 1AYN3 1C8M1 3P3NA 4CYDA 1VBD1 4PDWA 4PCRA 1RUE3 3BU7A 1B35B 2ZKLA 1VBB3 1V6MA 4AF9A 1YLLA 3W58A 3ETQA 4OHWA 2BQPA 4NWWA 2RS12 5KWRA 1AX1A 4FPYA 4LBQD 1NXMA 1AZDA 1OPOA 3K48A 5D1IA 1G9BA 3KT7A 3BODA 1CD3G 2D98A 1OA2A 4FQZA 1QJY1 2YY1A 3ECQA 4PIXA 5LK5A 2JG8A 1W39A 4CDXC 5I0SA 4Y4YA 3ZFEC 1SEFA 4K1ZA 3M3CA 3WUCA 2PLV3 1Y9QA 2WT2A 3EHKA 3BTAA 1HDKA 5AC93 1J3QA 5L7OA 3IPVA 1V6JA 4QGLA 2ZPXA 3AP7A 2ZX3A 4DB5A 3GZAA 4DRVA 4MUVA 1U5IA 4R4ZA 2A6WA 4HANA 1A6CA 2HWF2 4YM2A 5DDJ2 2UY9A 5A33A 5BXXA 1AYM2 2EALA 4GH4B 4GALA 4LBQB 2R1DA 2MEV2 3AMNA 4K21A 4AWDA 1SLIA 4K1YA 4YW2A 1MZ6A 2FZ2A 3MFAA 3CU7A 3MIBA 2FZ1A 4ZU7A 1DBNA 3VZMA 1UU4A 1DDLA 1F31A 3NSTA 3CO2A 4XMIA 2JENA 4RS5C 1ZBE1 1YFYA 1PIV1 4M3CB 4J1XA 4LNVA 2JE7A 4RD7A 4CP0A 4GIQA 1XNDA 2BNMA 4NPRA 3CF6E 3TN91 1QH7A 3WP5A 1LHUA 2ZX2A 4IQPA 1C1FA 5C9AC 4Q4X1 5DUXA 3IN9A 4YZ3A 1YIPA 3ZXJA 1RC6A 3MPPG 3T1LA 4CDXB 1AJOA 1VBC2 2WNVA 3ZFEB 1RUNA 2G9GA 4COUA 1L3JA 1OKQA 3MF6A 3KGZA 1V6IA 4S2GA 2OA2A 4I0BA 1QDOA 4XBQA 1RUD3 2DU0A 4LO6B 3KCYA 4Y20A 2WS93 2RE9A 2NPIA 3WW3A 1VP6A 4XF1A 2PTMA 3VHRA 1APNA 2H0BA 4JVAA 2CYFA 1NYWA 2TUNA 2FMDA 2CAVA 4E4DX 2DUQA 1UL9A 4NO4A 2QDNA 2PQQA 3LA3A 2X5IA 1PO11 1XYNA 3HT1A 2QQPA 4MV2A 1PGW2 1XE8A 3ZYPA 2R041 3B3QE 3HR9A 3NV4A 3M2MA 3QBQA 3W9AA 2A3YA 4CP1A 2OW4A 3FC0A 1WW4A 3AMQA 3E6CC 2SBAA 4WZFA 1RHI3 1SLCA 3V0AA 2BFUL 4E4SA 4AI3A 4R9CA 1DG6A 2ZMLA 4N53A 4CP2A 2RS33 5F6KA 4ES9A 1LR5A 3OCPA 5C9AB 4WZCA 4BCUA 1J3PA 4H7LA 1AJKA 3C2UA 3JBG2 2D43A 1QJU2 1DQ4A 2AUYA 1Y43B 1H8VA 3DV8A 4OUSA 2O1QA 3VDDC 4YNIA 2UYBA 4FOYA 4YYOA 3I2DA 3FLTA 2RM23 1W0OA 4D7SA 1RMU2 4WM8A 2AH2A 4AQ6A 4KU7A 1KFUL 1ENQA 4WBBA 1VBD3 3AP5A 4RR3C 2YZ4A 3H7YA 2ZHKA 2EF6A 5BNNA 2D6OX 1I5ZA 4LR4A 1MR5A 3H3UA 3ZXFA 3FE5A 2H6BA 1RUG3 4HKOA 5FO9B 1SBEA 3USSA 1SLTA 3IMNA 4LEJA 4LULA 3HN1A 2IZWA 3B94A 4HKLA 5EYXA 3ZYRA 4D7TA 3H50A 3LA7A 4RL7A 4EN9B 5AFBA 5IK5A 3B9IA 4XJZA 3H9AA 4A3XA 1W6MA 3JQWA 3S6PA 1HW5A 4QT6A 3ZXKA 5CB7A 5H9SA 3VBHC 5H9RA 1SACA 1ZYBA 3URFA 2CAUA 3H7JA 4AEDC 2R30A 3WR0A 3VGIA 4XF9A 2WZR1 4IXLA 3TBDA 2GC0A 3OYWA 4HPKA 1PGL2 2PHXA 1AYN2 4B3NA 4KG0A 4LO7A 2PELA 1WMFA 5C8WA 1ULEA 3H8UA 2HWF1 3WW4A 1RUE2 4B4QA 1YCIA 1SMVA 1JTZX 2IXIA 4ASMB 1VBB2 3PNAA 2P3KA 3O12A 3MLKA 3ZIWA 2DUPA 3VDDB 5FMOS 4DPNA 3RI9A 1VAVA 2XJUA 2A70A 5GZCA 1OLQA 4BMEA 4OHYA 1GICA 5CAZA 1XNBA 2E63A 2R1BA 1H2MA 3MEPA 1ZBE3 4Q0VA 1PIV3 3J26N 4S2DA 4YFWA 5J37A 4FT8A 4Y24A 1NA1A 1BMV1 3O0VA 4LBKA 1N1YA 5C8CC 2PLV2 4XJWA 3ZYIB 1YFUA 4XZPA 4BOWA 5AC92 3TN93 3H0OA 3AMHA 1CONA 1F5JA 2HWD3 3LGRA 4XFHA 1ZRFA 1H30A 1B09A 3BOWA 5KHGA 2Q5TA 3S7EA 4EN0A 4XQ4A 4ATEA 1QWRA 4WM7C 4BA6A 2Q1MA 1IPJA 2XG3A 4X6QB 3VBHB 5J3UA 3X29B 3NW4A 3H3ZA 1EP0A 3E5XA 3I59A 1ULCA 4AEDB 2XBO3 3ZMNA 5AFEA 1V9U1 5HI0A 4YM1A 1YRZA 5CFDB 1HXS3 3R4UA 5JWPA 3RYPA 4FOWA 2FHRA 4N9HA 3LOBA 5GKAC 5JSOA 4TSVA 4XF0A 4LO8A 4A7KA 1Q43A 2WJSA 4CRQA 1HQLA 4NHLA 1JW6A 3ENRA 3NWKA 2XLFA 3RNSA 1LU2A 4AVBA 1KDMA 2D3PA 5JIUA 4AQTA 2FMYA 5KHKA 1N3OA 3DKWA 5HXVA 1PO13 4EROA 5C4WC 2IXJA 1WMDA 1ZX5A 3OBTA 4AHXA 5BNPB 5GLUA 2UYAA 4QHBA 2WLQA 3O7OA 3IBMA 4GWMA 2R043 3VZLA 3WW2A 4E2GA 3WZ1A 4OLLA 2V09A 3FFZA 2DV9A 1LTEA 1CAWA 3JZVA 4GB33 4JGYC 1IZ3A 2HWE1 4U36A 1H2LA 5KXEA 2X29A 2ZZJA 5GALA 1FX5A 1W6QA 5C8CB 3VL9A 1RUC1 1M06G 4FOQA 4KWJA 4KGGA 1GNHA 2OYZA 4AQSA 2OIIA 1RUD2 3VN4A 4WVVA 2WS92 1LOFA 4HSLA 3AXDA 2IXLA 3JBG1 1LODA 4WM7B 2V73A 4Q1PA 1POV0 4LHLA 1IOAA 2CWSA 4TYSA 4HSJA 1XU2A 3WD5A 4P9LA 1OPMA 1GQGA 1IPKA 4IERA 1FV2A 4FQ4A 4Y22B 4GMP0 1MS9A 4DS0A 2PN5A 3KLSA 2AR6A 1WLDA 2DVAA 1MS4A 1WBLA 3PVOA 5GJ6A 2LUWA 3VBUA 2RMU3 2A6YA 4ISQA 5DG2A 2D5HA 1F9KA 4INDA 4UXAA 3QACA 3O0XA 2YGLA 2JXAA 2VNRA 1RHI2 2PHFA 3NAPA 2IFRA 2XVLA 4L8QA 4FBFA 5C4WB 1DQ0A 4GKXA 5JOXA 1LOCA 3JD71 2RS32 1DGRN 2D3SA 4OUMA 4QU2A 4LHKA 1OA4A 3FBMA 4QPIB 2R063 4EN7B 4JGYB 2VW1A 4XF3A 1BQPA 4AVSA 2NQYA 1CJPA 2XJTA 1AYN1 2B7YA 3WDUA 4B4RA 3AP4A 1RL3A 2RM22 3AYAA 5BNOB 2P2KA 1CESA 4P9JA 5T5LA 4O9EA 4IEPA 2YC0A 5E8AA 1OQ1A 1VBD2 4AHYA 4YVWA 1FATA 5JAXA 1UPSA 3KSCA 4WV8A 1VBB1 2Z69A 3FFQA 1AL21 2Q8OA 4RGAA 3VHPA 4J1WA 5ABJC 2D7FA 2YYOA 2NZ9A 2ZA9A 4JRAA 3PJYA 4Q0UA 4H3WA 4Y26A 2JD4A 4BZ4A 5HCBA 1Q8SA 3L2YA 4QM9A 1OMIA 4Z92B 2WINB 3LZZA 1ZM1A 4QD2A 4N7UA 5LRSA 1UZYA 4MH0E 4A7YA 5SV8A 3WUDA 2B46X 2XUMA 2ZAAA 3V56A 4YVSA 1MEC1 2D44A 5AC91 2LM3A 2NMOA 1ZNPA 3WCSA 1D2SA 1YFXA 5EV7A 1ULGA 4CDQA 1CR7A 3AYCA 2JEMA 3NV2A 4AVAA 2PFWA 2A6ZA 2ZACA 2JG9C 3CJIA 4Q4W3 3WY6A 5LEJA 2B9UA 4JGZA 5J36A 3EBRA 4N9IA 3DPRC 3QLQA 1S0FA 1KDKA 3Q9OA 4Q1RA 3CJXA 1G86A 4DINB 1V9U3 2VU9A 5DZFA 1Q8QA 2AGSA 3OJBA 4JC1A 4CDUA 4COZA 1EPZA 3QH7A 4GA9A 5AVAA 5BNQA 4B7EA 2P17A 2EIGA 1WLWA 4QGMA 1UN1A 3O0WA 2D5FA 1ZBE2 1PIV2 4R9BA 5CG9A 4XOGA 3UKVA 2GNDA 4CEWC 1X33A 5CFCA 3ROUA 4XW3A 5JI7A 5T52A 1LEDA 2HYKA 5ACA3 2RHPA 2I2SA 5IUQA 5ABJB 3AFKA 4XQWA 3ZXLA 3TN92 2E7TA 2ATFA 2HWD2 4EJRA 3KQRA 4DY5A 1OI6A 1K5MA 3B93A 2D40A 1IQAA 1ND3C 2QNKA 1WW6A 4G4FA 3ZN6B 5JZGA 1OFNA 1RVF1 4FTEA 1ZZ8A 3MIGA 2VGDA 2F4PA 2PHWA 5DG1A 2HWE3 4RGGA 1DU3D 2RJKA 1RUC3 3OY8B 2G4IA 1MQTB 2XBO2 4RQPA 2LALA 4OHVA 3RWNA 5FPXA 4AQ2A 1HXS2 3D8CA 3DF0A 2CL2A 4YZ5A 2AZ5A 1W6OB 4QXKA 3V65A 3HAGA 1ASJ1 1VR3A 5KXCA 2JG9B 2O8OA 1HLCA 2DVDA 3DPRB 1J3RA 2WQZC 3ZN4A 4IEQA 1JXNA 3A0NA 1EV13 3AP9A 3FLPA 4XFGA 5J48A 1G9DA 3VKFC 4XHBA 1HX6A 2BFUS 1LESA 2WFPA 1AXKA 1HV1A 2DF7A 1PO12 2WNUC 4WVZA 1H8TA 4DXZA 4BHPA 3D5OA 3GNEA 2R042 1PGSA 3PVNA 3RYRA 2GH2A 2VECA 2ZZQA 3E5QA 4GB32 1LEMA 1U5XA 4CEWB 2WIIB 4EN8B 1ND2A 3O5SA 3ZXGA 1YFWA 2JJ6A 2EXIA 4DNYA 1QNYA 2LTNA 4QPYA 5KC6A 4QQ2A 4L9BA 4CEYA 1QU0A 3KMHA 5KHHA 4OHXA 3KT1A 3JD73 3TOJA 4RHV1 1ND3B 1EY2A 1U12A 1JUIA 2ZGPA 3IDCB 2XWJB 4GKYA 1EAH3 3OBRA 3VBFC 3AXEA 4YW3A 1RUH3 1AX2A 2D97A 3B5LB 3ME2A 4WVWA 2RM21 2AREA 1D0HA 1CAXA 4ISRA 1O4YA 4PLOA 1HV0A 1OD5A 3AMMA 4MYEA 5K0UA 2ERFA 4YZ4A 1BXHA 1OOPC 5T5OA 4PLNA 3EJKA 4K8FA 1NXD1 1ZZ6A 3FUQA 1UKGA 3ST7A 3LA2A 1QJZA 2XKOA 2KA3A 1S0DA 5C6CA 2RMU2 4X8PA 1AL23 2E7AA 1I9RA 2I07B 1REEA 1SCSA 1KQRA 1AR91 1RUG1 4MZUA 3ALQA 4PIZA 3WNXA 2CNAA 4D94A 3BB6A 1UW8A 3MDPA 1BCXA 4NHMA 2WNUB 4QPGC 4SBVA 4YZ1A 2ZMKA 2OUHA 4M3CA 2Q4SA 1BKZA 2JG8C 3ILNA 3ILFA 4JRLA 1NE6A 3N7JA 3AJYA 5I8SA 5FO8B 2R062 1CAUB 4B4PA 2PHRA 1W6NB 1PO21 1MEC3 5GZFA 1X50A 2Y38A 1DYKA 4XMAA 3UV9A 1PVXA 2HEWF 2Q0AA 3C3VA 2WZR2 4H55A 4C1XA 1ZZBA 2DUOA 2ZGTA 3GBGA 4KG8A 5E1RA 4QX5A 3WG3A 2XJPA 4H14A 5BUVA 4JTOA 5HCFA 3NO8A 1D0GA 3ZFEA 2KXLA 4L97A 3ELNA 3VBFB 4P9GA 3VZKA 1F2NA 2GMMA 4XXAA 3OGGA 4AW7A 3ZPYA 2VUJA 4F7ZA 1KRIA 1IS4A 2OVUA 4F83A 2TNFA 1OOPB 1ZA4A 3PTYA 3WDTA 2ZMNA 2UURA 1ZRCA 1S0BA 3MIDA 2WZPP 1LOGA 4AGGA 4C0HA 3MFCA 1BMV2 2BTVC 3AX4A 1DIWA 1SQ4A 1XU1A 2JE9A 3FWEA 5IK8A 4XDQA 4F8AA 2B5HA 2DYCA 2HWD1 3ZVXA 4DFSA 2GMPA 3JUUA 3GALA 4Q8LA 1AR73 1O3SA 1MVQA 4IL7A 3LSDA 3RI8A 2ZBJA 3AJZA 2ZGKA 4Q4W2 2WLPA 1RVF3 2DU1A 4QPGB 1VJ2A 3ZFGC 4RS5A 1NCRC 3WOGA 2JG8B 2D6PA 1CIWA 1J1TA 2ZAHA 2EXJA 3TAYA 1E57A 4GWNA 2XBO1 3GBWA 2JX9A 1V9U2 1HXS1 1S0GA 2QJVA 2ILMA 3IPVB 5CNAA 3RMYA 4TWTA 4MGKE 3RSJA 2DTYA 4J6GA 3NV1A 2PA7A 3AKTA 4HZFA 1ASJ3 3DUIA 3VKNA 2W68A 1WW5A 1UF2C 3BALA 4IEVA 5DXDA 2A6XA 5L73A 4O9GA 1GR3A 1YI9A 2VNOA 2VOVA 3RRDA 1X36A 1RB8G 4OI2A 5ACA2 4XFCA 4Y1VA 3G6JB 1MZ5A 1DYPA 1J59A 2X5IC 1G9FA 3SCGA 1VALA 1FI2A 1BVP1 4K3UA 4OFGA 5J09A 4AG4A 5K9YA 2ZGRA 2BBVA 2R073 1Z7S1 4GB31 4MXVA 4MGIE 2HWE2 3MPBA 1IGOA 4ATFA 4UBHA 3MW2A 5D8AC 2VPVA 3FJSA 4XJ8A 1UCXA 1MZEA 5EZWA 1RUC2 3WG2A 1QQP1 1A78A 2G9FA 1KJRA 4HFSA 4N53C 2ES3A 1VBA1 2GC2A 1QOOA 4G9SB 5GLTA 3RYKA 4RHV3 3D4KA 3OGJA 3AZYA 4L11A 2ZGOA 3WG1A 2DCKA 3ZFGB 4LUMA 4FAHA 1NCRB 5JSRA 3THPA 1A8DA 3WV6A 1EV12 4IV1C 4NN0A 4YRDA 5FFOC 1H0BA 1WBFA 3AM2A 3HWJA 1UX6A 4WM8C 1QOTA 2VOXA 4Y20B 1BEV1 4A7ZA 2ZS6B 4N7IA 3IIAA 2NN8A 3NJZA 4META 3APBA 1FMD1 2RMU1 3WQ0A 3NL1A 5BNNC 1N1SA 3VZOA 1V70A 3OPZA 1AR93 5GM0A 2K0GA 3VDDA 1VBE1 4KWLA 2E7QA 2D93A 4EN6B 2X5IB 1KD7A 2D6LX 2D6NA 1RUI3 2UWBA 4LBLA 3AKRA 1XNCA 3JD72 3FX3A 2MPFA 4YARA 2GNBA 4RR3A 2R061 2NMNA 1DFQA 1YI7A 4FAGA 1Q5OA 1TME3 1DQ2A 1PO23 1EAH2 1KXGA 2XHKA 5D8AB 5CFDC 2XLGA 3EQEA 4XIOA 2UY8A 1GBGA 3H1MA 2Y26A 1ZRDA 1PZ7A 1H2NA 4N53B 1O4TA 4LBJA 4GQ7A 5FQ0A 3UK9A 1I6XA 2PHTA 2HWB1 3VBHA 1QOSA 1QNWA 3BOPA 5DZEA 5F9TA 2AYHA 1Q56A 4IEZA 1AL22 3RPQA 3LB9A 4IV1B 1XQNA 4NOTA 3POSA 4CDWC 5BNPC 1JYIA 4DOUA 1JBCA 2GU9A 4WM8B 1WMEA 3QCWA 2HJIA 3M3OA 3GBFA 5BNNB 1POV3 1D4M1 4YLZA 1LB2A 4Y5Z0 1NE4A 4N90A 4FPFA 4UBGA 1FV3A 1MEC2 3EXUA 2DCZA 2IC1A 2ZOEB 1H2KA 2ARBA 3OD0A 2CGPA 2A73B 2DVBA 5J96B 4GMP3 2EAKA 5JPMB 3M70A 4K9SA 4Z2WA 1FAYA 4Q4W1 2FQPA 1W6MB 2WKKA 5KHJA 3VBOA 1IKPA 3MF9A 1G9CA 5JR7B 3T1MA 1LECA 2R32A 2Z5WA 5DZGA 1PMIA 5C8CA 4D7YA 3QOPA 2V5YA 2WSVA 5IT6A 3M7AA 4FOVA 3OYWB 4HPKB 4AGRA 1H1AA 4DQAA 1S1AA 5IK7A 5JPNB 2DVFA 3L2HA 1GANA 1VAMA 3B7MA 3MW4A 3JCIA 1OA3A 3P3PA 4HK8A 5ACA1 1QY4A 1QXPA 2ZX1A 4L99A 3WCRA 2RR13 3WG4A 3U0ZA 1TNFA 1AR61 1WA4A 4A2UA 2YPJA 4V1PA 2ZGLA 4CDWB 5I8YA 4N43C 1CAVA 2HWC1 1AR72 1Z0HA 3M4FA 5FAXA 3KCXA 3WP4A 5CA6A 3CLPA 4QPIC 1RVF2 1CPNA 1Z7S3 3VKMA 4OI1A 1KITA 1V6NA 1MS5A 3V0BA 4BIFA 2AENA 2YGMA 3OF1A 5JIAA 4AI0A 5L19A 3WX5A 3VBRC 3VUOA 4M0HA 1GZCA 1TEIA 1QQP3 5BNOC 1DF0A 5C4WA 3USUA 5CADA 5HCAA 1NZCA 1VBA3 1X8EA 1ZRRA 2XH6A 5FLHA 2P3IA 3N7LA 1ASJ2 2E9QA 1YYNA 3FMGA 4YW1A 3ZSKA 2VNGA 1FOD1 5BY5A 1NCQC 5GLZA 4FPCA 1H4GA 4LO4B 4JGYA 1EV11 5I93A 4HN1A 4XEZA 4QMAA 3E6DA 1MS8A 2BGCA 4TZDA 1J1LA 3ZFFA 1GZWA 3I59B 4YM3A 3J4UH 1MS1A 3N35A 1JH5A 5T5PA 1NOVA 2VMIA 3CNAA 1BEV3 5I91A 2XJSA 2ZX0A 4FPGA 4GXLA 1TE1B 4Q4Y3 4R9DA 1FMD3 2ZKNA 3ZO0B 2R072 5JSPA 2BYVE 2IXCA 1UKRA 3GZUC 1ONAA 5JI9A 1UMZA 1LHWA 5JMCA 5T55A 1H9PA 2EA7A 1VBE3 2R0FA 3NAPC 4W6XA 2R49A 3AYEA 2CV6A 1LHVA 2ZABA 1ZZ7A 1R1A1 4N43B 1UIJA 2ZGMA 4RHV2 5FOJB 3ZXAC 4R4XA 1CAWB 1RUJ1 3ILRA 2R6QA 1YHFA 1EAH1 3RS6A 1DGWA 1PK6A 2RS13 1RUF3 2QVSB 3SCFA 3SITA 2Q30A 2SLIA 1RUH1 3HT2A 4AHZA 2BNOA 2ET1A 3VBRB 2WNEA 3DGTA 4JAAA 4XHXA 4YSFA 1RJ8A 3MLLA 1S2BA 1V6OA 2A5ZA 4XFBA 1YJKA 1QJX1 2I74A 3GF6A 4AGVA 3N7KA 1NCQB 1JYCA 5I0UA 2HWB3 3VLBB 1YIFA 3WDWA 3WW1A 5LEKA 3D6EA 1QF3A 4BWOA 1UD1A 1AR92 1RUG2 3U07A 4M00A 4AFCA 3ZXEA 1QHDA 3VHOA 3R6SA 4AFBA 1RUI2 4YGCA 1PZ8A 1G6NA 2VG9A 1KJLA 1AYM3 2C0ZA 1KS5A 3VBUB 3AYDA 2XVGA 1D4M3 4HN0A 1AL0G 1TME2 1LOAA 3J8F3 4Y1YA 1PO22 1JOJA 2OZ6A 5FBZA 1MQTC 1Z78A 5ABJA 3N4MA 1JN2P 3IKWA 4K7JA 1NY72 1TNRA 3NAPB 4CDQC 5B2GB 4DRRA 1MVEA 4OULA 3D0JA 3JB8A 3GZTB 3GHMA 4XFFA 4ONUA 2PAEA 1DHKB 1W6PA 1HRI3 4IEWA 4XXPA 1REFA 1DGRA 4XYXA 3MGUA 3A4UA 3OY8A 4CDUC 4B7KA 3S0MA 3AZZA 4AVTA 3M8LA 5BV6A 1Q8PA 2VMHA 4IEUA 5KHIA 2JG9A 4HK9A 2WSUA 4MSVA 3DPRA 5CBLA 2GC1A 2Z42A 4KNCA 1V6KA 2W08A 1AX0A 1AHSA 4M3CF 4EWAA 1AXYA 1PZ9A 2XLAA 1AR63 2DVGA 4URTA 4LBOA 4K20A 1AR71 2HWC3 5DUVA 3CL1A 1FNYA 5JZGC 4HLTA 4AYUA 1SFYA 2IXKA 4WVMB 2BVVA 2YDEA 1HKDA 2O0OA 3VBSA 4YG6A 4R9AA 4IV3C 2A6VA 5JLVA 3R0RA 4RQPC 3S30A 1AXZA 2GSYA 3RJRA 2XWBB 2Z79A 4CDQB 4MXWB 1WD3A 5A32B 4ZXKA 2BVBA 1ND3A 5LRRA 1FOD3 2GMEA 4AFMA 2XL7A 4FSJA 2E53A 1GYKA 1HQWA 4KH9A 4AFDA 1O4ZA 4JCKA 4LHNA 2B39A 3D0SA 3PLQA 4Q27A 3KGLA 2GN7A 1ZBA3 2XJVA 5T5JA 4CDUB 3HMYA 3VV1A 4AI8A 3ZYJB 4M3CE 2KM2A 1H8TC 3D82A 4UW3A 1B35A 2DCTA 3UKTA 1N1VA 3J9SA 2R071 5FDBA 2GNTA 1AVBA 5FPZA 1CN1A 4AHWA 1Z7S2 3CEWA 1W2UA 2WL1A 3S7IA 5CFCB 4P9YA 1TMF1 1D4VB 2VVFA 1CQ9A 1LENA 1QQP2 2VOKA 2BUKA 2NLRA 4MGZE 1R1A3 4PJYA 3N3HA 1Q3EA 1VBA2 2HEVF 3MYXA 5JZGB 2RJLA 1UAIA 3B02A 1BBT3 4I3GA 1JUHA 3HQXA 1RUJ3 2EXKA 1W6NA 1X82A 2Y0IA 3MI8A 4S2HA 1LHOA 4IV3B 4HMZA 1SBDA 2YV8A 1VIWB 4RQPB 1A8MA 1A3KA 3BIWE 4AI1A 4MLOA 5K0UC 3ZSMA 4EWEA 1BEV2 4PDWC 1QDCA 3SNMA 2ZGQA 1QKQA 1QJX3 4Q4Y2 1GV9A 1ULDA 5EYYA 2R0HA 2B42B 1FMD2 4GH4A 1SLAA 4ASLA 3ZX7A 4LBQA 2QZ3A 4IEYA 3POWA 2ZTNA 2NP0A 3G7DA 5C33A 1VBE2 2VVEA 2XB6C 1AUYA 3LCPA 1RUI1 1Q8OA 2GALA 1LOBA 1H8TB 1OOPA 1R1ZA 3QD6A 4AEMA 1X7NA 4C0BA 5GLVA 1TME1 2WT1A 4QM8A 3AKQA 1ZZ9A 1DGLA 1ND2B 3PMSA 3VHNA 5L7OC 1RUF2 1NY71 2B45X 2PHUA 2VW0A 5EJ3A 1RUOA 4E27A 2BWAA 1PVC1 2C9AA 4CEYB 2DCJA 3R05A 1X8MA 1IS3A 2GNMA 4BLJA 3KS7A 5AVPA 4QPGA 2IWGB 3FHIB 3JQXA 4LO5B 4C91A 2E51A 1CVNA 5F6LB 4CDXA 1J58A 2HWB2 2RS51 3SHRA 3IDBB 4B8EA 1ULFA 1R081 3ZN5A 3TWIA 1WUVA 1QH6A 3LSEA 1LULA 1CX4A 1CAXB 4FTSA 1GSLA 5K0UB 2ENRA 4PDWB 2HEYF 1COV3 1NLRA 1O5LA 5FOBB 4GULA 2MHFA 1DGWX 2P37A 1XNKA 3FBYA 3OD4A 4S2FA 3UJOA 1POV1 1ZZCA 2VW2A 4XBNA 1GLHA 1D4M2 1HRV1 2ZX4A 5EWSA 3J8F2 1XRUA 2H0VA 1S2KA 4BM8A 4GMP1 1FPN3 3BCWA 3L9JT 1QGLA 2ET7A 4YGBA 3RG0A 3U11A 4BMBA 2X53S 3WDYA 4P9IA 3VL8A 2WC2A 2WFF1 4FO9A 1EYBA 1SCRA 2WNVC 4HT1T 2XKPA 1HRI2 4AVCA 1QXJA 2OUJA 5L7OB 4Q8KA 2ARXA 3ATGA 4XFAA 4G3YC 2EAAA 1S55A 2K9ZA 1WGPA 2ZGSA 1HIXA 1XYPA 4AEJA