2BWEA

The crystal structure of the complex between the uba and ubl domains of dsk2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
LDPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DSK2
publication title Structures of the Dsk2 Ubl and Uba Domains and Their Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 16
structure length 46
sequence length 46
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R
ec nomenclature
pdb deposition date 2005-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2bweA00
2OOAA 4UN2B 2DNAA 1JR3E 2O25A 2DKLA 3E21A 2CP8A 2JZ0A 2H5XA 1ZMWA 2CWBA 2JP7A 2JZ1A 3FRIA 3F92A 2QNJA 1IXSA 1MN3A 3LCUA 1G3IA 3K9OA 2DENA 1SG9A 2MGWA 3FRHA 3IHPA 2DI0A 1TTEA 2KHHA 1T6OA 1PGYA 1WJ7A 4GEWA 2MJ5B 2JUJA 2K9DA 2LVQD 2OO9A 3MMPA 3H4JA 5JI2E 1XB2B 1T43A 2LVOC 3T6PA 1Y8GA 3FE3A 2EKFA 1WGNA 3GLGE 2JY5A 1CUKA 1YLAA 1OTRA 3GLIE 2BWEA 4WP2A 1DO0A 3E46A 2DZLA 2JY8A 2LTUA 3LCVB 2DHYA 1DO2A 4R71A 1HT1E 2L2DA 1XXHE 4F1IA 2OOBA 1KYIA 2LVPC 3B89A 1A5TA 1VQ1A 2HAKA 2KNZA 3K9PA 1V92A 1WGLA 1DV0A 2LVAA 1WIVA 1IFYA 1IM2A 2R0IA 1G4AE 2ZTDA 2JY7A 1NV9A 4F2LA 1HT2E 1Q02A 1OQYA 2QHOB 3IECA 1EFUB 2LBCA 2LVNC 1F4IA 2DAGA 2RRUA 1VG5A 3BBZA 1P3QQ 1HJPA 2WZJA 4HEOA 2MR9A 2L4FA 1ZMVA 3GLFE 1QZEA 2DAEA 2BWBA 2JY6B 2QSFX 1HQYE 1ZV1A 4DBGB 2DAMA 1TR8A 1R4GA 1WR1B 1VEKA 2DAKA 1VDLA 2EJSA 2KNVA 2L4EA 2EKKA 1UFZA 1NV8A 2HWJA 1GO5A 2ZTCA 2DAIA 2JNHA 4Q7JA 1BVSA 4G3OA 2B3TA 2KNAA 1AIPC 1OAIA 1WHCA 1E94E 3GLHE 1ZMUA 1OKSA 2K0BX 1VEGA 1VEJA 2G3QA 5DFLA 2MROB 1G41A 1C7YA
chains in the Genus database with same CATH superfamily
4B7FA 2X8AA 4UN2B 3JR5A 3R8FA 1I94M 2DKLA 4LJAA 4REZA 4DV0M 2JXNA 2Q2EB 2QPAA 5GKNA 4G4NA 2UU9M 3JAMS 1SXJE 4JI7M 1OFHA 2JZ1A 4KODA 3SMPA 1GL7A 4XGIA 3H4MA 2C5RA 2QNJA 1IXSA 4CGYB 3SAUA 3AOGA 3K9OA 1LV7A 1G8PA 2D7HA 1TH2A 2DI0A 3SBJA 4GC5A 4L16A 1NJFA 1PRBA 4LZZA 3GQ3A 4G4QA 3HHYA 1WJ7A 1IN8A 1D2NA 4IBEA 2XGNA 3U6PA 3U6DA 4DR5M 5FSWA 3QWLA 1D0LA 1XXHB 3H4JA 1DGHA 4JI6M 1Z59A 2CUZA 2D7GA 1ORYB 3BOSA 5IWAM 2WSFF 3QYBA 3T6PA 2C9CA 1Q3BA 3HZJA 1PJSA 3CF2A 4DV6M 4LG2A 2KZSA 3RE8A 1YLAA 2P5TA 5KPZA 3SC3A 4YHHM 1JB0F 3V76A 2BWEA 2ZAMA 1Z6TA 3I4VA 4LF7M 2JWSA 4NSRA 4NL4H 4GC9A 3E9SA 2DHYA 2QP9X 4OX9M 1QZMA 2CHQA 4X66M 1DO2A 2QBYB 3GPUA 2QCUA 4D81A 2L2DA 4KLNA 1XXHE 2RGHA 2Z4SA 1GVNA 4HL4A 3B89A 4KO8A 1D0KA 3HU1A 2Y0TA 3L25A 1IFYA 2R4EA 3W0FA 4M9ZA 3W0LB 2KDLA 3T15A 3I4YA 1TH3A 2I7PA 2BJWA 3HU3A 5FTNA 3U6OA 5IZ7D 4F2LA 3A45A 2DWNA 2F4VM 3Q8GA 1HT2E 4IBGA 1DGHB 3SYLA 4QOZC 1OAOC 1Q02A 3VFDA 1OQYA 4FCTA 3U61A 2VQFM 2XH9A 4LF4M 1QDRA 4PDIA 3A46A 1HNWM 1P3QQ 4JYAM 1HJPA 2JA2A 2F5NA 2MR9A 5E6JA 2V1UA 2L4FA 1HR0M 2G5GX 4FCWA 4AG5A 1GJTA 1NVMA 3AOEC 3E4RA 4RF0A 2JY6B 2QSFX 4LJ9A 4L4UA 4B3MM 1G71A 3K2LA 4LY6A 3GLGA 1VDLA 2L4EA 4BB9A 4MGYE 4Z8XA 3UJNA 4OW0A 2EKKA 2CHGA 2CRUA 3KOYE 5ITTA 1N75A 2QZ4A 4GITA 3PXGA 3HJQA 1NV8A 3D8LA 3L26A 3U5ZA 4LFCM 3KFUG 2FH0A 2DZNB 2KXEA 4FWGA 3I51A 3M6AA 2VDBB 3JR4A 2JNHA 1BVSA 4IBJA 3FYCA 1E9RA 1Q3CA 3SMSA 2B3TA 3FUWA 1AIPC 4QNRA 1OAIA 1UM8A 1WHCA 3U61B 5ITUA 2CV1A 4R7GA 1OIPA 4IBBA 3UK6A 1ZMUA 1K3XA 1L1ZA 1XNRM 3FTEA 3SHGB 2F5PA 1GKIA 3NBXX 5KPRA 1IBLM 3RGSA 3MJ5A 3J2PB 2V6ZM 4L15A 3C3DA 3GLHB 4JI0M 2FOIC 2MROB 3KXEC 5DFLA 3NWLA 2FNAA 2WSCF 1DGFA 1G41A 4QNMA 3U6EA 1C7YA 4AG6A 1R7RA 3E21A 1ZAEA 3SARA 2EO2A 2D7EA 4DR2M 4CHTB 4S12A 3VK7A 2CV0A 2CWBA 4MGZE 1XMQM 3GLGB 1IY0A 3UZUA 2OQ4A 4FCVA 5E26A 3LCUA 3SFZA 4JI8M 4DR6M 1SXJB 1D0MA 1TH4A 2X4AA 3I04M 2MGWA 3IHPA 3J81S 4LFBM 1TTEA 1IBMM 3U5ZB 4RNAA 2KHHA 3LQRA 5L8RF 4JI2M 1PGYA 4IJFA 3GLFA 2LHCA 1TDZA 3PFIA 4GKKM 4LRSA 4M9XA 3TE6A 2UUBM 1EE8A 2H1RA 2KW0A 4FWHA 4DV4M 5JI2E 3TWLA 1HNXM 1NJGA 2HKJA 4JV5M 2ERCA 2LVOC 4W5WA 3FE3A 2EKFA 5ITQA 5ITXA 2JY5A 3GLGE 1Z5AA 2UUCM 4LJ8A 4IBKA 2K6BA 4GHLA 5EQTA 3GRYA 4EIWA 3FD9A 3E46A 1Z5BA 5EP3A 2DZLA 2JY8A 2WSEF 3WHKA 3HHZA 1NNJA 2Y0QA 2YFQA 1J5EM 3KSXA 3W67A 4FWDA 3THGA 1HNZM 1IQPA 2DZOB 4AI6A 1GL6A 1QQWA 1HT1E 3IG5A 3TQSA 2C96A 2QENA 3Q8XA 2UXCM 3A98B 1N32M 1W5SA 2FE8A 1GJSA 2KNZA 1VQ1A 5FTJA 2V1CA 1WGLA 3DZDA 3L2AA 4WURA 3GPPA 4AQYM 2LH0A 2DWZB 1C1KA 2LVAA 3SAVA 5FTMA 4JI1M 3CGWA 4IBIA 4II7A 1W5TA 3GLFB 2CV2A 3R9XB 1L8QA 2JY7A 4NSOB 4LFAM 1TF0B 3FTCA 2KZUA 4IJEA 3KP1E 4CJ6A 3HX3A 2QHOB 3IECA 2HHHM 2J5YA 2YQZA 1NY6A 2GNOA 2GQFA 2LBCA 2XFTA 3DOAA 5A2QS 4X64M 2W82A 1R2YA 5EXXA 1J09A 1PJQA 1VG5A 3BBZA 1K3WA 3U6QA 3RFWA 4RKUF 4B3RM 1IXSB 1GABA 1IN4A 1MX0A 2C9OA 3ZC7B 3AL0C 3UGJA 2J7NA 2QQ8A 4FW9A 1IBKM 2UUAM 4B3TM 1X37A 3GLFE 1QZEA 1L1TA 4L78A 1ZV1A 3U6LA 4DBGB 2CE7A 4PD2A 2KA6B 3AOEA 5EXSA 3LW5F 1WR1B 3ZCBB 5ITRA 2Z8YM 2KNVA 3KOWE 4M0DA 4ANRA 1NHGC 4HLQA 3GLIA 1FNNA 1OJLA 1T3TA 5ITXE 3VK8A 3KW6A 4NRVA 3GRUA 1L2DA 3FUVA 4R3DA 2R62A 2DAIA 2RGOA 3L28A 4CIZA 1GLNA 3B7ZA 4JI3M 2X49A 2XF3A 4LJ4A 2DWLA 4G4OA 2KRKA 3HHWA 1IY1A 1QAMA 3QAUA 1I4WA 5F3WA 1OKSA 2F5QA 4P17A 4XBOA 4OU7A 1PJJA 1VEGA 2F5OA 2ZANA 2G3QA 3AJIB 2DHRA 4MH0E 5DYGA 4AW4A 3U6CA 2E5LM 3PNVA 3C58A 2O25A 3B7NA 2CP8A 2M5ZA 3M0EA 3B74A 3U60A 4MGHA 1ZMWA 3ILKA 1N77A 1XNQM 4CISA 2XZFA 1MN3A 2UXBM 2OPFA 4LRTA 3GLIB 2VQEM 1MU5A 1SG9A 2DENA 1NNUC 3KDSE 4AZFA 4DR4M 3LVWA 1IY2A 3HKPA 4X65M 2XLJA 5BR8M 3J7BA 2VF7A 4B3SM 3CTWB 4DV3M 3T1HM 1TDHA 1KSFX 4AKGA 2DWMA 2MJ5B 2JUJA 2DXIA 2F5SA 2K9DA 2LVQD 2OO9A 3MMPA 4JI5M 1IN7A 1AUAA 3K8ZA 2RKOA 1NO1A 1RU3A 3UMMA 5JI3E 4QHTA 1XB2B 5EP4A 1QANA 1XWIA 4B7GA 3HJ8A 1J7KA 1Y8GA 1V33A 1FJGM 1WGNA 3C3EA 4IBDA 4A3VB 4L6V6 3TWKA 3VKGA 1OTRA 3GLIE 3T38A 4MGKE 4WP2A 4IIWA 2Z7JA 1DO0A 3B7QA 3U60B 1XMOM 2LTUA 4WW0A 3HY5A 4XK8F 3AKZA 5FLXS 4DR7M 3I01M 4JXJA 1E9SA 2MH8A 2R46A 5EXPA 2I7NA 3BXWA 4D80A 4GRIA 3EIHA 3PNYA 1H6UA 1Q39A 3GQ4A 3IG8A 2LHGA 2HAKA 5IT9S 4LF6M 5H37D 1JR3A 4B7HA 1ZQ9A 1L2CA 1YE9A 3OTOM 1G4AE 2ZTDA 4M0WA 4BBAA 5DNYA 1VDDA 4ZPXA 3VKHA 5EP2A 1EFUB 2NQ8C 4AKIA 3U6MA 3K92A 1OFIA 3RGPA 2RRUA 4G4RA 2XZUA 1R2ZA 3SAWA 3CF0A 4LJ6A 1JR3D 3FUUA 2R65A 4PT5A 4DR1M 4TUWA 2HCBA 5KPTA 2UXDM 3SASA 2Z3XA 1N33M 3TWMA 3KOXE 4QOSA 3KS4A 1NSFA 4NRWA 3FYDA 1HQYE 5KQDA 3HWSA 2R44A 2LNHC 1R4GA 2DAKA 4KHPM 2C99A 1N78A 1QUTA 4LGMA 2L7HA 1QUSA 5LMNM 3FUXA 2QBYA 3ZQJA 1Z5CA 2YR0A 5EJCA 2O01F 4RF1A 2K47A 4DV7M 1GO5A 1V34A 4D82A 3GPYA 4LJ5A 4P16A 3QYEA 4GKJM 2FFJA 4G3OA 2BNKA 2KNAA 1DGGA 7CATA 4FVMA 4X62M 1XC8A 3KSJA 3FTDA 3KOZE 1S3SA 4LF9M 1MJGM 3FTFA 4DV2M 2K0BX 4MM3B 1NY5A 1NHWC 3MK6A 1VEJA 3D8BA 3J27B 1L2BA 1IXRC 2OOAA 2DNAA 1JR3E 4ITQA 4M9SA 2JZ0A 1OIZA 2H5XA 4GHAA 1DGBA 4LJ7A 3L29A 2JP7A 3FRIA 2VF8A 3F92A 4NOOB 1QAOA 2AHMA 8CATA 3GP1A 1G3IA 4JN6A 3DA1A 2R4JA 4MGIE 2R18A 3FRHA 5ITYA 3HU2A 5LMUM 4KT0F 3VLFB 4LF8M 3GPXA 3HJSA 1YUBA 3KVWA 1T6OA 5BPVA 4B08A 2CEAA 4GMQA 2L6OA 1R5LA 3LQQA 4GEWA 1PJTA 2LXEA 5DYIA 1JQJC 3TL4X 1IXZA 3FUTA 2XSZA 4DV5M 4DUYM 3K1JA 4PCZA 2XFSA 1HQCA 1T43A 3KP0E 4G6ZA 4LGYA 2L09A 2O5RA 2R6FA 5KO3A 1DV0A 1CUKA 1R6BX 5KQ8A 4L8RC 4LCBA 4IBFA 4OVZA 4LF5M 1E32A 1PJIA 3LCVB 1TGUA 1G59A 5EP1A 2CFOA 4FD2A 3AFHA 4R71A 2APLA 3AV0A 3DFZA 3GLHA 3ZH9B 2FS1A 2XEPA 2Y20A 4NXMM 3SATA 2XSZD 3SHFA 4F1IA 5C18A 2OOBA 3MHVC 1KYIA 1IN6A 2LVPC 4I5SA 1A5TA 3K9PA 1V92A 4GIPA 1WIVA 1XHBA 3J7AS 1IM2A 2R0IA 3EIEA 1NV9A 1SXJA 2ZBKB 4YY3M 3FKEA 3KS8A 1WXQA 2LWXA 2YNMD 4DUZM 1LTMA 4GH9A 4NXNM 4BLCA 4JI4M 1IN5A 3J80S 3VDPA 4DV1M 3U6SA 4I81A 3WHLA 1QDTA 4IBCA 2EUCA 2Z4RA 2LVNC 3LVVA 3PVSA 1F4IA 2DAGA 3VDUA 2DVWB 4QHSA 2J7OA 2WZJA 4HEOA 4OVZB 2KEBA 3SYKA 2R45A 2KRUA 3CF6E 1ZMVA 1SXJD 2DAEA 2BWBA 3L27A 4MB7A 5FTLA 4Z6YA 1SXJC 3TPZA 1N36M 2A5YB 1TR8A 2DAMA 1VEKA 2EJSA 4DR3M 4K0KM 3GQ5A 4I4LA 4AKHA 1KFVA 1K82A 1QVRA 5EXTA 1YSYA 1UFZA 2ZM6M 4I8OA 2ZAOA 3HHXA 1QYRA 2BJVA 2HWJA 1PM5A 2ZTCA 2N35A 4Q7JA 2Y21A 1QAQA 2CHVA 2HL7A 3W68A 4PDGA 1XXHA 3C9PA 2M60A 3GRVA 2EA0A 1E94E 4LZJA 2C98A 3GLHE 3T1YM 1EIJA 2G8LA 4Y28F 3GO8A 2L7IA 4NC6A 1N34M 3A42A 3HGIA 2VIIA 3M7GA 3NBIA 5C1BA 3GRRA 5FTKA 3B9PA 5IREB 3LMMA
chains in the Genus database with same CATH topology
2OOAA 4UN2B 2DNAA 1JR3E 2O25A 2DKLA 3E21A 2CP8A 2JZ0A 2H5XA 1ZMWA 2CWBA 2JP7A 2JZ1A 3FRIA 3F92A 2QNJA 1IXSA 1MN3A 3LCUA 1G3IA 3K9OA 2DENA 1SG9A 2MGWA 3FRHA 3IHPA 2DI0A 1TTEA 2KHHA 1T6OA 1PGYA 1WJ7A 4GEWA 2MJ5B 2JUJA 2K9DA 2LVQD 2OO9A 3MMPA 3H4JA 5JI2E 1XB2B 1T43A 2LVOC 3T6PA 1Y8GA 3FE3A 2EKFA 1WGNA 3GLGE 2JY5A 1CUKA 1YLAA 1OTRA 3GLIE 2BWEA 4WP2A 1DO0A 3E46A 2DZLA 2JY8A 2LTUA 3LCVB 2DHYA 1DO2A 4R71A 1HT1E 2L2DA 1XXHE 4F1IA 2OOBA 1KYIA 2LVPC 3B89A 1A5TA 1VQ1A 2HAKA 2KNZA 3K9PA 1V92A 1WGLA 1DV0A 2LVAA 1WIVA 1IFYA 1IM2A 2R0IA 1G4AE 2ZTDA 2JY7A 1NV9A 4F2LA 1HT2E 1Q02A 1OQYA 2QHOB 3IECA 1EFUB 2LBCA 2LVNC 1F4IA 2DAGA 2RRUA 1VG5A 3BBZA 1P3QQ 1HJPA 2WZJA 4HEOA 2MR9A 2L4FA 1ZMVA 3GLFE 1QZEA 2DAEA 2BWBA 2JY6B 2QSFX 1HQYE 1ZV1A 4DBGB 2DAMA 1TR8A 1R4GA 1WR1B 1VEKA 2DAKA 1VDLA 2EJSA 2KNVA 2L4EA 2EKKA 1UFZA 1NV8A 2HWJA 1GO5A 2ZTCA 2DAIA 2JNHA 4Q7JA 1BVSA 4G3OA 2B3TA 2KNAA 1AIPC 1OAIA 1WHCA 1E94E 3GLHE 1ZMUA 1OKSA 2K0BX 1VEGA 1VEJA 2G3QA 5DFLA 2MROB 1G41A 1C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOA A;  4UN2 B;  2DNA A;  1JR3 E;  2O25 A;  2DKL A;  3E21 A;  2CP8 A;  2JZ0 A;  2H5X A;  1ZMW A;  2CWB A;  2JP7 A;  2JZ1 A;  3FRI A;  3F92 A;  2QNJ A;  1IXS A;  1MN3 A;  3LCU A;  1G3I A;  3K9O A;  2DEN A;  1SG9 A;  2MGW A;  3FRH A;  3IHP A;  2DI0 A;  1TTE A;  2KHH A;  1T6O A;  1PGY A;  1WJ7 A;  4GEW A;  2MJ5 B;  2JUJ A;  2K9D A;  2LVQ D;  2OO9 A;  3MMP A;  3H4J A;  5JI2 E;  1XB2 B;  1T43 A;  2LVO C;  3T6P A;  1Y8G A;  3FE3 A;  2EKF A;  1WGN A;  3GLG E;  2JY5 A;  1CUK A;  1YLA A;  1OTR A;  3GLI E;  2BWE A;  4WP2 A;  1DO0 A;  3E46 A;  2DZL A;  2JY8 A;  2LTU A;  3LCV B;  2DHY A;  1DO2 A;  4R71 A;  1HT1 E;  2L2D A;  1XXH E;  4F1I A;  2OOB A;  1KYI A;  2LVP C;  3B89 A;  1A5T A;  1VQ1 A;  2HAK A;  2KNZ A;  3K9P A;  1V92 A;  1WGL A;  1DV0 A;  2LVA A;  1WIV A;  1IFY A;  1IM2 A;  2R0I A;  1G4A E;  2ZTD A;  2JY7 A;  1NV9 A;  4F2L A;  1HT2 E;  1Q02 A;  1OQY A;  2QHO B;  3IEC A;  1EFU B;  2LBC A;  2LVN C;  1F4I A;  2DAG A;  2RRU A;  1VG5 A;  3BBZ A;  1P3Q Q;  1HJP A;  2WZJ A;  4HEO A;  2MR9 A;  2L4F A;  1ZMV A;  3GLF E;  1QZE A;  2DAE A;  2BWB A;  2JY6 B;  2QSF X;  1HQY E;  1ZV1 A;  4DBG B;  2DAM A;  1TR8 A;  1R4G A;  1WR1 B;  1VEK A;  2DAK A;  1VDL A;  2EJS A;  2KNV A;  2L4E A;  2EKK A;  1UFZ A;  1NV8 A;  2HWJ A;  1GO5 A;  2ZTC A;  2DAI A;  2JNH A;  4Q7J A;  1BVS A;  4G3O A;  2B3T A;  2KNA A;  1AIP C;  1OAI A;  1WHC A;  1E94 E;  3GLH E;  1ZMU A;  1OKS A;  2K0B X;  1VEG A;  1VEJ A;  2G3Q A;  5DFL A;  2MRO B;  1G41 A;  1C7Y A; 
#chains in the Genus database with same CATH topology
 4B7F A;  2X8A A;  4UN2 B;  3JR5 A;  3R8F A;  1I94 M;  2DKL A;  4LJA A;  4REZ A;  4DV0 M;  2JXN A;  2Q2E B;  2QPA A;  5GKN A;  4G4N A;  2UU9 M;  3JAM S;  1SXJ E;  4JI7 M;  1OFH A;  2JZ1 A;  4KOD A;  3SMP A;  1GL7 A;  4XGI A;  3H4M A;  2C5R A;  2QNJ A;  1IXS A;  4CGY B;  3SAU A;  3AOG A;  3K9O A;  1LV7 A;  1G8P A;  2D7H A;  1TH2 A;  2DI0 A;  3SBJ A;  4GC5 A;  4L16 A;  1NJF A;  1PRB A;  4LZZ A;  3GQ3 A;  4G4Q A;  3HHY A;  1WJ7 A;  1IN8 A;  1D2N A;  4IBE A;  2XGN A;  3U6P A;  3U6D A;  4DR5 M;  5FSW A;  3QWL A;  1D0L A;  1XXH B;  3H4J A;  1DGH A;  4JI6 M;  1Z59 A;  2CUZ A;  2D7G A;  1ORY B;  3BOS A;  5IWA M;  2WSF F;  3QYB A;  3T6P A;  2C9C A;  1Q3B A;  3HZJ A;  1PJS A;  3CF2 A;  4DV6 M;  4LG2 A;  2KZS A;  3RE8 A;  1YLA A;  2P5T A;  5KPZ A;  3SC3 A;  4YHH M;  1JB0 F;  3V76 A;  2BWE A;  2ZAM A;  1Z6T A;  3I4V A;  4LF7 M;  2JWS A;  4NSR A;  4NL4 H;  4GC9 A;  3E9S A;  2DHY A;  2QP9 X;  4OX9 M;  1QZM A;  2CHQ A;  4X66 M;  1DO2 A;  2QBY B;  3GPU A;  2QCU A;  4D81 A;  2L2D A;  4KLN A;  1XXH E;  2RGH A;  2Z4S A;  1GVN A;  4HL4 A;  3B89 A;  4KO8 A;  1D0K A;  3HU1 A;  2Y0T A;  3L25 A;  1IFY A;  2R4E A;  3W0F A;  4M9Z A;  3W0L B;  2KDL A;  3T15 A;  3I4Y A;  1TH3 A;  2I7P A;  2BJW A;  3HU3 A;  5FTN A;  3U6O A;  5IZ7 D;  4F2L A;  3A45 A;  2DWN A;  2F4V M;  3Q8G A;  1HT2 E;  4IBG A;  1DGH B;  3SYL A;  4QOZ C;  1OAO C;  1Q02 A;  3VFD A;  1OQY A;  4FCT A;  3U61 A;  2VQF M;  2XH9 A;  4LF4 M;  1QDR A;  4PDI A;  3A46 A;  1HNW M;  1P3Q Q;  4JYA M;  1HJP A;  2JA2 A;  2F5N A;  2MR9 A;  5E6J A;  2V1U A;  2L4F A;  1HR0 M;  2G5G X;  4FCW A;  4AG5 A;  1GJT A;  1NVM A;  3AOE C;  3E4R A;  4RF0 A;  2JY6 B;  2QSF X;  4LJ9 A;  4L4U A;  4B3M M;  1G71 A;  3K2L A;  4LY6 A;  3GLG A;  1VDL A;  2L4E A;  4BB9 A;  4MGY E;  4Z8X A;  3UJN A;  4OW0 A;  2EKK A;  2CHG A;  2CRU A;  3KOY E;  5ITT A;  1N75 A;  2QZ4 A;  4GIT A;  3PXG A;  3HJQ A;  1NV8 A;  3D8L A;  3L26 A;  3U5Z A;  4LFC M;  3KFU G;  2FH0 A;  2DZN B;  2KXE A;  4FWG A;  3I51 A;  3M6A A;  2VDB B;  3JR4 A;  2JNH A;  1BVS A;  4IBJ A;  3FYC A;  1E9R A;  1Q3C A;  3SMS A;  2B3T A;  3FUW A;  1AIP C;  4QNR A;  1OAI A;  1UM8 A;  1WHC A;  3U61 B;  5ITU A;  2CV1 A;  4R7G A;  1OIP A;  4IBB A;  3UK6 A;  1ZMU A;  1K3X A;  1L1Z A;  1XNR M;  3FTE A;  3SHG B;  2F5P A;  1GKI A;  3NBX X;  5KPR A;  1IBL M;  3RGS A;  3MJ5 A;  3J2P B;  2V6Z M;  4L15 A;  3C3D A;  3GLH B;  4JI0 M;  2FOI C;  2MRO B;  3KXE C;  5DFL A;  3NWL A;  2FNA A;  2WSC F;  1DGF A;  1G41 A;  4QNM A;  3U6E A;  1C7Y A;  4AG6 A;  1R7R A;  3E21 A;  1ZAE A;  3SAR A;  2EO2 A;  2D7E A;  4DR2 M;  4CHT B;  4S12 A;  3VK7 A;  2CV0 A;  2CWB A;  4MGZ E;  1XMQ M;  3GLG B;  1IY0 A;  3UZU A;  2OQ4 A;  4FCV A;  5E26 A;  3LCU A;  3SFZ A;  4JI8 M;  4DR6 M;  1SXJ B;  1D0M A;  1TH4 A;  2X4A A;  3I04 M;  2MGW A;  3IHP A;  3J81 S;  4LFB M;  1TTE A;  1IBM M;  3U5Z B;  4RNA A;  2KHH A;  3LQR A;  5L8R F;  4JI2 M;  1PGY A;  4IJF A;  3GLF A;  2LHC A;  1TDZ A;  3PFI A;  4GKK M;  4LRS A;  4M9X A;  3TE6 A;  2UUB M;  1EE8 A;  2H1R A;  2KW0 A;  4FWH A;  4DV4 M;  5JI2 E;  3TWL A;  1HNX M;  1NJG A;  2HKJ A;  4JV5 M;  2ERC A;  2LVO C;  4W5W A;  3FE3 A;  2EKF A;  5ITQ A;  5ITX A;  2JY5 A;  3GLG E;  1Z5A A;  2UUC M;  4LJ8 A;  4IBK A;  2K6B A;  4GHL A;  5EQT A;  3GRY A;  4EIW A;  3FD9 A;  3E46 A;  1Z5B A;  5EP3 A;  2DZL A;  2JY8 A;  2WSE F;  3WHK A;  3HHZ A;  1NNJ A;  2Y0Q A;  2YFQ A;  1J5E M;  3KSX A;  3W67 A;  4FWD A;  3THG A;  1HNZ M;  1IQP A;  2DZO B;  4AI6 A;  1GL6 A;  1QQW A;  1HT1 E;  3IG5 A;  3TQS A;  2C96 A;  2QEN A;  3Q8X A;  2UXC M;  3A98 B;  1N32 M;  1W5S A;  2FE8 A;  1GJS A;  2KNZ A;  1VQ1 A;  5FTJ A;  2V1C A;  1WGL A;  3DZD A;  3L2A A;  4WUR A;  3GPP A;  4AQY M;  2LH0 A;  2DWZ B;  1C1K A;  2LVA A;  3SAV A;  5FTM A;  4JI1 M;  3CGW A;  4IBI A;  4II7 A;  1W5T A;  3GLF B;  2CV2 A;  3R9X B;  1L8Q A;  2JY7 A;  4NSO B;  4LFA M;  1TF0 B;  3FTC A;  2KZU A;  4IJE A;  3KP1 E;  4CJ6 A;  3HX3 A;  2QHO B;  3IEC A;  2HHH M;  2J5Y A;  2YQZ A;  1NY6 A;  2GNO A;  2GQF A;  2LBC A;  2XFT A;  3DOA A;  5A2Q S;  4X64 M;  2W82 A;  1R2Y A;  5EXX A;  1J09 A;  1PJQ A;  1VG5 A;  3BBZ A;  1K3W A;  3U6Q A;  3RFW A;  4RKU F;  4B3R M;  1IXS B;  1GAB A;  1IN4 A;  1MX0 A;  2C9O A;  3ZC7 B;  3AL0 C;  3UGJ A;  2J7N A;  2QQ8 A;  4FW9 A;  1IBK M;  2UUA M;  4B3T M;  1X37 A;  3GLF E;  1QZE A;  1L1T A;  4L78 A;  1ZV1 A;  3U6L A;  4DBG B;  2CE7 A;  4PD2 A;  2KA6 B;  3AOE A;  5EXS A;  3LW5 F;  1WR1 B;  3ZCB B;  5ITR A;  2Z8Y M;  2KNV A;  3KOW E;  4M0D A;  4ANR A;  1NHG C;  4HLQ A;  3GLI A;  1FNN A;  1OJL A;  1T3T A;  5ITX E;  3VK8 A;  3KW6 A;  4NRV A;  3GRU A;  1L2D A;  3FUV A;  4R3D A;  2R62 A;  2DAI A;  2RGO A;  3L28 A;  4CIZ A;  1GLN A;  3B7Z A;  4JI3 M;  2X49 A;  2XF3 A;  4LJ4 A;  2DWL A;  4G4O A;  2KRK A;  3HHW A;  1IY1 A;  1QAM A;  3QAU A;  1I4W A;  5F3W A;  1OKS A;  2F5Q A;  4P17 A;  4XBO A;  4OU7 A;  1PJJ A;  1VEG A;  2F5O A;  2ZAN A;  2G3Q A;  3AJI B;  2DHR A;  4MH0 E;  5DYG A;  4AW4 A;  3U6C A;  2E5L M;  3PNV A;  3C58 A;  2O25 A;  3B7N A;  2CP8 A;  2M5Z A;  3M0E A;  3B74 A;  3U60 A;  4MGH A;  1ZMW A;  3ILK A;  1N77 A;  1XNQ M;  4CIS A;  2XZF A;  1MN3 A;  2UXB M;  2OPF A;  4LRT A;  3GLI B;  2VQE M;  1MU5 A;  1SG9 A;  2DEN A;  1NNU C;  3KDS E;  4AZF A;  4DR4 M;  3LVW A;  1IY2 A;  3HKP A;  4X65 M;  2XLJ A;  5BR8 M;  3J7B A;  2VF7 A;  4B3S M;  3CTW B;  4DV3 M;  3T1H M;  1TDH A;  1KSF X;  4AKG A;  2DWM A;  2MJ5 B;  2JUJ A;  2DXI A;  2F5S A;  2K9D A;  2LVQ D;  2OO9 A;  3MMP A;  4JI5 M;  1IN7 A;  1AUA A;  3K8Z A;  2RKO A;  1NO1 A;  1RU3 A;  3UMM A;  5JI3 E;  4QHT A;  1XB2 B;  5EP4 A;  1QAN A;  1XWI A;  4B7G A;  3HJ8 A;  1J7K A;  1Y8G A;  1V33 A;  1FJG M;  1WGN A;  3C3E A;  4IBD A;  4A3V B;  4L6V 6;  3TWK A;  3VKG A;  1OTR A;  3GLI E;  3T38 A;  4MGK E;  4WP2 A;  4IIW A;  2Z7J A;  1DO0 A;  3B7Q A;  3U60 B;  1XMO M;  2LTU A;  4WW0 A;  3HY5 A;  4XK8 F;  3AKZ A;  5FLX S;  4DR7 M;  3I01 M;  4JXJ A;  1E9S A;  2MH8 A;  2R46 A;  5EXP A;  2I7N A;  3BXW A;  4D80 A;  4GRI A;  3EIH A;  3PNY A;  1H6U A;  1Q39 A;  3GQ4 A;  3IG8 A;  2LHG A;  2HAK A;  5IT9 S;  4LF6 M;  5H37 D;  1JR3 A;  4B7H A;  1ZQ9 A;  1L2C A;  1YE9 A;  3OTO M;  1G4A E;  2ZTD A;  4M0W A;  4BBA A;  5DNY A;  1VDD A;  4ZPX A;  3VKH A;  5EP2 A;  1EFU B;  2NQ8 C;  4AKI A;  3U6M A;  3K92 A;  1OFI A;  3RGP A;  2RRU A;  4G4R A;  2XZU A;  1R2Z A;  3SAW A;  3CF0 A;  4LJ6 A;  1JR3 D;  3FUU A;  2R65 A;  4PT5 A;  4DR1 M;  4TUW A;  2HCB A;  5KPT A;  2UXD M;  3SAS A;  2Z3X A;  1N33 M;  3TWM A;  3KOX E;  4QOS A;  3KS4 A;  1NSF A;  4NRW A;  3FYD A;  1HQY E;  5KQD A;  3HWS A;  2R44 A;  2LNH C;  1R4G A;  2DAK A;  4KHP M;  2C99 A;  1N78 A;  1QUT A;  4LGM A;  2L7H A;  1QUS A;  5LMN M;  3FUX A;  2QBY A;  3ZQJ A;  1Z5C A;  2YR0 A;  5EJC A;  2O01 F;  4RF1 A;  2K47 A;  4DV7 M;  1GO5 A;  1V34 A;  4D82 A;  3GPY A;  4LJ5 A;  4P16 A;  3QYE A;  4GKJ M;  2FFJ A;  4G3O A;  2BNK A;  2KNA A;  1DGG A;  7CAT A;  4FVM A;  4X62 M;  1XC8 A;  3KSJ A;  3FTD A;  3KOZ E;  1S3S A;  4LF9 M;  1MJG M;  3FTF A;  4DV2 M;  2K0B X;  4MM3 B;  1NY5 A;  1NHW C;  3MK6 A;  1VEJ A;  3D8B A;  3J27 B;  1L2B A;  1IXR C;  2OOA A;  2DNA A;  1JR3 E;  4ITQ A;  4M9S A;  2JZ0 A;  1OIZ A;  2H5X A;  4GHA A;  1DGB A;  4LJ7 A;  3L29 A;  2JP7 A;  3FRI A;  2VF8 A;  3F92 A;  4NOO B;  1QAO A;  2AHM A;  8CAT A;  3GP1 A;  1G3I A;  4JN6 A;  3DA1 A;  2R4J A;  4MGI E;  2R18 A;  3FRH A;  5ITY A;  3HU2 A;  5LMU M;  4KT0 F;  3VLF B;  4LF8 M;  3GPX A;  3HJS A;  1YUB A;  3KVW A;  1T6O A;  5BPV A;  4B08 A;  2CEA A;  4GMQ A;  2L6O A;  1R5L A;  3LQQ A;  4GEW A;  1PJT A;  2LXE A;  5DYI A;  1JQJ C;  3TL4 X;  1IXZ A;  3FUT A;  2XSZ A;  4DV5 M;  4DUY M;  3K1J A;  4PCZ A;  2XFS A;  1HQC A;  1T43 A;  3KP0 E;  4G6Z A;  4LGY A;  2L09 A;  2O5R A;  2R6F A;  5KO3 A;  1DV0 A;  1CUK A;  1R6B X;  5KQ8 A;  4L8R C;  4LCB A;  4IBF A;  4OVZ A;  4LF5 M;  1E32 A;  1PJI A;  3LCV B;  1TGU A;  1G59 A;  5EP1 A;  2CFO A;  4FD2 A;  3AFH A;  4R71 A;  2APL A;  3AV0 A;  3DFZ A;  3GLH A;  3ZH9 B;  2FS1 A;  2XEP A;  2Y20 A;  4NXM M;  3SAT A;  2XSZ D;  3SHF A;  4F1I A;  5C18 A;  2OOB A;  3MHV C;  1KYI A;  1IN6 A;  2LVP C;  4I5S A;  1A5T A;  3K9P A;  1V92 A;  4GIP A;  1WIV A;  1XHB A;  3J7A S;  1IM2 A;  2R0I A;  3EIE A;  1NV9 A;  1SXJ A;  2ZBK B;  4YY3 M;  3FKE A;  3KS8 A;  1WXQ A;  2LWX A;  2YNM D;  4DUZ M;  1LTM A;  4GH9 A;  4NXN M;  4BLC A;  4JI4 M;  1IN5 A;  3J80 S;  3VDP A;  4DV1 M;  3U6S A;  4I81 A;  3WHL A;  1QDT A;  4IBC A;  2EUC A;  2Z4R A;  2LVN C;  3LVV A;  3PVS A;  1F4I A;  2DAG A;  3VDU A;  2DVW B;  4QHS A;  2J7O A;  2WZJ A;  4HEO A;  4OVZ B;  2KEB A;  3SYK A;  2R45 A;  2KRU A;  3CF6 E;  1ZMV A;  1SXJ D;  2DAE A;  2BWB A;  3L27 A;  4MB7 A;  5FTL A;  4Z6Y A;  1SXJ C;  3TPZ A;  1N36 M;  2A5Y B;  1TR8 A;  2DAM A;  1VEK A;  2EJS A;  4DR3 M;  4K0K M;  3GQ5 A;  4I4L A;  4AKH A;  1KFV A;  1K82 A;  1QVR A;  5EXT A;  1YSY A;  1UFZ A;  2ZM6 M;  4I8O A;  2ZAO A;  3HHX A;  1QYR A;  2BJV A;  2HWJ A;  1PM5 A;  2ZTC A;  2N35 A;  4Q7J A;  2Y21 A;  1QAQ A;  2CHV A;  2HL7 A;  3W68 A;  4PDG A;  1XXH A;  3C9P A;  2M60 A;  3GRV A;  2EA0 A;  1E94 E;  4LZJ A;  2C98 A;  3GLH E;  3T1Y M;  1EIJ A;  2G8L A;  4Y28 F;  3GO8 A;  2L7I A;  4NC6 A;  1N34 M;  3A42 A;  3HGI A;  2VII A;  3M7G A;  3NBI A;  5C1B A;  3GRR A;  5FTK A;  3B9P A;  5IRE B;  3LMM A; 
#chains in the Genus database with same CATH homology
 2OOA A;  4UN2 B;  2DNA A;  1JR3 E;  2O25 A;  2DKL A;  3E21 A;  2CP8 A;  2JZ0 A;  2H5X A;  1ZMW A;  2CWB A;  2JP7 A;  2JZ1 A;  3FRI A;  3F92 A;  2QNJ A;  1IXS A;  1MN3 A;  3LCU A;  1G3I A;  3K9O A;  2DEN A;  1SG9 A;  2MGW A;  3FRH A;  3IHP A;  2DI0 A;  1TTE A;  2KHH A;  1T6O A;  1PGY A;  1WJ7 A;  4GEW A;  2MJ5 B;  2JUJ A;  2K9D A;  2LVQ D;  2OO9 A;  3MMP A;  3H4J A;  5JI2 E;  1XB2 B;  1T43 A;  2LVO C;  3T6P A;  1Y8G A;  3FE3 A;  2EKF A;  1WGN A;  3GLG E;  2JY5 A;  1CUK A;  1YLA A;  1OTR A;  3GLI E;  2BWE A;  4WP2 A;  1DO0 A;  3E46 A;  2DZL A;  2JY8 A;  2LTU A;  3LCV B;  2DHY A;  1DO2 A;  4R71 A;  1HT1 E;  2L2D A;  1XXH E;  4F1I A;  2OOB A;  1KYI A;  2LVP C;  3B89 A;  1A5T A;  1VQ1 A;  2HAK A;  2KNZ A;  3K9P A;  1V92 A;  1WGL A;  1DV0 A;  2LVA A;  1WIV A;  1IFY A;  1IM2 A;  2R0I A;  1G4A E;  2ZTD A;  2JY7 A;  1NV9 A;  4F2L A;  1HT2 E;  1Q02 A;  1OQY A;  2QHO B;  3IEC A;  1EFU B;  2LBC A;  2LVN C;  1F4I A;  2DAG A;  2RRU A;  1VG5 A;  3BBZ A;  1P3Q Q;  1HJP A;  2WZJ A;  4HEO A;  2MR9 A;  2L4F A;  1ZMV A;  3GLF E;  1QZE A;  2DAE A;  2BWB A;  2JY6 B;  2QSF X;  1HQY E;  1ZV1 A;  4DBG B;  2DAM A;  1TR8 A;  1R4G A;  1WR1 B;  1VEK A;  2DAK A;  1VDL A;  2EJS A;  2KNV A;  2L4E A;  2EKK A;  1UFZ A;  1NV8 A;  2HWJ A;  1GO5 A;  2ZTC A;  2DAI A;  2JNH A;  4Q7J A;  1BVS A;  4G3O A;  2B3T A;  2KNA A;  1AIP C;  1OAI A;  1WHC A;  1E94 E;  3GLH E;  1ZMU A;  1OKS A;  2K0B X;  1VEG A;  1VEJ A;  2G3Q A;  5DFL A;  2MRO B;  1G41 A;  1C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...