2BWIA

Atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
334
Chain Sequence
b'VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA02
2P80D 4DPAX 3FPYA 3UGEA 1ILUA 3ABLB 2IH9A 1A4AA 2GC4C 3X2QB 6PAZA 3AZUA 3MBWB 1OCOB 1FWXA 1J5DA 2EIJB 1KYAA 2CUAA 1ZDQA 4K9JA 3CDZB 4WKXA 1L9OA 2HZHA 1GY1A 4BDVB 4DP1X 1JZGA 3DTUB 1R1CA 3WNIA 1IUZA 3OMNB 2YAMA 3FS9A 1QLEB 2XYBA 1WS8A 3CZUB 1CYWA 4A2FA 3ZDWA 3ASNB 2XV0A 4GYBA 2B3IA 2XVBA 2YAFA 4HCFA 4AKQA 4YSOA 3QJQB 1MG2C 2A3TA 3NYKA 2YAHA 2BP8A 3AG4B 1BAWA 3QPKA 4PAZA 5D4IA 4KNSA 2E86A 2YQBA 2FJSA 1M56B 1XB3A 2VM3A 6PCYA 4YL4A 1SFHA 2VMJA 5B7MA 2PPDA 3QJSB 3S8FB 1SHWA 5B3SB 1AZUA 2OCCB 5I6NA 3MX0B 1AIZA 4EF3A 4DP7X 2N0MA 4DP6X 1T5KA 2H47C 3NJIA 1ET8A 2J5WA 1CUOA 1AS7A 4Q8BA 4GP8B 5PAZA 3RYMA 1IBYA 1ETJA 5F7BA 4MFHA 3X1FA 3FYIB 4TXVB 2CCWA 1XB6A 1ILSA 2TSAA 1BXAA 3BQVA 1UATA 3H4FA 2IDSA 4GP5B 7PAZA 2Q9OA 2FQEA 4W9ZA 1KCBA 1EZLA 3T6WA 3ZBMA 1E65A 1GW0A 1BXVA 1GR7A 3X1GA 2XV3A 1PAZA 2FT8A 3IEAA 1MG3C 1SF3A 2H5UA 3CVDA 1ZV2A 3QJUB 3OD3A 3AW5A 3DIVA 5E9NA 2FWLB 2JKWA 4DPBX 2HXAA 5TK4A 4YSCA 2I7OA 2YAPA 1ASQA 2NRDA 2PPFA 4BXVA 5I5JA 3OQRA 4YVNA 1SNRA 7PCYA 2FNWA 4AZUA 1KV7A 4UANA 2YAEA 2HX7A 5D4JA 4FA7B 1QNIA 3G5WA 2VSKB 1KCWA 3IN2A 1KDJA 3N2JA 3NJKA 3L45A 1WA1X 3X1EA 1W6WA 2IWFA 4HCIA 1EHKB 3NSDA 1PNDA 4F2FA 1L9PA 1J9TA 1AANA 3S3DB 4GY4A 4HCGA 2DYSB 4E9QA 1L9QA 2FQDA 1J5CA 3IN0A 1SDDB 3EH3B 2CALA 5LDUA 5TK2A 3S8GB 1WA2X 2PP8A 3FQYA 1HFUA 2HX8A 2XX1A 3DKHA 4UAHA 2VN3A 1URIA 2FQFA 1JXFA 3PPSA 1L9RA 1WAEA 1JZJA 2XXFA 1PLCA 4GXFA 3ABMB 1A4BA 1MZZA 1E30A 1V10A 2UXTA 3H4HA 1AZCA 3QQXA 1M57B 1X9RA 3FYEB 3WKQA 3TA4D 4AKPA 4KNTA 5FC9A 2VW6A 4KOBA 2BP0A 1HAWA 2EIMB 2BZCA 2BP8B 2IWEA 1QHQA 2UX6A 1FFTB 2J56A 3WIAA 3NJJA 4E9XA 1AAJA 3CVCA 2JXMA 3KW7A 1OE2A 3NSCA 2HLEB 1JZIA 1B3IA 4BWWA 2YXVA 3JTBA 2Y69B 5I5MA 1GS8A 1V54B 1A65A 3QJTB 2BO0A 1IC0A 4BXSV 2FTAA 3FSZA 1AQ8A 3C75A 5B1JC 1RKRA 2BHFA 4YSTA 4P5RA 2XUWA 1BQKA 4G70B 3FQ2A 4G7SB 4E9WA 4KO9A 1NIBA 1IBZA 2GHZA 2PP9A 1BYOA 3EF4A 1RZQA 1NWOA 5EHFA 3AG2B 4CSZA 2FT7A 3OM3B 1NDTA 1NIFA 4A66A 4YSRA 1N68A 2AANA 2GIMA 4F2EA 1GS7A 1NTDA 2RACA 1GY2A 1PLBA 3AY2A 4Q89A 1NZRA 2BZ7A 4AX3A 3U25A 2AZUA 4BK5C 3H56A 2UX7A 5B7EA 1SHXA 4E9YA 2VW7A 3PAUA 3EH4B 2IWKA 5AZUA 3TBBA 5I6PA 1JOIA 1CC3A 2CJ3A 3SQRA 5I6MA 1DZ0A 3WKPA 4DP0X 4DP2X 3NT0A 2W8CA 4YSUA 1AR1B 1OCRB 1JERA 4X4KA 4M3HA 4WTQA 2UXVA 2PP7A 1CURA 4NAJA 4UF7C 1AS8A 3GXUB 3UAAA 3PAVA 2DY2A 3FQ1A 3NP4A 2HX9A 4CSPA 4JHUA 2H3XC 1OCCB 1SFDA 1OE1A 4E9SA 2DV6A 4QLWA 3SBPA 4A67A 1GYCA 1RZPA 4DP5X 3NJNA 1NICA 4KO6A 1AG6A 1E67A 2AVFA 1JXGA 3FT0A 4KO5A 2ZWNA 1JZHA 1ET7A 1JVOA 4BWUA 2AFNA 1PY0A 2QDWA 2XX0A 3KW8A 1BQ5A 3T71A 4G71B 4HZ1A 2FQGA 1ZIBA 3PLYA 1ET5A 2B08A 4F7KA 2WSDA 2JFCA 2QT6A 4YSQA 4HIPA 4W1TA 4QKTA 4L0PB 1VLXA 4AI7A 2OJ1A 1KGYE 1M9WA 1PLAA 2X88A 2XLLA 1XMEB 2ZXWB 3JT2A 3UAEA 3S3BB 4E9VA 1HAUA 1L9SA 2UXFA 3WG7B 4G7RB 2MRYA 3FSWA 5ANHA 2BW4A 1W8EA 4G7QB 4DP9X 2I85A 9PCYA 1GS6X 3D12B 4HALA 4E9TA 5IY5B 3NJHA 3UADA 3UACA 3AG1B 3OMIB 1FA4A 2DWTA 2EINB 2J55A 2WO3B 2PPEA 2YAQA 3EH5B 4YSDA 2ZOOA 2W88A 2WO2B 5D4HA 1NIDA 3V9CA 3WNJA 1KBWA 1AZBA 2TSBA 3QJVB 4P5SA 4NB7A 1X9UA 1NPNA 4PCYA 4GP4B 1CYXA 5PCYA 4A2GA 5AKRA 4YSSA 3NSYA 5B1JA 4KO7A 2PPCA 1YLBB 3NJLA 2R7EA 1RCYA 1GSKA 2VM4A 1OF0A 2BP0B 4DP8X 1J9RA 2PPAA 2ZONA 4KNUA 8PAZA 3FU8A 1OCZB 2BWDA 4HHWA 3ZIYA 3FSAA 4ENZA 3TU6A 3BVDB 5B7FA 4A2EA 4G72B 1NIEA 1KBVA 4A2DA 3SBQA 1PCSA 1ID2A 2QDVA 4N4YB 3QJRB 1PZAA 3CDZA 1MZYA 5AFAA 4BDVA 3UABA 3HEIB 1A8ZA 5I6OA 2IAAC 1IKOP 1JVLA 4E9RA 1BQRA 1BYPA 1F56A 2IDUA 1WA0X 2GC7C 1TKWA 3NJMA 4M4RB 4HAKA 1W6LA 1AACA 1SF5A 5I26A 2LLNA 3X1BA 5I5IA 1I53A 2IDTA 3CG8A 2FT6A 1DYZA 2DWSA 2P80A 3V9EA 2AZAA 1MDAA 4HHGA 3ASOB 3X1NA 2YXWA 4FAAB 1AZNA 5A7EA 1XB8A 4YVUA 4ZK8A 2BW5A 2QPEB 2XV2A 1NINA 3PCYA 1ZIAA 3TASA 3T6XA 4YSEA 4JKNA 2UXGA 2QPDB 3T9WA 1BEXA 2CAKA 5B1AB 5I6KA 3SBRA 2DYRB 1BXUA 2PLTA 3ABGA 1PF3A 5I28A 1ASOA 4DP4X 3HB3B 3FU9A 4RH4A 1SJMA 1J9QA 3IBOA 1J9SA 1E5ZA 3T6ZA 1JXDA 1L9TA 3PAZA 4NERA 1PZBA 1NWPA 1ADWA 2Q5BA 4KOCA 1NPJA 3N55A 2VW4A 2HRHA 1N70A 1A3ZA 2I7SA 3ERXA 2Y1AA 1PNCA 2EILB 2OV0A 2BWIA 5F7AA 1AOZA 3WI9A 1E5YA 2VSMB 4DPCX 3NSFA 2CBPA 4YSAA 1V55B 3IE9A 2IDQA 5B1BB 4A2HA 4BWTA 1A4CA 4AKOA 1PZCA 1TEFA 3FU7B 1AS6A 1KDIA 5I6LA 1ZDSA 2HRGA 3TBCA 3NJGA 1TU2A 2J57A 2XWZA 2GB2A 3FU7A 5B1KA 2XXGA 2YARA 3CVBA 2GBAA 2IH8A 2PCYA 2XU9A 3ZX1A 2YAOA 3FSVA 1JZEA 1OE3A 3FPXA 1OOWA 1PMYA 1JZFA 2GSMB 1TEGA 1AG0A 3OMAB 2R7EB 3S3CB 1ZPUA 1AZRA 3PXLA 3EHBB 2GI0A 3GDCA 4YSPA 2IDFA 4N8UA 3T6VA 2X87A 2PCFA 4JHVA 3AG3B 2MTAA 1SDDA 3NP3A 2EIKB 3GYRA 4A68A 1WS7A 1OV8A 3ABKB 1NIAA 1ASPA 3NJFA
chains in the Genus database with same CATH superfamily
1JIBA 1DJSA 1UB5A 4PRPB 4U6HA 4OI8A 2VDPB 3OSVA 2VAAA 3WOVA 3EYOA 4L4TE 4GSDL 4I3RH 4JG1H 2RA1A 4KRLB 3AAZA 3U36B 4LSQH 3RWHA 5ANME 4XNXL 4MNQD 1RUKH 3KPTA 1JZ7A 1S4IA 4R6UA 3I9IA 4DP1X 1T1ZA 3D4ZA 1IUZA 5DQ9A 2Q3AA 4PV1C 3JTTB 3WLBA 3S35X 1DDHA 3T4AB 3CWGA 5FKAA 5T1LD 3IFLH 1BVKA 2XYBA 1WS8A 3ATDA 3KXFB 2NY6D 4JW3A 5L2KA 1C7TA 1N5AA 1VGEH 4D0DA 3ZKQD 1HXMA 1UD4A 2B3IA 4XX5A 2VQTA 2QKIB 1E3XA 2OBGA 1DSWA 1ICTA 3IRZA 4F57L 1U8KB 5K1VA 4PJEB 1FGNL 1P1ZA 5I15L 2VMJA 4OUUA 5GZND 4XPHL 1TMQA 4F93B 3AMLA 2L4OA 2XQYG 3LS4L 4NUGH 3D85B 2X12A 3LEYL 4I7ZC 5KZCD 4NC2B 1GKEA 4F8NA 3T8XB 5K59F 2XXCB 3MX0B 1QFPA 3LTVA 4P4RB 4MLIA 3CDYA 2F54D 4DP7X 3UBFA 2ZWSA 3T8VA 1A4KB 4YXKH 3MC0A 3U6RB 2ZZUT 4PJ7F 4KVCH 3AT8A 4PRPE 4AQAA 4TRPH 4KTDH 3V0HA 1F90L 1K85A 3PJSB 3RIFK 1MW0A 3L54A 3C60C 3VA2C 4Z95H 2GKIA 3IMUA 2NNXA 1CGWA 4GP5B 4HFUL 4CC1A 5DCCA 3JV5A 2EC8A 1U42A 1KN2H 3ZBMA 4G7YH 3NZHL 4CU8A 1Y7VA 4P3CL 4XNZB 1NL0H 2XV3A 4AC2A 3LKRB 4UZSA 2NW2B 3QJUB 3UBXI 2BOBB 4LBEB 3BWUF 3KXFE 5IZ7A 4IBWA 5G5DB 3NOIA 1L0PA 2HXAA 5T3ZE 2VIRB 4TPRH 4MCZA 3L4VA 1HDMA 2Y3AA 4LCVA 2X5PA 4RMBA 3C5ZA 3ZPDA 2HP4A 4P9HC 3U2SA 4M48H 4PJEE 5HI3C 1ZJAA 3EYSH 2IQAB 2QBWA 4JFTA 2I26N 4NZTL 4ZX5A 1PEWA 1JHLL 2WLKA 3MRJA 2ZIDA 1KBKA 2AJUH 4JQVA 2QHRH 4BZ1H 2IFFL 1QNIA 2PABA 3FU6A 4J5VA 3TT1L 4M7LL 3MRDA 4LOUD 1VADB 3L16A 3BAXA 3DX9B 4U1LB 1MF2H 4DEPC 5FHAH 1N59B 2GAZB 2LFGA 2MIZA 4XAWH 4NM4H 1SYVA 1CF1A 4JFED 3TCXA 2DYSB 4N1EA 4EN3B 1NCUA 1L9QA 3VSTA 1PSKH 1H0DB 4J39A 3L2NA 5C0GA 4GT7A 4GLRI 3V6OE 1KG0B 3EOBB 5LO7A 3RNQB 3MLWH 4JO3L 2VM9A 2OMNA 3L3JB 4GKZA 1KBGL 2EUZA 4FQXA 1VRSA 3CFTA 2ODHA 1ADQA 5DO2C 1FC2D 5J1AA 1JHKH 1IBBA 3VI4A 4X6EB 1KGUA 2KT6A 1NUFA 5C09D 2CLRA 2XPGB 4NQVB 1F3RB 1C5BL 4AJYV 4XZ4A 1JZJA 1U8OB 3DOSA 1LE9B 2Y7QB 4JFVA 3K2UH 4N9OB 1HINL 3CN3A 4J3BA 1CS6A 1XH3B 4OJAA 2B39A 5KYXA 3MBEC 1X9RA 1S3RA 4GKLA 4NPYA 3HLAB 4WWOA 5ERWA 1MFVA 2Z31B 4G83A 2WBJC 1TPXB 1BJ8A 4YHPA 5IHZA 4N8PA 4TLTA 4EN2A 1U8JA 3TBSA 2Y3NA 2J6EL 4NI3A 4PJCA 1EXUB 3NVQA 3VMPA 3QNZB 2OJEA 1ZT1A 4KX9A 5IJCC 4RZCB 5KVGE 3B4NA 3BP7B 3O0RH 4FMFA 1YEJH 3HI1A 2C4XA 3GSWA 1EMTL 2R0WL 4JL2A 4HX1B 4MD4A 5IFHH 1Q9LA 2JF1A 3QI9B 4FFWD 2UZPA 2FX9L 4K8RD 2XUWA 2MOVA 3HC3L 1B2WH 3ZL1A 3UYPA 3UG3A 1QOKA 3NTCL 3QIUA 4XXWA 3H3BC 3VTMA 1NCWH 3L2MA 4KKAC 4L8SC 3D5OF 5LBSH 1FVDB 4FABL 3Q6FB 3RPIB 3B9AA 4MA8L 1QR1B 2GPZA 5DUML 1NDTA 1UEMA 2OXHA 4XBEH 3B7TA 5I1AA 4P4KC 5JIPA 1I3GL 3V2AR 1TTUA 4JQXA 1VDGA 4BH7B 1W0WA 1Z5LA 5IMKB 5D1QA 3STLA 4BK5C 2O5XL 2O93L 4B7LA 2YO3A 3TJPA 1D2PA 1JOIA 4PG2A 3GI9L 5KBMA 2TAAA 3SQRA 1QUNB 2G3ZA 5E4IA 5C7XH 3ZZ1A 1GYUA 3FAWA 1KEGL 4FG6C 1UZ6F 2ICWA 3ORJA 5L88L 4PTUA 4M3HA 5CCKH 2YD1A 1TETH 4F7MA 1CF8L 3QZPA 1GGUA 3KPRD 3LHAA 3DRTB 1U21A 3FQ1A 1RI8A 2VZ3A 4NM8L 1WV7T 1MFBH 3THML 4YX2L 3MGOA 4KKCC 5HY9A 3K2KA 4XP1L 5EOTA 5D7IF 1KTDA 4Y2NA 2AABL 1Q0YL 4LOFA 1X7TA 4GRWF 2IEPA 5DFAA 4XB8A 1KJMB 2QDWA 3PNRB 1FL6B 3KBHE 1LO0H 2QADC 3D3VA 3G5YA 3G5VA 1RXLA 3BPLC 2ZX6A 3I2CL 5DK0A 5C9JA 2CQVA 4OF3A 4TVPL 4TF4A 2SODB 2X4OB 3SOBH 2A6IB 1VLXA 3TONA 1OGAA 2ADYA 4N9GA 5DU7A 2VDLL 3VFMA 1R75A 3IMRA 4GB9A 1S7UA 2HT3D 2P42B 2BS8A 5DJ6A 4FMKA 3BFOA 4BH8A 2ISDA 1XGRA 1UM4L 2QPFA 1IIIA 2UXFA 4R7VA 1L9MA 3B6SA 3JWDC 5CSZB 4Z7QF 3LX9A 3QORD 5F2FA 5B3JE 4W4OC 5IP4A 3P3RA 4GLRH 2DWEB 3ZY7A 4YAQB 2VLMD 4WGWB 3FO2B 2PPEA 2HLAB 4Y4HC 4PBWD 4ZO7A 3V9CA 1UC6A 4ELMF 3DUUB 4R7NA 1NKGA 4BK4A 1CDJA 3B2VH 2R9HD 4UM9B 5BV7C 5JPNA 2BFVH 4ZPTB 4R7DB 2Y7SA 2Y06L 4PCYA 4QTIL 4XO5A 1CYXA 4JE0A 5PCYA 4MQSB 4NCC2 1MWOA 2C7UA 3HNVH 3JWNH 3T77A 4ZMNA 5KVFL 2ED6A 1OLLA 1W72L 5ADPH 4ELDA 4UAOB 2AQQA 1YLBB 2W91A 4OFDA 4Z7UF 3AU1B 1GSKA 2P28B 3JT0A 1IGFL 4KJPC 4Y5VC 3EKCA 4NPKA 3T65A 8PAZA 4KMTL 5IBUG 5DD1L 3SYOA 3VRIA 4QTHB 3FT4A 4ZMLA 2WMPB 2FIKA 3E6HA 4H5SB 2M26A 4PS3A 1FZMB 3QWQB 4KRNA 1F11A 3WXWL 5CEYB 3D06A 4OH2A 3KPSB 1A1NA 3FTVA 2UZYA 1K4DB 5I24A 1TG8A 4Z0BH 3LKNA 3ALWA 4X4YA 1NDMA 5HGHB 4S1DD 2IPUG 4JPSA 5ALCH 2V3DA 1ZXKA 2VJXA 3VQ2C 1T2XA 1YVLA 2QR0A 5E2JA 3Q6GL 3HE6B 3J7HA 4QRTA 5JORB 1KC5H 3AXHA 3AREA 4UT9H 4BK8A 3ZHDA 2DQUL 1BZ9A 3HC0A 4LLYA 2J8UA 1BFVH 4JPWH 3MGTB 3A0OA 3DWTA 3WO4B 4J27A 5F7KC 4OZHB 2HUHA 4I8DA 3QDGD 3QC6X 5I26A 4FLSA 1I53A 3ECBB 4CILA 1SVCP 4K7PH 1UKTA 1J9CT 1QUPA 3PWVA 3SODB 1D7DA 4PG9A 4GPVA 4PJDF 5DC9B 5TE6H 2X4SB 3V9FA 2DLHA 2XXMB 4BFOA 4ZW8A 3QAZC 3MV9A 2VR6A 4HEME 3D1MC 2KH2B 3R8BB 5DFVC 4PRAB 1DQVA 2NCEA 1OT4A 2UXGA 3V0EA 2OQJB 3QNXA 1SLXA 3ZSTA 1YMHA 1PEZA 1BXUA 2C9UA 3CZGA 4XPBL 5C3LD 1E9OA 4XC1H 3PWPB 1M7DA 4PN6A 4YC2B 4Y9BA 1ANUA 3KPSE 5G4OA 2WCGA 5TE7H 1TUPA 4AL8H 5IB3A 1DEDA 3BEWB 1TDQA 3E0GA 25C8H 1M9SA 1MNUH 3IRCA 1BFSA 2ARJB 4NZRL 3P02A 4XPFH 5DD5H 5E9AA 3X14B 4IBUA 1EO7A 3U4AA 2D4FA 1KLGB 2QGCA 2D3JA 4L48A 3DRQB 4OJDH 4XMXA 2Y1AA 4H0GA 1CL7L 3ULVE 1HKLL 5B39G 3W2DH 3LKOA 1ZEAL 2AW2A 4W9JC 1WCQA 3NACH 3UDWA 5LHDA 1YUKB 4HJ0C 4I9XA 2CIKB 2R59A 3EJJX 3IGUA 2AK1H 5K33A 5ILTH 5FLVA 2IG2H 3M88A 2HTKC 2XC8A 4OZHE 3AS3A 4I87A 4R83A 1IAKA 2Z3FA 4WV1C 2D0HA 2CRYA 1TVBB 2FSEA 4G6KH 2HRGA 3TBCA 1QABA 2V2TB 1H5BA 2DN7A 1W15A 4HC1H 1Q9WA 3FQUA 4JFFA 4XMPH 4QHMA 2XN9D 3CFQA 3U7WL 3GZPA 3MNMA 4HAFA 1RZIA 2XU9A 2YAOA 1MWAB 2NSQA 4GS7C 4P23D 3FHEA 3WEBA 2CSPA 1D5ZB 4XNQB 1NUGA 4K23H 2OFQA 3PWPE 4Z6AT 1G1YA 3C5ZC 3KYNA 4ONFH 5E51A 4GG6F 1DQJA 1TOXA 2F7RA 4PY7A 3SJVB 2L7EA 3ML9A 5H35A 2DD8H 3I6GB 3V5DA 4JHVA 2JKIS 2NUPA 5DJ8A 3IDJB 1OGTA 4ISVA 4M7JH 4TQEH 2VR5A 5I75C 4DH2A 3ESOA 4HUWA 2P4AB 4HSCX 4YNYA 5GGSY 1WZMA 3I50H 4I18B 2OMUA 3IDYC 3VX1A 3RPKA 1WBYB 1HNYA 2Y7OA 3G6AB 2YUXA 4JFWA 3RIAF 1J8HA 4AM0B 2W0KA 1KYUA 1L9OA 1LEKB 4A7QA 2R23A 2ERJB 3BSZA 3U4BH 3WNIA 2VXQL 5I8CB 1KPUA 4RDBA 3OJ2C 2GJ6D 4JBSA 5KSAD 4GG8B 4GQ9L 2DLFL 4BSJA 5HYEA 3GUFA 1ZTXE 3GC3A 2PW2B 4OVUA 5AB0A 2KZWA 2OZ4L 1UD5A 4ZBJA 3VFPB 4LPUA 1N6QL 4ZX4A 3TIDB 3CFCL 2BDNL 4YSOA 3NDZE 4LIQH 1NCJA 5IMOA 3EIFA 3QUZB 2UY7B 3AABA 4HJJL 1RZKC 3WU1A 4IQHA 4U3HA 1VF5C 1A7QH 2EDXA 3ZTEA 5EO1A 4AYFA 2X89D 5CP3H 2FJSA 1JWMB 1M56B 4HWNA 2NY1B 5C07D 3MJ9A 5I1HH 1KJ2A 3SKOB 5CEXB 4LLVA 3OR7A 3ZDZB 2PPDA 1YEIL 3IDGA 4MJ6B 4GBXD 3H9YA 1KWGA 4ZXBB 1GOFA 2AV1B 3SJVE 5D5MB 1AIZA 1BIIA 3CBKB 1IRAY 4ACTA 3R0NA 4F58L 5GRVL 4J4PA 4Y9EA 3MRRA 3NJIA 4EUPB 1A6TB 4O4YL 4N2AA 5IB2A 2A6JA 4UMGA 1ORSB 2NX5A 4M5ZH 4Z23A 4JFYA 2GK2A 4PGCA 2BMKA 1R17A 4M1CC 2GIXA 4HCRA 4ES9A 1ILSA 1KCRH 4NPJA 3GSXB 4KZDL 3FTGB 5AAWA 2OP4L 4KZEL 1CE6A 2K3HA 3AS0A 3BKML 3W57A 1X7SA 4LSUL 3ZXAC 1ETZB 2XQYK 1T04A 1SF3A 2CMRH 4JGUA 2PW1B 1BDYA 3EYVB 1QVOA 2ITDB 4IU2A 2CDEA 4W9IC 5IG7A 3EYFB 4G8GD 2YSSB 4WTWA 5D96C 2MCG1 3ULSA 2OCJA 3IYLW 2OI9C 2D3LA 2XWBA 3FB8B 3V4VH 2Y5TA 4MCNA 4MB1A 3DX7A 4EQ3A 5E99H 1VAHA 3QWOA 4OM1H 1NKOA 3ARYA 3GI8L 3MDJA 3QEHA 3K4ZA 4N0CD 2V0AA 4FXGB 4JFHE 4UV7L 2Z4TA 1AQMA 2EE0A 4P46D 1F0LA 1EA9C 4U3SB 2P8LA 1R6VA 4KQ3H 3ZDZE 1KDJA 1LK3L 4JY6A 4RGOH 2KMWA 4JQXC 4W9HC 1KCWA 5D1QC 2R0ZL 1XZ0B 3H85A 4HJSA 2GTZA 4KVNL 3P0VH 4K3DH 5CZXC 5DEGA 1YEHH 3DBXA 2B14A 1RZ8A 5D5ME 2JH2A 3OLIA 1HIMH 3RY6A 4KQ4L 3MLXL 1OAKH 1QLRA 4Q6IC 5DD6B 4YZWA 3TWCH 1KGXA 5FA4B 1KBPA 1PLGL 1U8HB 5IOKA 2HRPL 2R29A 3MRLB 4RBPH 1JS4A 1FHGA 4AYSA 2ICEC 5AVYB 1D5IL 4QRRB 1NOFA 1QBMH 1PDKA 2GUYA 3Q1SH 4WUKL 5LDUA 3BXNB 2FX7L 1JNLH 1ZK9A 5IFJA 2WQWA 2XWRA 1M7UA 4IMKA 3KEDA 2OYPA 4JQIA 4NRYA 1MJ7H 5E1AA 1KXQA 3D33A 1MFUA 4D9LH 2KZ1B 3M45A 4XT1C 2Q8BL 3N0PB 5J56B 3MJ7B 2FO1A 4ZW6A 1YC7A 3KAAA 1SY6H 1UM5L 3LQZA 5GZNC 1R34A 4G59C 1F3DJ 4OBRA 1DBAL 3U82B 3AROA 2CHXA 3IS0X 2XXFA 3FAXA 5BUAA 2IFGA 5FYJH 4MKMA 3F6LA 2EDWA 3QRGL 1U8NA 3A6CH 3Q7JA 1QACA 1ZT7B 3QZWA 3D30A 1EPFA 2ICWJ 2E0PA 5L4MA 3OJVC 3F7QA 5I1IH 1NANI 5EIVA 4P9HH 4H26A 4OZGA 1SBBA 2FEJA 1R47A 5FDWA 3GS4A 2EIMB 3VCLA 1I1YA 5IB5B 2VT0A 3II1A 4WHTA 3LH8A 1TQWA 1U8IB 3QIBC 4M5SA 4PREA 4TSBH 4PWEA 3QDJE 1X5XA 3F7VB 3VO0A 4IK6A 2J88L 3HAEA 2JXMA 4FLQA 3KGUA 2OAAA 1FLRL 5KJRH 4PPTA 1MHCA 4QRRE 3AWFA 5JPMA 4OFYD 5ETUB 5DYFA 3EO9H 4G9FD 1HXYA 2OYKA 1V3JA 4E41D 3HRZA 1NAKH 4F33B 4G7SB 2IAND 4A6YL 1QP1A 2F18A 2JJTC 4V1DA 2H3KA 2A2QT 1AC6A 2XZAL 1RFDL 4J28A 4WO4A 4Y8AA 5EHFA 5JIKA 3RB7A 1M2OA 3O6LH 2X4UB 3MYZA 5AL0A 2QQNH 2EDRA 1DQTA 3JUZA 4HGWB 1GS7A 1KIRA 5HI5D 4MMZA 4LOUC 3NZ8A 4AIZA 2BIMA 4L8CB 4LPYA 5HI4D 1K4CA 4ZTPL 5TDNB 5I23A 4N2IA 3ARGD 4HH9A 4Z18A 3PF2A 3U25A 5IR1A 4YHIA 5B7EA 3EBIA 1N7ML 2P52A 2UZXB 2KQNA 1AIFA 5I73C 4LLQA 1KJ3H 4W9KC 2AF2A 5MI0B 5JHDA 4NZUL 5GJTL 2M1KA 3ECVA 3ZKND 1XCTB 4DP2X 4EDXA 4URTB 4JFUA 3WN5C 3IKCA 4D0CA 1I1FB 1Z3GL 4OJCA 4JZNB 1IGYB 3WE1A 2R2BA 1X6LA 2HMID 3TN0A 3PL6A 2DOCA 4JJ5B 4HVBA 1CICB 3MXWL 2VDML 1J0JA 4Y1AA 5KWYC 4JE4B 1OQOA 3C09C 3KG5A 4JRYB 4AITA 1JXGA 4K2UH 5KVMC 2K45A 1T22B 1ONQA 3KW8A 1QHOA 4OV5B 2ZOUA 1PFOA 4X5XA 1SOXA 4Y2OA 2G4GA 4ZZKA 1SUJA 4S1SL 4L4TA 2XY2A 1E3ZA 2UYLB 2Y1YA 4GXVL 1HWGB 5E5MB 2OJ1A 4AYEC 3WO3B 4EOWH 4OCYL 1WCBA 5ANMA 5IJBC 4LLMA 5T1KA 4NGHH 1P84K 4UTAH 3IMVA 1HL9A 3ARSA 3JT2A 3OV6A 4LQFH 3VFTB 4NO2A 2V3EA 1D9KA 4PJ7B 5A2AA 3ZHNA 1II4E 1CT8B 2DYPD 1ED3A 3AGWA 3VAEA 2WXQA 3VGBA 4FHKA 3RHWK 2IXQA 5I82A 1RZ7H 3UACA 1JNNL 3DVNA 1ZPLA 4NRZB 2Z64C 2DWTA 3CFDA 3Q8EA 4RNRB 5ABZA 3QUXD 5D6DA 1FIGL 2W88A 4F15B 1R3LA 3EGSB 3H1ZA 2PYEB 4TNVF 4AE1A 1OGSA 1A3RL 3BD5A 1PY9A 4FFWC 5F71A 4P2AA 1HILB 3U4EB 1MFEL 4K8RC 1NBYA 2OCFD 4A7GA 2XI9A 2VM4A 2FBOJ 4MVBC 5AW4B 4DK3A 4J2QA 4GIAA 3ATAA 1F1AA 2PXYB 4FFYL 1HZLA 1TJIH 1UHVA 1MIMH 2H0JA 3BWAB 3CXHK 3EGDA 4JRYE 2VKXA 3VWJB 4RDQF 4CSSA 2B1AL 1FQ9C 4PRNB 2A73B 2AAVA 1E4XI 1NANH 5GGTH 4PRPA 5GJSH 1ZCRA 2G0KA 4PV9B 2P9RA 2YMOA 4QRSB 3T2LA 3CH8A 3U36A 3FULA 5K59E 4JN1H 2IDCA 3PGFL 2Z35B 3FC8A 5I16A 4JG0H 1SN5A 1D5BB 4CMHB 4XP5H 4OCWH 4PJ7E 3ZL2A 3MOAH 1WJ3A 1T0NA 1TITA 3T4AA 2IDUA 1PJ9A 4ALAL 2GC7C 3P4OB 3VWKD 4BFEA 1HVXA 3KXFA 1TXKA 3WFDH 5AAMA 4HAKA 3JWDH 4Y0GA 3LD8C 2Y07L 1IGTB 4FQLH 4PB9H 3ZUNC 1HH9A 2QKIA 4FCHA 2PYEE 1HX0A 4J12A 3W39B 3MQIA 1U8KA 4PJEA 1PJWA 5E6ZA 3CK0H 5EH1A 5BV7H 3LV3A 4JVWA 5FX3A 5F96H 4PD4K 3GTTA 3R1GL 3D85A 4RQQB 1ITBB 1YRKA 3VFUB 3TCLB 4WW1B 3PWNB 3MX0A 3IKKA 4U6TA 3SBRA 4P4RA 5ITBH 1JNHB 1MFNA 2HT3C 1B9KA 3EDFA 3G6DL 3DGDA 4PI2A 5JW4Q 1A4KA 3TJEH 4DP4X 3U6RA 1SJMA 2VJ8A 4P3DB 4OF5A 2VSDA 2WUBL 4XVTL 4HUMB 3QORC 2IADB 4P5MB 5IFAL 2A4EA 3V6OA 1JTTA 1ZXQA 3UZVB 4KJWD 3ARBA 5EOQH 4RWHA 2Q87A 3WEAA 1TYEB 3B2XA 1EDHA 3DGCR 2EILB 2W1NA 2EDJA 2R9HC 4UM9D 3UO8B 1MPAL 3EOYG 1CG9A 3TVMD 2EDMA 4WZ9A 3WXVL 4UWQB 2NW2A 4BE5A 3QCVH 1HL8A 4LBEA 4UMSA 1JYXA 4H1LG 1QG3A 1THAA 5G5DA 1YMMB 2VIRA 1OY3B 2OR9L 3IPEA 2P3YA 5I2IA 4C56D 1LK2B 1O7DC 3IF1A 1M71B 1BV8A 1FORH 3TO4D 2IQAA 2K9UA 5DRWA 4HIHA 3HBGA 3IU4L 1DFXA 4XTRD 2VDQL 3GJEB 2IH8A 4JHWH 5GZOA 2QVFB 3APCA 3F8UB 4S1DC 4CBZA 1VADA 3VGEA 3Q2VA 2JJSC 3DX9A 4U1LA 1ROWA 3ZT7A 5L8KB 3EG9B 3AXIA 15C8L 1N59A 2BC4B 2GAZA 4EN3A 3AT9A 3KH3A 3ULVD 1QSFD 1C1EL 4FZEH 2DM3A 4FXLA 5I1EL 3QJOA 1H0DA 2HPTA 4HIEB 4LCYA 3SDDB 1QFHA 1QFWI 2HFGH 3EH2A 4ANKA 3KVPA 1OM9A 1O9VA 2QELA 5LUMA 4Q74A 1KG0A 2AI0H 2P80D 3RNQA 4DPAX 3IE4A 1XT5A 1M3JA 4Z76A 4Z3EA 4POZD 3UGEA 1NM9A 3H2PA 4LHUB 1GIGH 2WYHA 4X6EA 4BELD 1SQMA 3UCRA 3KPQB 1YN7B 3QNFA 4N87A 4PLKD 5D7IB 1FFNB 2BNRB 3HG1B 1UACL 2XPGA 3BW9B 3K0YA 4GRWB 4NQVA 3WIIH 1IC7H 4U1KB 1U8OA 3QEQB 1YMME 5JA8B 2AXWA 1LE9A 2Y7QA 5A16B 1QSEB 4JL1A 3UTSD 3WS6A 1IKNA 4NQCD 3VXRD 4M6MH 5FUOH 3K2MC 1M05B 1XH3A 2ESVA 3RLSA 3ISYA 4K3JH 4OB5L 3RFZB 5AL8A 5LNDA 3HLAA 4B9ZA 1I8IB 4GYBA 4LAQH 3B9VA 3V0IA 5IUCA 2A3TA 1DJIA 3Q48A 1I9RL 4PAZA 1ZHLB 2E56A 3SY6A 5DJXB 4PEEA 3QNZA 4PJXF 2XN0A 3UAFA 2BY0A 1FDLH 4RZCA 3MUUA 4JY5L 1S7SB 3BP7A 3LAFA 4JZJC 4YK4C 3BH8B 4E42A 3PU7A 4XMKH 1FPTH 4U6VL 4CVWA 1RZGB 2HKAA 4NKQB 1WGVA 1BHGA 3H53A 1FH2A 4HX1A 4LFHD 2Z34A 4UIKL 5BUPA 3BUBA 1B0GA 3QI9A 4X4ZA 4O02B 3VXSD 2BJML 3TC9A 1F4WH 3WNMA 1A7RH 4N0YH 2K6WA 1CD0A 4Q8BA 4Z7UB 4GP8B 4FQIL 4UQBA 4QEGA 2DZEA 3TBYB 3T2NH 32C2B 1HZKA 1FVDA 2X4TB 2D03L 2WXJA 4M56A 3UTQB 3Q6FA 5D7IE 3RPIA 5CLYA 3CGTA 1DUZB 1QR1A 2BNRE 3HG1E 3BX7C 1XF4B 4G6FD 7PAZA 4GRWE 3K6SB 1OLZA 1T7XA 2MCPH 5MP6H 3REVA 4FQCL 3KS0J 5JIQA 3QEQE 3LEVL 3RUGF 1MAKA 2GHWB 1QSEE 3ZHKA 5KSVB 4D9RE 5IMKA 2CO3A 4BH7A 3K4DA 4H8WC 1IAOA 1XR8A 3HRZC 4N6RB 3U9PL 5I76B 3F7PC 4N8VG 3Q0HA 4WFFD 3KGSA 5IROA 3NMEA 5CLXA 4Q9CA 4TQ8A 3P1VA 4GI9A 5KVDH 1KXVC 3PHQB 3CSFA 1E8XA 3KYKH 2RR3A 1E5UI 1RZKH 3B5GA 1XF3B 1A7PH 2B1HL 5D4JA 3DRTA 4YHOH 1MCEA 5IMMB 4KHXL 4AZ8B 3X1EA 5LWYL 1XWVA 3D39B 2PO6C 3FUMA 4UZUA 4G7VH 4DO6A 5HHVH 1PNDA 1RZFH 2WQXA 4MJ5B 2BNUB 4KJYB 4TYUA 4HJ1A 1KJMA 5F8RC 4CN4A 1F41A 4DN3H 4PJDB 1FL6A 5KSAC 4YHMH 3VA6A 4Z7UE 3FNKA 4OZFB 2BVTA 4LCWB 4NOBA 5F9OL 2X4OA 3F83A 3ZYOA 3B2DC 2BP3A 5TK2A 3RE0A 1G1OA 5CD3B 1RAMA 2PP8A 2VISB 1OVZA 3GDBA 5D1ZA 4HIIB 4O5LL 2Y7LA 4X5PA 4KV5E 2NZIA 3BCFA 5LXGL 3G9VA 3VFRA 3ETTA 4TVSa 5HHMB 1FLTX 3IGLA 4H8PA 2FQFA 5CSZA 3RU8H 1QFWH 2EH7H 4I5BB 4R9HA 4HBCL 1S5IH 2DWEA 4JG9A 3JWOC 2DIEA 4QR7A 3IMTA 6FABL 4YIQB 3FO2A 4WWID 5DJ0A 2HLAA 5E00B 3O8XB 3EBHA 3QUYA 3DUUA 3P11H 5DRNB 1BZ8A 1N64L 2ICCA 3REWB 5IQLA 1E30A 4CC0A 3ZRFC 3H4HA 4ZPTA 3BYYA 4R7DA 1JHTB 1BCIA 4RMWA 3SDCD 3BZFA 3M1OA 4IKNA 2WNKA 3I3DA 3K71B 1B9ZA 2H2PD 2CR0A 5FC9A 2VW6A 4HEMA 4A39A 1E5BA 3D39E 1V7MH 4I3RL 4JG1L 3EOTH 2KLRA 4LT7A 4N0UA 3U46B 1Y1DA 3N3EA 4QTHA 3TH2T 2WMPA 5E9DA 1FZMA 3AS1A 3A4AA 1V7NH 2P5ED 2AVGA 5BZWB 1WC7B 1A1MB 3DLQR 4YHYB 5IVNA 3IXTB 5CEYA 4PJDE 1LEIA 2AJYH 3RJDA 2R0LL 2X2IA 1GS8A 3MUJA 4JPIB 3HBQA 2FTAA 3WTTA 1A9VA 2CM6A 4LCWE 3CDCA 4YE0A 5HGHA 3B9EA 4RISH 1VGEL 1N8OE 1I9JH 4DKFL 2F7QA 1NCCH 3EHBC 3FZUD 3FQ2A 4N24A 4E9WA 2JNZA 3HE6A 4F9PA 3LRKA 1DTUA 3DJZA 5HHME 1BYOA 2R2HB 1TNNA 4YHNB 1RZQA 1TMCB 4MCYB 1NWOA 3C9NA 5ECGA 5MHSE 1UT1A 2WLLB 3GSUB 1FNHA 1HSBB 3MGTA 3OKEB 5EA0H 3NCYS 2G60L 1IGML 5CEZL 3VD2A 3IJ9A 1GPOH 4LLAA 3ECBA 3O81A 1HE7A 3VSVA 1QW9A 1WF5A 3QDJD 2X2JA 4YXKL 1OWWA 4X0NA 2X4SA 3LZLA 4TRPL 2FK9A 4ODVH 5FLUA 4YN3A 2EDKA 1SPDA 3T4AC 4M6OH 4HISA 9CGTA 1A66A 1X9LA 1A6ZA 1Y0LA 2DQ6A 3SCMD 1GJWA 2OQJA 5AAMC 1XMWA 1IQDB 4U2ZA 3QCTH 4FNQA 4GKNB 1KN2L 2FHBA 1NMBH 2B2XH 3CMOH 3OHXB 1NGZB 3PWPA 2OL3H 3L1OL 4HPOL 1QR4A 3AUWB 4JREB 1NL0L 4QLWA 2D2OA 4O2CB 4ZD3H 1N2RB 4WI7A 1M4KA 5JXED 5LGHH 3BLKA 3BEWA 1OQXA 4KC3B 1ZHNB 4YDKL 1AO7D 4UQ9A 4TPRL 1KLGA 5FF6B 1ZLDA 3DRQA 4P2QB 5CBAB 4LLWB 4X9IA 4AG4H 3LZFL 4M48L 2IV8A 3EYSL 2YD6A 4LDLB 4CGUB 5J11B 4IGBD 2VGLM 4Q6YA 1XMEB 3LZQA 2QHRL 4BZ1L 3GZQA 1WD9A 3RI5K 5F7EH 4X98B 3HCVB 3Q2NA 2AQ1A 2CZNA 2WKOA 4NWUH 3V6OC 2BW4A 1I1CA 1TVBA 1A64A 1QA9A 5FHAL 2HG0A 4DEUA 4X6DF 2X41A 4ZFOB 2V2TA 3O6MH 1FCGA 1FA4A 1XFPA 3WCYA 4FNLH 4XXCA 4OLXH 4XNZC 4FFZA 5SWQB 1PSKL 2ZG2A 3RJOA 1E9QB 1XL6A 3MODL 3QJVB 3CFKB 4ZMPA 1H8LA 3RA7L 4YBLB 1MFCH 3MLVH 3NZUA 4Z7OF 2HN7A 2A74A 3BSZL 4JDTH 4Q14A 4XCEB 3TPKA 1JHKL 1DFBH 3DX3A 3SJVA 4KK9D 2WC7A 4Z3JA 3I6GA 1ZWIB 2AV7B 5DURD 5D9SB 4ZMTA 3IDJA 2AKRA 2R4RH 5EF2A 4FN0A 5B7FA 5GZOC 1TJGH 2X6MA 3FSOA 4P2QE 3OPZH 2YWZA 3MV7B 3QS2A 1IM9D 3ARGC 2BSED 2A7BA 4QIRA 3G5XB 3H9SB 4I3SH 1WBYA 3DMMD 3VNYA 4LPTA 3KL5A 2DMHA 2XWCA 3ABZA 4AM0A 1UT2A 3MJ9L 2C1OB 1KLUB 3HEIB 1T4KB 3VM5A 5I8CA 3ZKNC 4MYPA 4RMQA 1HK6A 4GG8A 1K8DB 4EI5B 1BYPA 2O6DA 4YUEH 5IJVA 2A77H 4HMDA 3O9WD 2PW2A 3HE7A 3JTSB 3O0RL 3ZVVA 4K7PY 1YEJL 2HMIC 3CCHB 3DHPA 4ACPA 5T3XE 5IFHL 2NDFA 2JMRA 4IMLA 1JZ8A 3QUZA 2UY7A 1JWUB 1XZWA 2NT0A 5G4MA 1BMZA 3VI3F 1KN4H 3UG5A 5JOFB 1GZPB 1B2WL 5JQ6H 5LKNA 4TTDD 1BZ7B 3SKOA 4NQDD 3HZKB 4MJ6A 4K8RH 1ZIAA 1IKNC 3BUTA 2BCKB 5LBSL 4ZXBA 3POHA 2ZXEB 5I6KA 1LJMA 5D5MA 1OZTG 5BZDA 2Z31C 3KDMB 4P2OD 5GGRA 1G5GA 4GEIA 1A9BB 4XBEL 2V2WB 4KUCF 1A6TA 4XAKD 1YA5A 1ORSA 4UT7H 1ZHBB 1XAKA 3MV7E 5HXMA 2XACC 3HIZA 3V4PH 2IH3A 4M8VA 3H9SE 3Q5OA 2VMEA 4UQAA 3DROB 4DKEH 1UXWB 2YZ1A 5CCHE 5AD0B 4UIMB 1MOEA 2JLPA 3GSXA 5FYKH 3FTGA 3V0WL 3HHMA 3W9DB 4CAGA 2YA1A 5DHMC 4N2MA 1ETZA 4K4KA 2DIJA 4OAWB 4JO2H 1U0QA 2PW1A 3EYVA 2DBLH 4AV5A 2ITDA 3LRSB 4WCYL 3EYFA 4M6NH 3RKPA 2D7TH 4R2GB 5I30H 4MGXA 3LKPB 1PCXA 3OWRA 3FRPB 1N6UA 1QFOA 3UYRH 3QHTC 3VXPA 3FU7B 2ZXGA 5MEND 2R8SL 5E2TH 1JYNA 4FDWA 3QEGL 2OKMA 1LO0L 4YEFA 1QMUA 5B1KA 3BGFC 4U3SA 3VGGA 2XXGA 4HUKB 2YBRB 3WGUB 4I0PD 2P46B 5FV2A 1XZ0A 4W9EC 1JZDC 3J8F7 3SGDH 3SOBL 1JZEA 4OGXH 3CSTA 2X6BA 3H7LA 4HUVB 1I8KB 2P45B 2XG4B 2EECA 5J89A 2QEJA 5DD6A 1JCKA 5HHQB 2JJVA 4B9KC 2BOLA 1YJDL 2D31A 3FH8A 2OS7A 3ARTA 3B9KB 4HIXH 3VWKC 4QRRA 2I5YH 4Q52A 4E5XG 5CFHA 2DQGH 4YHLL 3BXNA 1DBMH 1ZLVH 3E9UA 5BO1L 2E6QA 2VQ4A 5FO7B 3B2VL 5LDSA 2BFVL 4LSRH 1MJ8H 1FL3B 1MCJA 2YEQA 1T3FB 3GXTA 3MCLH 4LLDB 3MJ7A 5LVEA 5LCVA 2QQKH 1UFUA 3CFNA 4DNLA 1GY1A 3DIFB 4WJ5B 5IQOA 1AXSB 1R1CA 4YLQT 2VNCA 4XE0A 3Q2WA 4GNKB 4ZO9A 2WCPA 4BRJA 3EJQA 3HMXA 4XX1E 1TKWB 4OY9A 2ADFL 3B2UD 1ZT7A 3T0BA 4IOSD 1ZANL 5J57B 3ZDWA 4NIYE 1AOHA 2J73A 4HCRH 1TJXA 2FJFB 4HCFA 2YAFA 2IAMB 1BQHB 1HYRC 3N9GL 3QJQB 2ZCLH 3OKLB 2EDEA 1G7HB 3GGWA 3T6QC 4B97A 3KYMA 5IB5A 4RMVA 5EBGA 4HZAA 1U8IA 5ALCL 5ECJE 4PLNC 4KJWC 1SQ2N 2JB5L 3F7VA 5GS0C 2C4FT 4I77L 3VXMD 4OBSA 1JPFB 5F7DB 4UT9L 1LL1A 3TVMC 4CVUA 4JANB 1UWYA 2E8YA 2E7BA 4Z3TA 3LN4B 4U2YA 1BFVL 4JPWL 4TUKH 3RDTB 4NCDA 4WK2B 5ETUA 2WBKA 3MOBH 1CXFA 4XN8A 1B88A 3GRGA 3S6CA 4F33A 2VH5H 1H3PH 5EO9B 4K7PL 3OAUH 4KTEL 4MFHA 5JZ7C 3QQ9D 4YL9A 3TO4C 5SWSB 3QG7H 1AGEA 1ZY9A 5TE6L 1KTLB 1CGVA 5F0MB 5DZLA 4DZBB 4BZYA 1KJVB 2F1EA 2X4UA 4W9ZA 5SWZB 1PX3A 3TEYA 3OQ3B 3FMGL 4HGWA 4GSQA 4JM2F 3I9GH 1GMIA 4N5UA 1OCWH 4L8BB 4L8CA 5TDNA 3KM2A 3GRWA 4B9GA 4JKMA 2VDKL 2UZXA 1N19A 2B0SH 2LV4A 2ZSVB 3HE6C 4F9PC 3ULVC 3RZCB 2FL5A 2ZTBA 1EZSA 2V9UA 5AEAA 4AK2A 1XCTA 4EXKA 4ZQTA 25C8L 3L4YA 1MNUL 1BLIA 5IM7B 5A2LH 4KMLB 1I1FA 5C0CD 1XV8A 2ALWA 4WSKA 5EC1B 4POZC 3G5WA 5LNGA 3BVNB 3P30L 1W6WA 3W2DL 4LARH 2WW8A 1NPUA 1NBVH 2ENSA 3AVEA 3NACL 1QO3B 1IGCL 1CICA 1M53A 4R84A 4PLKC 5TFSL 4JRYA 1LLAA 2AK1L 1I1AB 5TF0A 4TNFA 1QLFB 2IG2L 3LZRA 4GINA 2CUIA 1T22A 4C4BA 4HOMA 2WVTA 5ID1B 4HLJA 4OV5A 1MCFA 4K55A 3UJJH 4A7SA 2J12B 2FQDA 1D7FA 4UM8B 4LFHG 4G6KL 1G6RH 2UYLA 3MJ8B 5J6HA 3NA9L 5E5MA 5SWSE 3GXPA 4HC1L 3NCYP 1KB5B 4XMPL 4NO0D 4YC2C 5FYLL 3VFTA 5SWZE 3OZLA 2DL2A 3EOAB 1R5WB 3KPLB 4PJ7A 3KEHA 3DBSA 5FGBC 1CT8A 3N1FC 5CIPB 2DS4A 3O4OB 1AGBB 4Y9FA 1SBSL 2FR4B 4K23L 4PY8J 1HT6A 4NRZA 1KCSH 1IGIH 4P05A 4H8WH 3BQUD 4ONFL 4FG4A 2JTYA 3RPBA 2DQDH 3E1F1 1IFHH 3WIFB 2PYEA 5E6ID 2DD8L 4GUCA 4G6AD 3QDMB 4EZKA 3RAJH 4W93A 1HILA 3UZEA 3QQXA 4FERA 3FUNA 5E0FA 4BD4A 2A9MH 4M7JL 4TQEL 2IGTA 3B7RL 4ZOEA 3Q06A 1DUYB 1LXMA 2F74B 3UMNA 3A67H 3I50L 4NLAA 5CINL 1QBLL 2PXYA 3KWVA 3OC8A 5EF1A 3ZE1F 2MNWA 2VLLB 3CXHJ 4X7SH 4EEEA 2XOTA 3BWAA 4XI5C 1DJXA 3NPSB 1YNKL 1ZS2A 4NT6A 3G6JF 3OZ9L 3U4BL 3QCUL 3FH5A 4KKLC 4DW2H 4R4FH 1B3IA 1QASA 2A73A 1O7SA 1CFBA 2YXVA 3AGVA 1MFDH 1CU4H 4WEBL 2XKUA 4PV9A 5AOLA 1RKRA 4QRSA 5DJDB 2I9LB 5F9AC 1I8LC 2Z35A 2HFFB 3KLQA 4KKNA 4LIQL 4A2LA 1D5BA 1DCEA 1GGYA 4IHOB 1A7QL 1MY7A 3BVXA 1P1VA 2PP9A 1L0QA 2OR7A 5J13C 1Z2KA 3GJFK 4R7XA 1X9QA 3BJ91 2JCCB 5C71A 4I18C 2AANA 2GVYA 1IGTA 5D72H 3JWOH 3QDME 4R0LB 4C57C 2UX7A 3JSSA 4H0HB 1KGCE 1AGCB 4FI8A 4RFEB 3FQWB 5BVJB 5IGXH 1IL1B 4M5ZL 4RQQA 2W8CA 5CJQL 3L3GA 4OJFH 4Y2DB 5CWSB 3TOPA 4PS4L 3WDJA 3ZTNH 1UWEH 3PWNA 3ZK0A 4B95C 2PP7A 2XZCH 2WB7A 1KCRL 2ZCKH 4CMMB 3B5HA 4HOXA 1JI1A 1ZOXA 3SDAD 1IEAA 1MHEB 4EUPG 4WW2C 4DWHA 1HSAB 4HEPG 1J0KA 3KWXA 1SUHA 5DZVA 4F9LA 4OQTH 1DE4B 4A63A 2K3TA 2ZX9A 4P3DA 2CMRL 5HHMD 4Z7IA 2XWJB 4AEIH 2YC1B 3E8UH 1PW3A 2NY1C 2IADA 4P5MA 2WN3A 1ET7A 1FL5B 3K0WA 1KFGA 3UZVA 4PJXB 2CGRH 1QI5A 3FFCB 4F7CB 2ZOKA 3PLYA 1ET5A 2WCSA 5E99L 4OM1L 1ZT4B 1MFMA 2WOYA 5DZPA 3SDCC 1JV2B 1T89C 4EAEA 1JNJA 2A9AA 2F19H 2WAQA 2CHDA 3GJFH 3KM1A 5IOPA 1KIQB 1U6AH 2B1OA 2NXYB 4KQ3L 2VWEC 4XCCL 2LHAA 1YMMA 1W8NA 4LHQB 2MRYA 4YWGH 2VDPH 1OP5K 2NTFB 1LK2A 3LKQB 4E9TA 2DKMA 1M71A 4HALA 3UO1H 3NJHA 1OAKL 3AG1B 3TWCL 2C9QA 1WRFA 1JK8B 3SE4A 1WHPA 2WO3B 5ELIA 3AITA 4QRUB 3F6JA 1NIDA 3GJEA 1AE6L 1M42A 3AUVA 4KK5D 2PWEA 1GGCH 3Q1SL 4XOEA 1NPNA 3HNSH 4GP4B 2RCSH 2LTQB 5I1LB 4YSSA 1P4LB 3PABB 5B1JA 3EG9A 3NJLA 3FZUC 4PJ8D 1RCYA 4UCFA 1F4YH 2BC4A 3APFA 4G6JL 4Q4EA 5FO9A 3RX8A 4P48A 5T3ZH 5EBLA 3GFUA 4MJJA 4FXGC 4WGVB 3SDDA 5AVWB 3RWGB 3GF8A 1PS3A 5KSUA 3GHEH 1DANT 4HHWA 3T1WA 2NUTB 1C5CL 3BP5B 2EIZB 3GKWL 1YN6B 4PJXE 3BVDB 3ZR5A 3FFCE 4PBXA 3NH7H 2AJVH 3MRGA 2B59B 1F6AB 4LHUA 4CVZB 5EZJB 1UGKA 3GLEA 1FCCA 3ARFB 2HB0A 4LK4A 3KPQA 1SXCA 4V33A 5D7IA 3KJ6H 4JPQA 1FFNA 1PZAA 1T7YA 2BNRA 3BW9A 3HG1A 4P9HL 4GI8A 1HI6B 1LE5B 1YEEL 1AD9B 2R56L 3QEQA 3UL4A 1A8ZA 2RJMA 1IJNA 1E27B 1JVLA 1QSEA 2Y0SA 4OLWL 1OP5H 4TSBL 3QHFL 2E7MA 1M05A 1JD9A 1XTMA 1CFSB 2ZKHH 3JBG7 4DUXA 3RFZA 1N6VA 2HSIA 1EERB 1I8IA 3HFMH 4PJBB 2WVUA 3RBGA 2RHEA 1CPUA 3CG8A 2DDQL 4JRLA 2XCMC 1ZHLA 5D2LF 1F02I 1S7QB 3EO9L 3SE8H 1EZUA 2YA0A 4UNVA 1NAKL 2DQCH 3GWJA 1YYMH 4NBXB 3SPHA 1S7SA 2YRPA 1N4XH 3D25A 3BH8A 1OARH 1H8NA 1WICA 2ENJA 1J88A 1BEXA 3ZJAA 3FUKA 5H37A 3DHMA 1JK9B 1IGJB 3OLEA 3WJMB 4O02A 3O6LL 5ICZB 2QQNL 1PF3A 3MVSA 4X50A 4B96A 1X5AA 3R06B 3QIWD 4Z7UA 3MNZB 4F1SA 2X0UA 1JUFB 2J1XA 3TBYA 2EYSB 4NNXB 4WHDA 1RIVH 1T7ZA 5EORH 4NQTA 5AVSB 3KWUA 4AVIA 4J6RL 4YQXH 1PZBA 4LSTL 1VHPA 4KOCA 1DUZA 4N25A 3OMZA 5AVZB 1OM3H 1KJ3L 2HRHA 2BIHA 5EU6B 4FS0A 5KVGH 5BRQA 1G43A 2FWUA 2EEBA 5LBGA 2GUOB 5KSVA 4OIAA 4ERSH 1RLBA 4J3SA 5F70A 2AJ3A 4XRCB 4Y19D 5B1BB 4GW1B 4CNIB 5F7LB 3WHE1 1YYCA 4AQ8C 5I76A 2A6DB 1G84A 1GOHA 1DVQA 1QRNB 2ADGB 4PJBE 5F9WB 1PZCA 5I8OH 4KK9C 5C0AB 1LTXA 2F8IA 3VTTA 1MVFA 3WUZA 1OTUC 4K2UL 1HEJC 3PHQA 2Z8RA 3L5IA 4N26A 3U79A 2CK0H 3SHSA 2AQ3A 3ATEA 1DN0B 2ZSWB 4PJ5B 1XF3A 2VDLB 3TM6A 2F5AH 3UTTB 5IMMA 4AZ8A 5CLZA 1F58L 3U4KA 5CJOL 4EOWL 1YNTB 1BBDH 2QVKA 3DMMC 3RVUD 3US1A 4MJ5A 2BNUA 2WQVA 3MRKB 3P9MB 4P5TD 2V7HB 4P9ML 4WNSA 3PFUA 1K3IA 1NFDB 3NK3A 4BIKA 1YZZA 3IJSB 3QR2A 4OZFA 3T6VA 4LCWA 4WWKD 3O9WC 5EUOA 1JP5A 5TJWK 1RZ7L 1IAIL 1NIAA 5CD3A 1ECZA 1MLCA 4LGSB 2VISA 5I0YA 4HIIA 1W72B 5EU6E 1GTFA 1ILUA 1J8RA 3ZKXB 1RMFH 1GAFH 6PAZA 4A37A 2AQPA 1NGXB 5T1DH 1DJYA 4TTDC 4I5BA 4K9JA 4WKXA 5DDHB 4KWUA 1JZGA 3QGVA 5FM8A 3TLRA 3VRLF 1ETA1 3RX5A 2F1AA 5E00A 2XN9A 1QRNE 3O8XA 4IRZH 1AGDA 2I27N 5HDRA 5DRNA 3REWA 2YAMA 5C0AE 1U8QB 1JHTA 1EJ6A 2H41A 3HC4H 1IKFL 5GGUB 2EH8L 2NY3D 2QFRA 3MOQA 2AQTA 1EJ8A 5I1JH 2GI7A 4PJ5E 3LPFA 5CO1A 3K71A 3UTTE 4XC3H 3VJ6A 3PUUA 1C08B 3EFDH 1DJGA 2ZKWA 4S10A 5GGRY 1N9PA 3U46A 3IDMB 4JN1L 2YQBA 4ODWB 4W9FC 3MRBA 1SFHA 4OKDA 1WFIA 1ZHKB 5BZWA 4JG0L 4BKSC 1WC7A 4ZAKB 4ABVA 4XP5L 1A1MA 4QHPA 3IXTA 4OCWL 5E95B 1DVSA 1NFDE 35C8H 3MOAL 2YUWA 3BE1H 3UZEC 1P4BH 1VKXB 1BAGA 5IEKB 4ANVA 3B1UA 3CFJB 4OLUH 3BWUC 4NQED 1RIHH 1S7RB 3WFDL 1A7NL 3JWDL 4FNPA 1ZAGA 2X9YA 4DVBB 5KVFE 2J5WA 2AXJA 3ULUF 1M7IB 5F7BA 3MRMB 2X6AA 4LMQI 3VXUE 2R2HA 1XXFC 3CK0L 3VWJC 2D7NA 1UJ3B 4YHNA 7FABH 1Z9LA 5C0BA 5BV7L 4MCYA 2DQFB 5F96L 4LQ1A 2R83A 2WLLA 1RUPH 4ONHB 3OF6D 3GSUA 4QXTB 3JVGA 1HSBA 3R8QA 4I0PC 2A6KB 3OJDB 3SGJC 1A7OH 2EICA 5B38G 4ZW7A 4M02A 1SMDA 2OW7A 3X1GA 4L29B 3V0DA 2FT8A 4HXBL 1MG3C 5DFWH 4AC4A 1H3VA 1HYSD 2H5UA 2JWYA 2XICA 1NC4B 1G9MC 1ZLSH 3TJEL 4CMHC 3FT3A 3SQOL 5MERB 3LXBA 4PVNA 4GBXA 2G5UA 4N2CA 5DJZB 5FGRA 5E1IA 5FWQA 1JGLH 2P5WD 4YGVB 4PGDA 2APWA 3EFOB 4WI6A 4JGMA 4OCRH 3SKUD 7PCYA 5LQBH 1P7KB 5E2UL 1U4EA 2G3NA 5EOQL 4PVMA 2P24B 1QWHA 4GKNA 3BHBB 1N0XH 1NGZA 3QH3B 5GS0H 2JE8A 5KG9B 2QGBA 3CLEH 1SRDA 1KPVB 1OAXH 3JV0A 3C5JB 4MXVF 3VI3B 2J8UF 3FCBA 4X8JB 5FF6A 5HD8D 4B0MM 4ZW5A 4P2QA 3LH9A 4K5OA 4WY7L 2DMCA 4M00A 5CBAA 5I1CL 2X9XA 1N26A 3QNYB 4ODHH 3B2UC 3Q9PA 3CUPB 1FORL 4Z77B 5A1AA 1UM6H 2WQUA 3BUIA 5C7ZA 5DZOA 4HUNB 1G4RA 2NOYA 4QRQB 4G8GA 5D7SL 1S6NA 1WE5A 1DVFB 4XNUH 4F9LC 5JUEL 1M7XA 2D9CA 3LPWA 3LVEA 4X98A 3HCVA 4ZQKB 4ZUTB 3FCSA 3PYCA 2EVGA 4GMSL 5FIEA 5L0QC 4EKXA 1L6PA 4RVBA 2DEWX 4IRSB 2WZPA 4EZJA 4ZFOA 4QDGA 2HVBA 3WLWD 3V0AC 3L3IB 3ASWA 4YXHL 1VJSA 2E9BA 4FZEL 3OAZH 5DS8B 1W16A 2Z9TA 4CRPA 3PDOB 4JM4L 2JI2A 1KEMH 2HFGL 2FGWH 1E9QA 3ULVH 4CW1A 1AZCA 3WKNA 1EJFA 3CFKA 3QDAA 5GS1B 2AI0L 3QUKB 3HKZA 1E6OH 5I1DB 5A2KH 3O3UN 4EZMA 4L3FA 3VE0B 2G3MA 1EH9A 3TT3L 1ZJBA 1GIGL 5DEFB 3O4LB 3QQ9C 1CVSC 3B2PA 5IUSA 1UD6A 4DGVH 4LNVA 3C6LB 3QO0B 5AW0B 2AV7A 3OXSA 5D9SA 1IC7L 2YXFA 1JD7A 3SZ6A 3LN9A 3VI3E 5GISL 4HS6B 4ZO6A 4WI4A 4KXAA 1E4XL 3QJTB 4CVXB 5I71B 1HQ4B 2YGOA 4RAVA 4YXLH 3MV7A 4M6ML 1HJCA 5B1JC 2Q7AA 3G5XA 3H9SA 1AR1D 1F13A 5E5LA 3EJSA 4LAQL 4DJMA 4WHYH 4R97B 1T4KA 5DMJB 4X6FB 3SDDC 3S2CA 1TTFA 4B5EA 1K8DA 2R1YB 4EI5A 1BVOA 1HXKA 5E5UB 4G43B 4L37A 4L9LB 1FDLL 3JTSA 1XVSA 4XNMB 3RTQD 4M8RA 5FW7A 3CCHA 4HHAB 3GPSA 1PTZA 3GLAA 3GO1L 5TDOB 2MCAA 3PUCA 4FHJA 4LPCA 1WO2A 4WJG3 2VC2L 3LPGA 3U9WA 5TQ2H 1UWXH 2GIYA 3F85A 3O2DH 1JWUA 2BRQA 3ZL4H 1TZHB 1NMCB 5BZZA 5DJ2A 1F4WL 1A7RL 2VW7A 3EH4B 4N0YL 5JOFA 1GZPA 4AVKA 1BZ7A 4OZIB 1ND0B 5TD4A 3WKMH 3AB0B 3HZKA 4IBQA 5JIIA 3KLKA 2WY3B 5SX5H 3T2NL 2GCYB 3RIFF 5C86A 2ENQA 2EXTA 2BCKA 3O4LE 4JFZH 4LEXH 3NSXA 1BFTA 2BNQD 4U7SA 2AJZB 3KDMA 2DMGA 1ZTXH 2MCPL 5MP6L 1A9BA 4H2AA 2WXPA 2WQRA 3FBQA 2V2WA 5CSBA 1IT9H 4CDGC 4DF9A 4E9SA 4NHCH 3FQNB 4Z7VF 4FFZH 1RZPA 3D4CA 3DXAD 3VM7A 1FO0A 4NLHA 3NABL 4G5ZH 4YDLC 1MWAH 2AERT 3DROA 5BS0D 2XX0A 5AD0A 3BQUC 1P4UA 4UIMA 4EIGB 4DKDC 2GJRA 1BVNP 5E6IC 3VSQA 2OYLA 1H3UA 4G6AC 2BXZA 3W9DA 1S3KH 1E7UA 4QKTA 4L0PB 3STZB 3P54A 1QKZH 2GBTA 3KYKL 1ML0A 2FLRT 3LRSA 2VXUL 3VB8A 4JFDB 5JHBA 4DGWC 4CC4A 3LKPA 4YFLF 3F00A 4KZCA 2BPBA 3CZEA 4G7VL 3LNHA 4X6BB 3LDBC 4PLJC 4PP1D 9PCYA 1ORQB 1AQKH 4YO0B 1I85C 4G8EB 4S11A 4DN3L 2OMZB 4S1RH 4QGYA 4WKZB 4YSDA 4D9QE 4OZIE 3D09A 2WO2B 3Q5TA 1KBWA 3QRBA 1ZLUH 2UUDK 1BGXH 4UQEA 2GTWB 4OLYL 5JHLA 1VFBB 4N2EA 1X9UA 4NB7A 4ZOBA 4JM2B 1I8KA 5HYJE 2VQUA 4WDIB 3CN1A 2CBQA 1H3GA 2PPCA 1Y6NR 4QRBA 5HHQA 3I74A 3OB0H 3MXVH 4XVUD 4OF6A 1MCPH 1RK7A 3RU8L 1QFWL 3B9KA 4LCIH 2K6ZA 3ESPA 4HDIB 2BWDA 3TZVB 1S5IL 3BH4A 1VERA 2Y24A 1DVYA 3LQAL 3Q3GB 1ACXA 1FE8H 3P11L 4KRPB 4LHJB 4BFRA 3APDA 5FUCC 3NGBC 1OK0A 5FO7A 4O9HL 5ISZB 2FZ3A 2DI7A 1FYTB 2EVJA 1FL3A 3ZKSD 2I07B 5H2BB 2J8HA 1T3FA 3ZKMC 3MSPA 1F1DA 2QDVA 4PJAF 3N04A 3KVDD 3UTPE 4KKZA 5EIIB 1C8PA 4JFDE 3DIFA 4WJ5A 5GGSB 1AXSA 4YDNA 1V7ML 3SBWC 3IJYB 1CI3M 4EUPH 5FOJA 4BE6A 1Z0NA 3R7RA 2AXGB 4DFIA 1CFMA 5KS9B 3FXIC 1TKWA 2BIQA 1GC1C 1Z32X 3PS6A 1V7NL 4XHJD 3SDAC 4B7IA 1DJWA 2W0LA 3DVFA 4HUXB 3QFJD 3KD4A 1E4WH 4FL4B 1Y6KR 1M2VB 3G08B 2FJFA 2IAMA 1BQHA 1HZHH 2GFBA 3CX5K 1UXSB 4A6YB 2M2DA 3OKLA 1G7HA 1Y18B 4MDJB 4HHGA 4FAAB 4RISL 2YXWA 5DD3H 1I9JL 1TZOA 1NEZB 2AEQH 2ZYHA 2ZNXA 3VXNB 4UTBH 4W9GC 2NR6C 3O11B 2PR9A 4FKEA 1GL4B 3OZKA 5F7DA 4JKNA 1BPVA 4NN7C 2CAKA 4JANA 3F7RA 1OD9A 2DYRB 4IBYA 4KY1H 4L9DA 4P3WA 4WWNA 3LN4A 3RDTA 4PYHA 4PWKA 4GOSA 3ZO9A 1UZ8B 4OKVB 4CJ1A 3HB3B 4XO9A 4RH4A 1EHNA 2V2XB 3C6SB 1J8KA 3NN8B 5E4EB 5GGVH 4AEFA 5EO9A 5DHDA 1FYTE 3ZE1B 1J1XH 4GW5B 1QQDB 5SWSA 5IK3A 4D2NA 1KTLA 2XTJB 3BMWA 4ODVL 4DZBA 3EBAA 1KJVA 3G6JB 2OTUB 4PWJA 2WLJA 4M6OL 4PJGA 1E6JH 4QO1B 1IAIM 4KK5C 3H3KA 1Y07A 2W0FA 3ATFA 3EYUH 3FB7B 1INDH 1FVEB 2WWKT 3BPNB 4L8BA 2NNAB 5GGQH 3QCTL 2VDMB 4YSAA 3IE9A 1YECL 1NMBL 2B2XL 2ZSVA 1A4CA 1EFXB 2OL3L 4Q9QH 3RZCA 4ZD3L 3TX4A 2YK1H 5E5RB 1IARB 1FYHB 5LGHL 2IMMA 3P40A 5E08L 2NCMA 1H3WM 5IM7A 4QRPD 4IBZA 3JVGC 1U3YA 2VLKD 1UH2A 1WT5A 3BVNA 4P59H 1UUNA 4AG4L 3LMJL 1A14H 1QO3A 5ICYB 4Z7NF 2BH0A 4NZDA 3FPXA 1OOWA 1DL7H 4XN4A 1XCQB 3EZ8A 1I1AA 5IJKC 4L1DA 1MRFH 1QLFA 2CG9X 4JMXA 4NJAH 5F7EL 5ID1A 3UAJD 4P2RB 1BZEA 2HCZX 5LLIC 4NWUL 4XWOD 3QP3A 3U0WH 3SO3B 2BIOA 4N2BA 2QSCH 4UM8A 3U1SH 5KTEL 4F1ZA 1RULL 1UB5B 1RUAH 5I1KH 3H42H 2QVMA 1RZJC 3MJ8A 4F80A 5EN2B 1F2QA 2EIKB 5I9QB 3ZE1E 3O6FD 2JK5B 4WFEE 4FNLL 2NZ9D 3OHXC 4ICXA 3TBWA 4OLXL 2XTJE 4Q6KA 3RWHB 1KB5A 5L9DH 4R8WH 3G6JE 2VOTA 3K74B 4H8VA 2IH9A 1GJIA 1AR2A 1R5WA 3EOAA 3KPLA 3MAWA 2IPKB 3AZUA 3Q9QA 2M8XA 4GXUN 3QZOA 1J5DA 3MCG1 2YUVA 3M7FB 5DA0B 5CIPA 5F6IC 1MFCL 4N20A 1AGBA 4BDVB 5FKAB 5I8KL 4Z7WA 1DFBL 1EX0A 1NCDH 3BAEH 3OKMB 3OMNB 2CUMA 2LLLA 4R96A 3WIFA 5J11C 4RZKA 2N7SA 3QDMA 1SXBA 4YFDB 3CZUB 3S36H 1DP0A 2R4RL 3APMA 4HETA 3C12A 4FTVB 3DJSA 3OPZL 4PCSA 4AKQA 1DUYA 2F74A 4HT1L 1FBIL 2F58L 1BAWA 2VLLA 5D7LD 2VN4A 2WKLA 2XWXA 4WEUD 3SKMA 1R3IH 1XIWB 2EIDA 3OJMB 4RA0C 1NAMH 1PX4A 4P2RE 5K9QG 4K5PA 4H13C 1OANA 5TF1H 5CLTA 5ITFB 5C0ND 1I7TB 2YWYA 4KROB 4AQAB 4EF3A 2ZAIA 4L4VD 1V3KA 4H20H 1ECYA 1BXXA 5AVTB 5F7WC 1GGBL 4GKSB 4K5NA 4B41A 4KXBA 1PAMA 5CHNB 2HFFA 4G11A 1BVZA 4P99A 4QCIB 3BKCL 3L9BA 4IHOA 1OEZW 1PZUB 4TKWA 1KN4L 2NY0B 4NQCA 3VXRA 1MCOH 2G2PA 4PCKA 1NFIB 2IDSA 4K8RL 2VN5A 1E65A 2JCCA 5L2KE 2FNBA 2WTPA 1PAZA 3ZN6A 3IEAA 1UADC 3WHXB 4R0LA 3AW5A 2WXRA 3NIFF 3LPPA 4C4KT 5CLWA 4BFGA 4P5TC 1G7QB 1T66C 4AIXA 3U2SB 4FTVE 1AGCA 4Y5XB 2J1KA 2ED9A 4F37K 5BVJA 3S0PA 4EI5C 1IL1A 2AITA 1CBJA 1KB9K 4X80H 1AJ7H 3V4PL 4Y2DA 5CWSA 4KI5F 1E4KC 3VFGL 3CPUA 3EJRA 5HHPA 3KJ4B 4TOYH 2YPKB 5LB1A 3VXSA 5A2BA 4PJ9B 4GSUA 4CMMA 3MRDB 5FW6A 2Z92B 2ILLA 1MHEA 3HNTL 2EE9A 3GMOA 3NRFA 1JZ4A 1HSAA 2ZYSA 1SYVB 3NSDA 4HK3J 3S9DB 3VXUD 2YC1A 3KLHD 2DBLL 1T6BX 3MLYH 5D2LB 1FL5A 1G1CA 2JKLA 5E6RB 4M43H 3LXUX 2PTVA 5IVOA 4KFZC 3UYRL 2XRAL 3QHZH 4F7CA 2WK2A 4MMXC 3QO1A 1G9NC 3TA3D 2WHVA 5JTWA 4GKZB 2DLTA 2VDQB 5E2TL 2E7DA 2FBRA 4RX4A 2FUTA 4B5ZA 5FR3A 1V5JA 3RL2B 2K8QA 2I24N 3V0GA 1JV2A 3PWLB 4U1MB 4QAWA 5DR5H 1JPSH 3HFFA 3WDHA 2IIJA 3GB7B 1K5WA 3VDCA 3LQMA 2XX1A 3FRPG 3AS2A 4Q58C 1CGYA 2FWOB 5CP7B 2CLRB 1SVZA 5AW2B 2H26B 1HHGB 3DOSB 4HF5L 4U1GB 4Q4IA 2NTFA 3LKQA 5KEZA 2VAJA 3MNVA 5J12B 2ZT9C 3GMNA 4LO9A 1JK8A 2V5MA 1G9MH 1PLCA 4QRUA 4LRIA 3PGCA 1LO5B 5FAAA 5D7EA 4HIXL 4YHPB 2I5YL 4I85A 3TBSB 5I1LA 3OKDB 1P4LA 4R2GC 1FJ1A 5BRZD 2JLLA 4TSAL 3LOWA 4EPSA 1LYQA 2OJEB 3CHOA 1ZT1B 2KPNA 1LO3H 2QL1A 2YD7A 4K0OA 4LSRL 3IDIB 3MCLL 3HI1B 4KK6C 4GAJH 2M83A 2ZYIA 4GEJA 3RWGA 4WO0A 2JJUA 2CH8A 5D2LE 1HH6B 4PRBB 2NUTA 3BP5A 3IDXH 2EIZA 1XSOA 4LASH 5I5MA 2C5DC 3P4LA 2BO0A 2CNZA 1HYSC 3BFWA 2B59A 1F6AA 4CVZA 1PQZA 5E6SB 5EZJA 4ZS6D 3QIUB 4OLEA 1YQ2A 3PPEA 2ZKMX 4YSTA 2J6EA 1FRGL 1B0RB 2FYYB 3HTLX 3QB7C 2BSSA 1JGDB 3DTXB 3OC5A 1HI6A 2EXWD 2ZCLL 1AD9A 1CFQB 3GTVA 3UJIH 3V52H 5CCGE 3B9KC 2VSCA 1FZJB 1E27A 1IX2A 2H0FA 4KDVA 5DUBA 2Z1PA 2QGEA 3BFQG 5I0WA 3QR0A 1UQSB 1CFSA 5DSCB 4TLKA 4HEPA 4PJBA 4F2EA 5FM5M 4ZG1A 5IW1A 4TQPA 4X8XA 4XBGA 4H88H 4WHCA 4BRVA 1S7QA 5AYQA 4LKCA 3MOBL 4QJ3B 4MAYD 5FYJU 4UBDC 3WIHH 4M9OA 4F7MB 1H3PL 3WKPA 1AGFB 1CE1H 4HSQA 2BERA 3QG7L 2WTRB 3ZSSA 1IGJA 4UF7C 4O58H 3UAAA 5ICZA 2DY2A 1DZBA 1ZD6A 2VE6A 5F7HA 3WFBH 4KUCD 3SBPA 3R06A 1OCWL 3MNZA 4FZ8H 4DP5X 1B90A 3BYTA 5DK0B 3X12B 2WJ7A 2EYSA 4NNXA 4F7PA 1TTAA 2XQBL 2JELH 3X3GH 2B0SL 3SPCA 4BWUA 3IGFA 1BQ5A 4H2CA 1QFWM 4RDQG 1OGAB 4N9GB 1ACYH 5EU6A 5K69A 1LILA 1P5UB 2B08A 3P73B 2DH2A 4W1TA 4XMLH 5I5RA 2L0DA 1KUMA 1MHHB 2GUOA 3CMGA 3RDTC 3FB6A 3WEOA 4OD2B 1PLAA 3ARDB 5SV3A 4XRCA 3KHQA 3QRFM 4GW1A 3S3BB 4CNIA 4E2OA 4YLCA 4AW4A 2A6DA 2VMFA 3QA3A 4LARL 2YQ3A 1NBVL 3FCTB 1QRNA 2ADGA 3VH8B 3KE0A 1I8AA 5C0AA 4PI0A 5EEUA 5FGCB 1H15B 2E9JA 3DUSA 1RJZA 2G9HB 3BT2H 4HWEH 3UJJL 1DN0A 2ZSWA 1U33A 4PJ5A 4AEEA 1QPXA 3UTTA 3DX0A 4BZ2A 2VLRD 3HHRB 3VRLE 1G6RL 1JSYA 2OMXB 5FYJD 2RD0A 1SEQH 3PP3K 1YNTA 1U3HB 3UC2A 1ODUA 3BKJH 1AR1C 2QHLA 5FEBA 2JB6B 2VXVH 3D4GA 3P9MA 3MRKA 4TUJA 2BP0B 2P49B 4UILL 5DVLA 1NFDA 3FU8A 5KSBF 3VYOA 3IJSA 1A1NB 4WWPA 2E74C 2UZYB 1WAAE 1WT5C 3TCTA 5B3JF 1NC2B 3LKNB 2YQ2A 2XG5B 3L5WB 4NHUA 4ENZA 2DQHH 4A2EA 4JDVB 1OGAE 2DQDL 1W72A 5C2BH 3D9AH 4Y88A 3TPUA 1NIEA 4Z0XB 1F4HA 3QZBA 5EULV 3P3YA 1I1AC 3UEZA 2A9ML 2IQ9H 3K2IA 4MDIA 4B9JA 1MZYA 2W59A 4QOKD 5DDHA 1YPZF 1LO4H 3MZTA 3A67L 4OQ1A 4LLYB 3K6OA 2AJXH 2NXZB 1X6NA 4QXWA 2H32A 3WFCH 4EDWH 4X7SL 2CRMA 3ULUE 5HYJD 3UROR 1JTPA 1U8QA 4KAQH 5FGCE 1T83A 1KTCA 1NCBH 4BHUA 3INUL 5GGUA 4DW2L 2ZJSH 3M1CA 2C3VB 2CGZA 3QPXH 4R4FL 3BWSA 1XSIA 3IJ8A 3PXHA 1E40A 2X4PB 4PWFA 4TN9A 3KCWA 1MEXH 3WJLA 2ENYA 3I6LE 1C08A 3A22A 1JPST 3MV9B 3U2JA 3IDMA 4ODWA 2CHNA 2W9DH 3B2MA 3SQBB 2AQNA 1ZHKA 1XB8A 2BHZA 4W9CC 4APQB 3NCXA 4ZAKA 3BEVB 1NINA 3T08A 1WFTA 1FG2B 1BX2B 4Y4FB 1C8QA 1E9OB 1W91A 2IBZX 2XY1A 5E2VH 4JMNA 2PWGA 3KPNB 1DSYA 2I60L 3K4AA 4FRWA 3N06B 5AYUL 3OSKA 5E23A 1S7RA 1ZK5A 2F8OA 3KLAB 1K8IB 2P5PA 4LPWA 1M7IA 1WLHA 4O00A 5D7KE 5ENWB 4LF3B 3LCYA 1Y6MR 3LKOB 5F7NC 1AKJB 1NPJA 2DQFA 1JV5B 1AMYA 4HU2A 4ONHA 4QXTA 3S4SG 1IB5A 4MXVE 3SKNB 4PUBH 5EBMA 3CBRA 3D8MA 4I13B 1OP4A 1CDIA 2A6KA 3OJDA 4WUUD 4Y9GA 3ZTNL 1UWEL 4L29A 2ROYA 2YPLD 2DMKA 2FAUA 5DZNA 2XZCL 4OZFH 2MH4A 5CMAA 1CDGA 3GHBH 2CBPA 3T3PF 1NC4A 1NFAA 4XVJH 2Y9RT 3T8MA 3GIZH 3GEFA 1GC1H 4NQDA 4OF0A 4OQTL 5EV7A 1H5BB 1A3LH 4FXKB 4XVUC 5DJZA 5MERA 4Y16B 4AEIL 1XGQA 5D7JD 3E8UL 2UY6A 4YGVA 3SPVB 3GUTB 4IHBA 3EFOA 4JFFB 5CUSH 1YEWA 3MV9E 4KKBC 4AE0A 3TZVD 2Z7WA 2Q7YB 1R0AH 4B9PA 2GB2A 2FLMA 4XCYA 4U1NB 2P24A 4J8QA 1HOCA 5KYWB 3BHBA 4XPAH 5K1JA 2W9EL 1VZIA 3ZLQC 4AEHH 3EO1A 3CNKA 4NYLB 3ZQWA 3IB4A 5CEZE 2PR4H 2F19L 1JZFA 2GSMB 1AG0A 1KPVA 3C5JA 3CC5B 2WNWA 5H35B 4XGZB 3VI3A 2VYRE 4X8JA 2CR6A 4X8CA 3QJFB 2DQIH 2A9NH 4B9IA 5AB1A 3N1QC 4Y2DC 4HKJB 3CVIH 4YWGL 5JW5A 5K9QI 3KVQA 5IQ7L 4N8UA 3WUWG 4Q2ZA 4QI3A 1KCUL 3QNYA 5HJGA 3IXAB 3UFIA 5HSFA 3CUPA 4Z77A 4YNYB 1PZ5A 3RHWF 3HMWL 4JGJA 4J6IA 4NXKA 4KKCD 4WTZG 2OX5B 1GMEA 4LSPH 4QRQA 2ZCHH 1LWRA 3JV6B 2W65B 2ORBH 4R4ND 4ZQKA 1GGCL 2J5LC 4QYOA 2J25A 4ZUTA 5HYSB 1UD8A 2ZKYA 2WQ8A 2RCSL 4Z7VB 4XP9L 5I0ZA 1OCOB 2E5EA 1DVUA 2X38A 3ZTCC 1I3VA 2OYMA 5T5FH 3T2OA 4H0IA 1F4YL 4U7MA 1TTCA 5D2NB 1J10A 5DS8A 4AQEB 2R51A 2VITB 4ATTA 2X6CA 3PDOA 3FS9A 1GCFA 4JFFE 3BESR 3GHEL 3T0EB 2RIKA 2NXYC 5GS1A 3U7YH 4KDTC 3QUKA 4RCAA 2HA1A 4WNJA 3K8MA 5I1DA 2NY7H 2AJVL 5ADOH 1G9HA 3VE0A 3UIYA 3NYKA 2R69H 3V4UH 4LLVB 2VXQA 3HI6H 3O4LA 1N8ZB 2CXGA 3IDGB 5DEFA 5L8LB 1RPUA 1WIPA 1P53A 3C6LA 3FUJA 3QO0A 3KJ6L 4Y4HD 1MI5D 4JJHA 3WSQH 3MR9B 1YYLL 1EEYB 4ZRGA 3VW3L 3QJSB 4HS6A 1P7QD 5JOPE 1VFMA 3VGAB 4C83A 4CVXA 1HQ4A 2WYIA 5BMFH 1MJJB 2ZKHL 2D7PA 2YFOA 4YR6B 2DM4A 3JWNG 2FHFA 3HFML 4Y9CA 1RZJH 3VQ1C 1CUOA 2AQ2A 3U6XA 2D7OA 3ME0B 3CQPA 2WINB 5LAXB 3FYIB 4HMCA 4LCCC 2R1YA 3AXLA 5FB8B 4Z7VE 4HK3N 1LMIA 2R2EB 3EJZD 4FQJH 4G43A 4LVEA 4PP2B 4L9LA 5T33L 2DQCL 2JI1A 4IOSA 1T04B 1YYML 1EGJH 3TBVA 3P2TA 2Q9OA 1I9EA 1GW6A 4NRXB 2I9TA 1GKOA 4HHAA 4LVHC 2CRIA 5D2NE 5EMYA 1T1XA 3VD3A 2V5SA 3ARFC 3CVDA 2Y5TB 1TZHA 2C3GA 2X09A 3T0EE 2JKWA 2V8MA 3EBGA 4PJAB 3MUGB 4XWOC 3QEHB 4OZIA 4Z9KB 1ND0A 3VXMA 4IKLA 1TVHB 4BXVA 1J18A 3MACL 5CJXA 2GCYA 2P8LB 3OAYH 2JI3A 4OU3A 5ESAA 5AUMB 1MVUB 3ULAB 5JHMA 5EIQA 1TU2B 2DIAA 1TQBB 4JHAH 2NZ9C 3IVKB 1WITA 4MAUH 3UBXB 3VDBA 3DBXB 1O75A 1OSPL 4PSRA 3NJVA 4AGOA 1EHKB 5EN3A 4BGLA 1UURA 1LWJA 1YNLL 4IRJB 4ZMWA 3P0YH 5IV2B 1AFVL 2APBA 4AQOA 3S5YA 5I8OL 5L2KD 4Y8DC 5IFJB 3X17A 3ELAT 3W37A 2DQEH 4JCMA 3STZA 2CK0L 4EVNB 2OJZH 3QVAA 2F5AL 1DQDH 3ILEA 2HX8A 4JFDA 4G8IB 1L0YA 4X4ME 2VZUA 4ZMVA 4YHKH 4KUZL 1NGYA 1NM4A 4M62L 3VMNA 1EEZB 4X6BA 1R3KB 3PP4H 1BWMA 2Y6SD 4YO0A 2YD9A 4G8EA 3PQYB 5D5MF 2BX5A 1UTDA 1J5HA 1QWUA 2CJSA 4PJAE 4WKZA 2YKKA 2JIXD 4GXFA 1LEGB 5C0NC 1VGKB 1A4BA 2R1WA 2WM0A 4PB0H 3O3AB 5DQJB 2UXTA 3F05A 3VGDA 5FHBH 2DI8A 2HTKD 2Y72A 4JM2A 2AMGA 3OBAA 4R5VA 1OAYH 1I1YB 1G4MA 4WDIA 3TEZA 4I4WB 5F9WC 5DK2A 5HVHC 3LEXA 4DEWA 1GAFL 3FUFA 2IWEA 1QHQA 3HAEB 2VKWA 4M1GL 3TNMB 3FT9A 4HDIA 3IS1X 3PHAA 5AKVA 1AAJA 1WHOA 3NSCA 3Q3GA 5EU7E 2DTMH 4WJKB 1SMAA 4IRZL 2L7UA 1LD9A 4J3OF 5D93B 1UVQB 1HXYB 5EOCL 3FSZA 1SLWA 4X5QA 5ISZA 1FYTA 5ACZB 4WI3A 4DKTA 2I07A 2FUQA 5H2BA 1G9NH 3TIEA 3C5ZD 2NNRA 5I1JL 4YDIL 3WMSA 4Y4KB 4XB3A 1UB6B 5EIIA 2Y25A 5GGSA 2ZD0A 2AK4B 3WFEH 2WP3O 3TJHD 4BFKA 3EFDL 3DV4A 2MMXA 5HVWA 3IJYA 2VXSL<