2BWIA

Atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
molecule tags Oxidoreductase
total genus 86
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA02
1L9QA 1GS8A 1NWOA 1IUZA 2LLNA 3ZIYA 1BEXA 1CC3A 1BYPA 4GP4B 3IN2A 3N2JA 2FQEA 2HRHA 2IH9A 4BWTA 1GS6X 2GBAA 3BVDB 1NPNA 2XV3A 4GYBA 1ET5A 1GY1A 3WKQA 4PAZA 3ZDWA 5B7FA 3HB3B 1ID2A 5TK4A 2AZUA 1NINA 2BWIA 3UABA 3FSZA 2YAEA 3FPYA 4AI7A 2GIMA 3QJQB 4DPAX 1JZIA 1JZGA 4ENZA 9PCYA 2AVFA 5I6LA 1VLXA 2ZOOA 5D4JA 1OCZB 3SBPA 3TBBA 4AKQA 1NZRA 2BW4A 3FPXA 3H4HA 1WA1X 1L9PA 3DTUB 3OQRA 4UAHA 2JXMA 2EIJB 1RKRA 3OMIB 3QQXA 2MTAA 4HZ1A 3SQRA 3NJNA 3X1EA 1A8ZA 1NIAA 1L9OA 2BP8A 2VSKB 1YLBB 2FT7A 2FQGA 3AG2B 1KCWA 3DIVA 2AZAA 3ZX1A 1PZAA 2VMJA 1GY2A 2HX7A 4DP5X 1AZBA 4DP7X 1BQ5A 3ABKB 1JXGA 3CDZA 3FU7A 3NSFA 1R1CA 1X9RA 2IH8A 3NJIA 2GI0A 2BW5A 4KNTA 4A2FA 1BQRA 4UANA 2BZ7A 4A2EA 2BO0A 2JKWA 2HZHA 1JERA 4YSQA 2FQFA 3FSAA 2J55A 5B1KA 3ERXA 2GSMB 4AKPA 3PAZA 2WSDA 3OMNB 4W1TA 2GC7C 3EHBB 3GDCA 1AS6A 3NJLA 1J9TA 1J5DA 5I6OA 1MG2C 2XX0A 4N4YB 3ASOB 1ZV2A 1JXFA 4DP9X 2QPEB 3X1GA 3C75A 2FWLB 3NP3A 4A67A 3FS9A 2DYRB 4E9SA 3NJHA 2HX8A 5I5IA 1ETJA 2FTAA 2UX6A 4HAKA 5FC9A 5B7MA 4A2HA 4YSSA 1WS7A 5I6KA 1J9RA 2CBPA 1MZZA 1V54B 4E9YA 4KNUA 2XXGA 4ZK8A 2XX1A 3PPSA 2IWFA 3QJSB 4KO7A 3V9EA 1KCBA 2CUAA 1KBVA 2W8CA 3QJTB 4DP8X 2X87A 4M3HA 2B3IA 5AZUA 2UXVA 1QLEB 1E67A 1IBZA 1MZYA 1BYOA 3FSWA 5I28A 5D4HA 1OOWA 3PAUA 3T6VA 1NIEA 5TK2A 4YVNA 2P80D 3GYRA 1XMEB 2I85A 4DPBX 1AZUA 3NJFA 4A68A 2XVBA 2PP9A 3T6XA 1BXAA 4CSZA 1ADWA 5D4IA 1CYWA 1TEFA 3KW7A 3NP4A 3NSYA 4YSDA 4YSAA 1TKWA 2YAQA 3TBCA 1AS7A 1AIZA 1J5CA 3TA4D 4A66A 2B08A 4M4RB 1MDAA 2GHZA 1L9SA 2FQDA 2PPEA 4AX3A 3FSVA 1OF0A 1SHXA 3H56A 2YAMA 3FQ2A 2R7EB 3NJJA 1OE1A 3NT0A 1OE2A 5B1BB 2TSAA 4GXFA 2MRYA 1SHWA 2BP0B 4GP5B 3X1FA 4BDVA 3UACA 4YSCA 2QPDB 1A4BA 1JZEA 3S3BB 1L9RA 2PP8A 4DP1X 1E5ZA 3S8FB 3JTBA 1AZRA 3FU8A 4NAJA 2UXGA 1FA4A 1PAZA 1BXUA 1A4CA 1PCSA 4YVUA 4JKNA 1W6WA 2HLEB 1AZCA 2VN3A 4KO6A 3AG1B 3CVCA 4G72B 3CVBA 1ZIAA 1JZJA 2RACA 2ZONA 1A65A 5B1JC 5F7BA 1X9UA 1HAUA 2YAHA 1PMYA 3SBRA 3QJRB 4NB7A 4YSOA 4QKTA 4E9TA 1WA0X 4BWWA 3OM3B 1XB3A 3PCYA 3FU9A 1PF3A 1N70A 1URIA 3RYMA 2W88A 5B1AB 2CAKA 5B1JA 1WA2X 2IAAC 1PLCA 3IE9A 1BAWA 3QPKA 4UF7C 4W9ZA 1GYCA 3PAVA 4P5SA 3UGEA 2WO2B 4CSPA 1A4AA 1OCOB 1AAJA 1NWPA 2CALA 3MX0B 2HX9A 7PCYA 4KOCA 3WNJA 4HIPA 2UXFA 1W6LA 2YXVA 5AFAA 5I5MA 5A7EA 2OCCB 2BHFA 3FQYA 1OV8A 4Q89A 4EF3A 4FAAB 4F2FA 3PXLA 2EILB 4E9WA 4GY4A 3WI9A 4YSEA 3FQ1A 2PP7A 3D12B 2YAFA 4P5RA 2DWSA 5I26A 4G7SB 2R7EA 1EHKB 3T71A 1NTDA 2IWKA 4G7QB 3N55A 5I6MA 3NJMA 1A3ZA 2AFNA 2BP0A 1FWXA 2OV0A 3PLYA 1SJMA 3QJVB 2Y1AA 1PZCA 3UADA 1AR1B 2YARA 3ABLB 4AKOA 1WAEA 1OCCB 1ZDSA 1J9QA 4G70B 4DP0X 4E9VA 3FT0A 1T5KA 4DP4X 4A2DA 1QNIA 1AQ8A 1N68A 1B3IA 1CURA 2XUWA 3MBWB 4YL4A 1JOIA 3L45A 4HHGA 2J5WA 4E9RA 3EH3B 3QJUB 1PLBA 1AG0A 1E65A 3TU6A 4Q8BA 3ABGA 1IBYA 4X4KA 2UX7A 2H47C 3HEIB 4YSPA 1NICA 1QHQA 1SF3A 2YAOA 3CG8A 3U25A 1SNRA 2J56A 5LDUA 1DYZA 2FJSA 4HCIA 1PLAA 2PLTA 2BZCA 2DY2A 3UAEA 2E86A 3AZUA 2JFCA 1BXVA 4DPCX 2PPAA 4WKXA 1SDDB 2FNWA 3V9CA 5B3SB 1JZHA 1TEGA 5ANHA 3DKHA 2ZWNA 4JHVA 3NSCA 1EZLA 3FYIB 1KV7A 4KOBA 4JHUA 1IKOP 3H4FA 5PAZA 3T6WA 3SBQA 1ZPUA 2QDVA 1CUOA 2VW6A 3S3DB 1V55B 3ASNB 1PNCA 2VW7A 2I7SA 6PCYA 2BWDA 2Q5BA 3T6ZA 1ILSA 1HFUA 1NIDA 1V10A 2IWEA 1WS8A 2XLLA 1KDJA 2P80A 3TASA 3EH5B 3CVDA 1XB6A 1NPJA 1CYXA 2QDWA 3AG4B 4WTQA 2XXFA 1ASPA 5B7EA 1AG6A 4YSTA 4K9JA 2XV0A 4F2EA 4RH4A 2YQBA 1M56B 2H5UA 1GW0A 1FFTB 2XYBA 2X88A 1JVLA 2XV2A 2IDUA 3NSDA 2VM4A 3FYEB 3IEAA 3ABMB 2VM3A 1RZPA 2N0MA 1E5YA 4QLWA 2HRGA 2OJ1A 3X1NA 4E9XA 2I7OA 5I5JA 2AANA 1M9WA 1M57B 2CJ3A 5E9NA 1I53A 1SDDA 5PCYA 6PAZA 2Y69B 4HCFA 4BK5C 3NYKA 2WO3B 1GSKA 1JVOA 2IDFA 1PNDA 3AW5A 4G71B 1ZDQA 1HAWA 3WKPA 1J9SA 1NIBA 1F56A 7PAZA 2A3TA 4KO9A 3G5WA 2HXAA 2CCWA 4PCYA 4HALA 5IY5B 1NIFA 2NRDA 2IDQA 1AOZA 2DYSB 3AY2A 3X1BA 1JZFA 3NJGA 4A2GA 2PPFA 1SF5A 3IBOA 1RCYA 1SFHA 2YXWA 2ZXWB 1KDIA 1XB8A 2PPCA 5I6PA 1NDTA 2VSMB 1RZQA 2XWZA 4HHWA 3S8GB 5EHFA 1L9TA 3UAAA 1UATA 3AG3B 2H3XC 1GR7A 1BQKA 4BXSV 1SFDA 4TXVB 5AKRA 4F7KA 1AS8A 1ASQA 1AACA 3X2QB 2FT8A 4GP8B 4KO5A 2DWTA 1TU2A 3WG7B 1PY0A 2VW4A 1MG3C 3BQVA 4YSRA 4HCGA 4E9QA 1ET7A 1KGYE 4DP2X 4AZUA 3CZUB 4L0PB 2J57A 1IC0A 1AZNA 1KBWA 1E30A 1OE3A 4BDVB 1KYAA 1GS7A 2YAPA 2PCFA 4FA7B 2UXTA 4KNSA 4NERA 2QT6A 3EH4B 1AANA 1ET8A 1DZ0A 1ILUA 2FT6A 1W8EA 2PCYA 1PZBA 2IDSA 3EF4A 4G7RB 3T9WA 1JXDA 3GXUB 3IN0A 4DP6X 5I6NA 2Q9OA 4BXVA 4MFHA 2BP8B 2IDTA 2TSBA 4BWUA 8PAZA 2PPDA 3NJKA 4N8UA 3WNIA 3WIAA 2EINB 3OMAB 2GB2A 4YSUA 1OCRB 2DV6A 1ZIBA 3FU7B 3CDZB 2EIKB 2EIMB 5F7AA 3S3CB 3ZBMA 2XU9A 3OD3A 1ASOA 3KW8A 2GC4C 3JT2A
chains in the Genus database with same CATH superfamily
3S3PA 5HGHA 5AB1A 2DWYA 3PHQB 3EO0B 3DUHA 2X6BA 3Q1SH 3OQ3B 2P7TB 5AOIA 5D1XE 1HINL 5INDB 4FFWC 1DLHB 2G9HA 3GINA 2IH9A 4BWTA 4OGYH 1OAUH 2CMRH 1E6OH 5E23A 5FK9A 4B9FA 4ZMAT 2VE6A 4PS3A 5TQ2L 4JCMA 1MFAL 2YAEA 1HEJC 1CXLA 1JGVH 3ARTA 1CBVH 3B8SA 1G0YR 2AXGA 3FB6B 3MMEB 3WGVB 1KY7A 4A7UA 9PCYA 1NOFA 3V4LA 4TL5A 5C0BB 1EDYA 1AHWA 1SMOA 4EMZA 4Y19A 3VUAA 2QELA 5IHHA 1RJZB 4JFOA 3V4VA 3M8OL 4I3SL 5AKVA 1MJJA 2D7PA 1FJ1B 3IMUA 5B39B 3QQNA 1KJ3L 3CMOL 5BNXD 1YLBB 3HC3H 1CI5A 2VXSL 3MBEC 4MJID 3N43F 4JFED 5FOJA 4AJVA 1GMIA 2FDBP 1QZ1A 2IBGA 2WLIA 4WDIA 3ABKB 1I7UB 2JKXA 2C34A 1KXTB 2UVEA 4ABVA 3OKMB 1JPGA 5ICZA 1NMBL 4F3FB 4BUHA 3MBEA 5FW6A 4PRDB 2A73B 3CHXA 3VH8G 1AQKL 3HNVL 5FYJU 5CUSH 3FSAA 1A9EA 3JVFC 3H53A 1T1ZB 3FB7B 4Y4FC 2AK4B 2QFRA 2VSCA 1MAJA 1TCMA 2GC7C 3EJJX 4Y1AA 3G04A 3LN5B 4XB7A 4Q9CA 3KHOA 1J9TA 1A66A 1HYRC 4FXGB 4U1KA 4MNHB 1LD9B 4KFMA 4Y4FA 4LCWD 2KT6A 4WEBH 4H8WH 1C12B 1B88A 1OQXA 4HXAL 5JPMC 5G4NA 4L5FL 1DBML 5J13B 1U58A 4UM9A 4E9SA 3RLSA 1YVLA 1DVXA 3QC6X 1CG9A 3RKPA 3KH3A 5EUKA 2F5AH 3CQFA 3TVMD 5JPMA 3D6GA 4PMFA 1UTDA 4OV5A 1TSRA 3POCA 2R4SL 1J9RA 2FO4B 1ZKAA 2VERN 2ZXAA 3NTCL 3NABH 1NAKL 3AMLA 2AQ1A 4L2LA 3UIZA 1K9TA 4IHOB 5H94B 1F6FB 2W8CA 3QXVA 3CLEL 4OM1H 3GIZH 5EU7E 5LAXB 1U8CB 1CVRA 4FZ8H 1M1XB 4YHNB 1WD9A 2NY1B 3L4WA 3STLB 1MZYA 1JE6A 3FTVA 5CEYB 1XIWC 4X99A 5G4OA 1QNZL 2F5BL 1BAFL 1BMGA 1E43A 1FFOA 2WXHA 4RGOL 3BN3B 2Q6WB 1LJMA 1XIWA 3RPKA 4HK3N 2CO1A 1TEFA 3KL0A 3QFJE 4U3CA 1E5AA 4AYGA 3HVDA 3NSYA 4W70A 3BZ5A 3JXAA 4LQFH 4MZRA 3WN5C 3BSGA 2E76C 1I1AD 1L5GA 3KYAA 2GYSA 3IKKA 3KJ4B 4NNXA 2JJTA 1AD0B 2B08A 4EO5A 5KJRH 3P4OA 4LL4A 2F74B 3C87A 4RMWA 3GSQB 3LD8B 2CGRL 1HS6A 1MNUL 1U91B 3FXIC 3JWNG 3WN5A 4D0CA 5HYJE 5KG9A 1U8KA 3A6CH 2HT4C 4ODVL 4UT7H 5CHNB 4ZAKC 2YAMA 3WENA 2PETA 1URLA 1CGSL 1VEPA 2R7EB 3OKOB 3ALXA 1GGUA 4CRPA 1R5VA 3S37H 1F02I 3KGRA 1A25A 3BE1L 4ZAKA 4ANUA 2H2PD 1MFAH 4XGZB 3UACA 3C09C 4I18B 5D6CB 3IFLL 1CXHA 1MSPA 1CLCA 1L9NA 4XXDA 1FA4A 3W11C 3BEWA 2A83B 2HLEB 2R1YA 3INOA 1FFRA 5HSFA 1K4DB 1V3JA 1WWAX 2VDRH 4PJHF 5FYKH 3VRIB 1MJ7L 4HUKB 4YSOA 3ZTJG 1JS4A 4KAQL 1DJZA 4ETQA 2XQYK 2UZXB 1QR1A 2VR4A 2EACA 4M7JL 3KJ6H 4LSPL 1PLCA 1N59B 5GS0L 2J1KA 4UF7C 5KBDA 1R5WA 4H0LC 3VSVA 4XMZA 1W15A 4QIRA 3RDTC 3V6OA 3ARDD 4M8RA 4XCCH 4JRXA 4U1JA 3BYYA 1UWGL 4ODWA 4S0TD 4R2GD 3IJYA 1XV8A 3JZ7A 5EZLA 2A74B 3K2KA 3ZUCA 3RDTA 4EIGB 3VXTA 1BGXL 4WHDA 1RJYB 4B50A 1N5YL 3PP3K 4NUPA 2R69H 4Z7OF 1UWXH 1C16A 4E9WA 2NXYB 2X1QA 1XCTA 3I50L 3PQYE 5I76A 2E3VA 2ZXQA 4M02A 4IBWA 1BAGA 2B4CH 2NY6C 4MGXA 1INEH 2EICA 3S6CA 4ONGL 2I9TB 1KCKA 2HRPL 1A21A 3VXQA 2BP0A 1JTOA 4N8PA 4ODUB 3ZGIA 4M5YH 2P8LA 2R29A 5AZEL 5DF0A 4JDEB 4I1NB 4W9DC 4OKVA 1T5KA 1IC7L 5E4IA 4NN6C 4WV1C 1SXCA 1A02N 2XN0A 4O2FA 4X6DB 4WFED 1T4WA 2WN3A 4V2CB 4IU3B 4ZPTB 1SPDA 3U4BH 2WQSA 3N40P 4C58B 4HAFA 3FAXA 4FEIA 2C4FU 2UVFA 3ZKND 4AL8C 1KCRH 1YEKH 3EFFB 4WV1A 4KMLB 2Z8RA 5KVFH 4RZKA 1T80A 4KRMB 3SJVB 3KH4A 3KG5A 1FYHB 3EYOB 4KI5F 4QYAA 3BKML 5E6SB 3UJJL 3W82A 5MENE 4IGBC 3EOBB 1N0LA 4O9HL 4EIUA 2BC4A 5BUGA 4ALAL 1N7MH 3UAEA 4QJ5B 3LEVH 1DQIA 3O6FC 1DVZA 4DEPB 1F0LA 4OFDA 4HQQL 4IRJC 1FORH 3FT4A 3LAFA 2E9GA 3SBWC 4IGBA 1OTSD 1MCPL 3NESA 1G9HA 3FB5A 3L7EB 4X4XB 3CFDA 4TPRH 4UWQB 2IH1B 2OKMA 4DVRH 5ID0B 3O6FA 4BFIA 3LDBB 4GAYA 2GSGB 5CLZA 1QMUA 5MEQB 4IRJA 1KULA 2NY0D 1I8AA 3SBWA 4Z7UB 3MRCA 2VW6A 1MVYA 2YD7A 4CVXA 5E08H 3ASNB 3WIFB 1MCKA 4LLAA 4C56A 2Q5BA 2Y6SC 1EJ8A 3ENEA 5F0MB 5BS0A 1UH3A 4PJ5E 3TN0D 3FKUS 1V10A 4FDWA 2VJ0A 2IWEA 5F89B 3HNSL 4LFHD 2NSMA 5EO0A 1P4BH 3QRLA 2QVKA 1HNGA 1KEGH 3MJ9H 1CXKA 1JCKA 2EDRA 5HGDA 1PG7W 1N5AB 3QZWB 1EANA 1JWMA 3DX1A 4U1NB 9CGTA 2N7AA 1HXMA 3GEFA 3HE6C 5H2BA 3SZKC 4JPWL 3GRBA 3PF2A 4P99A 2B39A 5HP5A 1WTGT 2EADA 3NFSL 3UC0H 4FXKB 3NZSA 3ZZ1A 25C8L 3VYPA 3HE6A 2AC0A 2P5PA 2VM4A 5E8NA 2VM3A 4H8QA 4U3SA 1DFBL 1VCBC 4GG6E 2VKXA 1LQSR 4M8VA 3UCRA 4FJZA 4XBEL 3T5WA 1HOCA 2ILLA 4HC1L 4G6AD 5A2BA 1FNHA 5FIEA 3RVWC 5I15H 5E7BA 1YEJL 4P57A 2PYFA 1J7VR 3HMXA 2CGYA 3VWKB 3FT2A 1IL1A 3HOGA 1GYWA 1H6UA 4UOW0 1GSKA 4JB9H 2DQJH 4ODTL 3U46A 5DD6A 1IAOA 3DGGA 1J05A 1MAML 2AJVH 3TYFB 3WD5H 5FDWB 2E4TA 3TH4T 4M93C 1EAPB 2PW2B 3NACH 4X8GA 3V10A 5CCKH 3VXRB 3QUMA 5A2LH 3QDAA 1G9NL 5IJVB 3A67L 4L3ED 3LH2L 2B0SL 3X14B 3MLRL 5HBBA 3DUUA 1B4JH 1IAIL 1XGTB 4FQXB 4RGMB 3B9EA 3RX5A 2Y06H 4H25A 3C6LD 4OZGE 4YDVB 4LRIC 3VB9A 4KTGA 4Z8FH 5IFJB 3Q6GL 2PPCA 4PGBB 3B2PA 4LPWA 3IPFA 4ZYKB 4HK0A 1LWRA 4LEEA 1JHTA 4LLWB 2Z0UA 4F24A 3GKWL 3PWJB 1GR7A 3ZR5A 4NPYB 4NO3B 5DD1L 3H7BA 3Q6FA 1QSEA 3VD4A 3MYZA 2FT8A 4ZFZB 4OFIA 1PZ3A 1T6VN 4QY8B 1RXLA 3ECUA 1R47A 3OTTA 4XWGL 4LB8A 1AJ7H 1CL7H 3DX2A 2JH2A 4ZMWA 3RIAF 1ZK9A 3ZE1B 3B2UC 4JRWA 2OTWA 3GZKA 4LHUB 2WJ5A 3SPIA 4FJ6A 3KWWB 1CDCA 2Z93A 1GZHC 3FTXA 1WBXB 2X4NB 2Y22A 4DGIL 3A22A 1N4XL 4UT6L 1T7WA 2AJUH 1CDBA 3WXWH 2YMOA 3HG5A 5HHNB 3P9MB 2DPKA 4N2DA 1AO7B 1HSBB 1GZHA 2EDJA 4O58H 2MQ0A 5T3XE 1DCEA 5CJQL 1Z9LA 3IJHA 1NKGA 3FCGA 3HUJA 1Q0XL 2FR4B 1Q0YH 3T9WA 3PU7A 3OJ2C 3QWOA 3BZFA 4L8DA 4AC4A 2BP8B 3DBXA 2WMPA 2OULB 3NVQA 5AOZA 5BRZD 2WLNA 4X6FA 3Q8BA 4HOMA 2XY2A 4YSUA 4XMVA 4BSVA 2UZIH 4W9GC 4B96A 4Y4HC 3CDZB 3NK4A 1H3GA 3DTXA 5HI4D 3S3CB 3M07A 1EJFA 1MFCL 3ULVH 3HR6A 1G0DA 5IFHH 4OAWA 5CD5C 4GKNB 1TMQA 1JJUA 1SN5A 4ACPA 4I7ZC 4Y4HA 4RX4A 1SM3H 5JOPE 1NEZG 4G3YL 3F6IA 1J8KA 3BUTA 1XH3A 2VT0A 5FB8A 4RVBA 3B3IA 5HI3C 2OZ4H 5C9JA 2AQSA 2K4WA 4JGUA 3MBWA 2JJVA 3T3MB 1JPFB 1GY1A 1XGPA 4AENB 2IG2L 5C08E 4WK0B 4NP4H 3T4AB 5E94A 1KYOK 4MJIB 5BV7C 2H2SD 4XWOD 4W9HC 2HMID 1GYUA 3H9SD 4IBYA 3KWUA 3FPYA 4B27A 2UWEA 1JTTA 5GJTL 4UOZA 4TVPE 6CGTA 3QA3A 2PUQT 3V0HA 2ETWA 4GQPH 5B39G 5TDPA 2Y5EA 4PJEB 1NCCL 4E5XA 3HJEA 3GGWA 3CQPA 4RGND 3AREB 4OCWH 6FABH 4NNYB 3JWNE 4XPBH 4AM0A 4KUZL 4PVBA 1SOSA 2JXMA 4Z0XB 5IOPA 4PP1D 4JQXC 4LEXL 4HJSA 3D0AA 4UU9B 1XXFC 3GMNA 3KLLA 3D3VE 2R2EA 4ZOEA 3AG2B 2ADJA 1T03L 4N2CA 3IVKA 5F88A 2AXWA 2AV1A 4JQXA 4TTGA 3GTNA 4ZNEE 3W56A 5GGUB 4FS0A 2BZ7A 2YC1A 2HZHA 2WP3O 2FSDA 2FQFA 3FRUA 2J55A 3QIBD 5KAQG 1WFOA 5C0AB 3VGHA 5EUOE 4NQCD 2D7MA 5L0QB 2J21A 2GT9B 3P3YA 2IANE 2WXPA 4JGMA 4NCC1 1OP4A 4DP9X 4Q6IA 1A1OA 1J8HA 5HHVL 5DGRA 4AEHH 3DX9A 3EYSL 4P59H 4KKZA 4TUOB 5K9OA 4YDLB 4OJEH 4LASL 4ELKA 2CKNA 1KMGA 3BCDA 1SXBA 2W95A 3RWEA 4UTCA 1DBBL 1QPKA 5I6KA 5CN3A 2XZAH 3LPGA 5KVMC 2H0PA 1CDYA 4DSYA 1CIDA 4GW4B 5IMLA 4F2MA 3NA9L 3OR7A 4PD4J 4MVBC 4U1LB 5HHPB 3E8UL 2ZIDA 3ZUNC 2E9BA 1I1AB 1RPQA 1S46A 4G9FD 4WU5B 2XNAA 1A9BB 4JREC 4HG4J 1KBVA 2X53A 2X2IA 1E8WA 1RIVL 3NCFB 2NYKA 4MJ4A 2BNUB 2KLSA 3O11B 5ECJE 1BFTA 3QQ3A 4FP8L 3T8MA 4PB0H 4JPIA 2B1AH 4ZS6C 2MWCA 3DWTA 3X12A 3IXAB 4XPAL 2VZ1A 5EOQL 4OZHE 1BFSA 1DBKH 2HTKD 1F58L 4X6BA 3TV3H 5JORA 2HFGH 3FT9A 3MA7A 4NLAA 1MCWM 5CFAA 5JQ6H 1OGTB 2HP4A 4BH7A 4YAQA 2IPKA 4Z78B 4JPVL 4UTBL 5E6UB 4OLZL 3KPQB 2QZ5A 3T8XB 1HZHH 1SLVA 2X40A 5I73C 2WZ5A 1A6TA 1CE6B 5E56A 4UTAH 1JRHH 3PWPA 1VPOL 5AVZB 2LTQB 3ZTCC 4HX1B 1PDKB 1DJIA 4DKEH 5BMFH 1QBMH 5LB1A 4W9IC 5BRPA 1OD9A 3V4PL 5HHOD 1FYTE 1YY9D 2F7PA 1P7QD 4RA3A 1OAQL 3WY4A 3M17A 5DVLA 1CD1B 4HBCH 4R7VA 1F4WL 5GJTH 4I48A 4F7PB 2QQKL 3INUH 1A7QH 2E7CA 3FT1A 5C09A 4R2GB 1VJSA 3HG1E 3KLAB 3QEGH 3IPEA 2YEQA 1ZA6A 3AG1B 1WAAF 5FWQA 3VXOB 1AGBA 3O2VH 4PG9B 3QAZC 3MLSH 2KZ1B 1YZZA 4DTGL 3MOAL 4IM8A 3L3IA 3IJEA 4WEEA 4LIQE 4C57C 3PCYA 2FUTA 5EA0L 1AGEA 4J3OF 1CLVA 5D7IF 2CLVA 5IG7B 2Y1ZA 3ILDA 3ELAT 4FYTA 3VXMD 5BVPH 2W9DL 1Z6JT 2O5ZH 4B9PA 1ES0B 5EU4A 2JELL 1NWPA 3MX0B 2X4PA 2YPKB 2ZWKA 2OAAA 4L3CB 1C8PA 5AFAA 3TF7C 3IJSA 1P5VB 4F5CA 3WLBB 4EF3A 1WBYA 2DLFH 1X6LA 3QCVL 3TEXA 2WIMA 4LRNH 2DQGL 1Q90A 4ABWA 5KJ7E 4URTB 1MVUB 2IBBA 1UQSA 3IGAA 3KWTA 4M43L 4HCRA 2B3RA 1NANH 5F6IB 4JRYE 1KN4L 4NWTL 3OKEB 3VVWA 2R23A 1C5CL 1X44A 4OLUH 3SKMB 3UEZA 2NXZC 5JQIB 2EDEA 5DYFA 4MD4A 2PXYD 3H54A 5IW6B 2F7IA 3PRZA 4CBZA 1U2CA 4LKCA 3VM7A 1HC1A 2N4IA 4KI1A 1CDIA 4OUUB 2JTDA 1O0VA 1HTYA 2VZUA 3QSKB 2D7QA 3EXLA 4QXGH 2YO3A 2X3BA 4L3AA 3MNDA 4WFFD 3C60D 4M1DL 1MHCA 1T7YA 3AC0A 2QKIC 2ED8A 5IVXA 4P4KC 2AJSH 2V17L 1ZGLP 3MNWB 5CEZD 5D2LA 2Z4QA 2BIQA 3OAYH 1URZA 2NY0B 4MD0B 2YGNA 3CU7A 2BHZA 3EW3B 4FFZH 4X4KA 1OAXH 1NGQL 2QKIA 2VLLA 3QK0A 4N87A 4HUMB 4P4KA 4V33A 4YSPA 1XR9B 4DIXA 3QORD 3UZVB 2VLRA 4LSVL 1YYML 4ZFOL 1SNRA 4HWBL 5F1OB 2X6CA 2MJWA 4PRID 5GRYA 2BZCA 3QZNA 4TOYL 3FNKA 4BGLA 4YEFA 3FTGB 1G7LB 3AZUA 5E7FA 1UZ8A 4XNQA 4Z77B 3LOWA 3A4AA 2FNWA 3M7OA 3EKCA 5B3SB 4ZFFB 3SE9H 3RZCC 2A9DA 4P4RB 4R3SB 3CWGA 3KPLA 3QCUH 5AW4B 3EZ8A 2I60L 4IKNA 1S7QA 3FUEA 1DN2A 2GJ6A 2AJZB 1UURA 3D4ZA 2X4SA 4ANWA 5D7KE 5ILTL 4D9QE 4GUOA 3RZCA 2X0VA 2J3SA 4MNGA 1ZLEA 5HVGB 1S2EA 5BZWB 1XFPA 1JGUL 2OJZH 2DLIA 3APFA 2OMBA 4OU3A 2EH8H 2EDMA 5CLYA 4HWNA 4D8PB 5D2NE 2XTJB 4OFYD 4OCYL 1BZ9A 5CIPB 3LEXB 2X7LA 2OW7A 4MCYA 3ZMEA 1MFDH 1XHHA 3R8BB 4AK2A 35C8L 4MNQD 2WLLB 1EO5A 5E8OA 1CLZL 4DOHE 4MHHG 3AG4B 1MFUA 4BSJA 1I1RA 1J0YA 5DHVA 4WW1A 5JW3H 4RH4A 1EVUA 3IETA 5CR1A 1PX3A 3EJTA 1MQ8A 1UHVA 2OCFD 1E3XA 2HTLC 1DSFH 1S7SB 3COOA 1JVLA 3FTUA 3GHPA 5FM4A 3S0PA 1A2YB 4HUWB 5DFTA 3RX7A 3IEAA 1AD9B 3P73B 2CDEA 4N2LA 2XKUA 3HN3A 3JVGC 3Q48A 4QGYA 5ADOH 2Z0BA 1GCFA 4MLSA 3BAIA 1M9WA 2ZXBA 1M57B 2EYTA 2Q76A 4UZSA 1AXTH 3FT3B 3IRZA 1CGYA 2OMTB 3GMLB 4IBZA 4S1QH 4FULA 1VGKA 1FHNA 3MOQA 3BRFA 1EEYA 1TENA 4AYSA 4PGCA 3UZQA 4Z7NF 2IDFA 5F3BA 1SYSA 2VDLL 1HXYA 4A6YL 1MIMH 5CBAA 1ZDQA 1ZMYA 3TT3H 5HHMB 2HUEA 4ISVB 1QFOA 3CK0L 5C0BE 1KZYA 5D72L 2Y0SA 2HXAA 3P9LB 2B2XL 1KPVA 1SEBB 1U4FA 2DM7A 3BI9X 3UTSD 3WIHA 3P69A 1D5IL 4FHKA 1A47A 1MPAH 3EG9A 1NIFA 1KN4H 3G6JF 5FO8B 1O7SA 1CXEA 2CDFB 4UM8A 5DK2A 4AEIL 4XVSL 3MVSA 1PG7L 4MAYC 5HI5C 1X7QB 4GKZB 3RU8H 4HU2A 3S4SG 3S7GA 1Z3RA 4AY0A 1LO5B 4QHNB 4BUGA 3PJNA 4MMZC 1RZQA 1TQCB 2WLHA 3GJEA 1ETA1 4MAYA 2PW1B 2ZICA 3TWCL 5L8KB 4JQIL 1DO5A 5TF1L 4GT0A 1G87A 2K3TA 2W81C 1T4KB 4MMZA 2NY4D 3S37X 5CD3B 1QWHA 2AK4E 5B38A 4NZJA 1QBAA 2QR0B 3CFCL 4K3DH 4JUTA 2EVHA 15C8H 2J1ZA 2OMUB 5FCSH 5BRZB 1R3LB 4MA3B 5CIPH 4LE8A 3IYLW 2J57A 2FSEA 3QQ9D 2Z8VC 1CE1L 4MSWB 5MEPA 1OE3A 3PWVB 3EOYG 1KT2B 3AAZA 5HGAB 5D93B 2ZX6A 4OFPA 3ZKQD 2WBJB 4ELMF 4X5PA 1MFEL 4MRBA 2FATL 5FYKE 1G94A 4PRAB 4MA8L 2UUDK 3DXAD 1IV8A 1ROWA 1JP5A 4M1GH 2DQEH 5IB3A 2E56A 1VF5C 3L8QA 2G60L 4QXWA 1KG0A 1IGML 1NGXB 3BLKA 2H9GA 3O41B 3VI3A 5FV1L 2ATAA 3US9A 5DD5H 3QRGL 3MROB 1F13A 3RNQB 3L5XH 2N1TE 3QXTA 3CSYA 1XR8B 1SJHB 3VRLF 3EFOA 1RZIA 2CG9X 2LAAA 2Y6TE 1XD0A 3KVDD 4WTWA 4XC3H 3V0WH 2NR6C 1L6ZA 4IJTA 3BSZH 3ESNA 4JDZA 3ROLA 3VFRB 3RL1B 3H9SB 3L5WB 4Q0XH 1HXKA 5DD3H 5I17A 4PJCF 5FA3A 3UTTA 1DQMH 3OGOE 1EK3A 5I1LA 2NR6A 3RL2B 1ODUA 1K85A 3S36H 2DN7A 4AGMA 2D8KA 3C2AH 2VDNL 2EEXA 2A6DA 2P5WA 3A23A 3FB8B 2PYEB 4GP4B 4FN0A 2BNQB 2FQEA 2V7NB 1RY7B 3IDXL 4JO3H 5IMKA 1XF2B 4LP8A 4UQAA 2KKQA 1BHGA 2ZUTA 3JWDL 1JN6B 1VZGA 1ZT1B 1ET5A 2YA2A 3HBPA 3Q3GB 4P2OB 2HT3D 1QKZH 3LQZB 4M5ZH 1O75A 3OKNA 3U4AA 3RWGB 2ZKHL 1GIGH 3KYMA 4HKXB 5EPMB 2DI9A 4DUXA 1FVEA 3FQRB 2V2TB 4PJIB 4XVUC 4N0UB 5EBGA 1D7CA 3QVAA 4G1EB 2HVBA 4B7LA 4CMHC 4HIIA 2M26A 5DVKA 5DI8A 3HPJB 4RFEA 5F6HI 4P3CH 3APCA 1N6VA 5EBWA 5AVQB 1J11A 4TULH 5IQ7H 3QIBB 3RWDB 3JBG7 5KVFE 1TQUA 5TE4L 3QYCA 1NFAA 1Z7JA 3GM0A 3D0VB 3DTUB 4NQCB 4UAHA 3UBGA 3TX4A 2OMXA 1LILA 4L1TA 4Y9GA 1MW3A 3QQXA 2ZUSA 3T4YA 4I77H 1E8YA 4JG0H 3HB3D 1AC0A 3QISA 2EUWA 4MJJA 3GLAA 3SYPA 1A14L 3ARBD 1YEGL 3K0WA 4Q4IA 5I24A 3GBMH 3CK0H 4PY8J 5I8OL 1D6EB 4N1EA 3OXRA 2D3LA 4M7KH 3VFUA 1K3ZA 3OC8A 1R1CA 2FCBA 2XY1A 4U1MB 1K6QH 2R15A 2X4TB 4B5EA 4LSRL 3GMOA 1M53A 4JX0A 1XD1A 1EJ6A 2X70B 1U3HB 1LQBC 5LGYA 2ESVB 1JZ5A 5KYUA 1U8IA 1VFAA 1D2PA 1TQVA 4JDVA 5G5DA 1J5DA 4G9FB 4UBDC 3QR1A 1KN2H 3ZIMA 2PWFA 4U31A 1JXFA 3QNXA 4UV4L 1CDHA 5F6HJ 4EDXB 2WIIA 4ZS7H 1M2VA 3SDYL 5T3ZL 4RBPH 3DLQR 2FNBA 3LQAH 5TH2A 2IGLA 1E9PA 1VADB 1ADQH 7FABH 2AXFA 1E90A 4TLTA 3G5ZB 3UJIL 1QSZA 3J27A 4QT5A 4WWKD 2E47A 3IMRA 3K3QA 4KK9C 2YKLL 3HLAB 4X8XA 3IDYC 2BNRB 4OF6A 3RBSA 4AYID 2X2YA 3CZKA 4L4TA 4E9YA 2A4EA 5ICXA 4MA7L 3TZVD 4B97A 2VXVH 4GAJH 1PEWA 2QHRH 1MHEB 1JVKA 3OHMB 4XZUA 3VW3L 4NFBA 5MEOA 3SKUD 5FUZL 5FOBA 5EBLA 4MDJA 1I3RA 3FQXA 2E27L 1IT9H 5EWIL 3QXAB 4ZUWA 2V33A 4X7SL 1YEDA 1BYOA 4P23B 4X6DE 3M46A 4HP5A 4ONFH 3IGUA 5C1MB 4DAGL 2F58L 5C0JA 1UD2A 1OP5H 4WW2B 3VXSB 5CJOH 1JV5B 4LDCA 5HHOB 2W80C 1RK1A 5HDQH 5I19L 4GRMB 3QNZA 1RZJC 4XNMB 4K7FA 3U9UA 1CFNB 3WTWA 5E2WH 3V6ZB 1KXQE 1CYWA 2OMZB 3MKKA 2F8IA 5EU6A 3SJVE 3WFCL 43C9A 1BZ7A 2JKTM 4XMPH 3O81A 3TH2T 4HJTA 5DHDA 2HUHA 3ILPA 2R56H 4XP4L 5TDNB 4U1HA 4Z3JA 1G6RL 2APSA 5F71A 1SDYA 1FIGL 4PTTA 5CMAB 5D1QC 1J1OL 1HDMB 1RD6A 4CU8A 5FECA 3H3PH 3ARFD 1SY6L 3U9PH 4LVOC 2A4CA 5A2AA 5D1QA 1FI8C 1BEYH 5D96C 4Z7UE 1GGYA 5DJDA 2FRGP 2CLRB 4KJQD 3SSGA 4M6ML 4EIBA 4P07A 1PGRB 3VXMB 1A4BA 5IOKA 2H26A 2ZNXA 4MXVE 2CHDA 3VWJD 4LOFA 1ACZA 1OAYL 4ZOBA 1PYWB 2ITCB 2WQ8A 4NAJA 2NY5L 4PJAB 5ISZD 1OCWL 2WVSA 2EUXA 5DMJB 5FR3A 2Y7OA 1VAHA 1F5WA 4IRSA 1L3WA 1ZIAA 2NZ9D 2RACA 2YS4A 3ZL2A 3D51A 1R5IA 3GBNH 4OJYA 4YPGB 2YEZB 3SBRA 3CGTA 3KYOB 5D70H 2YSTA 3BAKA 5JMOC 1WA0X 2ZJSL 3TJEL 4BWWA 2CM6A 3KPPB 2I07A 1E27B 1HHJA 2H1PH 3OPZL 1PF3A 1MCHA 4I88A 4NCDA 3NEXA 4W81A 3PHOB 4GW1B 3VE0A 3HCVA 3QEUB 2YGQA 4L1SA 1N64H 3VFOB 1AI1H 3L1OH 1T1YA 5AW0B 4C4KO 1UXSB 1JIBA 5BOJA 4WHTA 2WO2B 2C3WA 4HH8A 4I3GA 3FQWB 4PJHA 5B8CC 1Q9WB 4FA6A 5I1IH 1C7SA 1H8SA 3NFNB 2CALA 4WFHD 2IVFC 4NQXA 3VFWA 4WI0B 2F19L 5SWZD 5C7XH 2G2NA 3IFNH 4AV5A 4GW5B 2BHFA 1IRAY 1QD0A 1QTPA 2UZYB 2W07A 5T1KA 1EAJA 3ZR6A 5B8CA 1KGCD 2H8PA 1I9RH 2XKNB 2Q20A 3D85A 1Q0EA 3GZQA 1AHMA 2XWJB 3WI9A 3QG7H 4UOW1 2DH2A 2VMEA 5IT2L 4J8RB 4GPVA 3ULVE 2WUCL 4G7SB 1II4E 5ADPH 1F97A 3ULSA 2M1KA 1KTCA 1QI5A 3GDBA 4LF3A 4OI9A 4DPRA 1BVNT 1U8HA 2O1AA 3VXRE 4PRIB 5LN8A 4FQLL 4KXCA 4TNWK 4EN3C 1O7DE 3ULUF 2HJKB 3VFTB 1G7QB 4HJGB 1EJOH 2Z65C 1KLGA 4HKZB 4NHCH 4HHAA 4PJ8C 3H42H 4JN1L 5F97E 1N68A 3BN9C 1B3IA 1BJMA 3EDKA 4EN3A 2WPGA 1G1CA 3V6FB 1MHPL 1QLRA 1OGPA 2HG5B 4WWOA 2MMXA 5HYSA 1AG0A 1E65A 1JD9A 4PJ8A 4LFHG 4U7SA 1L0XA 3LN9A 5DRNB 3MNMA 4LXFA 4OGXH 4WI9A 2OI9B 3FU3A 2N56A 1I3VA 1H15B 2LLGA 3UFIA 4XBGB 3MYJA 1PKQA 4WWPA 5LO7A 1PLAA 2EVFA 2I25N 4W6WB 3AS3A 4JW3A 5DEFA 3ZE1E 1A4KA 1R3JA 1T0PB 3D2TA 1EWHA 2KH2B 3M1BA 2J43A 3QHFH 3UO1H 2ZWNA 3NSCA 2Y23A 3R0NA 3NZHH 5EBMA 5L2KD 1R0AL 5SWQB 5DRZA 4AH2B 1CB4A 3ZDXB 1HK6A 5ESAB 2C8NA 1AO7E 4F92B 1JYVA 3MCLH 4Q9RL 3VMPA 3H3KA 3CXDL 2IFGA 3QHZL 3UBXB 4KTDH 5IP4A 4TSAH 3V7AE 1ZGLA 4K71B 3FUIA 4F7CA 1KLUB 5DS8A 3BKYH 1P9MC 1OM3H 5A2JH 4PGDA 3PP4L 5T33L 2IADB 2EECA 1TJMA 3Q44A 3CVDA 5GSRB 2X5PA 5LGJA 4NC1C 1PLGL 2D31B 4YZFF 2K45A 3O4LA 5AOJA 5CEZH 1I9IL 5AW1B 4XNAA 4U05A 4F2EA 3A6BL 4Z23A 4HSQA 5E8DH 1KIPB 2XSKA 1HQRA 3LS4H 4HS6B 2ERJB 2HSIA 1Q8MA 1D5MB 2AP2A 2WK2A 4G6KH 4BKSC 3UTSB 2C3VB 1KBBA 3CLFH 1CZ8L 2J8OA 1ZLVK 3T3ME 3X1NA 1HEZA 5EEWA 5I5JA 3D69A 5C0GB 1GKEA 5SX4H 1JNHA 2J6WA 2O6FA 2BOCA 3EH2A 4MJIE 1KPUA 1I53A 4DGVH 1AYOA 1YEHH 3ATAA 1H0DB 3KS0H 5DHMC 4H44C 4FNUA 2CXKA 5JIIA 3MV8A 3ZE2B 3PHSA 3L3KA 2WGXA 4XTRC 2KDYA 5LG6A 4L18A 2DKSA 4HFUH 2VB5A 2YBRB 4PJEE 5LGHH 1CK0L 3G08B 4ORGA 2GSIA 5GRUL 5E6ID 1XF5B 1TXKA 3DPBB 3OMZA 2A0LC 2CR0A 3UIYA 1CS6A 2G0LA 4N2NA 4DN3H 1ZLSL 2N59A 3PNWB 3WGUB 3NIFB 3W57A 1Z66A 5D1ZB 1TZOA 1KDIA 5JDSA 3VXUD 3V6BR 4I8DA 5HGHB 2QZQA 2L7EA 4FABL 4J3UA 5AQ0A 2VSMB 1HKLL 1H19A 5GZND 4RMSA 3QDMA 2OMVA 4WCYH 2G9HB 3L5JA 3TT1H 5EZIL 1MQKL 4HS3A 4OD1L 5FM5M 5FK9B 1YRKA 2BSSB 4UCFA 2VE6B 1LWHA 3B2MA 2H41A 2ZCLL 4F9LC 1A3LH 5IIEB 1T2XA 2EXWD 2AXGB 4IBLT 2NZIA 4OZFA 3LZFL 1KCVL 1JDAA 3HRZC 2JSFA 4F9LA 1MW2A 2HT2D 1J0KA 5HD8C 2X38A 2QVTA 1AHWB 4N0CC 4XR8C 2FVNA 3HFFA 4GI8A 4JFPA 1RMFH 2EO7A 3HRZA 4JFOB 3V4VB 2XQ0A 4FFVD 4K0OA 4N25A 1MJJB 5C07D 3RGVD 1H3VA 3L9BA 1PU0A 3D08A 5I66A 3UDWC 1KFAH 4G43A 2TSBA 4K23H 3EO9L 3GXMA 3MLZL 3NJKA 4NZUL 4BZ2A 4LP4A 4P2RD 3VTTA 3HN8A 4DGYH 2LU3A 2VR6A 4OVVA 5E99L 3UDWA 2EIMB 5JDJA 1JPGB 4LPCA 3S3JA 1U8PB 1ZWIA 3ZBMA 4UOJA 4GBXC 2OS7A 1AVAA 2VC2B 3OKDA 2VUOA 4NQTA 1A9EB 5T33H 1GA2A 1XCQB 4TQEH 2R0KL 3DX6A 3AVEA 2IPTL 4Y1AB 4GBXA 2BVEA 3LXCA 4GUPB 4LU5H 3L4TA 4U1KB 1BOGA 2G3NA 2ICWB 2XV3A 3V2AR 4Y4FB 3UG4A 3BWUF 4PRNA 4YFLF 2Q2LA 3HB3B 3GSVA 1UYWL 2VZ3A 4HKJA 4QEGA 3WFBL 1U58B 4N6RA 4RIRB 5DRWA 2CO6B 4UM9B 4MX7A 1NCWH 1JGEA 1S78D 1CG9B 1BJ1J 4IBQA 3PS6A 4UNVA 5TGBA 4P9HH 3KYNA 2CK0L 4ODSH 5I16A 4X7TA 4PBDA 5FUOH 4OV5B 1GHFH 4HXBH 4NKIL 5JW4Q 1RZFH 3LIZH 3VQ1C 3N41F 4KK8C 1IFGA 1TYJA 4KXAA 4DF9A 4MCNA 5J9PA 3W39A 4Y16C 1JNLL 4MQ7A 3OG6B 1LO2H 1YEIH 5MERB 4H8HA 4Q9QL 3N6YA 4EQ3A 2X6AA 1BG1A 4NM4L 4NNPH 3O3AA 1Q9KA 4XBPB 1N2RA 2AABH 1NKOA 4KKAD 5D8JH 4Y16A 1D5XA 4MJ5A 1BD2D 4OM0H 4R5XA 5KVGH 1NGPL 3TFKC 2BSTA 4XAWH 3VD7A 3PDOA 2VMJA 4X99B 3PABA 3A4DA 5IEHA 4CNIA 2O72A 4JFQB 4PJXF 4TNFA 2RA1A 2QMKA 3J8F7 2Z34A 3H8NA 2B1HL 1FFOB 1VA9A 2M2DA 1DE4A 3FQNA 2NYZA 4GMTH 4GLRI 1XIWB 2RCSL 5TQ0L 5E4AA 5A3IC 3DIFB 3BJLA 4GMSH 2UY6A 1EQWA 3HFMH 3V4VH 1MF2H 1GRWA 3PAZA 2OFQA 2APXA 3IFPB 4PLNC 3WNOA 5D9SB 1OXYA 1L5GB 4NNXB 5JHLA 2I24N 2NPLX 2ZOLA 4FG6C 5DU7A 4WHCA 3P4OB 3ESVF 4DGWC 4B9JA 2AKRA 3MSPA 3OSKA 2ICEC 3LB6D 5KG9B 3CVIL 3FOLA 1S7VA 3PV6A 1ORQA 3KE0A 3OJVC 4TL4A 4WFEE 4JFFD 2VC2H 1TVBA 4F9PA 2ICEA 5ESQA 1R5VB 3PY9A 1UM4L 5CGTA 4HAKA 1DVFC 1MZZA 5AYTA 1EGJA 4FYSA 4XNUH 1N3NB 4WUUD 1XZWA 2ZKXA 4XB3A 5FYJD 1HCFX 3BEWB 3PPSA 4YBLC 3W9EB 3C09B 3IAQA 1KTBA 2R1YB 4UYPA 5J6GA 3WL9A 2CK2A 1BBDH 4R96A 4E68A 4D7BA 3FK3A 1OSPL 1FLTX 2ENPA 3RVTD 3RURA 4X4YA 5KBKA 3PJSB 4N5UA 2BDNL 1FH5H 3MCKA 5AW7B 5I28A 4AC2A 1QR1B 1NIEA 3SPCA 5AW3B 3SE8H 3TIEB 1IKFL 1SLUA 3GXTA 4G8FA 2V8LA 4M00A 3WJLC 3FZUD 1R5WB 3EOAA 1OAZL 3D25A 3LSOB 1S7XA 1G9MH 3DURA 3RRQA 4ZW7A 4JRXB 4N0RA 1BIIA 5CXPA 4ODWB 3GHBL 3LZPA 1U95B 1EXHA 3WJLA 5EU5B 1X5HA 3ZU8A 3QG6A 3D9AL 3RDTB 4XPHH 3VXTB 4I3RH 1K4CB 1L9SA 1C16B 3GK8H 4NQEA 1XCTB 4UQEA 4P46D 2IFFL 5DZ9A 4OJCA 1MREH 5B1BB 5AVWB 3D5OF 4KVNL 4KY1L 1LP9F 1K5NB 3VXQB 2BP0B 1QFWM 2NY6B 4G9DA 1JZEA 1UKTA 4M4PA 5JXEC 2P8LB 2DTSA 1J0IA 4M9OA 1HJCA 4OKVB 2D2CC 1FNGB 5SWZB 2XTJE 2DQDL 4JBSA 1WH0A 4O2FB 3GRWL 4BFBD 3U7WH 4U0QB 2K6ZA 1PW3A 4QTIL 2Q8BH 2IO5A 3CVBA 2ZONA 5DQ9A 2BS9A 4NN6B 4WV1B 1YY8A 1Z5HA 1VGEL 3G6DL 4CDGC 4HMEA 5F96H 2XRAL 4R4FL 1XB3A 3U82B 4UQ3B 3V9FA 1N70A 2YMXL 4LCVA 4KBPA 4JFHD 5DMGC 2ADIA 4RAVA 5GJSH 1WAAA 1PTZA 2EYSA 5DZJA 3AQDA 4RESB 4F7MA 1N0LB 3PXJA 3NN8B 5CZKA 1UJTA 2Y25A 4JFYA 3GHEL 3MACH 1MCRA 3WNJA 1DJXA 4MB1A 1GZQA 4IGBB 1W6LA 4G42A 4OLXH 4RSYA 2WD0A 5A7EA 3RVVD 5D7IA 4YJZL 4G8EA 3MUJA 3QPXH 1G84A 5CBEA 3O6FB 4BFIB 4GAYB 1GOGA 1FPTL 4IRJB 4PUBL 4XN4A 2BXZA 4FG4A 2QGBA 3MRCB 4FLQA 1EFXA 2EXTA 3OBAA 2ORBH 1YQVL 4C56B 3U0WH 5BS0B 1PPIA 4BQBA 4G7QB 4KX9A 5E9AA 5HHME 2YRZA 5I6MA 4DK6A 5DJXA 4FA8A 1WGVA 2XQBH 3N04A 1YNLL 2VSDA 2CR3A 4JHAL 4W9EC 4Y9CA 1CF1A 2G9KA 5HPMB 1WAEA 2CUHA 2JKRM 2WLYA 4YXHL 2W65A 3Q5OA 3L3OC 2OA9A 3GI9L 2B1OA 5HGDB 3FCBA 4L23A 4X5QA 1E4XI 1KTLB 1OARL 1OW0C 2VR7A 4QR7A 5L6YL 1JWMB 4NQQA 3EH1A 3O2DH 2BVQA 1HXMB 3L3OA 3P3SA 5D7LA 1IGCH 2KMWA 3EFDH 4KKLD 1F42A 5I1GH 1OW0A 1BVOA 4XXCC 2W0KA 5BPPA 1U8OA 1H8NA 4OIAA 1JDCA 2X4QB 3HE6B 3VD2A 4IBUA 4C83A 5E8NB 3ZMNA 4D0DA 2R29H 3ZMRA 4TRPH 4XXCA 1R33A 5F9OL 2WUBH 1OPGH 1HOCB 1VDGA 3Q9QA 5FGRA 1KYFA 2J5LC 1I1YA 3NCMA 2JFCA 5CKGA 5BRZE 3D2UA 5I71C 4AQ1A 3KLHC 2D03H 3DVFA 2DDQH 1IL1B 4C8XA 4E42B 1WUZA 3FYIB 3M6DA 3IS1X 5KTEL 3TTYA 3U46B 1OF2A 4U1SB 2CLZA 1TMCB 1UD4A 3P4NA 3LRKA 4NOFA 4H26A 3A47A 1ZPUA 2PABA 2XT1B 2JCWA 4AL8H 5CWSA 4O4YH 2AQ3A 2F68X 3QUMB 5GS2D 1KEML 4S1RH 3MZTA 4LAJH 2GEQA 3SDCC 1S8DB 1YN7A 1Q94A 4CILA 2AEQL 3GSNA 1TUPA 3B7SA 3DUUB 3DJSA 1PG7X 5J56B 3OWRA 3KPSA 2R1WA 3TPKA 5CJXA 1VIWA 4GXVH 3SDCA 4H25B 2FE0A 3QUGA 4XO9A 3C08H 4TSBH 4HK0B 1U33A 4ZUVA 3H9SE 4U0RC 1IAII 4JR9L 1NAMA 3CHQA 2WTRA 3GSXA 3DNKA 3H7BB 4YC2C 3I3EA 2DLHA 2LGNA 2YQBA 2HCZX 3H9ZA 2WWKT 4ETYA 2OMNA 2XYBA 4BFGA 2RBLA 2O30A 3JT0A 1JTPA 3E3QE 5ES4B 1NH6A 2GJZA 3NIGF 5C0IA 2PYEE 1OVZA 2BNQE 2CHXA 5A43C 2OTWB 3AQXA 3BH9B 2E74C 1RZPA 2FX8L 1BP3B 4WO4C 2EZ0D 4L1DA 1PJ9A 3FH5A 1TTGA 3IDGA 5KANI 1UZGA 2Y9RT 3BW9A 3ZSSA 3U6RA 2JIXD 5E6ZA 3TH3T 3E7JA 4Z0BH 4ZSOA 5I1KL 1XTLA 2NCEA 1BG9A 1RJCA 4WO4A 4G8GD 3VXUB 4HCFA 2FWOA 5AUMA 4PJIE 4IJ3C 1SRDA 4N0UE 4DN4H 3IJHB 1UD3A 1SQ2N 3I84A 3HUJB 3QEQA 2NY2D 1CQYA 4AEEA 5T1DL 1UC6A 4N9OB 4TNVK 4ZZFA 7PAZA 3HS9A 3QWOB 5HDWA 3BZFB 2CD0A 2EXYD 4L8DB 4A55A 4KMQA 3G5WA 4PGEA 3DBXB 2WMPB 4NQCE 2EDDA 2W60B 4HALA 3QGVA 1N12A 2JI3A 4D3CH 3BH8B 4X6FB 3TFBA 3GLDA 4UT9A 4PBVC 2BVPA 4BSVB 3CCHA 3DSFL 1KCSL 4KDTC 3HMXH 3O4OC 2YD6A 1QX1A 3P0VH 4OAWB 3ZL4L 4NQSA 1UWEL 1WSST 3S96A 4KJYB 3RKDC 5MP6L 1G0XA 3RVXD 3KNBA 3UG3A 3O6ML 3IDIA 1GGIH 3G6JA 4KDTA 2AF2A 5FB8B 3QUMH 3B3IB 4MXWL 5E5LA 2BJML 4QRAA 5C9JB 3AT8A 2DOCA 5I0YA 1RZGA 3MN8A 3TJHD 4K3HA 5KEZA 1XGPB 1HIMH 4IMLA 3BUYA 4LO9A 2VW4A 4HCGA 3B3BA 1LDPL 1YMMD 5E94B 4YNYA 3CZUB 1BQHA 2LFGA 4G9FE 2QADD 2CDGA 4Z76A 4KQ4H 2ZSVA 1AZZC 4OLWL 3APMA 2W9EL 2DQFB 2X2JA 1BVZA 4ZX3A 2UWEB 1I1FA 5E70A 1I8LC 4K3EH 3UTTD 5BV7B 1KYOJ 3EBGA 3CE1A 2NYYC 3BAEL 3DHJA 3HZVA 3BHBA 3L95A 4HOWA 5JR1L 4LGSB 4AM0B 4Z7QB 3WTSA 5IHZB 3GBDA 2YFNA 2BNRE 1QLFA 2DQ6A 2ROYA 3GMNB 5C0CD 3MNVA 2R2EB 2XFXA 1F6AA 1W0WA 1WLHA 4MFHA 2IEPA 2ADJB 4WEMB 4ELMA 4PRHA 1E0OB 2WANA 4N8UA 5DFVD 4XHJC 1B0IA 2LV4A 3TONA 2AV1B 1JF1B 4ABUA 1E2VA 2GB2A 1RFDL 2V0AA 1HWWA 3FRPG 3QIUC 2W94A 4MJ2A 3T0ED 5AVTB 4OB5H 5A16A 2J88L 2Q86A 1JI2A 4XBMA 3KW8A 3ARSA 3MXWL 4OZHF 3MJ7A 2YC1B 1V7ML 1EEUA 3QIUA 3FRUB 5LNDA 2LLNA 2IH3A 3VXSE 4YFLI 1TTCA 3ARWA 3NBNA 2F53D 2IALA 3C9NA 5HHOE 1LEIA 3STZB 2HRHA 4U6TA 2ZXDA 2R4RL 2G30A 5D5MF 3W1ZA 1QASA 4PJCA 1DLFH 3RWIA 1NGZA 1WP6A 4Q6IB 2WTOA 1A1OB 1J8HB 4PAZA 1F00I 5F9JA 5GGVH 1NM9A 1WBZA 3DX9B 2AZUA 4WTZG 3UABA 1CGTA 2TAAA 3WKMH 3RGBA 1WZMA 1U6AL 5K9OB 1C5DA 4HF5H 5D6DA 3SD2A 1N6UA 1TTAA 2WNGA 3UZEC 3ARXA 1HOEA 3RWEB 2C9QA 1VACB 3VQMA 5JOEA 3H6AA 4L29A 1BMWA 4N9GB 3BP4A 3QAQA 4JPKL 3R7RA 4F2MB 3OR7B 4OBSA 4QRPA 5IMLB 4OCLC 2BW4A 2ID5A 3L3DB 3T0AA 3UZEA 5GRVL 4KNQA 1BV8A 3ZZLA 3ZHLA 2XNAB 4XNYL 4UNUA 4S1SH 1YMHA 3QUXA 3VXME 4Y2DD 3U6XA 2BHUA 4JKWA 5JQHC 2FYYA 4FTVA 3IMVA 1ZE3H 4YUEL 5E2UL 4OFVA 4PJAE 3S35L 1ODAA 4PJFB 3SE4A 4JPIB 3WE1A 3DETC 5J5EA 4JREB 1AZBA 5BV7H 2DWXA 2DQIL 2EKSA 4X6BB 1SDAB 4NZTL 3MA7B 2GI0A 1JFQL 3MRIA 4YXKL 5I8CA 2ZX8A 3KPRA 1I7TA 3K91A 5DMKA 2ZOUA 3TO4D 1JWSA 7CGTA 2JKWA 4BH7B 4KZEH 1IBGL 2IPKB 1ITBB 3QI9A 3N42B 3HPLB 2AI0H 1CLYL 3ET9F 2A9NL 3FBQA 3O9WC 3HC0A 1AS6A 1BVKA 1FV1A 4QF1B 4RWYH 3A6OA 3C5ZC 1KELH 5DHYA 4P06A 4LSTL 1TZHA 3PWPB 4W4OC 1GGCL 4H40A 2D2OA 3X1GA 1ROCA 2Y7SA 3N3EA 3O9WA 3PDDA 3L2MA 5G2NA 2HFTA 3C5ZA 3O6KL 3O2WH 2MOGA 4X7EC 5CEZE 5GRVK 3DJZA 1MJUL 5I1JH 2Y7NA 3BJ91 4Q4EA 3N0AA 1GGTA 3C8KB 3S48A 5KBNC 4KHTL 1A4JB 3O3UN 4XP9H 1J87A 1D6VL 5E4EC 4N2MA 4HCRL 4ZW6A 4I48B 1YJDC 5C09B 3EHBD 4IOSA 4BQ6A 5SX5H 5IUSA 3LQMA 1ZA6B 5C0RL 4PRIE 4AE1A 3O0RL 2P5EA 2XQYA 5ALCH 5DUPL 2HB0A 3QCTL 4UUJA 1PCXA 3PWLA 3KXFA 1QOKA 1ECYA 1OO2A 1EIBA 1SYVA 4Y2OA 4HZLB 3QYNA 3L3IB 3IJEB 1M6OA 4U6HB 1FGVL 1LK2A 1OOWA 2OSLB 3QAZB 1AGEB 2GPZA 2ADFH 3OAWA 4NGHL 2CLVB 4BCYA 2P48B 1Z9PA 3NJFA 1QFWH 1U9KA 3CZGA 2XN1A 2P8PA 3NZUA 4L37A 2F9BT 1NL0H 4MJ6A 5EU4B 4HOXA 5B3JF 3CC5A 2OQJA 1E4WH 2A6JA 4RNRA 3BWAA 2DQUH 1JAEA 3TBCA 4JKKA 2HRLA 1AIZA 2GIXA 4IRSD 3GMRA 3IJSB 3NCEB 4J4PC 4K2UL 4OH2A 3JZYA 1GW6A 1WBYB 4TNWF 1BVLA 5ALBH 5FV2A 3FO1A 1FBIL 1QATA 4KDVA 4EOWH 3ILQD 5DJ2A 1M2OA 1XF4B 2CUMA 1TZGH 3FHEA 4AMKH 4J4PA 4UOQA 3B9KC 4YHML 2R23B 2TSAA 4MD4B 1K2DB 5BQDA 2HN7B 3BD5A 4RAHA 3ZDXE 5GS0C 5AAPA 3CHPA 1TCRA 1RZ7L 3X1FA 4PREB 3L17A 3AABA 5HYJD 3HAEA 5FYJH 3B9KA 1GAFL 1YEFH 2NXZB 4IRZL 1GZPA 1A7RH 2VR8A 5DHEA 1B0GA 2YQ2A 1W72B 4JJOA 2UXGA 2ZAIA 1PCSA 2XA8L 5T1KD 1AZCA 1HL8A 5IVXB 1JZJA 5D2LB 3BOVA 2Z4QB 3MA9L 3FFCA 3QJRB 1EMTH 4K7PL 4E9TA 2L7UA 2VLLB 4PJDF 2A1WL 1KV3A 1KUMA 4P4KB 1URIA 3IDNA 5CGYC 1NC4A 5DJCA 4BA0A 5B1AB 5DZNA 4PJ6A 3H9HB 2PN5A 2R9HC 5AW6B 4MZ3A 4BSWB 3UGEA 4L1HA 3TPUA 3MRKA 1HWHB 4ZO7A 1A4AA 4N2HA 3BAXA 4MMXB 3UTSE 2PR4L 3C5JA 4XNQB 1X3DA 3MRQB 3PJLA 2QSTA 3K6OA 1QLEL 3W9DA 1IMHC 1FF5A 4P5TC 3KBFA 1DQLL 1S9XA 3D39D 2ED7A 3KPLB 4XN8A 1IB5A 4MS8C 4OGAC 4FAAB 1GYVA 4XC1L 3IGKA 1S7QB 3M1CA 2GJ6B 1FAIL 4HLEA 1RQ5A 4IKJA 5GGSY 5E2VL 3RAJH 1LK3H 3OF6A 1AFVL 1L7IL 4FQ1L 4P5TA 3RZCB 2KZWA 3EYQC 4IEFA 4B9IA 4MNGB 4G83A 2AGJH 2LABA 3ZE2E 5IM7A 3OKLA 4XP1L 1LMIA 2ZCKL 3WUWG 4GRWB 4S11A 3SQOL 1EHKB 4IBTA 4WGWB 1T66D 4QWWC 5E03A 3VTMA 3LXBA 1SJMA 4JKPH 4OCRL 1K3IA 4ALAC 1U3NA 3PQYD 4LZKA 1IE4A 1BZ9B 1FZOA 4YDJB 4MCYB 2V7HA 3MLVH 4A38A 4XCFH 1NDGA 2JF1A 4AQAB 5IZ7A 2Y5QA 4KI5D 1NJ9A 4EUPH 5CLWA 3ULUC 3NIFE 2DYPD 4HD5A 5DHVB 1DJSA 4WW1B 1QFUH 4PJ9C 1RP8A 1TOXA 1KC5L 5H4YA 4HJEA 3HC4L 3IETB 3L9RB 8FABA 5DZPA 2P26A 1XL6A 2YD9A 4CADA 1A6WL 1CDJA 1RUKH 3OWEA 2OXHA 1U36A 4EI5D 3N0PB 3WU1A 1FNSH 1QPXA 1D7BA 3FTWA 3MBXH 4PJ9A 1CFVL 2HLFC 4P2QA 2CDEB 1A6VL 3BRGC 2Z31D 2F7OA 1DVUA 1W72H 3CU1A 4NIYE 2EYTB 2DEXX 2GAZA 2Q76B 5EZOL 4PG2C 4HSCX 3KHQA 3RFZB 5KAQF 4XPFH 1VGKB 4RMRA 1PQZA 4LBEA 4LCUA 4K5MA 1DDHA 2F54A 4GAGH 5EOCH 5MEND 1H9VA 1HHHA 3I2CL 1KV7A 1OANA 4PG2A 5F3BB 5BOZG 1HXYB 2Y07H 1MWAH 1XL4A 2MNUA 2VR3A 5EN3A 3SBQA 3F85A 4QNPF 3MRHA 1PL3A 3SYAA 4XO3A 1KPVB 4QD2E 1D2OA 1HU8A 1B4RA 3ZKMC 3DRQB 2X4UA 2ZUYA 5AVYB 5LG1A 2OK0L 1Z5YD 4UM8B 4X2UA 5DK2B 1G7MB 1KDJA 1UZ6E 1UGKA 4NQDD 2IQAA 2VDMH 1S7TA 5ENWA 5IEKA 4TTDC 3TBVA 3HZKB 4L8SC 3Q13A 3HLKA 1FNFA 3US1A 3HS8A 4LSUL 4PJ5D 5HGBA 3K7UA 4HC1A 4YBQC 4MAYB 2D7TL 12E8H 4M7ZC 4AWJC 4K9JA 2I27N 1IC1A 3BT0A 4PMEA 2NY2B 3KPOA 3KL5A 3VQLA 4L8SA 2JMRA 1O6SA 2PWHA 4MMZB 4GRWH 1O6VA 5B38B 1YNKL 4Q9BA 1G9NC 1F11A 5D1XC 3F7PC 4Y1AE 3NSDA 2Y3NA 3FYEB 2MPAL 4LVHC 1NCBH 1FDLH 1Q9OB 1MRDH 3O6LL 2VISA 2P46B 2FSEB 4PWHA 4I85A 1MELA 5MEPB 4KMTL 5JHDA 2WYIA 4UMGA 3MV01 2EE3A 2JK5A 4TUUA 3AAZB 1FGNH 5D1XA 4TLUA 5DEJA 2WYTA 4ATWA 4M6OL 5DVMA 4HUCA 3DMMA 1LO0L 2CNYA 2ITEA 1RLBA 5DHVH 5CCHE 4K5OA 3MAWA 1HE7A 1OWWA 3DRTA 4QXUL 4I13B 3Q9PA 2WO3B 1QWNA 4PRBA 3LEYH 2EE0A 1YPZF 4BZ1H 1Q72H 5IB3B 3LKQA 3C6SA 1AY1H 1F56A 3FO0L 2H9GB 2VQ4A 1BVNP 3HE7D 2VRAA 4WI8A 3VI3B 5CSGA 4X4ZA 3P11H 4GSRA 2J71A 2QGDA 4Z1PA 2WQAA 2CCWA 4FHBD 3CSYB 4HA1A 1YMMB 3S34L 4D2NA 3R18A 4JDZB 2QADB 2BZDA 3ROLB 5HJBA 3ZE0B 5C71A 4PJBF 3HMWH 4HSAC 3WO4B 2EH7H 3X1BA 4BA8A 3CBKB 4ZFGH 5I17B 3IBOA 5FA3B 3UTTB 5I1LB 1MXGA 1KCUH 2Y7LA 1JYXA 4NN7C 3FN0L 2A6DB 2P5WB 4HHWA 4M48H 4UT6A 3RWCB 4I9XA 5E6YA 1N6QH 5IMKB 2RR3A 4JM4H 1E50A 3WIHH 3Q5TA 4D9LH 4OD2A 2JQAA 4GSDH 5J12C 2FZ3A 2YPVA 1AYRA 1KY6A 3O3DA 3OKNB 1YUHA 3KYMB 4L4VA 4FNQA 4QO1B 3SDDC 2ENSA 3T0EB 4F57L 2V2WB 5F7KC 2R0ZL 3PGCA 4NJAL 5ACZA 2PCFA 2XACC 4ODXA 1IM3A 4HIIB 1J1XL 4TV3A 5DI8B 4RFEB 5EORL 2MOQA 2JJSC 2KZKA 1BIHA 2YUVA 3E1F1 2X2UA 3GO1L 1JG9A 3B4NA 3EH4B 3GD1C 5EBWB 3VMNA 4I0PA 3F65A 1CTNA 1IILE 3T08A 1TJIL 3KGTA 4CMHB 1E28A 2C7UA 1B2WH 2OTUB 3OLGA 1I8MA 1PZBA 1D7FA 2OMXB 1EO8L 1KJ2A 2JJSA 1IGYA 1MCEA 3NFPA 5DUMH 2K0RA 3T4YB 2Q9OA 3I2CH 2P49B 2IDTA 8PAZA 4RDBA 5CZVL 2CHWA 2XZCL 4HBQA 4K94C 2EINB 5AZ2L 3UGUA 2E9JA 4JY6B 3OXRB 4WLCA 1P2CA 5EU7C 4GIOA 5IBUB 2AAAA 3CD4A 3JV0A 1KXVC 5K39B 5J6SA 3GMOB 3OB0H 4HS8L 5LQBH 3U4EB 1ZTXL 1M7DA 3UYOD 3N43B 2UV3A 1KXVA 5KYUB 4KRPD 2G75A 1PZSA 3VD3A 1OTUC 2D0HA 1NCTA 4JDVB 5G5DB 3KAAA 3V6OE 1IC4H 3JUYA 1CGWA 4JRXE 3QH3A 4OT1L 4Y2DB 3QNXB 3HZMA 4HWEH 3V7MA 1XGYL 2WIIB 3MUGA 4ZMQA 2Y2TA 2V9RA 1ID2A 4L1LA 1OP3K 4PD4K 3BWUC 5TH2B 1E9PB 1A3RH 3QFJA 1T21A 2AXFB 5AB9A 1E3FA 3CVHH 2QPUA 4FC3E 5E4OA 3RA7L 1TNMA 3B9DA 1J0ZA 3L3GA 1LHZA 4QT5B 3QJQB 4CJ0A 5FF6A 2XXMB 2Q1EA 4BFFA 2DTMH 1JZGA 5C08D 1MI5A 4L4TB 4IS6A 2L4OA 5ICXB 3UAJC 1F4AA 2VDQB 3HIZA 4DESA 3MJ8A 1C1EL 4XZUB 2KPNA 4P8QA 1NC2A 5MEOB 4XVTL 4G6ML 3AY4C 5GHWL 5FOBB 1ZANL 4TVPD 4TUJA 3BIKA 5F8RC 3SQRA 1ND0A 1JD7A 4MDJB 3UAJA 5FO9A 4PEEA 4Y4KD 1LO3L 3HNTL 4WFHE 3ZT7A 3B2DC 3VRJB 1L9OA 4FQCH 2VSKB 3LRSA 1FRGH 4ZUWB 5SWZE 4XXWC 2XPGA 1YEDB 3AY4A 3F7KA 1L7TL 1JPSH 2YWZA 4X80L 1DL7L 4IW4C 5C0JB 3L08A 1KGCE 4J8QA 3MUY1 3CFTA 5DYOA 4BFOA 1WIUA 2YXMA 4QGTA 4KHXH 1RK1B 3D3VD 4XXWA 2Z35A 3QNZB 3U9UB 3H2PA 4CC0A 1JERA 3EJUA 3N06B 4R7LA 4UI2A 4POUB 2VIRA 4WUKL 1A5FL 5EU6B 5D7JD 2WZPA 43C9B 1FG2A 3C8HA 1BZ7B 4R90L 5K69A 1QAWA 2VQTA 1RU9L 1TNNA 3D8MA 1MLCA 1RUPL 2ZKYA 3ILPB 4W6YB 3EHBB 4PJXA 4F15C 3CBJB 1P0SE 4HW6A 1IGTA 3L16A 4U1HB 3RWFA 1YAZA 2EDQA 5IV2A 1UT9A 3FHAA 1O5PA 1WC7A 2FWLB 3DX4A 1MFNA 3NP3A 4HIJB 1C8QA 4ZOAA 5DTFB 3BP7A 3FS9A 5FECB 3QIWD 4XE0A 5AW9B 2W59A 4KTEH 2NY3C 5IW3A 1I7ZA 3TBWB 2SODB 3B83A 4S0HA 2QVFB 1AQDA 2XZQL 3K5SA 1Z9SA 5D1QB 3ULVF 2IAND 2XN9D 5DJDB 2YUZA 2VL5A 3UGXA 5KZCD 4LVOB 3SE6A 2H26B 4C56E 1GJUA 1LEGA 4A7SA 4BKLA 5M7QA 5BS0E 2WC7A 2IV8A 5D96B 4OCNC 2NX5D 1SXSA 4G82A 1S7RA 4MQXC 1EERB 4ILDA 2AJYL 5CGMA 4NC0B 2FEEI 4ODBD 4IRSB 2L04A 3QJTB 4J3TA 4K8RD 1CTOA 3DV6A 5C8JA 1SVCP 4UTBA 4M3HA 1R5IB 4DH2A 4OIIL 1GPOL 4XOAA 4U2ZA 5DK3A 3L2NA 1E4HA 1WFIA 4FFYH 4TQHA 2I07B 1HHJB 5HYFA 1QABA 3BZ4A 4NKDA 4N5ED 3VE0B 1AP2A 2P80D 3HCVB 5IF0A 5L9DL 1T6BX 4B3VA 2X4RB 4NRZA 4MYPA 4JZOA 1D9KC 4QYOA 1WZ1L 2VDQH 4WHTB 1WEJL 4O00A 4PJHB 1CWVA 3LKOA 4EUPG 3F7VA 3LXAA 2Y5TA 4DKAA 3V4PA 4U1GC 1MFBH 4NQXB 5HHXH 2GJJA 5HVWA 3L4VA 3T2NH 3QP3A 3GUTA 1HVXA 2WCPA 1KJMA 1TT6A 1D9KA 1VHPA 3T0DA 1P5UA 4ZMYA 5T1KB 2W07B 5B8CB 1IQWH 1Z1WA 2XWDA 2H8PB 3HG0A 5E9DD 2VXUL 1QBLL 4YH6A 2BFVH 1ZVSB 2XWTA 1SHXA 3QE5A 1ZHLA 2BOLA 3TA3D 5DFAA 4LCIH 5JNYB 5B3NA 1OE1A 2C3GA 2CRIA 1Q38A 5GRJL 1JPST 4IOFC 3ULSB 4LF3B 4HKBA 4UV7H 2DH3A 4Z7OB 1SMDA 1NGYA 1U8HB 3KPNA 4GP5B 4LESA 1A6UH 4M6NL 5DQDH 3K5RA 1RZJH 1BQLH 2H4EA 3BUIA 4GINA 4JRFA 5BO1H 3HHMA 2RTTA 3VA2C 3S8FB 3G3LA 1KLGB 4J3OD 3MLWL 1A4CA 2BIHA 1DJHA 4RRPM 1FYTD 4JY5L 3CN3A 3D39B 1LP9A 5B1JC 4MA1C 1NUNB 1M9SA 1KB5A 2XG4A 1YEEH 4MB3A 4R4ND 4DKTA 5HYSB 1CMOA 4QKTA 1J5IA 1TVDA 2ZD0A 4F93B 1AXSA 2W88A 5DD0H 4ZTEA 5B1JA 2BS71 3RTQC 1DQQB 3MYJB 1PKQB 4IU2A 1CU4H 4L0ZA 3BT2L 1XMWA 3QUZC 4PW9A 5GSVB 3MJ6A 1J1PL 4OJAA 1F90H 5CLXA 1A4KB 4OTXH 3KLQA 2HX9A 3RTQA 4PY7B 4FL4C 1X5KA 3QUZA 4J39A 3M1BB 4OD3H 3FQYA 2O6DA 4W9FC 1G7HB 4YIQA 3WHE0 5EBMB 1GGBH 3GBLA 4YXLH 3VXUE 2PP7A 3MRRA 3SDAD 1JGDA 2ZKWA 3HUJE 3AACA 4F7CB 4AUUA 3IM1A 5DFWH 2WXIA 1SXZA 5DS8B 2O26U 3OHXA 4PGDB 3IE4A 2OSYA 2JQMA 2Z31B 3PL6D 1MXDA 5E8PA 3FHQA 4ZZKA 5LGJB 4ZFOA 4HUXA 4KK5C 2YD5A 4HWBA 4PB9L 3BQUD 3KBHE 4F8QA 3AXHA 3O4LB 4UNIA 2AVGA 4HAGA 4XX5A 4K9EC 3WSQL 5HXMA 1E4JA 4DUVA 3IU4L 1PLBA 3FMGH 3TU6A 1HQRB 4DQOH 3L2LA 3ZZSA 3NCYS 1JNNH 3RX9A 5TFSL 1V8HA 2WLZA 4CN6A 3U83A 3CIAA 4JN2A 1F6LL 4TNVF 1INDL 3WFHA 3EJCA 2ISDA 3D69B 1KTRL 4LLUA 4RFOH 2OR9L 2DQTL 1VFMA 2E9IA 2NZ1A 4P5MA 4NQDB 1KPUB 4HV8B 2XICA 4JFDA 2X1WL 3WTTA 1ACYH 3U1SL 4U6VL 3OB8A 1S3KL 4JDTH 3RJDA 4AYDC 4K5LA 1CFTA 1D7DA 4BINA 4PWIA 1CGVA 1W91A 3KYKL 1N0XL 3MV8B 3ISYA 3L9EA 1CICC 4YHLL 3GI8H 5TE6L 3UPRA 3X11A 2D73A 3S3DB 4I1RA 4C47A 2NTFB 4Z7QE 1GXEA 4ZODA 1NIDA 3ARGC 2BIMA 1CICA 3S88H 5BJTA 2APBA 1Y7VA 1RL1A 2E46A 5J06A 1JXJA 3MRMA 1MCSA 1IIIA 3BP5A 5IB1A 5KVDL 4Q2ZB 2DQCL 4D9QD 4U33A 2K9UA 3ZK0A 3QFDB 5B38G 3LMJL 4BD4A 5IESH 4M7LL 4GH7B 1NCDH 3TF4A 5AVUB 5KUMA 3AITA 3QDMB 2OMVB 3ZPDA 5B7EA 2VCOA 1U41A 2GG1A 2CBOA 5J3HD 4LL9A 5BZXA 1WZAA 1SMAA 4HS3B 1W9XA 2QJDA 2YK1H 5ESVA 4XVJL 4JFZL 1FLRH 4P04A 4WY7L 1NFDF 2B5IB 3GM8A 3JYBA 4YHOL 3ME0A 1QBBA 2ZTBA 5JPNC 5FO2A 4A6YA 2DL9A 1RVFH 3BIBX 4N8VG 3DOSA 3TTSA 1QEWA 3D18A 2N0MA 3E2HB 3CZJA 2DJMA 4DKFH 1K72A 4PBWD 4WI3A 5EG6C 2A4ZA 4EPSA 1J8HE 3W5NA 4LPVA 2ZX9A 1G4MA 1FVCA 5JPNA 3HR5A 4BZYA 4OZFB 1LDSA 4NWUH 1CJYA 1IBFA 1QHOA 5HHQB 4LKXA 4BK5C 4QPEA 1JZ2A 1YECL 2WXJA 2B16A 3B9AA 4F7TA 3O3EB 5L7XH 4UQ9A 3WO3B 4JFPB 5KBPA 2F1BA 4G71B 1N9PA 3WKPA 4ADGA 2GK0B 4A7TA 4BK5A 4F2ME 1T7XA 3SPJA 2XVLA 5I66B 4G43B 3WOVA 3JWNC 3QDJD 1XVSA 2XA3A 5GISL 2HVJA 3D30A 1QSFD 2NNAB 2TRYA 2ZYSA 2B77A 4CAGA 1ZWIB 1ICTA 4JY4A 4G8AC 3VSUA 3OKDB 1SFHA 5C0BD 4PJFE 1EXGA 2ZWSA 1M7XA 4LOUD 1JBJA 1MIEH 5I1EL 5LWYH 2XWZA 2VITA 1FQ9C 2YSSA 3DX6B 2WJ7A 1QI4A 3EJZC 1UATA 2BVUA 4HJ0C 1XX9C 4GBXB 2R0WH 1SFDA 4JAMA 3NCBB 2WM0A 3NEEA 4M56A 1BOGB 4HUUA 3SD5A 5GZOC 4PRHD 3Q0HA 2F8OA 4PRNB 3MLYH 5FYJE 3VGAB 3P1VA 5J57B 1MG3C 3Q2WA 4ZTOH 1VEOA 2A9MH 4N6RB 3F7QA 5DRWB 2FB4H 1J5OL 4L0PB 4CW1A 3C5SA 3LNGA 5CJ5A 1JGEB 4Z95L 5IVOA 3PWPE 5GZOA 2IC2A 1NUDA 3KYNB 1BREA 5I16B 2YAPA 2AK4D 2IGTA 4KNSA 2HWZH 4Y1TA 4Y9FA 5D71L 5J9PB 3W39B 4GB9A 4MQ7B 5ETUA 2E6PA 1W8EA 4JS7A 3JTSA 4BBWA 4G7RB 4KRPB 3WHXA 1SQMA 3O3AB 5IBUG 1Q9KB 1UB6A 3JWDC 5FCUH 3S35X 4IKIA 1D5XB 4MJ5B 4JM2C 5C09E 4H0IA 5FYKD 5IBTL 3P0YL 3WIAA 5BXFA 4PYGA 3PDOB 3N44F 3VFNA 3PABB 1VKXB 4JE0A 3Q8CA 4CNIB 2IAMC 4NO5A 1FL6A 4OZFH 4OW6A 5IEHB 1OCRB 2JKNA 1WGOA 3LJ3A 1YHPA 5DK0A 4WJG3 3OD3A 1F1DA 2FH6A 3ML9A 1IKNC 4PS4H 4Z7VF 2VR5A 2IAMA 1GS8A 3X3FH 2UY6B 4WU7B 4PCSA 1BEXA 1HE8A 1Z9MA 3BC9A 2R2HB 3DV4A 2HKFL 2ZOLB 3QUXD 2NY1D 4JHWL 4UAOB 3BVDB 4BZ2H 4DFHA 3KLDA 5DJ8A 2OL3L 2NSQA 4OZHA 5EZPA 2J4WH 4Y4KB 1S7VB 3PV6B 1ORQB 2P24A 4LDOB 5TK4A 5IB4A 4F5CE 3MOBL 5BZDA 1PZ5B 2OYMA 4LCYB 4QRRD 2WINA 3QNFA 5ESQB 4JEGB 3F83A 3FQTA 2O6EA 3T2QA 5D5MA 2D7OA 2VXQL 3S3SA 3WIIH 4LDEB 1CL7I 1N8ZA 2NY7L 3QI9D 3LRGA 3FCTA 3UYPB 3QARA 1WYJA 3N5AA 4JFHE 1PZUB 3WJJC 1ECZA 2HH0H 5I0DA 2NMSA 1SHMA 3MRDA 1TQWA 4G7YH 2J2ZA 2JKLA 2WVVA 5J6GB 5I18H 3WL9B 3ZKXC 2P52A 4LLYB 1RIHH 4R96B 2Y4SA 1FZKA 1Y6MR 4TUKH 3WJJA 3E80A 1LYQA 3K46A 3PYCA 2FT7A 1IEAA 1UVQA 4X4YB 3ZT5A 3EYVA 4H0HB 5IVXE 1OSYA 3EDJA 1F4XH 5D2LE 4WF7A 5GGRY 4NRYA 3FU7A 3JWOL 2OMWA 4MHHI 2VDKB 4KKCC 1UCBL 1IFHH 1JK9A 2QGCA 4LSQL 1BBJA 2XN9B 3HG1A 3R06A 4IBSA 3EOAB 4QRQA 4X5RA 3WJMB 3DROA 3D25B 1S7XB 5IBLC 5KZCB 1BIIB 1SBSH 2I5YH 2RFXA 3Q1EA 4Y2LA 4YE4L 1C08A 4IOSD 4EXPX 3SY6A 3PGFH 3V55A 1L0QA 2HFFA 3NAAL 2NX5B 5L2JA 2DJSA 3QG6B 4QRBA 2OYKA 2N01B 4ZMVA 2X0WA 4KQ3H 5KYWA 4N0YH 4B53A 2W1NA 2W9LA 2OP4H 1TQBC 2OSXA 5AW2B 2CIIA 3C6EA 2VDPB 4KZDH 2PKDA 2LQRA 1AE6L 1LL1A 3VDBA 1BFVH 1GSMA 4AT6A 2CJUH 1WPCA 2GJ6E 3WTXA 4N8CH 3GZOA 3QQ4A 5EC2A 3BAWA 1X5AA 1BFOA 4XP5H 4YR6B 2WVUA 4O5LL 4RCAA 5C0NC 2AMGA 5B7MA 4BZ1A 4A2HA 4PJ7F 1IE5A 5IW1A 4MNGE 4G9DB 2JJUA 5JHLH 3H1ZA 1E9QA 4XNBA 5FGCB 1HNYA 2A77H 4GRWE 5KW9H 5LNEA 4J3BA 1EH9A 4UIKH 5AYUH 4ZPVA 3GTVA 3WMQA 1HL5A 3GRGA 4JRYA 3MREA 2ZPKH 4K7PX 3EBHA 1IO4C 2UZPA 3RWHA 5MHSE 2BVOB 5E9DB 5IGXH 2K9FB 4M7LT 4IDJL 5DQ9B 2BY1A 3CH1A 1YY8B 3UJTL 1JYWA 4NZRL 1IAKA 4M3KB 3VYOA 3I6GA 5HJGA 1BSIA 1HCYA 2P45B 3E6FA 3SGKC 1G6RA 1JGIA 2FLBT 5I74B 4GSXA 1P4IH 2ADIB 3ZO9A 1U8LA 2WWMC 2EYRA 4RAVB 3MKGA 1E2ZA 5EU3A 1AZUA 5I75C 2EYSB 1EGJH 1JF6A 1MCOH 2WNWA 1BLNA 3EGXA 2COVD 2XVBA 3JTTA 4FLRA 4KJWD 4XPGL 1YUKB 4F7MB 3SGKA 1R3HA 2J1YA 2MIZA 1X5MA 4FMKA 3P0GB 4LLDA 2VOTA 3UCQA 4JQVC 4BE5A 5C0EA 4WQOA 3B7UX 4JFYB 4YSDA 4ICWA 4Y9EA 4ACTA 5I1HH 1NCAL 1U8NB 1GZQB 4XI5C 4G42B 2BRRL 2R8SL 3AU0A 2A6IA 4YK4C 5AOKA 4NPKA 4CA4A 5C9KA 4M4RB 4GJTB 1UM5H 1FE8H 1SLWA 2KBGA 1U21A 4DW2H 1DQDH 3IWVA 3WFZA 4DKDC 3WDJA 1PEZA 4OKDA 3SJVD 2E7HA 1EFXB 3P3TA 2VQUA 2VDKH 1ZRUA 5DO2C 4V1DA 1JGLL 3EJYD 2K7QA 5GGTL 5DZLA 5BVJA 4DWHA 4GXFA 4Y5VC 3SDXF 3VGEA 2DMBA 1ZHNA 3RVUD 4ZX5A 4PHZA 5EO9A 2GUOA 2W65B 4OF8A 4Y5VA 5DR5L 5FA4A 3TCTA 1EHLL 3JTBA 3LKRA 5KVEL 5JUEH 1MH5A 2WYZA 4PCTA 2APTA 2VDPH 3FUHA 1OTTC 3MODH 2BVQB 3T65B 5I8KH 1LE5A 3BMWA 2FIKA 5D7LB 4AG4H 3F7YB 1G7JB 3CZFA 4H8WC 2FGWL 2X2HA 3HI1B 4F33A 1I9JL 1U8OB 4YEEA 5IHUH 1Q1JH 4P48A 3FU9A 3SDAB 4X6CB 3BD4A 5E5MA 2YRPA 3RYMA 4C83B 1WA2X 2F7QA 2VL4A 4FI8A 2J1XA 1BCIA 3IE9A 4W9ZA 2P1YA 3ATBA 3B7RL 3P9WB 4XMK