2BWIA

Atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 86
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA02
2YAOA 1WA2X 1PNDA 2YAQA 4F2EA 2RACA 2YAEA 4A68A 2PPAA 5I6KA 2PP8A 1BYOA 2EILB 4BWUA 1GSKA 1OCZB 1CYXA 1HFUA 3FSVA 2FQGA 5TK2A 5ANHA 1M9WA 1NIDA 2CAKA 2IDSA 3FQ1A 3NSCA 3IBOA 4E9RA 3FS9A 3ZX1A 3NJFA 1SHWA 2I7OA 1BQ5A 3QQXA 2WO2B 2Y1AA 1J9QA 3FYEB 2FQEA 5B1AB 1W6WA 4KO5A 1FWXA 1OF0A 3NT0A 4KNSA 4JHVA 1TU2A 4GP5B 3ERXA 3S3DB 3EH4B 4DP7X 6PAZA 2XV0A 2IH8A 3WKQA 1V10A 3WG7B 3UADA 1IBYA 2J55A 4G71B 1PMYA 1ZDSA 1TEFA 2AVFA 4A2DA 1SHXA 1OCOB 2YAHA 1A8ZA 2BHFA 2IDTA 3NSDA 1X9RA 4NB7A 3GYRA 1CYWA 3NJNA 1ZV2A 2BWIA 5LDUA 4YL4A 3S8FB 1MZZA 3G5WA 1W6LA 1BQKA 1WS7A 2BW5A 3PXLA 1JZEA 1AG6A 1BAWA 3ZIYA 1WS8A 3S3CB 2EIKB 1L9RA 1J9TA 3DKHA 1NIBA 2HX7A 2TSBA 1NIAA 1JXDA 2FJSA 3MBWB 2BP8B 4G7SB 5I5IA 3RYMA 1NIEA 1L9SA 1XB6A 1SFDA 4HCGA 1QNIA 1ET7A 1PLBA 1A3ZA 1KYAA 4GP4B 1KV7A 2NRDA 2X87A 2XUWA 1GYCA 2GI0A 4KOCA 1JERA 1XB8A 4BDVB 3AG2B 2GC4C 1GY1A 1XMEB 2PPFA 3CZUB 2IDUA 3HB3B 4W9ZA 4DPBX 4E9YA 1RCYA 4YSRA 1BXAA 5I5MA 1WA1X 1A4AA 1IKOP 4GXFA 3DIVA 3S8GB 2UX6A 1X9UA 1NINA 4CSZA 3UABA 5B7MA 1PZCA 2MTAA 1SFHA 1BXUA 3TBBA 3UAAA 3IEAA 3QJTB 4E9WA 2IWFA 1AANA 3N2JA 4DPAX 4KNUA 2UXTA 2W8CA 2YXVA 2GHZA 5D4IA 5B1BB 1SF5A 5I6LA 1KDIA 1OCRB 3S3BB 2B3IA 2IDFA 1PNCA 1SDDB 2CUAA 2JXMA 1AR1B 2JKWA 2BP0A 2YARA 4Q89A 2XV2A 2XXGA 2B08A 1AZNA 2HLEB 2PCFA 1BQRA 1QHQA 4AKQA 4M4RB 1CC3A 1KCBA 4L0PB 3T71A 3AW5A 3C75A 1A4BA 2VMJA 1RZPA 1EZLA 1JZGA 1HAUA 1GY2A 2ZOOA 1N68A 1GS7A 4AKPA 4K9JA 1SDDA 1ASOA 1L9QA 5I28A 2FQFA 1VLXA 4GYBA 4EF3A 3CVBA 1AG0A 1QLEB 3X2QB 1ZPUA 7PAZA 2OJ1A 3FQYA 3PLYA 3NSFA 3QJQB 5IY5B 1JZHA 2BO0A 2GBAA 4DP2X 1J9RA 3FSWA 4A2HA 1NDTA 1ET5A 2CBPA 1ASPA 2IWKA 2AANA 3IN0A 1IUZA 3FU7A 2J5WA 4AX3A 4DP8X 1BXVA 1ET8A 3CDZB 3QJSB 1AZUA 2J57A 4HHWA 2R7EA 4JHUA 3FT0A 4PAZA 1TKWA 1JZJA 3AG1B 1NPJA 4YSCA 2FT6A 2HX8A 1RZQA 3GDCA 1PCSA 2FT8A 5AKRA 4FA7B 2GB2A 1W8EA 4ZK8A 3CVDA 2IWEA 3PAUA 4RH4A 3T6WA 3EF4A 2FWLB 1OCCB 3FU9A 4DP5X 9PCYA 2QPDB 3ASNB 4WKXA 3BVDB 4YVNA 1E5YA 3ASOB 7PCYA 5I5JA 2YXWA 1M56B 1KDJA 2DYSB 1SJMA 2XYBA 2XX1A 2GIMA 4MFHA 3JTBA 4G7RB 1PZBA 4CSPA 2FQDA 2BZCA 1IC0A 1KBVA 4BWTA 6PCYA 2PLTA 1DYZA 2YAMA 1OOWA 4PCYA 3OMNB 3WNIA 2QPEB 2R7EB 3TU6A 4AI7A 2HRHA 1R1CA 2VM4A 1JVOA 5I6PA 4BDVA 4DP1X 2YQBA 2QDVA 4E9VA 1NICA 1J9SA 2UXFA 1AZBA 4JKNA 1AS7A 4WTQA 2H3XC 1OE1A 4G7QB 2DWSA 3SBPA 3PAZA 3X1EA 1PAZA 2JFCA 3AG4B 1UATA 1OE3A 3NJKA 1AAJA 2BWDA 1IBZA 1AACA 4UF7C 4UAHA 2H5UA 1GW0A 2TSAA 3FQ2A 3H4FA 2CCWA 1AIZA 1FFTB 3GXUB 4N8UA 1TEGA 2VM3A 3V9CA 5PAZA 2ZXWB 3WKPA 2Y69B 3CVCA 2DYRB 2LLNA 5B1JA 4YSEA 1J5DA 2PPEA 2X88A 4BXSV 3L45A 3X1NA 4UANA 3NYKA 3OMAB 4KO7A 3NJJA 8PAZA 1OV8A 3SBQA 2DWTA 3IN2A 1YLBB 4YSDA 4A67A 4N4YB 3T9WA 2XXFA 3SQRA 3ABLB 1L9PA 2UXVA 3X1FA 2BZ7A 1NTDA 4F7KA 3NJGA 4YSSA 3EHBB 5AFAA 1KGYE 1URIA 4G70B 3FU8A 3NP4A 1ZIAA 3QPKA 1WAEA 1A65A 1MG2C 1V54B 3T6XA 3WIAA 2OCCB 3FPXA 4A2FA 1NPNA 2WO3B 2DY2A 2DV6A 3FSZA 5AZUA 1ADWA 3HEIB 2CALA 3QJRB 4W1TA 4BWWA 2GSMB 2I85A 2XLLA 1MG3C 2FNWA 4QKTA 2QDWA 1V55B 2HZHA 2Q5BA 4HCIA 4P5RA 1HAWA 1T5KA 4YVUA 3NJHA 2IDQA 1E30A 4HIPA 2EIMB 4E9TA 3UAEA 4YSUA 5B1JC 1ILUA 4HCFA 1NWPA 2AZAA 1ASQA 2AFNA 1AS8A 2EINB 2P80A 1BEXA 4E9QA 1OE2A 1XB3A 3PCYA 1MZYA 3QJUB 2PP9A 4QLWA 1AZCA 1JVLA 4YSOA 1M57B 1AS6A 1GR7A 2ZWNA 5B1KA 3NJLA 1ILSA 4A66A 3UGEA 1CURA 2H47C 1RKRA 4KOBA 2BP0B 1PF3A 2UXGA 2VN3A 3ZBMA 1NWOA 3PAVA 2VW4A 4G72B 1JXFA 1NIFA 3KW7A 4NAJA 3TA4D 2VW6A 3WI9A 2PPDA 3ABKB 2I7SA 2AZUA 1ZDQA 2XWZA 1JZIA 4HAKA 4YSPA 1ZIBA 2BP8A 3PPSA 4AKOA 1J5CA 3FPYA 2VSMB 1GS6X 3TBCA 4P5SA 4A2EA 3T6ZA 2W88A 3ABGA 4GP8B 5PCYA 5A7EA 1WA0X 2Q9OA 1A4CA 1E65A 2XV3A 3AZUA 3TASA 3N55A 1AOZA 4KO6A 2PP7A 1GS8A 3EH5B 4M3HA 5D4HA 3ZDWA 5E9NA 1CUOA 2MRYA 4AZUA 4HHGA 3CDZA 4HALA 4YSTA 3ABMB 2J56A 1E5ZA 4GY4A 4HZ1A 1AQ8A 3NJIA 5EHFA 5I6OA 5I26A 2HX9A 4Q8BA 2PCYA 1SNRA 3JT2A 3V9EA 3NP3A 1F56A 4X4KA 2BW4A 1JOIA 5D4JA 2ZONA 3U25A 1L9TA 1AZRA 3T6VA 1ETJA 3SBRA 1JZFA 2HXAA 2WSDA 4DP0X 5I6MA 5FC9A 1KCWA 4YSQA 2A3TA 4DPCX 1L9OA 2EIJB 1NZRA 4FAAB 3NSYA 5F7AA 5I6NA 4DP4X 5B7EA 2UX7A 4NERA 4KO9A 3OQRA 1PY0A 1BYPA 4E9XA 2XVBA 2E86A 1SF3A 1E67A 2CJ3A 3KW8A 3EH3B 1FA4A 5B3SB 3OD3A 1I53A 1PLAA 3H4HA 2HRGA 4YSAA 2VSKB 3H56A 3D12B 3AG3B 4TXVB 1DZ0A 1ID2A 4DP9X 2FTAA 1MDAA 3BQVA 4BXVA 1PLCA 4E9SA 2IAAC 2XX0A 3FYIB 3X1BA 2YAPA 3NJMA 1B3IA 3IE9A 3FU7B 3UACA 4BK5C 4DP6X 2FT7A 4ENZA 4F2FA 1PZAA 2YAFA 1EHKB 5F7BA 5TK4A 2XU9A 3X1GA 2OV0A 5B7FA 4KNTA 1JXGA 3FSAA 1KBWA 2P80D 3AY2A 2N0MA 2VW7A 3OM3B 3QJVB 3MX0B 3WNJA 3OMIB 4A2GA 3CG8A 2PPCA 2QT6A 2GC7C 2IH9A 3DTUB 1N70A
chains in the Genus database with same CATH superfamily
2YAOA 1NKGA 3C9NB 5F7HA 1WGVA 2VDMB 4DAGH 4BWUA 5I71C 3KPPB 1NUNB 1K9TA 4KKRA 3AB0B 3SGKC 1O75A 4P2OC 5DSCA 1PFCA 5BZDB 3CN3A 4N85A 1AY1L 2XFXB 1PL3A 1Q1PA 5B8CA 4OI7A 2AK1H 3NJFA 1IL1B 5B8CB 1ZA6B 2VOTA 5I76A 3QQXA 5B22A 4L5FH 4HUXA 3RWFB 3UO1L 1UD5A 4RVBA 5KVEE 1FWXA 1G4RA 1T0NB 3O2VL 3WO4C 5C3IA 2WIIB 5AVQB 3KYNA 1HKLL 4QRRB 2WINB 2CRIA 2FDBP 4PJEF 5I17A 1KJ2A 4JO1L 4OGYL 3NZHL 1KZQA 4XPAL 3UADA 4HSQA 3A6CL 3PDDA 2ZXQA 4L4TE 3HRZC 2FEEL 3UERA 4OFVA 3VXME 3G5ZA 4BFJA 5CFHA 2OMWA 3NQIA 4FEMA 2BJML 2NXYD 4HIHB 4Z7NE 4LSQH 1L7IL 2F1BA 4IBVA 1ZSHA 3VH8A 2XVLA 2BSSB 3ES6B 3ROLA 4DFIA 3CFTA 4YMPA 4L9DA 1TQSA 3VMPA 5EPMB 4OF3A 1AGFB 3U0PA 4IDLA 1YRKA 3V4PL 1JK9A 3ZKMD 4ZW3A 4MDIB 4NNYB 3AJ7A 2XYCA 5KS9E 1SHMA 5DD1L 3GD1C 5F89B 3D39E 3ECVA 5IQMA 4K3HA 2XKNB 3VFWB 3B4NA 4HOZA 3L8QA 3BAJA 1F41A 5CEZE 1YDPA 4H13C 3P4NA 3DSFH 2BIOA 3HB3D 5ITFA 2OZ4H 4HFUL 4F8NA 2GQHA 4BFIA 2CA3A 1LE9B 1JXDA 3MMEB 4YJZL 4Q7DA 3QIBA 5GSRB 5FDYA 4LAQL 2D03H 1Z9NA 3RYMA 2VDLB 3Q2LA 1Q94B 4QRQB 4ZMNA 3EYOA 1XF2A 4E41E 5IB3B 1KJ2L 2EQDA 1YECL 4PI0A 2XUWA 1IM3D 2BSEA 4Q4IA 3NDZE 1TVBB 4WFFD 5CINL 1QRKA 3CBKB 1O7VA 4JFHE 3STZB 5KUKA 3GSRA 4CGTA 4NQVB 4AIZB 1AHWA 1D5ZA 5D1ZD 2ENPA 5H4ZA 2MTPA 3JWDL 2NYZA 2X4TB 3BPLB 3QUGA 5I24A 2KKQA 4E9YA 1S78C 4NQSB 2Z8VC 4MAYB 4Y4FC 4XPGH 5I16B 1J1OH 3TT1L 4FI6A 1CIUA 5H2BA 4IBTA 3BT2L 3OPUA 1BVOA 1D7DA 3RILA 4NN6B 4B9IA 4NM8L 5KS9F 2R0ZH 4XBMA 3GSUA 4C83B 4LRNH 4TF4A 2AQRA 4U6YA 1Z5LA 3TBBA 1UB6A 3HJ0A 3RWEB 1LHZA 1UM5H 3GUTB 5DYOB 1T1ZA 1B90A 5DUBA 4XBEH 4J4PC 4OR1A 1AKJD 2GABA 3ALPA 3WJJC 3INOA 4QRQA 1WFNA 4BZ1L 5G4NA 3SDCD 2DL2A 1A7PH 2B3IA 4RIRA 2QGBA 2DQEL 5DO8A 3U30C 3TEZA 2ICWA 2QKIC 4QDGA 5I1CL 4MCYB 1AMYA 1J1XL 3WUWB 2K4AA 3MGTA 1INEL 1XIWC 3FQUA 3PWNB 4WI3A 4YC2B 4AYBA 5GGUB 1Z9SA 3EG9B 2ESVE 3M6DA 4U6TA 1AZNA 3V6OC 3Q6GL 1BQRA 5ICZB 1OOAA 1RZ8A 1WZ1L 1D6VH 4YDNA 1C08B 2A77H 5CILH 5DUMH 5E5UB 4M48H 3QISA 5DJDB 4WI7A 1JGUL 3H53A 3Q8FA 3EF7A 1G7MB 3F64A 3H0TA 1JZGA 3QUYC 4BQCA 3JVGA 5HHMD 3TN0B 4PGJA 5BNXD 4MHHG 3DVNA 4F9LC 1QWNA 4EF3A 1CLOL 3MRHA 4K94L 2OJ1A 2OM5A 4JFHD 4R83A 2C3VA 4N6RB 2GBAA 2P45B 1UA6L 2UZXB 4LEXL 4PJ9B 4W6XB 4A2HA 4KH2A 2K45A 2CBPA 5I1DB 2R0WH 3LD8C 1MFCL 4H7VA 4Z7VE 1JYWA 1J88A 3QRFM 5LO7A 4AX3A 4XN8A 4JO2L 4X9YA 5E94A 4F7EA 3DPBB 4YGAB 3FTGA 3EXJA 1UCTA 1WBXB 1GGCL 1EEQA 3S36L 3U7WH 4MNQB 5IIEA 1P7KA 4M6MH 5KSVA 3GDCA 3F3HA 1CFVH 2JB5H 3G5YA 2PW2A 3KWWB 3RI5F 4PREB 4UTBL 1YZZA 1H3GA 1YG9A 5CN1A 5H37G 3HNSH 1BCIA 2VDRH 1UD8A 3TGXA 4QRPA 4V1DD 4KRMB 2DBLL 3WUWG 3TYGH 4IGBA 4NQDD 1IGML 1B9ZA 1P4LA 3GHEL 2KZKA 1FL6A 3ARFC 5EOCH 1MLBB 3QQDA 1OARH 4K0OA 4NJ9H 2PO6A 4X0KA 1SN0A 4J3OG 4V2BA 1K6QL 2ZICA 4J6RL 4AV4A 1OAQL 5HPMA 1XSOA 1YEGH 3GI8L 2ZWZA 4PJCB 2E7LC 3FZUD 4EZJA 1N18A 1MCJA 3VYOA 3MV9B 5KG9B 3CZFA 1QR4A 5LG1A 3DHUA 4FC3E 4QEGA 4TN9A 3WBDA 1ICTA 1XGYL 1KJ2H 1NJ9A 2X2YA 5J1AB 3CC5B 3OAUL 5DO2D 5EN2A 1IFHL 2P52A 2EZ0D 5JOPD 5DD5L 2BNQE 5TQ0L 1DQDL 4FQQB 1JV5B 1BZDA 1RZJL 4G1MB 4OZFA 5K39B 1HS6A 1WF5A 4YLQT 1DVXA 5EORH 4D9RE 4IJTA 2DKSA 1F4WH 3U79A 1FGNH 1S7XA 4DPRA 2R4RL 4OJCA 5KVMC 2KLSA 4U33A 1G0YR 3RNKB 1KSRA 4G8EB 4UTCA 4L0YA 4YSEA 3UTZA 4S0SD 3ML9A 4HS6A 3VNYA 1T0MB 2APTA 4JFDD 4MS8C 2JIXB 5FLVA 1CGTA 1BVNT 1IAOB 3OJMB 3RWJB 4N0FA 4HD9A 1YLBB 5IF0A 3L4VA 4S1DD 3F84A 1MFMA 3H2WA 1F6FB 1FFOA 1QPKA 2W60A 1I9IL 3LSOA 1EXUB 3L48A 2UXVA 3N0PB 5D1ZI 4OVVA 3ZTEA 1T0NA 4NZRH 4I85A 5C09B 4CC4C 4YPGA 5AFAA 2X4NA 5CLXA 3FU8A 2X4SB 4H8QA 2ADFH 2J21A 2OL3L 4IJ3C 1EVUA 3TEWA 1ZGLA 2M1KA 4RGNE 4KY1H 3OXSB 2DQJH 1FL3B 2YBRB 4G9FE 5DU7A 4IM8A 2P49B 3WIAA 1IX2A 4AC4A 1KOAA 3UBFA 1KN4H 1P1VA 3LAFA 3SY0A 3UZEA 3BP6B 3QJRB 3ARED 4B3EA 4PJ9C 3RGBA 3LZRA 2NNFA 1Q9OB 1MWAA 4PSRA 5FO9B 3QI9B 2FD6H 3U9UA 1L7TH 4FQ1L 3QDHA 5KVEH 4UMGA 3P02A 4Z7UA 1COBA 1NOAA 5ETUA 1DJHA 4FL4C 5C09D 1S7VB 1KLGA 3TXAA 4X7EC 4EN3B 4MB5A 5FUCE 4XO9A 1TYJA 4Q4EA 3K6NA 1ORSB 4XAWH 4I1RA 1JZ6A 5B1JC 4TQEH 4I3RH 4O51A 1U91B 1UOVA 4ODHH 3K6SA 5AQ0A 5AZEL 2AFNA 3GKWH 3WEXA 4N2BA 1NMAL 4KMTH 4JFDB 2DD8L 3AT0A 3MBEB 4OGZA 2Z3FA 3W0WD 4OW6A 2WM0A 3GI9H 2D7TH 3IDIB 4PEEA 2IJ0C 4LLMA 4NJAL 1LEKA 3U2IA 1CICB 5ABAA 4XI5D 3CH8A 3Q06A 2Q10A 1YEIH 2ATAA 4ELDA 4A66A 2MWCA 5T5FA 4P2OD 4R90L 1BOGA 3JQOB 1DVTA 2VXTL 5I8OH 5CZKA 3UIZA 4GI6A 2UXGA 3FT2B 1M4KA 2MOGA 2FVNA 1J8KA 3KW7A 4GI8A 1FZOA 2NTFB 2ROXA 3H42L 2VW6A 2WXPA 3O9WD 4PJGF 4UT9H 3O45A 3C6LD 2R9HC 3OF6A 1MWAL 2NY7H 4ACTA 2PYED 2VXSL 4ZMZA 4PRIB 2NXYC 1JRHI 3BAWA 2R23B 4GNKB 1WLHA 4PTTB 4MMXA 3H0TB 2BFVH 1A6PA 4WEMB 3ARZA 1EA9C 2VLJA 4PRHB 1E42A 2HT2D 3MXVL 1S2EA 3DI2B 1A66A 2OA9A 4B53A 3KLDA 4GG6F 3PP4H 1GS8A 1U8QA 4S2SB 2BOBA 3LN9A 1Q72L 1E2ZA 3UDWC 1NCDL 3WFEL 2GK2A 1V7NL 4WWKD 1S5HA 3MLWL 4XBGB 4XMZA 2WK2A 4OFDA 2D31A 3LNEA 1MAKA 3I6KA 2ZYIA 4YSTA 2CH8A 2ZYHA 5B38G 2ITDB 1LK2B 3IM1A 4HJSA 3I6LD 3C08L 3IFOA 1ZGLM 2B77A 3F7VB 2Q76A 3U0WH 4PP1C 3L5HA 3F7VA 1WPCA 1JOIA 4PRBB 4B50A 4OVUA 3OKYA 1B4RA 2ZD0A 3UJIH 5F6IB 3I6LE 4GKNB 2UWEB 4YSQA 4PJFF 2A3TA 4ZFOL 1R3JA 1T0PB 5I2IA 4M5SA 1FORL 4HXAH 4K55A 1MUJA 1QQDB 1JF6A 4QT5A 1PY0A 3UMNA 3OLEA 4GBXD 1MCHA 1RFDL 2JB6B 3EJYC 2WO4A 1OEZW 2BCKA 3FOLB 5L88H 3L16A 5CUSL 4R7DA 1WSST 5IHWA 2QADC 4HPYH 4WI9A 3GTTA 4DGIH 4OZIB 2HLAA 5LGJB 2LU3A 3PDOA 3WFDH 5HGHB 2W65B 4RGMC 3PNWB 1BVKA 4JO4H 4P46B 4YE4H 4MZIA 5F70A 2YAPA 1SJEA 2OMBA 4L3CA 3FU7B 1HXYB 4HIXH 4GEIA 4XMKH 2B0SL 2XU9A 3HNVL 4KK8C 4MZ3A 2NZ9D 3KYOB 2PTTB 3IJ7A 4HKJA 2A73B 3TPUA 1JUFB 1AQKH 4F8PA 3QQ9C 2V7NB 2W0LA 4MDJB 4KPHL 1YC7A 2IGTA 3UTPD 2HRPL 3NK4A 1EGJH 4GS7C 1YMME 1NA8A 4KJQC 4L3EE 3ESMA 1DFBL 3KPRA 3MTXA 2IQAB 1ZXKA 1TQBB 1AZVA 3TV3H 1NL0L 3ZDZB 5KJRH 2IH9A 3UZVA 3LB6C 3Q5YA 1NCBH 1TO4A 4LSSL 5IBUG 4J5VA 2C9RA 3GMNA 5G4MA 1AOHA 3QJFB 4ZFOA 5KSAC 2D03L 3B7YA 3DWTA 1BYOA 2EILB 1BEYL 3MV11 1XZWA 2XPGB 4XP5L 2CNZA 1OGTA 1OW0A 2ZYRA 4FLRA 3ECBA 3FSVA 3TS8A 2ATPB 4YHZL 5ANHA 4HCRL 4EXPX 2RMNA 2ZKYA 4ODTL 2WLNA 1XD1A 1FG9C 4LAQH 1TDQA 4HJ0D 2QVFB 4N68A 4LOVA 1JNJA 3U2JA 3SPJA 4OLYH 2FQEA 1TZHB 5DQJA 4A7SA 3FU0A 4U6VL 4IKJA 4KO5A 2I5YH 4HDIA 3BZ4A 3IJ9A 1ZE3H 4OCXL 3HAEG 4ELKB 2VDNL 4KZDL 4X5RA 2Y6SC 4GRLA 1V10A 4L4TA 2WNXA 2HG0A 4Z78A 1OTTD 2BRRL 3O6KL 1AO7B 1K4DB 3EYQD 4YHLL 4NP9A 3VFOB 4AV5A 5CZXD 2MKLC 3ZTNL 3IGLA 4LHQB 2ADIB 1ODUA 1MWAH 4YHML 2BHFA 2IDTA 3FUHA 4IKLA 3IJ8A 4HIEB 3DX3A 4RNRB 1USZA 1OO2A 2PCXA 5HJ3A 2Q7AA 5B3JF 3MLVL 4HUMB 1LD9B 4PRAB 4TVPE 4FTVD 4UQ3B 4BELD 1ZK5A 3HS8A 3DDGA 4FNLH 4RFOL 5GGSB 4WQOA 3UX9B 4NXSA 4FQIH 4NCC1 3BAEL 1UUNA 4QRPE 3OB8A 3L3DA 2NZ9C 4FXKB 5BQDA 1Z2KA 4KHXL 2L04A 2VR3A 4NDMA 1KC5L 4Y89A 1NBVH 4N2MA 2NLJA 4CJ0A 4JZOA 2HLFD 5DDHA 1NCWH 4NEHB 4DGVH 1EJOH 4IKNA 1JYXA 3TN0C 2BSTA 4AL8C 4DUXA 5HYJE 5MEQA 2Z7UA 2VC2B 4UB0L 1ET7A 2CRYA 3MKGA 1UCBL 4QOKB 1TT6A 1CE6B 3ECWA 2BDNL 4JLRB 4FP8H 3OZLA 4LPXA 3SPHA 1FPTH 1AQHA 1JERA 4N2HA 1UA6H 3L3OA 4W9KC 4BK5A 1CLZL 1QOKA 3WHXB 2D7QA 3SJVD 1Q0YL 1KB5B 4YEEA 1R3HB 4PBVC 1WYJA 2ICCA 3KYAA 4OCYL 3PWLB 2WQRA 1AHKA 2E4TA 3ZR6A 3ILPB 4AJWA 1H0DB 4JDEB 3B9VA 5KW9L 2NT0A 5A16A 1F4HA 1RURL 2OCJA 3GRWH 4KUCF 2ATKB 5C7ZA 1UOWA 1ZT4A 1E4XH 4PJHB 1CU4H 2I69A 4RMVA 2E9IA 3KPMA 4FYRA 4GKOA 4WKZB 4TQPA 3O3BA 4GBXB 5T3XD 4I0PA 4KNUA 2HG5A 1I3GH 2UXTA 4KK9C 4UI2A 3ZTNH 4Z76B 4Z7NB 1CL7I 5KSBF 3GC3A 1MJUL 3MUUA 2B7DT 2JJSA 2ZX9A 4NC0B 1PNCA 1PZ5B 5TPWL 5CZVL 4IIQA 2OMXA 5EU6B 2JXMA 2OMXB 5EU6A 3SZ6A 2VZ1A 3MOBL 4MMYB 2AEOA 5DVKA 2G3MA 4U1NA 5HDQH 4HX1B 1UWEH 1N12A 2HLEB 4DQAA 1QFWH 4ZMOA 2WNWA 2YEZB 4AKQA 4M4RB 1LE5B 1CC3A 4M43L 5E1IA 5KWYC 4LVEA 4A7GF 3D52A 1QX1A 4JX0A 2X2IA 3D5OF 2BMKB 4Y4FA 1YQVH 5A2KH 1ECZA 4HKXB 4QWWC 5DVNA 3T0ED 4R3SB 5FDWA 1GS7A 4AKPA 4PR5B 3K80A 1VFMA 4OGAC 2JK5A 2JMRA 4QYOA 4X7SL 4J3UA 4HJGA 4CMHB 5DJXA 3RDJA 3EDKA 3T0EE 7PAZA 1BWWA 4HUUA 3GRGA 2C7UB 1EQWA 1WK0A 1TZIB 1KCSL 2BOBB 4DTGL 1T7WA 2A6IB 4JGNA 3QIWB 3FQNA 1UWYA 1GGBH 4DN3H 3W37A 1EAOA 4ZW6A 3VXRE 3ZZ1A 4POUB 2C9PA 1KJ3L 4HHWA 1E9QB 4PGBB 3B9EA 5T1KB 2B39A 3WS3A 3KDPB 2F74A 4H40A 1N0LB 4WUUB 2Y23A 4ZUVB 1FZKA 4L8BA 2NX5A 2X70B 3B2DC 1WG3A 1DL7L 2XG5A 3PP3H 5E2TH 1GZHA 4NENB 2D0HA 2PR9A 2VDPL 4BZ2H 2XA8L 2OYKA 2FE0A 2SODB 2QPDB 5ECGA 2LQRA 1INDH 3V4PB 4DKEH 4DW2H 5I8CA 3DMMB 2EE3A 2PW1A 3PWPD 4JFXA 5D1XD 1WEJL 3TNMB 2C7UA 3S88H 4WFGE 3G6AA 4TS6A 2FQDA 1KBVA 5TDOB 4QNPE 1NCCL 1NLDH 3IU3B 3JWNC 3OKEB 3RWDB 2AITA 2CHZA 2NYKA 2AXJA 2WJ7A 1OOWA 3I2CH 5I8EA 4Y5XA 4PJDF 1JMZA 2EEFA 4AI7A 3H7LA 4BZYA 4PHZA 5KYXA 3APDA 3SDDD 2AVGA 3VMNA 4ANKA 2RJMA 3KJ4B 2QDVA 4M8QA 1HHKB 3LHPH 4F33A 5HXMA 1FNFA 2KL6A 2QADD 3N40P 4HDIB 5TH2B 5GGRB 3HG2A 4J3BA 4XP4L 1S9KC 3MCLL 3K4DA 4FABL 2YRBA 1TNNA 3FB5B 4HU8A 2HYMA 1UATA 1OE3A 1DJSA 1MIEL 1AACA 5IVZB 4JG0L 3MGAA 2HUHA 2BLFA 3QDME 4PV8A 2WBWB 3CN2A 1FFTB 1GGBL 1YJDL 3IXAB 4Q6KA 1MAJA 2HT2C 2EECA 5F0MB 4NHUA 5JHLA 3BKJL 4HVBA 3HG5A 5AYTA 1OGAD 1SUHA 1BW8A 1S7QA 2BRQA 4MA7H 2NY2D 3F12B 2JQMA 2R29H 4MQXD 5D1QA 3WN6A 1H3XA 5DEZA 2HFTA 1MJUH 2EDMA 3CTTA 4PH8A 4OZHE 2E7LA 3VJ6A 1S9YB 4YNYB 3TZVC 2E6PA 4N0CD 4I3SH 3EBGA 1Z5HA 2LT9A 4TTGA 7FABL 3HMWH 5SWSA 5CFAA 4BRJA 5BW7C 3GXIA 5LGHH 3TVMA 3H42H 3LKPB 4JY6A 1LNUB 3T2PA 5AW5B 1V54B 3T6XA 2VERN 3BN9C 4PGDB 1C9SA 2OCCB 3KPTA 2E47A 3J27A 4NM4L 5ESAA 2CZNA 1CZ8H 2ZWYA 2XN2A 2O6PA 4QYAA 1P9MC 2X9YA 3APNA 2W9DH 3POCA 1T04B 1E30A 5AAMA 1NMAH 3MGTB 3KS0J 5TE7L 5AW8B 1I8IA 3BN9D 3MAWA 4K71C 1FZOB 2D3JA 1MHPL 2NTFA 2R51A 2QLVB 4R4BA 4WI5A 4DOHE 3NFPB 2WXGA 2YZ1A 1ZXQA 3VGAC 3P40A 4OZHF 3GPSA 4GRMB 4PRPD 2HFEB 3V10A 4QLWA 3EO9L 3DVGA 3AQDA 4OLUH 4UILH 5IKCA 2NY6D 2P8LA 2XWJA 1THCA 3G04B 5DZ9A 3AU1B 3ORJA 4U31A 4W9JC 4AT6A 2WWNA 3DV6A 1OCWH 3B3BA 1QZNA 4XXDA 3D08A 2OXHB 5BS0D 4PWKA 1FFOB 2H6UA 4Z8FL 3UZEC 1VFAB 1X44A 4PGCA 2COVD 1IGMH 3L9RA 4TSBL 3BSGA 5M94B 2A4EA 2VB5A 4XOEA 4KJYA 3PHAA 5HHPB 1CD9B 3NCXA 1N3NB 4Y1AD 4AKOA 2W80C 4PJCE 3WOVA 1TZGH 3MXVH 1ERNA 1GGIL 1EFXB 3I6GB 1WCBB 4XP6L 5MEOB 1W72H 4GMSL 3I6GA 3V8CA 5K9JH 4GP8B 3B5GA 3NMEA 4WEBH 1KY7A 1WA0X 2CLVB 2WXMA 2Q9OA 5BV7H 3WFEH 5IFHH 2Q2LA 3B1TA 3JV4B 2UZXA 4K2UL 4M5ZH 1RUML 1YEEH 4JHZA 4JM2B 3CXDH 4QF1B 2FO4B 2WUBH 4ZFZA 3EFOA 2R56H 1OP5H 2ZX5A 4O9HL 4K7PX 5E1HB 1JPSH 3FQNB 3EZ8A 4G9DB 4HEMA 1DSFH 1ETA1 2CO1A 3IJSA 3P11L 4WFED 2R23A 4KXAA 3NAAH 2PCFB 3MLUL 4B96A 1SXSA 2CR3A 1AQ8A 4RZCB 3T1FA 4JREC 3E2HC 3V9EA 3PDOB 5HGHA 5C07E 3V6ZB 4C56D 3NK3A 1ITBB 1WDAA 5DXWA 2ZONA 3POHA 3T6VA 4ES9A 3ATBA 4PJCA 3ARSA 3FCSB 3EUUA 2JIXA 5K69A 3GXDA 5IVOA 1GAFL 3A4DA 5H37H 2HUEA 2FAUA 4AK2A 4CMMB 5CEZL 5E9DE 1I7TA 1MCOH 1CJYA 1C5DA 1MJJB 4Y0GA 1CDBA 3UXFA 4A7UA 2OTUA 5INDA 3NFNA 3BEVB 5MERB 1AFVL 4J3XA 3VFUA 1CVSC 4AXWB 5B39G 3APFA 3IMWA 3BSHA 4GMTH 4KK8D 2I9LB 1DZ0A 2Q76B 1F42A 4JN1H 2E0PA 3QC6X 1J5IA 3DX6B 3NJVA 3II2A 1F1AA 2K7QA 3TCTA 5L2KB 3TFBA 3QFJB 3K2KA 2E6JA 4TV3A 4XCYB 1T03H 3MLRL 1XSIA 4XCYA 5T5NF 2ILLA 4BSWB 3WE6B 4ONHB 5IFJB 4OLWL 1JGLL 3QEGH 4IBQA 4WCYH 2VL4A 1KBWA 2J88L 3MTRA 1E8XA 5ISZE 4HF5H 2YA1A 2EDYA 2P24A 1HDMA 2X44D 4R4FL 4LFHD 2MJWA 1IAIH 2VH5H 4OFYA 3QQNA 5F3BB 5KVEL 4JRXB 3MNZA 4TKWA 4RMUA 4XNAA 2EKSA 3VXOA 1KCRH 3SGDI 4XOBA 2BY2A 3P4MB 3RPBA 3ARBC 4RAUB 5KAQG 4N2DA 3LEXB 3H3PL 3PIQB 1JZ3A 3G08B 4HUWB 1KELL 1B2YA 1RI8A 3HC3L 2VLMD 2VMFA 1CLYH 3QHFH 3LIUA 4OLYL 4KTYA 4ZDHA 4JLRA 3VYNA 2H0EA 2HH0L 1OGSA 4UQAA 1QPXA 4Z7WB 1F97A 4W4NA 5FGBC 1XF5B 3KCPB 5BJTA 1FVCB 3UZVB 3EO1B 4EI6B 3KPSA 2ZT9C 2X4PA 3V0IA 1U3ZA 1VIWA 2XRAH 3OPZL 3Q1SH 4YHLH 3WG7B 5GGVL 3CVHB 3HPJA 2J55A 1PMYA 3ZYZA 3WTTA 4ZUSB 3ZDXE 1JHTB 3MHZA 1K3ZA 5JW4N 1J05A 2WY3B 2EE6A 2ARJB 4LVOC 1IFGA 1WCBA 1FYTB 1ZVSA 2VLRD 1NEZB 3SDDC 5ERWA 3GRWL 3BH8B 5D5ME 5LCVA 5J3HC 4GQPH 1IKFH 1MRFH 2AEIT 2V5TA 3BPNB 3DVIA 1ZKAA 1D7FA 5ETUB 2BPBA 4DGYH 3G5WA 1U8CA 1TZ8A 3B5TA 3Q2VA 1WFIA 4K3JL 1L0YA 4WW2A 1WS7A 5DZPA 2D3VA 1JPTH 3DETD 4JREB 4LEOA 5E1QA 2AKRB 2UWEF 2HN7A 1HC1A 4N0YL 5MEPB 3ZIYA 2Z1PA 1ZPLA 5BZZA 1TYEB 4PM1A 3O41A 5F1NA 3HR6A 5C2BL 3JWNG 3GMQB 3GNML 3D18A 4FN0A 1HHGB 3C09C 2E7CA 1ID5I 2Y7MA 4WIQA 1JV2B 4ZYKA 1Q94A 1SMOA 1L9SA 2F68X 1U4FA 1QNIA 3CXHJ 4MNGB 1ZVSB 1U2YA 3TNNB 1KPVB 3AQXA 2WQWA 2OSYA 2XTLA 4GLRI 1Q9WA 1M1XB 2DKMA 2QVMA 3HHSB 2ZAIA 4U0RB 3RHWF 3UPRA 2N1KA 1R24B 3LB6D 3QORA 2YPVA 3D0LA 4FULA 5K5YA 2MCAA 3U46B 3L3JA 4IU3B 3LKRA 5D1QE 4FYTA 4K8RL 1X5LA 1NAKL 2AQSA 5CEXA 5CP7A 4GXFA 2GITB 2ZP9A 2VDOH 1BJ8A 4JGMA 3S35X 4Y1AB 1NINA 4YIQB 3VWJC 2ZX7A 2HFFB 1X4ZA 3IGKA 2CKBL 5L9DL 1I8LA 3GMMA 3LKSA 2ZKMX 4KXBA 3V6BR 1A6ZB 4M8RA 1SZNA 1Q38A 2WKOA 3FNKA 3R0MA 3TX4A 4LCUA 3D2UD 1FL5A 4F3FA 1U3HD 1BZ9A 2YC1A 5KJ4A 4J8QA 4CN4A 4IOSA 2R1YB 4GSQA 1Q8MA 1YMMB 3VD5A 3KBFA 1J18A 3C6LB 4TTDD 3GMRA 3VGHA 3TN0A 1AR1B 1NPUA 3QP3A 5DJ2A 2X6UA 1NGWB 3L3HB 2F19H 4HCRA 2XXGA 4NQEB 2YR3A 4OF7A 1F02I 4XVUD 3D4GA 5DMGC 5T1LB 4OZIA 4UBDC 5D2NA 3MRQA 3CSYA 5ID0A 3SGJC 2OX5B 5LBSL 1QTSA 3VD4A 3G9VA 1MH5A 1IE5A 5E08H 3E6FB 3T71A 4AQ8A 2P46B 5T8IA 3ZKSD 5CM1A 1LEKB 4LLMB 5DLML 2ICEB 1D6VL 4XNUH 4TUOA 4FQLH 5FIEA 1MVYA 4GXVH 1KELH 1ZS8A 1KN2H 4L0ZA 1N8ZA 4XE5B 3WIIH 4IBUA 2CKNA 3D06A 3VXTB 4YDJB 5DRZB 1NGQL 3VH8G 5DJYA 1AKPA 4FABH 2R2CA 3CVBA 5JQHC 5D7IF 3NBNA 3UGUA 4XCCL 5HHOD 3G6JB 1JZHA 3HE6D 4OCNC 1F0LA 1T5XA 1JGVL 4HSCX 2AANA 3BZFA 3KLKA 2VABA 4HPOH 4WY7H 4C54A 3ARDB 4CGUB 1BXVA 1DQLL 2C3HA 5FM8A 4F7EB 1AZUA 2C34A 4R2GB 3PV6B 1RUQL 4F7CA 2XZAL 2A6JA 1TKWA 3F65A 3JYBA 3AG1B 2IPKB 1MCEA 1NPJA 4LZKA 4NSKA 5DGQA 3TWYA 5I1JL 2V3FA 3C87A 1A7NH 3MNMA 1G84A 2IEPA 2YBGA 1FGNL 5CF3A 2Z65C 3D4CA 3GBMH 1NFDE 1HSBA 4PIBA 3EDFA 3T77B 3GINA 3JSSA 3V4UL 3D39B 1IKFL 3Q7JA 3EJQA 5LBSA 3K6DA 5K9QG 4BIKA 3C09B 4OIBA 4Y4KC 2J2ZA 4FJZA 4HW6A 4ZBJA 1JP5A 3UJJH 1KT2A 4M9PA 3QWRA 5DZAA 1JGEA 3B9KC 2YN5A 1OB1B 3FCUB 1ETZA 4I88A 4MFHA 2OSXA 1ETZB 2C3VB 1MQKH 1N67A 1JIBA 2QKIB 1DR9A 5DUJA 4A6YB 2CDGA 4JB9L 1IC4L 4O02L 2NQDA 3H9SE 1R3IL 3O0LA 3EADA 1FO0B 4DCQB 4AVJA 1GHFH 3T0XA 1P4IL 4EI5D 1KCUL 5I0VA 4DP1X 3FQXA 5ACZA 3HZMB 2P8PA 4NHUB 3DX9B 1W0YT 3MCLH 4H1LH 4HMCA 3EXLA 2FGWH 3V0FA 4E42B 3IPBA 3K2MC 4JKNA 4JUTA 3QQ4B 4AGLA 4LVNB 3ZHKA 5EIIB 2D7MA 4MGXA 3QUYB 4OH2A 3VG0L 5IOPA 1OAKH 1QRNA 2DWSA 1M7XA 4NN5B 4J4PA 4OGXH 1LWJA 4G7YH 3FCTA 3US9A 5JLZB 2A1WL 2MHAB 2EKSB 4YPGB 3Q43A 1G7PB 3H4FA 3IFNL 1LQSR 3MBXH 4YXKH 4EQ2A 4N8UA 4QI3A 4CL7A 1UTDA 3L5WB 2VM3A 3HKFA 3VXSA 5ERWB 5I1EH 2GSIB 2XG4A 3CVCA 1IGTB 2A6KA 4U4IA 4IU2B 2BS71 4NO0B 1LO4L 3KYMA 4HMDA 1CFNB 3AXLB 4JFFA 3V6OA 5ESVB 3MV7B 3X1NA 5I1GL 3GQFA 4BM7A 1M3JA 1UWGL 3DV6B 4RAHA 3VXUA 1RSYA 2DWTA 4W81A 3WNPA 4M1GH 3L3KB 5KS9B 3DJZA 1NCAL 2AQNA 4X98B 3FHEA 3NG5A 2CLRA 4PS4H 1NMCC 1TG8A 1Y0LA 2P9RA 1A1MA 4K9EC 2PCPA 4OUOA 1U36A 5J11B 4HOMA 2WAHA 4HLZH 3QUYA 1URIA 1SPDA 4J6IA 3TNMA 3OC5A 2XWTB 4R0LB 5CS7A 3HC4H 3BPCA 2MOVA 3HE7D 3NUKA 5J0BA 4NUJB 1IAKB 4PJ5A 1DBJH 2YA0A 3OJDB 3CSFA 4UQBA 3W82A 1BBJB 3FTSA 3MNVB 2WO3B 1IEHA 3A4AA 1KTRL 4AW4A 1YEHL 1EAJA 4L4VD 4JHBA 2F9BT 3RE0A 1SJHA 4CSTA 1GC1H 3LDBB 3TBYA 5D1ZC 5CD5C 2XQYG 4ZPVA 2UZIH 1PZ5A 2HZHA 1TMQA 5TE7H 1UJ3B 4P5RA 3MRLB 4YHPB 1FV1A 3NJHA 4DAGL 1FN4B 2B9AA 1U93B 2HP4A 1NC4A 2WVSA 5AWNH 4E9TA 2BP3A 5I15L 4AGPA 3RRQA 1MFBL 2DICA 1AS8A 3TC9A 1IC7L 2FZ3A 1XH3A 5EO0B 3OV6A 5E8OA 2VXVH 5ESQA 1AQDB 1F13A 1XF4B 3JTTB 4NQDB 1OP3H 2WCGA 1J86A 4RX4D 4ZO9A 1U2CA 1AS6A 1IAKA 1GR7A 1LDPH 1T66D 3EDDA 4YDVA 3VXRD 4BFFA 4Z7VF 4M62L 1JI1A 4HKXA 4UV7H 4H0HB 3KR3H 4OCSL 3SOBL 3J2PA 4YBLB 4ACPA 5D7LD 4GT0A 1I8MB 3RVWD 5GRUH 3BEVA 3VI3F 1RLBA 5BVJB 5AAWA 2OMUA 3ZHLA 1FNGA 1JXFA 1GXEA 2QSCL 1YSOA 1THAA 3S96B 2ESVD 4M5YL 5EOCJ 3KDMB 3OKOB 5DEFB 4ZQKB 4QO1A 1T20A 2NDGA 4OCLC 1P9MA 3UROR 5MEQB 3HA0A 1A4KB 5JQ6L 2BXZA 3S5LA 1J5CA 4LVNC 1RUKH 2NY2B 1P7BA 2E3VA 4Y5YC 3CVHL 4XPTL 5J6GB 5I0XA 1EVTC 1Q72H 2XN9E 1GCFA 5FYKD 4DO5A 3EYUH 1EEZA 3AZUA 2XWXA 1PU0A 1DQJB 2QQKL 3QBTB 1UWFA 4L4VE 5IOPB 3F58L 4TNEA 3MCG1 4X2UA 2QZ5A 1BVLA 1KTJA 3UH8A 4AWJC 5BUGA 1Z7JA 5DMYA 2D8KA 4XPFL 5H8DA 3CDZA 3IS0X 3T2LA 1A5FL 3WXVL 1VA9A 1PTZA 1QI4A 4P23A 2VLKD 4R2GD 3BZEB 1OGAB 3UPCA 3BRFA 1BZ8A 4AM0Q 1SNRA 3VI3E 3BP4B 4X4KA 1DEEA 4P05A 4DERA 2IV9A 4F7PA 1AZRA 1T7VA 4XP5H 1NMCB 4XVSL 1T66C 3LNIA 3DHJA 1HINL 1G7MA 3GFUA 5J11C 3MBEC 4P2AA 4BQ8A 3V4PA 2EDOA 3UG4A 2UX7A 4GT7A 1OL0A 3TCLA 2DQCH 1Q1JH 1XGRB 4OZHB 1F1GA 1DQJA 2GY7B 2BVTA 4U1JA 5B3SB 3DPDA 8CGTA 4BSVA 1QR1B 5CNHA 1KGWA 4L8DA 4UIMB 2FX9H 5E9AA 3B2VH 2O1AA 4QTIH 3B8YA 5E2VH 1OHQA 4ABVA 4DP9X 2OMTB 4YK4C 3CHQA 3DJTA 1P6WA 3REWB 2CUHA 1UM5L 2O26U 1U8NA 3UACA 5JOFA 3TM6A 3K8MA 4MD0A 1MRFL 3NRFA 2Z35B 1PZAA 1TETH 4M93C 5E6ID 1UJ3C 2IBZX 4FHJA 5HHVH 2Q6WB 2WCSA 5AVTB 2XIIA 3RHWK 3SKNA 3LQAH 4WHYG 5B39A 2LABA 5BRZA 4QYOB 4AIOA 3VDBA 3WTYA 4NLAA 2BY0A 3BN3B 5I17B 4P57B 4PBDA 4HU2A 2IH1B 3QG7H 4C55A 2W59A 3T6QC 2PPCA 4ODXB 5HHQB 1EGJL 3NZSA 2OMNA 2JB6A 2X41A 5HHQA 3RGHA 3U6XS 1KTLB 5AL8A 1FBIH 2YAQA 1I9JH 2DH3A 2RACA 4TNWK 4WHTB 1L4IA 1TCMA 5BO1L 4IRSA 3UJIL 3THML 3ATEA 1OCZB 1QP1A 1OSZB 1L0QA 3C5ZA 4RETB 1BEYH 1S7WA 1SXAA 5D55A 3QZWA 2Z35A 2V17H 4NNYA 4ZQTA 4LASL 1NEZA 2WN3A 3SYQA 4X42A 2XWDA 3FYEB 4WUKL 3TEUA 5JPNB 4PV1C 3VJ6B 3PWUB 2F53E 1EHLH 4Z0BH 5EF2A 5CU5A 4JJ5B 1YAIA 3ZQWA 5F72S 2AP2A 2F8IA 4FG6C 2W1NA 2H26A 2R2EB 3RIFK 1PEWA 3FJTA 2G60L 3JV6B 3UEQA 5KSBA 3PJLA 4PRIE 4JFED 3UC2A 3VXSD 4F1SA 4HWUA 1ZGLB 4ZT1A 5KN5A 3WAKA 2AEQL 1KTLA 1IZKA 2A74B 4OGYH 1IM9B 2P7TB 1NAKH 1NCUA 3AROA 1QATA 5CJ8A 3LKSB 5FWQA 4LCWD 3QEQE 1JTOA 1OCOB 3FB7B 3HNTL 4LPCA 4OI8A 1UVQB 3G9AB 1BJ1J 5JYLA 4CA4A 4EOWH 4ONFL 4QHUA 3W9EB 3TPUB 4F8LA 4N2IA 1HILA 3ULVC 3N1GC 4OQTL 2F08A 2CLZA 4NO3A 1G7LA 2J8UA 3DUHA 3OXRB 4JRWA 1VSCA 3GJEA 1LEGB 3EIFA 4AM0A 1OAQH 5E2WH 1HZHH 3E6HA 4AITA 3RWEA 5IFAL 2X9WA 3F6JA 5C07B 4DZBB 2FJSA 2P8MB 4HT1L 4CADB 3C6SB 4WHCA 3E0GA 3T0AA 3VFTB 3VSQA 1CICA 4KQ0A 5I5IA 2AEPH 3MZGB 2M2DA 3THMH 3PNRB 2NUTB 1LP9B 4APQD 1CK0H 1NBZB 1EO7A 4BA0A 2RQ8A 2Z4QB 3QDAA 5EZLB 4JANA 4LKXB 3LN4B 1RH8A 2UWEE 5EBWB 1XB8A 5INCB 2ZIDA 2JKRM 4AEEA 2YKLL 1AHWB 1A7RH 3LH9A 4ANXA 5CEZH 3N1MC 2W81C 2Y7NA 4K8RC 4DPBX 4EUPA 1QSED 3H55A 3DIFB 3SCMB 3ZW3A 4RX4A 2AJSL 3VFMA 4POZC 3DIVA 4TUJB 5GRJH 3FUIA 5HJDA 4WSGA 1GPOL 1IGFH 4UYQA 2BWQA 4Y9EA 4MXWH 1FYTA 2AEQH 2GVYA 2ZAGA 3L1FA 2VO8A 2J1KA 3N2JA 2UUDK 4NCDA 1RZIB 1VFBA 2XWBA 4ZTOH 3SQBA 3BUDA 2YXVA 1QABA 5CR8A 1L7IH 4YHIA 4UQCA 5I6LA 3E1F1 4NFBA 4DO6A 3S3BB 1HHIA 3M17B 3S35L 1MOEA 1VZIA 3RGVD 4GSDL 1OW0C 1QTPA 3VI4F 5IGXH 4Y2OB 5I66B 2BP0A 2OZ4L 4HFUH 3CFKB 1QTYT 3MJ9L 4KK9D 3FKUS 1UT1A 5T1JA 3Q5TA 2B08A 2CRZA 4JG9A 5C0ND 3ULUD 2EDEA 2IALB 1WBZB 3ILPA 2FIRT 2NLJB 4LHUA 1YQVL 4LLVA 2C9QA 4MMZA 4WW2F 1BZOA 3T4YA 1Z66A 4Q6IA 1IGIH 3S8WA 1WVZA 3BJ91 2BOLA 4P8QA 2XTJC 1OP5K 2Q0ZX 3UYPA 4G6MH 4G7VH 1HAUA 1A21A 3B34A 1N68A 2HFGH 1H3PH 4ORGB 3L4YA 5IWLC 2PYEA 4XNQA 1V8HA 2EYSA 1G43A 5FYLL 1T2QH 2QQNH 4E0RB 1BREA 2DWYA 1I3VA 1VESA 3DA0A 1I8LC 1RK7A 1HDMB 1DQQB 3KWUA 5KSAD 3ARYA 4QHKJ 2YD9A 2PXYC 4HGWA 4LSRH 5I66A 3JWDH 2IWKA 5C0EB 1QHPA 5AG8A 1EJ8A 7CGTA 3FTXA 1HXYA 5KVGE 4I4WB 4HWBA 1BMWA 2ICEA 4BFNA 4I4WA 4UIKH 4BUHA 1TFHA 3EUDA 4XMTA 3QR0A 4YSCA 3GBML 4JG0H 4WKZA 2VDPH 4BZ2L 3ZR5A 1CXIA 3PAUA 1TYRA 4EPSA 1DN2A 3SGJA 3TPKA 5HDOA 3BISA 4L3EB 4R7NA 1GGUA 9PCYA 2OAAA 2Z7WA 1LO4H 4QIRA 5LBGA 4I1PA 4I13B 3C6LA 3E8UH 1Z1WA 5LQBH 1U3HA 3Q1EA 3MCKB 5GS1C 1UZ6F 3ZU8A 4OT1L 2AK4E 4G7RB 4PI2A 1YC8A 4MJ5B 3GHBL 4GIOA 3DUUB 3UBXG 2X3BA 3ZE0F 1DYZA 5IR1A 1NM9A 1R46A 4ESKA 1WBYB 7FABH 1QKZH 3MRIA 4LCWA 4GUPB 2R7EB 2EKJA 2XTJD 4ECNA 4DCQA 5J3HD 3GSWB 3VH8B 2DMBA 5DURB 4Z3GA 3STZA 2NX5B 5IMMB 4LEXH 4BE6A 2LVEA 1YMHA 4NN6C 4U6HA 1U6AL 5AKTA 3V5DB 3B2PA 3U9PL 5IW1B 3QEHB 1OLLA 3L7FB 2CD0A 2A6IA 1JPGB 3TFKC 4EVNA 5I74B 3GMNB 3O11A 4C4UA 4LARH 1E27B 3P4NB 4CMHC 2ZX8A 5LCVH 2CCWA 1XF4A 3JTTA 2P5WE 3QA3B 1TEGA 1ZMYA 4KGLA 3ZK0A 2R39A 2QR0B 1OTUD 3QEUA 5DQ9B 4XHJC 2Q86A 3GKZA 3L5XL 3SOBH 1U8KA 2ICWI 5IJVB 5L9DH 3CIQA 1JF1B 1OANA 2ZUXA 5D71H 1FFRA 3WNNA 5GGTH 4R97B 3MACH 5EIVA 2WC7A 3DUSB 5CLYA 1G1KA 4HSAC 4JPKL 2FH6A 3ARXA 1CDJA 3BC9A 4X98A 1NTDA 3HVNA 3C2AH 4HH9A 4LL1A 4Y5VB 3QYNA 5BZWA 2WZPD 3ARVA 3UBXB 4X9FA 1WC7B 2GTWA 2LAAA 1U58A 4H25B 1ZIAA 1HXMA 2DOCA 5HVGB 1UM4H 2ZCKH 1LO3L 4GG6A 3HKZA 2QSQA 1IGTA 4PJ5B 3ZDYF 2QFRA 1YY9D 4EIGB 5A3ID 2WVVA 2DY2A 2CM5A 3BD5A 2IGFH 3ETTA 3VXRA 4F91B 4BWWA 2NY1D 4YHYB 3V55A 4XB7A 3PJSA 4S1RH 4YOKA 3LD8B 2Q86B 3RVVC 4Q9CA 2WLIB 5D6DA 2HLFC 2DJMA 1KTCA 4QHKI 5IKCB 4K5NA 4LOUD 2F54D 4LLAA 3EDEA 4EE2A 3HE6C 4NKOA 5HGAB 4HIPA 1MFEH 4L23A 4O5LH 4QCIA 5E8DH 2JI1A 3OX8B 4YHZH 1AQMA 1KXQE 4HJJL 5KVGH 3V8OA 5FO7A 1NSNH 4MLIA 3IFPA 1FL5B 3UP1A 5C0FB 1JVLA 4NQCB 1LNUA 3G6DL 4PQXA 3D85B 2XN9A 4Z7WE 5CD3A 2AJXH 2O5XH 4YDVB 1GZQB 4N2LA 4IIQB 1G6RA 2NW3A 5BOZG 1XT5A 1A0QL 5DCCA 2VDNH 2WLJA 1PF3A 4GB9A 3RUGE 1IEAB 1SXNA 2YFNA 3QUMB 3T3MB 4YXHL 3LNDA 3LEVL 1AXTH 4GUQA 1UYWL 1FNGB 2W95A 2IOOA 2AJUH 1CFTB 1KYDA 5EV7A 2QV4A 2NY0D 3HN3A 2A9NL 4KK5C 5CBAA 4QJ4B 2XWZA 1O5DT 2N7AA 4PU2A 2EJ1A 2ALAA 2I07B 4YL9A 4Z7QB 2BP8A 3QIBB 5GSRA 5DK0B 3H9HB 4P23B 4N86A 4Y16B 4H5SB 4Y16A 1NDMA 2H1LM 5BV7L 4JFQA 4L05A 5IFHL 2Z31B 4HAFA 1DEEB 1HI6B 4OBRA 3OZ9L 5F7LB 4AGMA 5EN2B 4AYID 3CFIC 2VJ0A 3WEMA 1PLGH 4LLQA 3ZDZE 1F4AA 1AD9A 1F5WA 3BKCH 3HG1D 4M56A 1ZGLP 5H37A 1KEGL 3C8KB 2JKSA 4G8GB 4K5MA 2BY1A 1DE4B 2DD8H 2UYLA 2NCEA 2HN7B 4B5ZA 2F61A 3QDMB 4OIIL 3TURA 2GITA 1BQHB 4GAGL 3BWAA 5HVWA 3UBHA 5D1QC 2X2UA 3NCEB 5IBUB 3SYPA 1J0YA 4MXQD 4P3CL 1KCKA 1OQXA 4PV9A 4RDQF 2BW4A 5J6GA 4Y8AA 2CDFB 2OTWB 1WFJA 3NA9H 1ETJA 3QXWA 3MBWA 5CINH 3BZ5A 3EBIA 3MV7A 4DP0X 3KJ6L 3EGDB 1AGDB 2CIIB 2OI9C 3R1GH 3EHBC 3AWEA 3R7RA 2EIJB 5FYKU 5EUOA 3OAZK 5I6NA 1J0IA 1VKXB 2DZEA 1F58L 3PDGA 1A7QL 2E86A 2DJSA 2LTQC 1ZT1A 5T3XL 3Q3GA 3MROA 2OMUB 1BGXL 3CBJB 4P4KA 1CXEA 2XNAB 3O6MH 4Y8DC 4CU6A 3QNYB 4I77H 4FQPA 1DVUA 4BFRA 4YO0B 2X9ZA 4BKSC 1CTOA 4IRSD 4LB8A 2G60H 2VSCA 3ZLQC 3FXIC 2JCCA 4KZEH 1B3IA 2ZKWA 2WVVB 3OAWA 5CEZD 3JTSA 3K8KA 2YAFA 2F74B 4HUKB 4FNTA 1TSRA 2VXSH 1NC2D 1JAEA 1H8SA 4JM2D 5CCKH 2IANE 4WZ9A 3U0PB 3KYOA 4HKJB 2VERA 2WUBL 1JXGA 3S2AA 4JO8A 2D4DA 1A2YB 4NENA 2Z7ZA 4OGAD 1EO5A 4XNYH 1JPFB 2ZKHH 1UZ8A 2K1MA 2G2RB 3QJVB 4E41D 4ZUUA 1DSFL 3N42F 4HK3N 1YMMA 3WNJA 3DNKA 3CG8A 3HW7A 5FW8A 5CIPA 4LLYA 1C5BH 1TENA 1FH5H 1R5WB 1AD0A 3IXTB 2WWMD 1CLCA 4LIQH 3LKOA 3Q3GB 4ODWA 5A2BA 1KJ2B 4MB4A 1TCRA 3L4WA 1L9MA 3GZQA 3BPCB 5IVNA 4H8WC 2DMKA 3IDJB 3QHZL 4F37F 4UTAH 4NOFA 2NW2B 3TEYA 3D8MA 5I18L 1A9EA 4L8CA 3MRDA 5DO2C 3KPNA 1SDYA 2VUOA 1T2XA 2H45A 1BA9A 3CX2A 1WHPA 4M29A 4WJ5A 5B1AB 1OGPA 3DX7B 3GXNA 1EXUA 1HOCB 1SEBA 2FJGA 1MREL 4LQFL 1S7RA 2VWEE 2Z31C 2LU4A 1LL1A 4HIXL 3V0GA 5ICYA 3MZTA 3IMTA 5FYJL 2IMNA 4PGDA 1HH6B 5I1LB 1AQKL 1JNHA 2K3HA 1WO2A 1KBGL 2NY3D 2H3NB 3L5IA 3HZKB 3EYFA 3NJNA 1ZV2A 1UXLA 4L2LA 2WTRA 3QG6A 4U6XB 1MZZA 2X4OA 5KZCD 2IAND 2GK0B 5FFOA 1N6QL 1LM8V 2ZOWA 3C8KA 5HI4D 1TJIL 3MPCA 3NSJA 4LEOB 2Z4QA 3CFMA 2V5MA 3FT3A 2DQMA 2JI2A 3DTXB 2DJUA 2NY5C 4G43B 5KN5B 1BXXA 4V1DE 2C9UA 2CXKA 2XN9D 2FZ3B 4GRLD 2CGYA 5DUPL 5FYKE 2ATKA 5CCHE 4MD5A 1XGZA 4HUVA 4JEGB 1FJ1B 2Y7OA 1J9TA 1HEZA 3DKHA 3O8XD 5T5NG 4ZTEA 1ZLWK 2BX5A 3CQQA 4PRPB 3MRPA 2PKDA 2KMWA 2L7QA 3HI5L 4RISH 3QO1B 1GA2A 1AE6H 4GIAA 4NWTL 1SFDA 4HCGA 1KYAA 3PWPA 1NM4A 3HZVA 4N3UA 5SX5K 4KV5E 1SY6L 4PY7A 1BOGB 1E3FA 1KV7A 3OAYK 5TF1L 2R4SH 4B9PA 4Z7OE 5L0QC 3KM2A 2MIZA 1BBDH 1BFVL 4P46C 1XCQA 2A4ZA 2CJTA 4G1EA 4YLBA 3B2UD 3QUMA 5SX4H 3IVKA 2YZ8A 1UWXH 1UXWA 1LXMA 2IDUA 3PU7A 3SDXE 3HB3B 5E95B 1OAUL 1RK0A 1WUZA 1A4AA 3MSPA 2ZUTA 4XP1H 1ORSA 3RZCA 2UX6A 4QKXB 5CJBA 2VDOB 4NKIH 4I87A 5JLZA 1NBCA 3WHE1 4P5TC 2ARJQ 2VDOL 3UTSA 3P9MB 3QNZB 1EO8H 4LLVB 3NSXA 4MMZB 5C0AE 3EGXB 5ABZA 5IM7A 1LLAA 4LSQL 2XPZA 3FN3A 3L5JA 1QYGH 1D5ZB 1NGPL 4L18A 1A6WL 2DEXX 3ARBA 4Z77A 4ZPTB 3AFLA 3ARRA 5JIKA 3CH1A 2IAMA 3GHEH 5B3NA 4XNZB 4KDWA 5JW4M 1DVFC 3VXTA 3PREA 4TNVK 2Y3AA 4UQEA 4ODUA 3RX9A 4Z7UE 4PJDA 2D31B 1RUAH 3II1A 3MRHB 1ZHNB 3GHBH 3L3GB 4X99A 1J5OL 5FCUH 4A38A 4U1NB 2DKUA 4IMKA 3VWKA 2Y36L 1JPEA 2TAAA 3ELAT 2ATPA 4XN2A 3AW5A 2BC4A 4NUGH 2XKSA 3RY5A 3UYOD 2YPLB 1E8ZA 3O4OC 2O61A 4TUOB 5DVLA 1FPTL 3I3DA 3F00A 4I0PD 1E28B 3BUPA 1HHJA 5JNYB 3HI1B 3O3BB 3I50H 2PW2B 2HPTA 1G0DA 4JFEB 1TITA 4MAZA 1VLXA 3VW3L 1KN2L 3B8SA 5GGUA 1IM3B 4ANVA 2YC1B 1AG0A 4ZPTA 1X5HA 5IBTL 5TE4H 4JJOA 1LYQA 4UDUA 2BNRA 4AENB 2BO0A 2NY3C 2HKFH 4AQEA 4KWUA 3KLHC 3OR6A 4FS0A 3S88L 5F0LB 1URLA 1YEFH 2VLRE 3PGDB 5JOFB 3LZQA 1UA3A 4FXLA 5C0BE 4JHUA 4JZJC 3IKCA 3V7AE 1JZJA 4M4RA 1U0QA 1UB6B 4M1CC 3TJPA 4OLVL 1A6AB 1TQWA 4YDKL 2R0ZL 1H9DA 2XZAH 3SCMD 2GK0A 3BCFA 4NP4L 1HH9A 1I82A 2GT9A 3TJHC 3TT3H 4LCWB 1KTKE 2FWLB 2VXQL 4P2RB 1U92B 3RWJA 4ADIA 5JXEA 1B0GB 4K23H 4QHLA 3WLBA 4OFKA 4MQSB 1IC5L 1ZAGA 1CDIA 4MKTA 5ITBL 1BFSA 4MA3A 3ASOB 2QHRL 5IMMA 2EUXA 2YXWA 4Q6IC 3BFQG 3K2IA 4NDMB 1D5BA 2XYBA 3PG2A 2WKOF 3GMPB 1QO3A 3MNDA 3V4LA 1KMGA 4U7MA 4FQCH 5JPMB 2AMUA 1UB5A 3JTBA 4U05A 3SE6A 2ZG1A 1T5XB 3DGDA 3STBA 3OKLB 4TQHA 4NZFA 1KEML 3Q6FA 1A1OA 5LGJA 4PRDB 4EDXA 1EUUA 4ENED 3RX8A 1I3RB 2EDJA 2VQ1A 1XL6A 3LJ3A 5K93A 1FF5A 4HIEA 5EBWA 2BS8A 1DN0B 1AE6L 3PUUA 2ZCLH 1GHFL 2ICEC 3RA7H 1L0PA 1ACYL 2HWZH 4FFVC 4H8WL 2APVA 3FTWA 3BVVA 4P5TB 3ISWA 4EMZA 3QXAB 1A9BA 4Y2DD 3NFSH 4TRPH 3SBPA 2PWGA 3D25A 2JFCA 4I2XA 4Y9FA 3CMOL 3E3QC 2IQ9L 3L4XA 1LQBC 4RGOH 2ARJA 3EO0B 4DEPC 4PTUB 4Y19B 1HH6A 4J3VA 3TJEL 2DIJA 2E8YA 3QXUA 5DDHB 3MU3A 1U3HC 4I89A 4JO2H 5ALBL 1ZLDA 4MJID 3B83A 3RKDD 3LMJL 2OSLA 5EB9A 4EZMA 1FZJB 2NZIA 4EEEA 5ADOL 4BXSV 3PL6B 1GZPB 3BGFB 4Z0XA 4PS4L 4WI4A 1QFWM 1OV8A 4QRPB 3VFNB 3SBQA 3ZVVA 3RVTC 4AQ8C 2WYZA 1QYGL 3GJFB 4NQEE 4N4YB 1NAML 4YGVB 4FQQA 3TA3B 2R2HA 4JO4L 5ITFB 2HCZX 4ADJA 3AXHA 2YRPA 1RPKA 1AH1A 4HLZG 3FW6A 4L3ED 4RBPK 2BNUA 5GGSY 2LOEA 4KJQD 5CO1A 5I5RA 1RVFL 3HHRB 1SLVA 3GIVA 3FMGL 5GS2D 2DWDA 2FLBT 3TBTA 3VGBA 3B6SB 2OR7A 2FRGP 3EAKA 3KZ8A 4XVTH 1M6OB 1ML0A 1T83A 4KX7A 3ZQ9A 4NUGL 3LRLA 4N9GB 4LPWA 1B88A 1HSAB 3ZT7A 3P4LA 4HBCH 5IV2A 1M05B 3IWVA 3KPOB 5J56B 2HVBA 4B5EA 1L9NA 3KPOA 5CZRA 3FQ4A 4P5KA 1N64L 4Y2DC 5D1QB 3V5HA 5H2BB 4GRWB 3HS9A 4YDIH 2CJSA 2VO5A 4P3WA 3Q8CA 4AQOA 1EBAA 2AZAA 3QCUH 5CEYA 2J43A 2XN0A 3SY0B 1FAIH 3EFFA 4NC2B 3NABH 2APBA 4IRJB 3INUL 4FQXA 3FF8A 2NDFA 2XC8A 2R29L 4JPVH 1A0QH 5G4OA 4OM1L 3KVPA 5JPMC 2ICWB 5AL0A 4OV5B 3MGOB 1AXTL 5KYNA 5JIDA 3B7RL 4PJAA 3TO4A 3SODB 2OP4L 2V6HA 4JFXB 3ZBMA 3SB3A 2WBXA 3VXUE 3CZJA 4UM8B 3O4LA 2CIKA 5BUPA 1UH3A 2X38A 4UT7H 3UTPE 2JE8A 1L3NA 5LQBL 1FHGA 3CBRA 5FHAL 3AUWB 3BESR 1OQOA 5DT1L 5D7LB 1PG7W 1IKNC 2Q87A 2RD0A 3HOGA 4L1SA 4Z1PA 3FO1B 1G6RH 4XMVA 2R0KH 1M71B 4QLRA 1KEMH 3OKMA 1PPIA 2B1HL 4A37A 2VIRB 3S4SA 3ABGA 1CTMA 4XWOD 1FP5A 3GSRB 2NXZB 2HJFA 3BYYA 3PXHA 4PRNB 4N9OB 4NKMB 1HL5A 4LVOB 2A0LD 1B2WH 5TE6L 4ORZC 1JI2A 1F00I 1XCXA 1C7TA 1W0WB 1A1NB 3K6OA 3BZFB 3PWNA 3N1FC 5A40E 4JM4H 3C5SB 3ULUH 5EU4B 4WF7A 3UC0H 5ACLA 5I6OA 4XPFH 5I26A 1JN6A 1G7IB 2WCPA 4WSJA 1RZKC 2GJ6D 2IPUK 1UCBH 3RWCB 4PJEE 4MX7A 4ONGL 5D4JA 3NIFF 4V2CB 5HPMB 3D05A 4KQ4L 3EBHA 1BJMA 3RDTD 1JZFA 5IROD 1QBLL 5CJQL 5DS2A 2WWMC 5I6MA 2AV7A 1KCWA 5I73C 4ODVL 1AGDA 2BSDA 5HJBA 4X6DF 5E03A 4FAAB 2JH2A 5KBLA 1HKLH 1D5RA 3F7YA 2QJDA 5KG9A 4XCNB 2B14A 3MUY1 5B7EA 3ALXA 2FBRA 3MV8E 3S4SB 4E9XA 4PG2C 2CO3A 1MCNA 3LZOA 4X5WA 1D2PA 4QXUL 4PY8I 1H3VA 3I3BA 5E2JA 5GGTL 3BPOB 2C3XA 4YSAA 2WTPA 3UCRA 1HXMB 3FB5A 4U1SA 3SJVE 3WTXA 3CDGB 2IADB 4HEME 3L1OH 5LNEA 4KI5C 1J0JA 3Q8AA 3ME0A 4O58H 4X8JA 1W0VA 1SOXA 3TYFB 3WFCL 3D51A 4HOXA 5MENB 4XOAA 1PD1A 5F7BA 1UM4L 2OJZH 2ZCKL 4GJTB 3AREC 2B1AH 2DM7A 4I9XA 5C3TA 4X4XB 4TPRL 4QOKD 3MOQA 5HYJD 3MN8A 1A3LH 3CFEA 1JPSL 2DYPA 2H2SD 3FH5A 1CDGA 1OZTG 2FSEB 1U92A 2HKHL 1GW6A 1TJMA 1XH2A 1TQCB 1L6PA 1NBQA 5DMJB 1U95A 2BS9A 2GYSA 4F2EA 4U1JB 1RLWA 3EOYG 5IB1A 4A68A 4UDTB 5HY9A 4L4TB 4U1LA 1TCRB 1U2HA 3EOAB 5DMIL 1TVDA 2B2XH 3TIDA 2XG4B 3T4AC 2F2HA 5AZEH 5HDWA 4X8CA 5E4EB 2YMXH 3BW9B 5AAWC 4O2EB 5GZOD 1F4YH 1PKQA 1XCTB 3CZGA 1KWGA 5AB2A 4BJLA 3CN1A 5IESL 2MFNA 3UYPB 2MEJB 4XBPB 2BHZA 4GKSA 4XO5A 5B38A 3ZE0E 1I8AA 2FEDD 3BFOA 3WV0A 1E4JA 2FGZA 4OBSA 3WIHH 3RY6A 2DQUL 4YHKL 4MCZA 2DIEA 2EYTA 5LAPA 2OMVB 1G7QB 2XVGA 1G4MA 3GMOB 2OMVA 1RUQH 2XWTA 4R0LA 4Z7QE 3V0VB 1VEPA 5CN3A 1M71A 2A4CA 4ONFH 2A9NH 5ANMB 5KBDA 1RHHA 5JR1H 4CSSA 2PF6A 5DJ8A 1TOXA 3MLZH 3HG1B 2ENYA 1OD9A 2NNXA 4NM8H 5C0BA 5K1VA 3STLA 3TF7C 3APMA 4WFGD 3HPLA 5LWYL 1E8YA 3GS4A 3IDMB 5D9SA 4G6FB 4KGJA 2EADA 5SWQA 4EIUA 4HC1A 2YD7A 3AU0A 4AC2A 4NQSA 3VD0A 1DFXA 4GRLB 2V8LA 1DE4A 2NY5L 4ZFFA 4J23A 1R3LA 1FC1A 3SGEH 2CXGA 2Y36H 3GJEB 4I9WD 4DGYL 4IHBA 3LRHA 4L48A 2O5YH 6FABL 1F8TL 4OJFL 5DRXB 3WNOA 1FH2A 4N0YH 2I9TB 4WTXA 1ZT7A 4ZXBB 4WHTA 4UZGA 4AGOA 3D18B 2TSBA 3MO1A 1D6EB 4KHTL 1ZLVH 2VC2H 4JVPA 4MJ5A 5FR3A 4MBRA 4XX1G 4GAJL 4ZJ9A 4H5SA 1PLBA 2D7NA 1H5BA 3FAXA 1LTXA 3MRDB 1CXHA 1QVOB 3D87B 3LQZA 2GI0A 2HG5B 4Z76A 2CMRH 3CPLB 5BVJA 2X2HA 3IMRA 5HDBE 3SDXA 1XH1A 3BLBA 3FF7A 4P06A 4QF1A 4AMKL 2AABL 1G9NC 5DHXB 5D2LF 2H26B 4F2MB 4QD2E 5DS1A 4QXGL 1CF8L 3AREB 1NC4B 3MA9L 3CZLA 1ED3B 5DWUH 3BE1H 3A6BL 3QDGA 3LCYA 3QO1A 4FJ6A 3V95A 1FLRL 2ENJA 3BVUA 4ZTOL 4PJ5D 5CJXC 1UD2A 2MTAA 3J7HA 3L6FA 5L6YL 1KIPB 2C9XA 1YEFL 4KTEH 4H2CA 4NP4H 4OCRH 1J0ZA 5I1LA 4F58L 3GLAA 3QJZA 5I19H 5BRQA 2NCMA 4DESA 4KXZI 4HK0B 3FO9B 1RIUL 4AOFA 4R8WL 1OAZH 3CUPB 1GJUA 5JR1L 1JHKH 4N2NA 1SF5A 3RVVD 1UC6A 2OJZL 3HNVH 4JVUA 3ZSTA 4KV5F 4OFPA 2XQBH 4LSUH 4GAAA 1XCWA 1WIPA 2QTVA 4PR5A 4NOBA 1Y18B 2AV1B 3QIUD 3ZO9A 3FOLA 5KVDL 1V3KA 1S9VB 5IFAH 3C5SA 4JBSA 1EEYA 1X7TA 3L3GA 3IRPX 3RIFF 3HAEA 1IGIL 25C8L 1U8PB 5LBVA 1CGXA 2AQ1A 3EFDL 3UTQA 1SJEB 4L3CB 3ULVE 4MSWA 3X17A 1JDDA 5D7JB 2RALA 3OLDA 3BAIA 4NNXA 3LZFH 2HWZL 3SE9H 4KVNL 2Z8RA 5JO5B 1J7VR 1GYWA 2ICES 2JXMB 4E5XB 4ZS6C 2X4UB 4ZUWB 3L4CA 1IGJB 5EIQA 4Q9RL 1BF8A 1IGJA 2J72A 4UIMA 2BP5M 2G2RA 1DUZB 3RFZA 5GS0D 1GTNA 4MNQD 3D09A 4OM0H 1NDTA 5EIIG 1D9KC 3MCKA 4NS0A 2V2XB 1D2OA 1BD2A 1MREH 3RU8L 3DX6A 4WRLA 1G1YA 1CF8H 4H0LC 3S9DB 3WY1A 1CPUA 1DVFA 4PJ9D 4QWWD 2M83A 1JN6B 3N43F 4FDWA 4X6CF 5CP3H 3CHPA 5AKRA 1YN6B 4KRPD 1MLCB 1EGJA 3ECUA 5ISZB 3K1KC 4IMKC 4TSAH 2BK8A 2CGRL 4ZUUB 4OKDA 2Q1EA 1EFQA 3FO0H 4MAYD 3IGUA 4WGWB 3VQ2C 2WBJB 3S3PA 2V9QA 3M1OA 3S36X 4OU3A 5I5JA 1DO5A 3VUAA 4ZTPH 3FQTA 4H1LA 1QSFB 2R1WA 2R1XB 4U1MA 1ODAA 1L6ZA 1OB1A 1U8MB 5DJZB 5JQ6H 3ARTA 1HX0A 4ODSH 3GZKA 3P3SA 1TZGL 4CSPA 3QZWG 3VQMA 4EN3D 1IC0A 3LPFA 3VXNA 1A6AA 5E7BA 4EVNB 2XVKA 1P6AB 5GRZA 3NCJL 1E8WA 3HUJB 1A3RL 1XCTA 2ZWLT 3MFGB 4KHTH 4MA8L 1F2XK 3HS0A 1KV3A 5CXPA 5A2CA 3HI5H 3HZKA 4RISL 1DO6A 2FECI 4KKQA 1CGYA 5D70L 3SYCA 5DS8A 3CHOA 3DXAB 1WFMA 4NNPH 4W6WB 5I1KL 4DZ8A 1N26A 1RQ5A 4YBQC 4FP8L 4QJ3B 1U8OA 4ELMA 3DGCR 1OK0A 3APCA 4G7QB 3LKQB 2ROYA 3DJRA 2CGZA 2R2HB 3V0JA 1IBZA 2F5AL 4FXTA 1QW8A 4TM9A 4G2AA 1T6WA 3BWAB 3LIZA 4RRPA 1QNZL 1AGBA 5C0BB 4EQ3A 5BOPA 1IM9D 1CU4L 3R06A 1FZJA 3QFDB 5A6MA 1DBBL 2EDXA 4K5OA 1SXBA 5IJCC 4M9OA 3L1GA 2O5ZL 1NCOA 1ZANH 4G80B 3HUJF 4ZX6A 4F9PA 4GMTL 2QLYA 3ULUF 2X9XA 1YNLH 1RJYA 5F3BA 4W68A 1GKEA 3LSOB 4IBLT 3TH4T 4RDBA 4P3DA 3I9GH 3B9KD 5EF3A 1BAFL 2WANA 4P3DB 4XR8C 3NJGA 1YEKL 2E9WA 3GXPA 1JCVA 1KB5H 1Q4NX 5EZIH 3JZYA 1KENH 3VU1A 4ZS7H 1YPZF 1H0DA 1R75A 2CM6A 3N40F 4HXBH 4ZOCA 4ZZFA 2IC2A 3WSQL 5GGQH 2K9FB 2K7PA 3DX4A 2IGFL 3FCBA 4FOMA 4IW4C 4JHAL 4AVIA 1EV2E 2ZNXA 1EWHA 2B1HH 4R6UA 1NUGA 1NBZA 1YNKH 4WWKC 3MLYH 2CK2A 2JKNA 1GOGA 4KZ0A 1CQKA 1FG2B 1K4CA 2WQXA 2XLLA 2VRQA 2X4QA 1EMTH 2HJFB 4FFZL 1NCDH 1U8KB 4YZFF 4YGVA 3TA3A 3RVUD 1FNSH 3VRJB 4F8TA 1OVZA 4QPEA 3PL6D 2E27H 4MDJA 2Q5BA 3ZMRA 3MREA 5L4JA 4P2QA 4HYTB 3KPRB 4JQXA 2OBGA 3SQOH 3T8MA 1LK3L 3KPSD 4WU5B 2H2PD 3N41F 1DEDA 3V0DA 3L5XH 3QPXH 2R0WL 4AYSA 1HWHB 1QSEB 5E6IB 2WBJD 2WXNA 3D50A 3P3RA 3RU8H 5EEZA 3KH4A 3PWVA 2JTYA 1KACB 1TJHL 1MCPL 4PJBE 5KYWA 1YPZE 3FO1A 3KEDA 1GRWA 1M2OA 3BPOC 4FZ8L 5JNYA 3RGVB 3KGUA 3TIEB 5KYUB 2JK5B 4WUUD 3V0WL 3PAVA 5HBBA 1XR9A 2DQDH 2UUDH 3JWNE 3SDAC 2AK4B 4F27A 5JDJA 3JV4A 5FUZH 4UM8A 2QPUA 5JIPA 5B8CC 4XO8A 1A7QH 1XEDA 3ABKB 2EC9T 4R97C 4MXVF 2AZUA 5EEWA 4NAQA 1RJZA 3ARDA 3Q9PA 3A4FA 2V2TA 1N5YL 5EU5A 4GKNA 4AG4H 35C8L 5J57B 4Y5VC 2ED6A 3BIKA 1DSYA 1Z9MA 2NY6B 3HI1A 1X5YA 4NBZB 4A2EA 1IT9L 5EO1B 1GC1L 3IDIA 4ZW7A 4D0DA 4IRJD 2C4FT 5AW9B 1T22B 1PKOA 2XBZA 3KL3A 1G1OA 5ALCL 3N55A 1X4XA 2EYRA 4HIIA 1T21A 1CE1L 2PP7A 3QQ3A 4X6FB 4HJIA 4P2YA 3ZDWA 4OIIH 4QHLB 4ZOEA 1LWHA 4N6RA 1K2DB 3B43A 4U3SB 4F24A 2C9VA 1BZ7A 1CUOA 1U42A 1DP0A 2OMTA 4UOZA 4IOFC 5DGRA 4TNVF 4J12A 1YUHA 2CO7A 5FOBA 2J56A 5CP3A 5DHVH 4Y19E 1E5ZA 2OKMA 4HZ1A 3SKJH 2Y5QA 3JWOL 3KPMB 3VO0A 4PB0H 5C97A 3UBXI 4G6KL 4K7FB 3NPSC 3NACH 3RX5A 4MX7B 2BVOA 5D93B 5H35A 1MNUH 4JS7A 3QPXL 4D8PB 2OMZA 4ZD3L 5J5EA 1S8DA 3J8F7 1NGZB 4P4RB 5FV2A 1SQ2N 5DD3L 2OSWA 3VFNA 2R1YA 3QCVH 3MVSA 4FNPA 4GQQA 5JHDD 4P2CG 1P6FA 3OQRA 2FUQA 4HPYL 5KUMA 3VQLA 4DGIL 3BKYH 3LEYH 1MCQA 1DJZA 1YNTA 1JPFA 3CLFH 4KXZH 1X7SA 5C0JB 3NPZB 4HX1A 2VDRB 1R5VB 1WZAA 2W65A 5EFIB 4AYFA 4C4BA 5FUZL 4Y1TA 3DMMD 2APWA 3MLXL 5CWSB 5EEXA 1JYVA 4BCXA 5AB9A 1AHWC 3ULVL 1PAMA 4L29B 5D1ZB 2K8QA 3MRMB 2WXFA 2Y07L 4JFSA 3CLWA 5DLLA 2XBTA 2ENQA 3C8DA 1E5CA 4PJXB 4XCNA 2P28B 1RIHH 4XNYL 3S35H 5HGBA 1GGYA 4CKQA 4PYGA 1IVTA 4D0BB 4IOIA 1KY6A 3AXLA 4NKDB 4NRXA 4YX2L 1FIEA 5KVDE 1ZLVK 3IDNA 1G5AA 1XHHA 4L1HA 3RP1A 2HAZA 1ZHKB 4DETA 5E6IC 2IAMB 4P04A 1JGDA 1GJWA 2IG2L 1HKFA 5E23A 3B56A 1KXTB 4PGEA 3GSQA 3G5ZB 3HVDA 4ZFGL 3K72A 1YNTB 2YAEA 4JDVB 1HCFX 5GRWA 2PP8A 4PLOB 3BVNA 2X89D 4P9ML 4FQXB 4YDIL 4E2OA 2EABA 4FQLL 1CYXA 3ZHFA 1QUNB 2EVJA 2GEQA 4R7LA 1NBVL 4IEFA 5DC4B 5IB5B 2FQGA 4GOSA 5C0GB 1EX0A 3SDAB 3HMXA 1FAIL 1JCKA 5TGBA 4B0MM 1WE5A 3SO5A 3REVB 4G5AA 4I0KA 5C70A 1IL1A 5A6LA 3WIHL 2MPAH 2WO2B 3IJHA 2YSSB 4P2QE 5KS9A 2R15A 4JO1H 4R90H 5B39B 1VF5C 1AC0A 3EH4B 1V7MH 1PZ2A 2XTJB 3GMPA 2CR6A 4FNQA 5IQ9B 4GSRA 4JN2A 4JO3H 3WKQA 1NBYA 5IG7A 4PJFA 1IBYA 4EBQH 32C2B 4OLXL 3BX7C 1CBJA 5EUOF 3GXTA 4RMBA 5K39A 4APQB 3NEOA 4XP1L 1PVHA 2BVQB 4DT2A 1ZHBB 1CD8A 4RGMB 5JUEH 3FBKA 4LSUL 2FLMA 1PKQE 4Q0XL 4OCWH 1MKFA 1S7QB 2H32B 2ZUSA 4RMQA 1C5BL 3QQ4A 2KZ1B 1W15A 3LQZB 5IREA 1YYML 2J1YA 3QUYD 1ADQA 4LT7A 1G7QA 3GMOA 3LQAC 3RAJL 1KC5H 3DOSA 4NPYA 3GB7A 3PP4L 2WMPA 3FU5A 1CN4A 5J1TC 2F54E 5EA0H 5GJSH 3IXTA 4M43H 5LN4A 4AQ1B 4N90D 5AUMB 3G5VB 4R9HA 3B2XA 4BZ1A 2CDEB 4U1IA 5LXVA 3OF6D 4JZOB 4NPKA 4ZXBA 4N8CL 2R2BB 1RZKL 4NQCA 4XT1C 5GGRY 4G7SB 1UWEL 5EOQL 1B0WA 2QKSA 5I0DA 2AJVH 1BIHA 5FO8A 3ARFB 4L5FL 1A3ZA 5KSAB 2VQ1B 2BOCA 5JW4R 2PO6C 5BUAA 3S98A 2DLFH 2WSKA 4XPBL 2Q2EB 1PX8A 4KMLB 2WBKA 3BWSA 1EEZB 3IDUA 5INCA 1LD9A 5DD3H 3BKML 2GC4C 3CZUB 5K9QI 5BOJA 4N87A 3ZE0B 4O4YL 1TNMA 5E70A 2B20A 4LLUB 4K5LA 1BZQK 5E8EA 3RNQB 2BVYA 3HE7A 2IBZY 3S8GB 1PD6A 2NXZD 4N8VB 3H2QA 4F7CB 3RWHB 4S1QL 1J87A 3BCDA 2WGNB 1G7IA 4Q2ZB 1BXUA 1UD3A 4G8AC 4PS7A 3FRPG 3G5YB 4Y4FD 3EGXA 2XZQH 3PQYD 1UH4A 2CGRH 4QRAA 1V3MA 2KI6A 3IB4A 3GSXB 5IJKC 4RWYL 4DKDC 5FA4B 2FWOA 4F92B 3UAJD 3GTNA 4F8OA 1U41A 1U8QB 2ZOTA 4FFYA 4OLWH 4QRUA 5HHOB 4Q74A 1QFHA 2R0LH 5DZNA 3FH7A 1WISA 1P5UC 3BDBA 4MASA 3T8VA 2IXQA 2YARA 1CFSA 3ZL4H 1LEIB 3SE8L 5JORB 5EBMB 3LXCA 3QDGB 1PJ9A 4PS3A 3FUJA 4Y1AA 4NO0D 1LO3H 5L8KB 1E9QA 4FHKA 5IVXE 1J1XH 1NANI 3ZT6A 3H7BB 3IETB 5JHDA 4KUZH 4X6EB 3VXNB 3BLPX 5FCUL 1C08A 4V33A 4HK0A 5C7XL 4NJ9L 3C75A 4FXKC 3RL1A 2BNUB 5BPPA 3CU1A 5DI8A 3LKPA 3W3BA 2ED8A 3RDTC 4AEIH 4HIJB 5DJDA 1U30A 3SZKC 3BDXA 3H1ZA 2F8OA 1R3JB 4CC4A 1EZLA 2NNAB 3G3LA 2Z31A 3CZFB 3NCJH 1SQMA 1U3YA 5EDXA 2EUZA 1MJ8H 2AGJH 4U7KA 2A74C 1MVUA 3RFRA 1UXMA 2J4WH 4RCAA 2DL9A 3W2DH 1TZAA 4Y16D 2Y7QA 4RSYA 2IH1A 5KOVC 3TT1H