2BWIA

Atomic resolution structure of nitrite -soaked achromobacter cycloclastes cu nitrite reductase
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwiA02
5I5JA 1ETJA 2IH8A 3GDCA 2PCFA 4A2GA 1PLBA 2HLEB 1KBVA 2Y69B 2ZONA 2LLNA 3D12B 1AG0A 4NERA 1E5YA 5PCYA 4BWWA 2B08A 1KDIA 3UACA 2RACA 1BAWA 1X9RA 3NP3A 3ASNB 2R7EA 2TSBA 2YAFA 4K9JA 3KW7A 1KV7A 5FC9A 2BWDA 1PZAA 3FU7B 4UANA 1ASPA 4YSSA 1IBYA 1OF0A 2EIJB 4GP8B 3FSZA 2XUWA 2UX7A 3CVCA 3GXUB 3H4FA 3X1EA 2W8CA 1SHWA 2UXFA 5B1BB 4F7KA 3NJMA 1BXVA 3NJKA 3T6ZA 2FJSA 8PAZA 2YAPA 1W8EA 2CCWA 2I7SA 3OMIB 4L0PB 1J9QA 4KO7A 3UAEA 1IUZA 3NYKA 1W6LA 2P80A 3S3CB 3H4HA 4G71B 3FQYA 4MFHA 1JZJA 4DPCX 4KNSA 3FSVA 2AZUA 2GB2A 2GC4C 3H56A 3S3DB 1FA4A 3FYEB 2AVFA 2R7EB 1PZCA 1J5DA 3N55A 3N2JA 3CZUB 3UAAA 3OMAB 1TU2A 1AIZA 1BXUA 4KOCA 4A68A 5D4JA 1PY0A 1NTDA 1WS8A 1AACA 2X87A 2DYSB 2JKWA 4E9WA 1AS7A 4G7SB 4AX3A 1A8ZA 1WAEA 2BZ7A 4YSAA 1JOIA 3OQRA 3T71A 1KDJA 2CAKA 2QDVA 2OV0A 3NJJA 3WKQA 1XB6A 3FPYA 3NJFA 4GY4A 2XVBA 1MG2C 2H5UA 5F7BA 1PMYA 1TKWA 2WSDA 1WS7A 1A4BA 2J55A 1ILUA 3UADA 5I6LA 1AZCA 3FYIB 5B1KA 4GXFA 1IKOP 2CBPA 4GP4B 2IDTA 3S3BB 5I6MA 4M4RB 2H3XC 4YSCA 1T5KA 2YARA 1FFTB 4P5RA 3ABGA 1HAWA 2EILB 1GY2A 3ZIYA 4W9ZA 4DP1X 1AG6A 3CVDA 3NT0A 2BP0A 2GC7C 3WG7B 4DP0X 4HAKA 4YL4A 1BQ5A 2UXTA 1ET7A 3X2QB 1QNIA 1GW0A 2HXAA 1PAZA 3JT2A 1AOZA 5TK4A 5B7FA 3PLYA 1WA2X 4QKTA 1L9OA 5I5MA 1B3IA 4YSRA 3OM3B 1GR7A 3TBCA 1CUOA 1JZEA 2HX9A 1EZLA 4CSPA 4BXSV 1PNDA 3NJNA 2QPDB 4HALA 3FU9A 2CJ3A 4DP2X 1HAUA 1ET5A 1OCOB 4HCIA 5D4IA 1SDDA 1OOWA 1L9PA 2FWLB 2GBAA 3SBQA 4BK5C 2GI0A 2HX8A 1PZBA 2MTAA 4G7RB 1JVOA 5I6PA 3T6VA 2BZCA 1EHKB 3TASA 2FT6A 2N0MA 1JZFA 2BP0B 1NWOA 4YSDA 2XV0A 2XXFA 3QJSB 1OE1A 2ZOOA 1ZDQA 1FWXA 3MBWB 1SF3A 4KO6A 2ZWNA 4W1TA 3ZDWA 1PF3A 3NJHA 4P5SA 1YLBB 1JERA 3X1GA 1SFDA 3FQ2A 2VW4A 3ABMB 1I53A 1M56B 2YXVA 3SBPA 1GS8A 2I85A 4PCYA 2GIMA 3CG8A 5I5IA 1R1CA 3ZX1A 2XV3A 2QDWA 2HRHA 1KYAA 3TBBA 2DWTA 4JHUA 1OCRB 1V55B 3CDZA 4A2FA 2W88A 3V9EA 1L9QA 2XU9A 2FNWA 4AKQA 4E9XA 3GYRA 2VM4A 3FU8A 3DIVA 1PNCA 3NSFA 4E9TA 5A7EA 4DP6X 4E9SA 1SDDB 4YSUA 1E5ZA 1OCCB 2VN3A 3KW8A 3AW5A 3SQRA 2XV2A 3AZUA 1AS8A 1J9RA 3QPKA 3NSYA 4KNUA 4AKPA 2IH9A 1AZBA 2H47C 2XXGA 2YAEA 1QHQA 1SNRA 2PP9A 1AQ8A 3NSCA 2FQDA 4EF3A 1KGYE 1NPJA 1KBWA 1L9TA 2Y1AA 3FQ1A 4YVUA 3PCYA 4A2EA 4BDVA 1OE2A 3DTUB 4KOBA 2AANA 4E9RA 2FQGA 1WA0X 1TEGA 1IC0A 2IAAC 2Q9OA 3CDZB 2EINB 2MRYA 1XB3A 2QT6A 2J57A 1M9WA 4KO5A 1E67A 1RZQA 3PAVA 1WA1X 3ABKB 2PPEA 2QPEB 3PAZA 1OE3A 5F7AA 2YXWA 1JZHA 2VW7A 1JZIA 4YSEA 1UATA 2YAOA 3WNIA 3NJLA 4E9QA 1ZDSA 1NDTA 2UXVA 3UGEA 4HHGA 4HZ1A 4BDVB 2FTAA 2GSMB 2DY2A 2PCYA 3QQXA 2BP8A 2DYRB 1AZRA 3FSWA 1GS7A 1OV8A 1AZNA 1CURA 1NZRA 2IWEA 3DKHA 1A3ZA 2J5WA 3UABA 3RYMA 4BWUA 4YVNA 2DWSA 2XX0A 1DYZA 3QJTB 3L45A 1SHXA 6PAZA 5I28A 3QJRB 4DP4X 2YAQA 4KNTA 5AZUA 1HFUA 2HRGA 3WNJA 4CSZA 4GYBA 4E9VA 3BQVA 3NP4A 2WO2B 2JXMA 1J9SA 2YAHA 3OD3A 4RH4A 1RKRA 7PCYA 2FT8A 4AI7A 3G5WA 2CALA 1AZUA 1N70A 1ADWA 1AR1B 2P80D 3IN2A 5B1JC 2PLTA 3T6XA 1IBZA 4A2DA 1SFHA 2ZXWB 4UF7C 2IWKA 1M57B 2BP8B 1URIA 2PPFA 2EIMB 5AFAA 4HHWA 3C75A 1ID2A 3PAUA 1NIFA 2B3IA 2PPDA 1NPNA 2OCCB 4DP7X 3V9CA 1KCWA 3EF4A 3MX0B 4ENZA 1NIBA 2I7OA 4BWTA 1CYXA 1XB8A 2XLLA 1JXFA 2BWIA 3S8GB 2CUAA 4Q8BA 3EHBB 2XX1A 3AG4B 2FQFA 5EHFA 2GHZA 4M3HA 1KCBA 3SBRA 2FQEA 2BW5A 4N4YB 3WI9A 1NIAA 4DPBX 4ZK8A 2IWFA 3JTBA 1SJMA 4GP5B 4DPAX 1A4AA 5I26A 4DP5X 3AY2A 1A4CA 3NSDA 3TU6A 2X88A 3EH3B 4FA7B 1ZV2A 7PAZA 5I6OA 1XMEB 3ASOB 4HCGA 3X1NA 1ASOA 1CC3A 2WO3B 2YQBA 1MG3C 5E9NA 2XWZA 3PPSA 5AKRA 1ILSA 1RZPA 2VW6A 3NJIA 2BO0A 2VMJA 2PPCA 1L9SA 1AANA 5ANHA 3PXLA 4DP9X 2VSMB 3WIAA 1AAJA 3FPXA 3AG3B 2VSKB 3AG1B 4KO9A 4G7QB 4JKNA 1MZYA 2OJ1A 2HX7A 4YSOA 5B1AB 4FAAB 5PAZA 4A2HA 1E65A 1JXDA 9PCYA 4N8UA 1V10A 1JVLA 4NAJA 4HIPA 5B7EA 2PPAA 3IN0A 3S8FB 3IE9A 2YAMA 3ZBMA 2AZAA 4QLWA 4F2FA 1CYWA 6PCYA 4G72B 3U25A 2FT7A 2DV6A 5I6KA 3X1BA 2VM3A 1NWPA 4TXVB 3QJQB 5B3SB 1BXAA 1AS6A 4G70B 1NIDA 1V54B 4NB7A 5B7MA 1ZPUA 1TEFA 5IY5B 3TA4D 4HCFA 3QJVB 4WTQA 2XYBA 4YSPA 2IDQA 3T9WA 1F56A 2BHFA 3AG2B 1RCYA 4YSQA 4JHVA 1L9RA 4AZUA 4A67A 3HEIB 2PP7A 1PCSA 1QLEB 4A66A 1X9UA 1ZIAA 1ET8A 1JXGA 2PP8A 1BQKA 1GY1A 2UXGA 1NINA 3FT0A 3CVBA 3IBOA 5TK2A 1JZGA 3OMNB 4YSTA 1N68A 1NICA 1J5CA 1BYOA 1VLXA 3NJGA 2IDUA 1E30A 2IDSA 5LDUA 3EH5B 1PLCA 1ASQA 4WKXA 1W6WA 4F2EA 1BYPA 5D4HA 5I6NA 3HB3B 4DP8X 1NIEA 4Q89A 3ABLB 3WKPA 5B1JA 1MDAA 3FS9A 4AKOA 2IDFA 1SF5A 1BEXA 3IEAA 1A65A 2E86A 3X1FA 3ERXA 3QJUB 1GSKA 1BQRA 1J9TA 2BW4A 2J56A 1ZIBA 2AFNA 3FU7A 4X4KA 2JFCA 1OCZB 3EH4B 1DZ0A 3T6WA 4PAZA 3BVDB 1PLAA 2HZHA 2Q5BA 2TSAA 4BXVA 1GS6X 2EIKB 2A3TA 2UX6A 2NRDA 4E9YA 3FSAA 4UAHA 1GYCA 1MZZA
chains in the Genus database with same CATH superfamily
2IH8A 4M5YL 5SX4I 4OM0L 2HLEB 2OMUA 1C08A 1VFMA 2H8PA 2R1XA 5D93B 3ZKMC 4LRNL 1UM5H 3FT1A 1YMHA 1NCBL 5IW1B 2X4QA 1KDIA 2WLNA 5BVJB 4HMDA 4I4WA 5FCUH 5FOJA 3V0GA 4BRJA 2R7EA 2WSPA 1HI6B 1BQUA 1WFTA 2VRKA 3WHE1 4JUSA 3US1A 5FC9A 5ICUA 3BXNA 4CMMA 1QW9A 3ZQXA 1AZZC 4GP8B 3KXFB 1BVKB 12E8L 2CHZA 4PB0H 4X5PA 4ZMTA 2G0KA 4X0NA 1SHWA 1XXFC 2DIEA 1MY5A 2WNGA 5DD6B 2P1YA 4MAUH 5CJBA 2KL6A 3MRIB 5JIHA 1LQBC 3MV7B 2R4RL 5DT1H 2G4GA 4NRYB 2A9MH 1TTBA 4M6NL 3ZOAA 1CO1A 4G1MB 3UAJC 2VSDA 2IAMD 2CO7B 3LRSB 3OXRA 3NYKA 1EJOH 1L5GB 4P07A 4DCQA 5DJ0A 1KULA 1CR9H 5DWPA 3GSQA 1T22B 3S36X 5D7HA 2F08A 4NWTH 4APQD 5KZCD 2AVFA 4DFHA 4ZSOE 4L4TA 2VT0A 2XPYA 2NY1D 5HYJA 3IBEA 5CLXA 1Q9LA 2HUEA 1RPUA 4UZUA 5J7CC 5AZ2L 3EBGA 1DLFL 1X5GA 3QRBA 4FQLH 5EBMA 2C9SA 3IVKA 1AS7A 2FSEB 1G9MC 4JY5L 1P2CB 1WAEA 5DYOB 2G3NA 2WB7A 2BLFA 1M7XA 1E42A 1RK1B 1OGAD 3B83A 4WHTA 4XNUL 3B3BA 2ESVE 1D5XA 3P9MB 3BAXA 3ZZSA 3CSYA 5DS8B 4YXHL 3HKFA 2H5UA 5F7BA 2OP4H 2V7NA 1FFRA 1UM4H 2GTZA 2GITA 5DRXB 3ZO9A 2AV1B 2ZXDA 5F7UA 5DC9B 3BIKB 1E6JL 3B5GA 3QI9C 4FZEL 4UTBL 4LB8A 4GKSB 4R97B 4KROB 3U36B 4WV1B 1RJZB 3HUJA 4X6CF 2RJMA 4LGSB 1MHCA 3M1CA 4NFBA 2CA4A 3CFQA 1MJUL 1QHOA 2P24B 4Z3GA 5I66B 2W80C 4JUTA 3VO0A 3WG7B 3ZTJH 1EFXD 3T2PA 4HEMA 5IK3A 2Z9TA 5H4ZA 5DMKB 5AW9B 2IEPA 4AL8C 3H0TA 4CADB 3X2QB 5CD3A 2HKFH 3O2VL 4ZW3A 3WLWD 3JT2A 5I74B 4DWHA 3BRFA 2IC2A 3LVEA 3KCPB 3MRQB 4FQQB 2BNRB 4N8VG 5I73B 1GR7A 3ZGHA 3I50H 5J6GB 3D85D 1S5HA 4M8RA 4NNXA 4BXSV 3WEXA 4RX4A 1ND0B 4LCCB 5FO8A 2ZP9A 4BFEA 4K8RC 2C1OA 5T5FL 3R8BB 3FULA 4KKAD 5E2WL 4MMXB 2VLLB 1L9PA 4FMFA 5JIQA 3QIUA 4JPWH 3MTXA 5I17A 2CKBL 1FZKA 1HCVA 5M7QA 3TV3L 4PTTA 4JM2A 2OX5B 2CG9X 2VZSA 2XPGA 2PCXA 4O2EB 3DVNA 3MRPB 4DQOH 2VJ8A 4OZHA 4FQIL 3TZVC 4OUUB 4QGYA 2ITDB 3Q44A 3WFBH 4W9CC 2K78A 2XG4B 5FIEA 4W1TA 2VLRA 3MFFA 2IPKB 2XZQH 3ARFB 3PGCA 3NJHA 1F02I 3ZDWA 1YLBB 3L4XA 4LNVA 1SFDA 3OB8A 3PWUA 3MNMA 1M56B 4LGPB 4ZNEE 3LKRB 3EDJA 1MDTA 2ATAA 4YO0A 2AK4B 1AGBA 1TQBB 3E1ZA 2FNWA 3H55A 4U1SA 1N0LB 4G1EB 1E5ZA 3FK3A 4ZUWA 4KKCC 1GZHA 2DOCA 4GB9A 3ZYZA 1Z5LB 2DDQL 1J1XL 4XMUA 2HTLC 4AKPA 1PFOA 2A9CA 2PTUA 3NSCA 3KLKA 2OYKA 3MJWA 1LLAA 4YHIB 1MFEL 3WXVH 2YD1A 3H54A 4H8PA 4PJBF 4BZ1A 3ZTNH 5D7IF 4DUVA 2QV4A 4CDHA 3X13A 5EEZA 4OKVB 1IFGA 4HK0A 4PJHE 4KOBA 5CLYA 4P9HH 3BQUC 5KSVB 1YNLL 2G0LA 4HPOH 4ZFZA 1PVHA 1QWNA 5B38G 4BZ2H 3QJHB 2XVKA 1UA3A 1CFTB 3B6SA 2EDJA 3CZGA 5CGYD 3BVXA 2VMFA 4HS3B 1I9JH 1E67A 1MCOL 3JYCA 4PJIA 4UV4H 5HTSA 5MERB 5SWZB 3F83A 5CR1A 3OR6B 1S9YA 4OFKA 1MIMH 2RALA 3SCMA 5FA4B 2YXWA 4ECNA 1A1OA 1S7RA 4D0DB 1LMKA 4YHZH 1U2CA 1CPUA 3UGXA 4MNQE 3O45B 1Q9KA 5EBWB 3ML8A 3P2BA 4QXUL 2ZTBA 4MQ7B 4ZW6A 1X7QA 3MLWH 3WNKA 2F15A 3F7KA 4EUPB 5HPOA 5IQOA 3IS0X 2BC4A 3UTSA 4XHQA 3WFZA 1IM9A 1HINL 4XN5A 4K7PH 4AQ1A 2PYEE 4R3SB 4ZX5A 1FAIH 5C0RH 5MEQA 1E7VA 4Z7WF 1WITA 5JPNA 3QRGH 5ALBL 1COBA 5C7ZA 2Y2WA 5L7XL 1FL5B 1KY6A 5D55A 5ANMA 4AW4A 2P45B 4Y2DD 5CBAB 4QRPB 3QG6A 3VJ6A 3D9AL 4XNMA 5DUPH 5F0JB 3P77B 1DSYA 3ARGC 5ADOH 1HFUA 3WNJA 4B9JA 5D5MB 3RFRA 4RISL 2KYIA 4M7JL 1NCAL 1QSEA 1VSCA 2A73B 4IRJC 4NO0A 2Y3AA 1KB5B 4XVUC 7FABL 4K71C 1WZLA 1AZUA 1N70A 4X4YB 2CK2A 3K6OA 1DE4A 1NGPH 1NLBH 3FOLB 3RY6A 2ALAA 5I18L 4DVRL 2VC2H 4BH8A 3ZRFC 2P5EA 4KXCA 1MHEB 1NAKH 1S3KL 3KPRA 5LNDA 2NYKA 2HJLA 4RAHA 5HHMB 4HW6A 5FUOH 5MHSE 1N8OE 1Z3GL 1FFOA 3UO1H 2QTEA 1JN6B 3QI9B 3PAUA 3X12B 5CM1A 1S46A 3MOQA 2QVFB 2GJ6A 3OMZA 2BIHA 1DBKH 3ZK0A 4OIBA 4ACPA 1JNHB 5CEZE 1Z0MA 3PRZA 4MAYC 5CGTA 3RA7H 5ENWB 3CE1A 2FD6H 2JXMB 3MV7E 5JDSB 1MIEL 3EYUH 3HE7D 1SN0A 2ARJQ 2FJGB 2K4AA 4H0IA 3V8OA 4BSWA 5I16A 2F8OA 3QQ3B 2IV8A 1XGUA 1NOFA 1DO5A 2XICA 3GSOA 4NKOA 5L6YL 1KF9B 1GJWA 2AXHA 5KVGL 3CFCL 5J9PA 3KVDD 4YPGA 4ELMB 4BQ9A 2Y72A 4PJEF 3DX0A 5GRVL 1CDBA 4J23A 2ITCA 1NFDE 4G59C 4FA7B 2X88A 3RU8L 3IRPX 1ZV2A 3L1FA 2OSLA 3D0LB 4XVOA 5KW9H 3QIWD 4NZRH 3RDTC 4NPYA 1BGXH 1VKXB 1XMEB 1TO5A 2Z0UA 2RGSA 5GSVB 2ATKA 5M95B 5DD1H 2AJZA 1PCXA 4JDVB 4DN3H 1N3NA 3KL0A 2ARJB 2O5ZL 5H37G 2VW6A 2NTSP 1UOKA 1EVUA 1A3QA 1Q38A 2DJMA 4TUUA 1L9SA 3Q2WA 3TZVB 1MXGA 3CN0A 3NK3A 1H5BC 5HJBA 3DI2B 4HIHB 3S5YA 2VSKB 1VCBC 2YRLA 4EZKA 2E7CA 3CFEA 1DN0A 4EQ3A 4G80A 4Y1AB 3V52L 4PLNC 1MAMH 1K5NB 1HNYA 2MQ3A 1DJSA 4JFDE 1A2YB 2RCSL 2BHYA 3IMWA 3HS0C 4LCWB 3UJIL 5DZ9A 1YEFH 2AZAA 2BSSA 5K59E 5D1XC 4L48A 3VRLE 4Y4HA 4QT5B 1I3UA 5T1LB 5EO0A 4O9HL 4PGZA 5D7KD 1GPOH 3ZRSA 5DR5L 1CFQB 1UCTA 3SJVE 5B7MA 1AHWA 3JWDC 5DRNB 1OK0A 1U4EA 1JPEA 1KJ2L 3T8VA 1D6EA 5E6IC 1Z5YD 3ZQ9A 4LPVA 2BHFA 4M62L 5CCGE 1A3LH 4KVNH 1RCYA 3QUZC 1NQBA 3SKJH 2UZIL 4UM9D 1P84J 4LFHD 3V0VB 3QFJA 3UEZA 1LGVA 3F7VB 1QLEB 2V9UA 1A3RL 5E9DA 2QSTA 3BQUB 4QTFA 1A5FL 4HIXL 3G6AB 4X9FA 3GJEB 43C9B 1Z0NA 3CPLA 3OKLA 1W72H 2BDNH 1D2PA 3ZN6A 2NCEA 4FCHA 4OM1L 2IDUA 4YHMH 1TTRA 4PJXF 2CJUL 3RGVC 3VXMD 1P7KB 3L3HA 1UZ6F 4PR5A 1KYUA 4FTVA 4P4KA 1HSAB 3L1OH 3V4VH 1CXHA 3VB9A 1EBAA 5KAQG 2Y1ZA 3V95A 3VNYA 4ODXB 4G8GD 3RUGF 4DP8X 1YECH 3GMMA 5DD5H 4Q14A 3O4LD 4LLYB 3SQOL 2RR3A 3LV3A 4EXKA 2IDFA 3PGFH 3STZA 4QD2E 4L18A 3RWEB 2AK4E 3K1KC 4I18C 5IHUL 4L8CA 3MCKB 2J88H 3VFTB 3ZXAC 5JHMA 2D4FA 3QJUB 4TQHA 4DOHB 1QBML 4FS0A 4HUUB 1FL6A 1DVYA 2V7NB 2ZYHA 5EBLB 3U2SB 2P47B 4L1LA 4NN5B 2CLZB 5F1KC 4J8RB 3F7PC 1S78D 3FH5A 2BSEA 3CLWA 4EI0A 4M43L 2W0FA 5EDXA 4LLDB 2WXRA 4C4KT 1E4XI 3EOYG 3QDMA 1C5CH 4LP4A 3ARGB 4LLQA 4M1DH 2BOCA 1HESA 2YK1L 2J2ZB 3LEYH 1DUYA 4OV5A 1IGTB 3RHWF 4P3DB 4IRJB 3MLRL 1HQRB 4WUUE 3WS3B 2F5BL 5JW4R 3NIDB 4K71B 3HAEB 1XGYL 1CGUA 3ZZQA 2VDLB 4Y8DC 3TXAA 4ANKA 1EHAA 3BKMH 3STLA 3F8UB 5IZ7A 1XF5A 1J0YA 4Y4FD 4MDIB 2IBZX 2EICA 2IOIA 1N5YH 4YDVB 4QHUA 3VVVA 1FORH 1YY9D 5EOQL 3WMSA 2OMXA 1BBJA 1XSOA 5SWZE 3KPNA 2F2HA 3PQYE 3KNBB 1YMMB 3O3AB 1J1XH 4NT6A 3FUDA 4AQEA 1INQA 5EZPA 3RIKA 4G9DA 1QFHA 3KPPB 5IB2B 2EDHA 4D7PA 3GXUB 1A6TB 3WUWB 5IMLB 5L2JA 4MAYB 1MFEH 4ICWA 5GJSL 4FDWA 4P2QA 1FZKB 3D34A 3JZYA 5HJ3B 2AXWA 3QFDB 2IQ9L 3SKOA 2DLEA 5AZEL 3U7AA 3N9GL 1OTUC 5E8PB 5E0QA 5GISH 2PCPB 1YEHH 1LE9B 4IU3B 4YFLI 1UENA 2V37A 2FJSA 2HA1A 4OCYL 4Q6IA 3WNPA 4KNQA 1TDQA 2CCWA 2Y7NA 3GMRA 1FH5L 1SQ2N 2R9HD 3HZYB 4P2OC 5BS0D 2CIKB 2YD7A 3U0TB 2GUOB 2X10A 2KI6A 4I0PA 1AC0A 3QEQE 5IHZA 4MXWL 3RBSA 4R2GC 1GYAA 4R8WL 3AB0C 3TCLB 3KLAB 1Z9SA 2RIKA 1JPSH 3D52A 4KNSA 2EDTA 1IQDA 3H56A 4WNJA 3TO4D 1E5AA 4CVXB 5KVEH 4ZX3A 1KYDA 4ILDA 5DZNA 3FQWB 3RDTB 3FBQA 5T5NG 5JR1H 4XH2B 4KOCA 4NBYB 5HVHC 3BSZH 5EU6D 3GO1H 4OH2A 5B39G 2O5YL 2EUWA 5HVGB 4Y9GA 4UQ3B 4CU6A 2KUTA 1Q90A 2HWZL 1EVTC 35C8L 5F9JA 1UZGA 2BZ7A 4TUKH 5DFVC 1YUHA 2NNFA 4AH2B 3OQRA 1DP0A 3O6LH 3P3YA 4YHLH 4KTGA 3ROOA 1H5BB 3CX5K 4Z3FA 4P57A 2Q10A 4H5SA 5JIKA 3QR2A 2XTLA 3K8LA 3MRMB 1QBLH 2J6WA 5HHME 4OZGB 2UYLB 3BAYA 1IAKA 1DBBH 1OWWA 3K4ZA 4DF9A 4O2FB 1BOGB 5DHMC 1SMDA 3FYIB 3HS0B 1TF4A 3MRHB 4ABVA 5LN8A 4GXFA 5FYKD 1SPDA 1WQVT 4OV6F 2Q0ZX 3D9AH 5D1XB 1T80A 5E2VL 3IDYC 4R7DB 1BD2E 3L4UA 1JD9A 3JWNE 4W9ZA 1AFVL 5F7FA 4MS8D 1BZ9B 4M7JH 1BCIA 4M3JA 2EYRB 4Z6AT 2WHVA 2NNXA 3DRQB 1TZ8A 4YIQB 1T6VN 4LGRB 4UNVA 4MJIB 1PAZA 4TYUA 2Z93B 3PLYA 5E6IB 3GRBA 1OKEA 4N68A 3QUZB 2C9QA 5DEZA 4D9RE 1U8MB 2A9NH 4CSPA 3NCJL 3BO8B 4A63A 1MSPA 2CLRB 4G9FE 4UQ2B 2VRQA 3GBNH 3GIVA 5HHOD 2Q6WA 1DQLH 1SOKA 5GS0H 5BQ7B 2NNRA 1OHZA 4LVNC 5EUKB 5BW7C 3RGVB 4MXQD 5I6PA 4P48A 3KG5A 3TASA 1TVHB 4ZUUB 1HXYB 2AGJL 2X38A 3DC0A 1OE1A 2YPVL 4GSUA 4F5CE 3AXIA 4P2CG 3ZE0B 4BA8A 4UQIM 3L54A 5CJXC 1C8PA 2ZWNA 3CFCH 4HXBL 1YEEL 1U3YA 3RX5A 2WQRA 2ODHA 3VWJD 2YUVA 2CUHA 3CZJA 4Y1AE 3WE6B 1QSEB 4DQAA 1R34A 2AABH 3QXDB 5GGQH 5JA8B 2D0FA 4FHBD 2V9QA 3QNXB 1HN1A 1QO3B 3FO9A 4KMTH 4WCYL 4CN1A 4I18B 4LCWE 5DVPA 1IKNA 2DBJA 2XCMC 3CAFA 2EE2A 4K9EH 2XU9A 2OMZB 2ZD0A 1G9HA 3BP6B 3A3YB 5IM7A 3FU8A 3JWNG 3LH8A 4E9SA 3AU1B 2HJLB 3KW8A 2YKKA 3GHBL 1AD0A 1IGML 3MRDA 4M7KL 4W9HC 1HXMB 3DX1A 4ZUSB 3MJ8B 3AM8A 2E56A 4PWFA 4X7TA 2WJ5A 3P69A 2KZKA 4A6YA 3CVHH 5F9WC 1V05A 1VERA 2QEJA 3POCA 1E28B 4YVUA 1H6UA 3T4YA 1T1ZB 3KPMA 3MBXL 1TXKA 2SEBA 3RILA 4ETQA 2Z7YA 2EJ1A 1JFQL 3ETBF 4U3SA 4XP1L 2CK0L 4QWWC 4GQZA 1YEJL 1TZIA 2GI7A 3GEFA 1XH3A 3ABKB 2PPEA 3GSXA 3MRLB 1XZ0A 3TJEH 4L29A 4Z7UB 3W9EB 2FYYB 4X6DB 5E00A 3WTYA 4CKQA 3D18B 2N59A 3O9WA 1LO0L 3GTNA 2G3MA 4NQCA 3ULAB 4YSEA 1LNUB 3GGWB 3SYAA 1FYHB 2X1XR 3QJFA 5GS2H 1U0QA 4AJVA 4XNZB 3VXRD 3WNIA 3F2LA 2BM3A 2VZ3A 4DZBA 3H9SD 2AEPL 2VLKD 4HWEH 2O26U 3MLXH 1QI5A 2WQ8A 4GW5A 4P2OB 5BZZA 3S7GA 1F13A 3DXAA 4XXWC 1WC7A 2BH0A 1ODAA 1WWAX 2JB6B 4R2GB 3IDGA 5E5MA 5BOZG 3AB0B 2Y7OA 2C8NA 4WEMB 5TF1L 1ZLSH 3T1FB 4MQSB 4MNHB 5L9DL 1OLZA 2ENPA 2W07B 4PM1A 2GIYA 4JW3A 1DQKA 4NNYA 5HVHB 2P9RA 4LK4A 4XPTL 1VA9A 4X6FA 4ABQA 3EYQD 1FDLH 3B9AA 1MHPL 2HLFD 4AEEA 3QZWA 3VDAA 4PH8A 2VH5L 2J8UB 1GGUA 3KGRA 3TFKC 3AXLA 3C5JA 4OGXL 1I8LC 5ID1A 1GGCL 4TPRH 2WXQA 1IBGH 1E2WA 4QHMA 3G5WA 4Y9EA 3F85A 4J1UB 3SBWA 3W0WB 3VB8A 3OJDB 2B5IC 3P2TA 1IEHA 4KHTL 4Y5YC 3BVNB 3QO1A 3Q2CA 4N20A 3WS6C 5E99L 4KHXH 1OAYL 3GKWH 3DX8A 2C3VB 4PJAF 1G43A 3I6LE 4PJ9D 1SBBA 5LWYH 1OAUL 3IMUA 3ZMEA 1YMME 4OVUA 3P0GB 3HZVA 2EXYC 1TCMA 2VN6A 4M43H 4FD0A 2HRPH 3BW9A 3P54A 3VGGA 5TQ2L 4BK5A 2VIRA 4QNPF 3IDYB 5L88H 2W65B 5CS7A 2ZUYA 3UPAA 2OL3L 4XCYA 3NFPA 3CV5A 3U7YH 1BFOB 4KXZI 4WIQA 2JNZA 1ZT4A 2EYTA 2F5BH 4JGMA 2A83B 1C16B 1CXIA 1FC2D 2NR6C 5DHDA 1PAMA 2FZ3B 3VSVA 2Z91A 2EIDA 2VQTA 2OCJA 2X4TB 4HXAL 1E7UA 1WGVA 2L7UA 2QL1A 2VDNH 2XN0A 3HJ0A 3MLUL 4PRHA 4Q6KA 4DPBX 4ZMAT 5LB1A 3V7MA 4Y2OA 5EORH 3DGGA 2IH1B 5CJQH 5IB4B 2VDKB 3FL7A 3WGUB 3SPIA 3TJPA 4JPIB 4IBYA 3TN0A 4A7GA 1M71A 1TZHB 4O02B 1Z32X 2A4CA 4LVNB 1MG3C 2QKIC 4KI5E 2K8QA 1EO5A 1AO7B 1LDSA 2BSRB 1SEQL 4NQEA 3HAEG 4CVWA 3O0RH 5CSZB 3RPIB 4RMBA 3N9GH 2WZAA 2WQUA 1QWHA 4R83A 1IAOA 1I8KB 2AQPA 3VE0A 1E4KA 1F6LL 1FNSL 1WFOA 3NCCB 5DRZA 5AYUH 1A6VL 4QLRA 1U36A 1U95A 1BZ7A 3O6ML 3BZEB 1YEIH 1C9SA 3QT2A 4WI0A 2F61A 2B39A 3WHXB 2YZ1A 4R8WH 5HD8C 3FHAA 1JGUH 2A6KB 2EE9A 2YPLB 3O4OC 3DETC 4X80L 4XE0A 5T3XD 2OPCA 3TP4A 4OQTA 4R5TA 4P3WA 1EJ6A 5DFTA 3WUWG 2HT3C 4WFGE 4F8LA 4R4FL 2FWOA 2DMKA 4JQXC 1P5UA 3FCBA 3UYRL 3M8OH 6PCYA 2YQ2A 1TVDA 1ZS8B 4J3VA 3VRIB 2VDML 4NENA 1BLIA 2OS7A 1HHKA 3X1BA 3MOAL 4A2LA 4FQ2L 1KC5L 7TAAA 4Q2ZB 4U2ZA 3G3LA 5F6HI 2J4WL 2K8MA 3TH4T 5JHDB 3QUML 3IDIB 1BQLH 1PX8A 4M6AA 3NDZE 2DB8A 1WCQA 5JMRA 3HMWL 5F9WB 4JHVA 4XOBA 1KT2B 1UHVA 4Z95L 5J1AB 1VF5C 2X2UA 1SJHA 1KTLB 1ET8A 1NCIA 3HC3L 2XWCA 4LKXA 1GA2A 5J0BA 1BQKA 1KCSH 2UXGA 3FT0A 2CO3A 4XP6L 3FTWA 3OMNB 4HKJA 5E2VH 3A67L 4XP9L 2G75B 4NKMB 4Z7QF 1CF8L 3D7PA 2DWXA 1IX2A 4FFWC 4GUPB 1PQZB 2FBOJ 4Q52A 1DVSA 3RZCA 3LSOA 4BFKA 2EE6A 3IDMB 1DSWA 3ULUE 4N2LA 2ALWA 1WO2A 5FPIA 1LDPL 1MEXH 2AJYH 5EWIH 4UTBA 2V6HA 2HLAB 3PWPB 3ZE0E 1IC4L 4F2EA 3ZZLA 1WLHA 4WY7L 2GK0A 1R5IA 4JFWA 4YDNA 1RIVH 4X98A 2NUPA 1NAML 1T5XA 2V0AA 4FJYA 3VGHA 4S1DD 4PBXA 4G6ML 5EIIA 1I1AC 5ETUA 3C5SA 3ERXA 5I8KH 1MVFA 3Q2LA 1P4BL 1JWSA 5CR8A 5E8DL 4MJ4A 2IFGA 4IGBD 3ARBA 4F7TA 2IXQB 2GTWB 4AXWA 4H8WC 3BYYA 3EOTL 3CH1A 5JDJA 3VXNB 3KMDA 4JFSA 1VFAB 1J0JA 1I9RL 1UXWB 5GPRA 3FDWA 3P4MB 5HHPA 1WFNA 1GRWA 2P8LB 4P2RA 3IF1B 2J21A 4X5XB 2RA1A 4HXBH 2QHRH 2G5BB 2D4DA 1T0MA 3D2UA 1RZIB 4OGAC 1HHJA 5AKTA 1S4IA 2UX6A 3QQ4B 2BCMA 4EDWH 5GS1A 2B5IB 3QWOA 4Q97A 2WVVB 4LDCA 4Y5YB 1AXSB 1L0QA 3SDDA 5IGXL 4AMXA 1D7CA 1T0PB 5ICYA 3V4PB 2D31A 3NACH 2IANA 5C0CE 1L9MA 2V7HB 1MNUL 3FFCB 2VXQL 1IRAY 3D39B 5IBLD 4RZCB 4R96A 4B9FA 3T0BA 4XCEA 2X05A 5MI0C 5AUMA 1ZSDA 4M8QB 1KEGL 1RZFL 1PZAA 2J7LA 4X6DE 3OKOA 4OFVA 2FNBA 4FXKC 4WI5A 2OW6A 4QJ4B 1RVFL 1WUNT 4JCWA 2UX7A 4NXKA 1RU9L 4UDUA 1G87A 4P5MB 4WO4C 5FHAH 4K07A 4ADGA 2XTJC 1OB1B 3ALXA 1PFCA 3QEHA 3IXTA 1P7QB 1BXVA 3MU3A 4UIMB 4RSYA 2L04A 4P3CL 5DJDA 1EEZB 4WTXA 3PV7A 1WT5A 2HT4D 5F1NB 3C5ZC 4YZFE 2P80A 1F86A 3QZLA 5CXPA 3S3CB 2CU9A 4JO8A 1KV3A 3WIFB 5DJXB 3PUUA 2JKXA 1F97A 4JRYA 4W9DC 2NY6D 3T3MB 3U2IA 2DYPD 1U8JB 2COQA 5TE7L 2NXYD 2GFBB 4C58B 4QO1A 4X9GA 4KWUA 1AIZA 3BP5A 1F90L 3U0PB 4Z0BL 5FHBL 2AQ1A 2X53A 2Y5EA 5JHLL 1R0AL 2DYSB 4NSKB 1AI1L 3T8MA 3IJSB 1B88A 2ZUSA 3N04A 3SZ6A 1BFVH 1MREH 1QZ1A 1WDAA 2OJEA 1JK9B 1JXKA 3DECA 4FYTA 5SX5H 4I2XA 3C9NB 3VI4E 2OV0A 2E3VA 3PFUA 1CDGA 3LVTA 1PL3A 3V79C 4PJCF 1MG2C 3IWVA 4HWBL 2M8XA 2DLGA 4YBHA 1QWUA 2K9FB 4PJGF 5AVQB 1ZGLP 5DEFB 1OP5K 1NOLA 3O4OB 4LHQB 4XBEL 1ILUA 1I1CA 2ZOKA 4XPGH 2OMYB 4Z7VF 3SE9L 5I6LA 2ZNWA 2OAAA 3KWVA 4NZUL 4ZTOL 3NEXA 5BO1H 2PYFA 1TU2B 4LPXA 1A7QL 1PG7W 4TVSa 3QUYC 1KLUA 4DP1X 3U79A 4W9KC 1PZ2A 4KKZA 5GS3A 1DL7L 5FLVA 1BQ5A 2OSWA 4NLAA 1EGJA 2DQTL 4OD1H 1XR8A 4QRTB 2APVA 3R0NA 3LEVH 3MBWA 3L5HA 4HK3J 5H37H 1DDHA 5L8KB 2BSTA 4GRLA 1MHHB 3EYOB 4HMCA 5E4OA 2C9VA 2IJ0C 5LAPA 4D3CL 1NGWA 3OM3B 4ABWA 2HMID 5TDOA 1MCFA 4XZUA 5EG6C 1CD9B 1QFWI 2QV2A 3I9PA 2XY1A 3NBNA 5MEOB 3W11D 3L5XL 3ZTCC 3MZTA 2WUCH 4L2LA 3WE1A 1AO7E 1IZKA 2D0HA 3S37X 3GBML 5A3ID 3RTQA 4ZYKB 1K85A 1ZHLA 3GMPA 4TVPE 5CEZH 5I23A 1AJ7L 5C08A 2H2SD 2PTTB 3Q6FA 3QNZB 3QORD 3IFPA 1TJGL 4JK0D 1Y6NR 2PW1A 3GI9H 3HG1B 1PF3A 2KLSA 5B4MC 2FBJH 4N2KA 1CBVH 3ABMB 3P02A 3RE0A 3S6CA 5BCAA 5JQ6L 1TFPA 5MENB 3G6JA 3VA2C 1PDKA 4LASH 2B15A 5LNEA 4PRAB 3S3PA 1I1AB 1KTCA 3RWGB 4JHUA 5D7EA 1IFHL 1UH4A 1T04A 3CXFA 4I9WE 1OM3L 3BP4B 5DHVB 5EEWA 5BOPA 2CM5A 5I71C 3BLKA 4OF0A 1ZTXL 3ZDXF 4RFEB 3DHMA 2K7PA 4HH9A 1XIWA 1BFSA 3AREA 4LU5L 2JCCE 3HI1B 5C09D 4O58L 5F3HB 3VXOB 4L3EB 5FOBA 2VLME 5D7JD 1PD6A 3NAAL 2AI0L 4EF3A 3B9KA 2NSMA 1D3CA 2HB0A 1A9EA 1KTRL 2R2BB 3LN5A 5SX4H 3W39B 2C3WA 1AP2B 1VGEL 3EFOA 4OLXL 1IE4A 3DTUB 1YAZA 2YR3A 2NSXA 4JFTA 3DSFL 2O6EA 3SO5A 3OKEA 4Y5XC 1Y18B 2XXMB 4XXCC 2I60H 1QLFB 4Y19E 5J56B 1T21A 3L3KB 4U1NB 1CU4L 5MI0B 3KXFD 4PS7A 4WU7B 5G55A 3LH9A 5JHAA 2ZG2A 3G9AB 1J05B 3QCTL 2A0LD 4FXKB 4GXVH 4QOKE 3PWPE 3B3IB 4XNXH 1UB5A 5KVFL 5E1AB 4F1SA 1PBYA 1EHLL 4WO4B 2TRHA 3MV7D 2DKUA 2XTJB 3BFWA 3TBYA 4F9LC 1N59A 3QDJD 2XN1A 4Z95H 3E6HA 3WIHL 5EZLB 3CSTA 1N8ZB 2V5YA 4J28A 4PGJA 1HWGB 1XGPA 3C5ZB 1CLZH 4GAGL 2BP8A 4MASA 4I3RH 1KJ2A 4N6RA 1CLOL 4WENB 2K70A 4WI0B 1HC1A 4ODWA 5ESVA 3SPJA 1KZQA 4B96A 1A1NB 4R26L 4S1RL 1KYOK 2JV6A 5KSBA 1A3ZA 1RPQA 3OKDA 2EDLA 1IGIL 3GNMH 3I75A 3S97C 5L4JA 5CN2A 3KCWA 1R3LB 2XN9B 2B1AH 3M17A 1IT9H 1SM3L 4QHPA 5C0AB 4BH7A 4ZMPA 2Q3XA 2R8SH 4G5AA 4LZKA 4AIEA 1CVRA 5JYLA 5DXWA 5IVZB 2CALA 1HQ4B 3Q1EA 1GTFA 4N5EC 4D9QD 4GAJL 4G7VH 3Q43A 3RFZC 3CZEA 2YD9A 3Q3GA 4S1SH 4PGEB 1P4BH 2B7DT 3BJ91 1ES0B 3JV0A 5ALCL 5DJCA 4KROD 3ZSTA 1ZY9A 4QCIA 3EOTH 2M2DA 4AQAB 5BV7L 1RZ7H 1T66D 4JFFE 2F54B 3IDXH 4H0LC 4MCZB 5I1DA 1ZGLB 5JW4Q 1F8TL 4DP7X 3SDXE 4GS7C 5K1JA 1KCWA 3S5LA 3BZ4A 3LH2L 3QUYB 2LQRA 4BD4A 5KYYB 4W6XB 3GB7A 1GH7A 5GRXG 1M7DA 2HP4A 3MPCA 1KXQE 4NRXA 2Y06L 3RWFB 4JS7A 2DLTA 4MA8H 1F1AA 3S3SA 1FNGA 3CU7A 4LLMA 5EC1B 2BNRD 1SLUA 1K3IA 5LGJA 5IGXH 2VXTH 1U2YA 1T1WB 5GGTH 1F3DH 4YDKH 1MNUH 2JB5L 2K7QA 3MLPA 4DP5X 4YHKL 5DFAA 3SGJC 3UTPE 2N7SA 2MCG1 4NCC2 2P5WB 3QUXC 4OLYH 4BV1A 1KEGH 1JDCA 1FLRH 2EDXA 3KLSA 3BP7B 2XZAH 2QSCH 4XO8A 4DGVL 1P4UA 4GKZA 1WFIA 1ED3B 4OQ1A 3A4EA 3UC0H 4PD4K 1E3FA 1WICA 2AP2A 3N1PC 1YN7B 3NJIA 3D5OF 4AXWB 5I1KL 2JIXD 2X7LA 3BJLA 4L37B 5D7LA 5F1IA 1G9NH 3ARFD 1FBIL 1NGZB 5EO1A 2VSMB 3FCTB 4KKBD 1BVLB 2Y7QB 2RD0A 2BSCA 1AYRA 5D2LB 1INDH 4XNDA 1G7MB 2RQEA 3FUMA 3CLEH 4YK4C 2AXGB 2ZPKH 4DZ8A 3Q2NA 5AYTA 5B1AB 1OO2A 2CNZA 2AK4D 2IG2L 5AAMC 3JV5A 3WJMB 3MLSL 5CP7A 3RVXD 3MJ7A 4PYHA 2R0LH 2X9ZA 4TNGA 3K74B 1A6ZA 4UCFA 3LRMA 4RMSA 3SB3A 3WJLC 1KIPA 4AK2A 1RJLB 2WN2A 4YDLC 3ZTEA 5I71B 1E4JA 5JHLH 1IVTA 4TNFA 3VXUD 3ZVVA 4ELKB 2G30A 2FT7A 4LAQH 3WNOA 2YFOA 1DO6A 1ZTMA 3NZ8A 3EDFA 4LCYA 1J48A 2FB4H 2MJWA 3B9DA 2VO8A 1G9MH 4JFHD 4LCIL 3CVIL 5FKPB 4PJHF 4NB7A 1W16A 4JL1A 3O41A 4XPAL 2LR4A 3P4OB 4JJHA 3SGKA 1NM4A 1E9QB 1L9RA 1O5DT 1I9IH 4F58H 2ICWJ 1PKQB 1OANA 1VDGA 3BIAX 1DEEA 3WGVB 4Y5XB 3VXTB 5SWZD 1IBBA 4LRIA 2HH0L 4PQXA 1JFHA 3QCUL 4PP2A 4HK3N 1FG2A 4ZFOB 2BFVL 1XSKA 1ZA3A 4W4OC 5CZVL 4HC1H 3L3JA 4IOSD 4LHUA 5AALA 4EEEA 3SDAC 4XPFL 3EO0A 4X5QA 2OQJA 2BZDA 1CE6A 3JWNH 1WJ3A 2PW2A 3FCGA 1CLVA 3H7BB 2IMNA 4L8DA 1U9KA 4PJ7B 4WKXA 3THMH 3MV9A 4HBCL 4AL8H 3G6DL 3HG1E 4GAYB 2ENSA 1OOAA 3ATDA 3UAJD 2X6AA 4XO5A 4GO9A 2A6JA 5MENE 4RQQA 4AKOA 4AMKH 2R23B 3LPWA 2KQMA 1RZ8A 1BEXA 4OZIA 4WW1A 3K6NA 1J18A 1E50A 1R3IH 1ONQB 3NCBB 3L1EA 2VDPL 2BVTA 3ETTA 4JO2L 1XGRB 4QRPD 3ZHLA 3E6FA 3T65B 1QA9B 1FGVH 4N0UB 5LQBL 3FT9A 1DVFC 1HIML 4JZJC 3BZFB 4XNBA 4JPKH 4BK8A 3ORJA 1JZ4A 2EDFA 1GIGH 4FFZA 3T6WA 1CGSH 4KJPC 4TQEH 4RMQA 2B77A 2GSGB 4QYAA 4UB0L 2WXKA 3LKQA 3SEPA 1UJTA 3CFJA 3GDBA 5HY9A 4YJZL 1XCTB 3UTZB 5JQ6H 3GXIA 3P9WB 3LKNB 1DQDL 1MZZA 1KSRA 1A14L 4OAWB 3RFZB 3V0HA 3VXSA 1M4KA 2Z7UA 3MGTB 2YPVA 4RWYL 4OT1L 5C07B 5FYKL 1QZNA 1HH6A 2Y23A 3QI9D 4HOZA 1T2QL 4PJ8C 3GXNA 3QFGA 3U4EB 5T1DL 1KFAL 2DQMA 2GQHA 3N40P 3HG5A 1JZDC 2M83A 1CK0H 3FN0L 3UZQB 5IV2A 4LLVA 4QRSA 1Y07A 3BFOA 4UANA 3AWGA 1DJYA 4GS7B 4OZ4A 3ZL4L 1JWUA 5IVXB 3NZUA 2XTJE 4JPVH 3M7FB 2P5PA 3X1EA 5H35B 3U9UA 4QYOA 5B1BB 1WISA 3IMVA 1K9TA 1NFDF 1U6AL 4KKRA 4EIBA 4OLXH 2FRGP 5H8DA 3NFNB 1O6SA 3FTZA 1RZGA 1BQHB 4N0FA 4E41A 1W8NA 1AGEA 5JOFB 4JFEA 4G71B 4MKMA 1INEH 2VDQB 1IGFH 3FO2B 4LSSH 4K8RD 1OGTB 4DPCX 1CU4H 4XXDA 5AVZB 1KNOB 2RBLA 3QUXB 4N2OA 4OCWH 4UU9A 3NTCH 1SOXA 4R5XA 4IDLA 3QCTH 3KYMA 3RL1B 3WKYA 2DWEA 2VUYA 3NN8B 5KVFH 1LK3H 2XN9E 3HNSL 3K2KA 4HUCA 4UMSA 4XWGH 3WFCL 1KLFB 4G6AC 2NY3C 5C0AE 1AACA 2HUHA 5SWSA 4U1IA 3TZVD 2XKNB 2BIIA 3TT3L 1MFDL 3B8YA 4H2AA 5I1LB 2R2EA 3UTTB 4JKMA 4OZFB 4ZODA 2EACA 2YGPA 3EJZC 1SYVB 2CDGA 3WIHH 1RZKL 2UY7B 1VEPA 3NJJA 2DZEA 4X6CA 1CFBA 3RIAK 2OMVB 2XFXA 4YK4B 1GZPB 5M94B 2V17H 2MHAA 3IJ8A 2OYPA 3AU0A 4LCWD 4R26H 3MOBL 1EEQA 2K6WA 5FA3B 1AZCA 3QHFL 4KRPD 1T1YB 2F54E 3F12A 3SKMA 3DUSB 1D6VH 5DJ8B 4URTB 5T1LD 4NBXB 4MXVE 4XO4A 5I8EB 1V7NL 4XC1L 4PJDA 4YDLB 4Z3IA 4YHOL 2C34A 4RSVA 2HTLD 3TM6A 3NCYS 4OTXH 3MGAA 4JN1L 4TUJB 1A6WL 1HKLL 4NHUB 4H20H 1TO4A 3P0YH 3ZT6A 1SEBB 3V8CA 4L5FL 1ADQL 4CNIB 4OLVL 4HZAA 1X3DA 3GS0A 4B0MM 1S7UB 2FJFA 4QMEA 5TK4A 4CKVX 2D7TH 3K5RA 4GW4B 3CHSA 5GSRA 5D6DC 3BQUD 3ZE2E 5E2TH 1FN4A 1G4MA 3CXHJ 3NCWA 1FV1A 2B16A 4NUJA 1CDIA 4DGIL 3D25A 3WDIA 4KDTC 4XN8A 2CJ3A 3PP3K 2BJML 1TQUA 1E0OB 1C7TA 1TNMA 1FIEA 4WNQB 3LS4L 4HCIA 3SDYL 1RIUL 4JO1H 5HI5D 1LHZA 1MFBL 1KIUB 2X6MA 4L4TD 1OAXL 4LL9A 2WZ0A 3SDAB 4Q9RL 1DJIA 1OALA 3LZNA 4OR1A 5IFJA 3T0VA 3ALWA 4M5SA 1ROWA 3KWWB 2ZOOA 3OAUL 1E90A 1QTYT 5D2LE 1JGLL 1JHTB 1SUHA 1TTAA 1U92A 3QEUA 4JDEA 5JXEA 3BI9X 3UL4A 2R69L 3G5YA 4OGZA 4JFZH 5DJ2B 5HYSB 3R4DA 4XAKE 1G7JB 3IGAB 4PN6A 1QTSA 5DUJA 3REVB 3ZSSA 4AENA 1DBML 4RBPK 2HN7A 4PRIE 5GJTH 3N3EA 5T5NF 2JI2A 3CDZA 3IE4A 3TX4A 1N26A 3KPQA 2VE6A 2R0ZH 1PNCA 5ACMA 2Z35B 1TYRA 5D7IA 4YSUA 4OLWH 5IF0A 1E4XH 5ITFA 4LSDA 1BW8A 2B1HH 2EDOA 1H3PL 4YAQB 1ZEAL 3ARGD 3FO0L 1DVFB 4JZJB 5C6TL 2QFPA 1S2EA 2B4CC 1XO8A 1EJFA 3AGWA 1KIQB 3QPQC 2VDOL 5J3HC 3RGBA 3GSWA 3BKYH 1QHQA 3KPSA 1F2QA 2WB1A 2PP9A 4OIFA 1CTNA 4GMTH 4B6ZA 2OTUA 3I9GH 5I0ZA 2BHZA 5KYWB 4M1CC 4DESA 2IG2H 4XT1C 3JVGA 1ZT7B 4Z78B 3U6RB 1PKQE 3DWTA 3I3DA 5ISZB 1F4XH 3H9HB 4K23L 4ZD3H 4PJ8B 3MLZH 4HKBA 3U9PL 4RX4D 5LNGA 3L5JA 1NCJA 4FCAA 3MRGA 3FRPB 3BPNC 2QJDA 2DQEH 1N12A 3POHA 4MAYD 4PJFB 4LCIH 3QYMA 1N6QH 3JV6A 1H15B 3ZU8A 1R19A 4JFUA 2DPKA 4UUJA 3TIEA 3NJLA 3AWFA 4XB3A 1IC7L 4GG6B 1HHGA 4AQ1C 3BZDA 3CZLA 3TEWA 3IU3B 1CLYL 2CRYA 2YSSB 2UXVA 4QEGA 2CUIA 1F6AA 4L3CB 2JKSA 4BDVB 1F58L 1VFBA 2I5YH 2XQBH 3EOBB 4J8QA 1KN2H 2DS4A 3QUMA 2J1XA 2MQ0A 4JDZA 4OGYL 3WOVA 3QCUH 4KZDL 4Z7NB 5D5MF 3RDTD 4FFYL 1PD1A 1ZVSB 4FABH 2E9BA 1CB4A 2ZXCA 2OK0H 4H8QA 1NEPA 4N90E 4YX2L 3LPGA 5CP7B 1TQTA 4HBQA 4XMLH 3L45A 4XVSH 1N64L 1KN4L 1A6ZB 2WWKT 5AD0A 5JNYB 2NY3B 5AVTB 2HRLA 3ULUH 3NFSH 4HSCX 3GBDA 3NP4A 2IBZY 3RNQA 3S36H 1DSFH 2WUBH 3CWGA 4KDWA 4P2YA 2VM9A 3UBFA 2FT8A 7PCYA 3KEDA 4M6OL 1O5PA 3FU3A 4EVNA 3HHSA 1VACA 2FGWL 2FGZA 1T03L 4NYLA 1FO0A 2H9GB 4UMGA 5F72S 2R0KH 1KXVC 2YJQA 5T3XL 1LK2A 3BH8B 2H1XA 1FP5A 4HX1A 4B7LA 2ZKXA 3VFVB 2IAMA 1SHSA 5MEPB 4DTGH 1U8LA 5FW6A 1E43A 3QRLA 5D1XD 1T20A 3SSGA 4TUOA 1SXAA 3LEXA 3T0EC 1GGBH 2YPKB 5D7SL 1U8NB 4APQA 1A6UH 4KPHH 2WINA 3A6OA 1VRSA 3ETBJ 4CA4A 1RUKL 5ITBH 3DX6B 3TOPA 2AK1L 1G5AA 2BY0A 2ZCLH 4ENZA 4P5KB 2EECA 4BFNA 5F2FA 4ELMF 4PJEA 4KK6C 4NLHA 4UNUA 3SCMD 2DQJH 4U0RC 4K94H 4FZ8H 4MJID 4Q8BA 5C0NC 3VH8B 3ZHKA 5D96C 5E6ID 1U8OA 2B2XL 5F7EL 2Y5TB 4BUHA 2QSQA 2DM2A 3QUZD 1A14H 3QHZH 5EHFA 5JA9A 2HKHH 4Z7OB 2AV7B 1J87A 1A1MB 3ISYA 1OGAA 1GL4B 3VI3E 1KCBA 4GEJA 5BUAA 1AGCB 3QPXL 1IM9D 1KFAH 5JLZA 2EIZB 2NDGA 2ZYIA 3J2PA 1TG8A 3KLQA 5E24E 3D69B 1BX2B 5TE6H 2VZOA 1KFGA 4WFHD 3RGVD 3DO7B 4H1LG 2CKNA 2C9AA 1Q0XL 1OP9A 3MLVL 1G6RH 1NDMA 5CGBA 2O61B 1A7BA 2OR7A 2QVTA 2VXQA 1ZT1A 5CIPA 3PYCA 2A6IB 2BO0A 3SKNA 3UTTE 4YFEA 2W91A 4KY1H 3AY4A 3G08B 4JCMA 2OBGA 4NP4H 2E74C 4I1RA 3RI5K 4UT6L 1QSED 2FECL 5AVXB 5KS9A 2CIIA 3ZHFA 1CFNA 4C4UA 1BWWA 4KO9A 5DYFA 5GIRB 5KYXA 4KFZC 2UWEE 1ZXQA 1MW1A 5H4YA 5E8EB 1JXDA 4N2FA 2P5ED 1V10A 1HZHL 3NJVA 2YRZA 4NZJA 3KYNB 5KYUB 3D85A 5HJDA 4KTEH 43CAB 3IJEA 4JZOA 5KBKA 3EBHA 2FR4A 1R9FA 4MMYB 4HUWA 3OHXC 1RHHA 3N43B 1FL3B 4DFIA 2ATPB 3Q8AA 3B43A 2I07A 1LEIB 3ARUA 2PN5A 3HN5A 3EFDL 3JV4A 5IV2B 3MRKA 1BQHG 2WPGA 1XMWA 2LW3A 2WWOA 1LO3L 2BSBA 2XQYG 4OGQC 4Q7DA 5CZXD 2F7OA 3RQ3A 5KANI 2Y36L 3ARQA 3MNVB 5HJGA 1MWAB 4PJXA 4IDJH 4OCRH 2BNQB 3GRWH 3HFMH 4WHDA 1BF2A 1A22B 5IQ9B 2VQUA 2ZXEB 3EYFB 5DUBA 3WTSA 3QHFH 1LD9B 2NUTB 4V33A 1BLNA 5DFWH 1XCQA 1J8HA 2X0VA 4J3OC 2WYZA 2WK2A 2CJSA 3SOBH 3BUPA 4TF4A 3I9IA 4XC1H 4ONFL 1P4IH 4HWBA 1MCRA 2FL5B 4N2CA 3AS2A 1A6WH 3BPNB 1V27A 4OZFG 2IDSA 4FFTA 5I24A 2DM4A 5BXFB 4L5FH 2V2XA 1TTGA 3GMLA 4XHJD 4L8BA 5DLMH 3A21A 5KUKA 2WLJA 1OW0A 2UZYB 3ZKSD 1SVBA 1TQCC 3HZ3A 4OLVH 1E2VA 4G42A 2VDRH 3VW3L 1M3JA 3SPVA 2WTRA 2R2EB 3IU4H 1JNLH 1BEYH 2OYLA 3WYRA 4B50A 4R2GD 5KOMC 4NZTL 1NC4B 5HI3D 1A65A 5IBTH 2C7UA 2X70B 1L0PA 2F53E 3DPBB 3BAEH 3VM5A 3WY1A 4NQSA 2Y7SA 2VQ4A 1NM9A 3F6LA 3NIDF 3ZUCA 1ZIBA 3BE1L 3A6CL 5ADPL 5GGRY 4F91B 3TBTA 1QTPA 3VQLA 2P8MA 4Q9RH 4V1DB 4DGUA 4W9EC 4L8SA 3D87B 1T7ZA 1MLBB 2BVOB 2W38A 4N0RA 4TVPH 4NQUA 2QQKL 4HSQA 3W0WD 4FYQA 2EIKB 2CBTA 1QLRB 1GGIL 2CMRL 1PZ5A 1YQ2A 3MMEA 5I2IB 1JPGB 2VL5B 4QTHB 3UTQA 1NGQL 2Q2LA 2UVEA 5ISZE 4LSUL 1PLGL 3IYLW 2ZONA 3UBXA 4YHPA 3QA3B 5FYLD 1E5BA 1I85A 1USZA 3IFLH 3SE3C 2DIBA 5F89B 1X9RA 3O3DA 4PWIA 1ESOA 4MDJB 3T0EB 4Q9QL 4HSAC 4M8VA 4JKWA 1KV7A 5CCHE 2CLVA 1T0NA 4N8CL 4QTIH 4XN4A 1K4DA 4KXZH 3VFSA 4CSTA 4I48A 5DK3A 3A4FA 2XUWA 1K3ZA 2ZOLA 4Q0XL 4Y2DA 2ICES 2ADJA 5F7LB 4FTVD 4U0RB 5GRJL 1TQWA 2YD8A 3GJFK 3VMPA 4AE1A 1FNHA 5C8JA 5D96B 4AYEC 4FQHA 1EUTA 3DHUA 1VADA 3I6KB 5CJ5A 3VFUA 3HCVB 5IMKB 2EKSA 1FJ1A 3PJSB 4Z18A 5AOJA 4RFOL 4QHLB 5JQIB 1IUZA 2WW8A 4KI5F 2KZ1B 3UYPB 4Z7NE 5HHQA 4K3DL 2WKLA 2WO4A 5HYJE 3CFKB 2O5XL 3PXJA 3L3GB 4K2UH 1M05B 1TPXC 4JR9L 4V11A 5LO7A 4R6UA 1Q9WB 3C6LA 1DFBH 4AYMC 1C5BL 25C8H 3HR5B 2NNAA 4PJBB 4DKAA 4ODSH 4OCSH 5HHVL 4QRRA 4APXA 4IU2B 2DWDA 3TBWB 2DQGH 3ZTDC 1HOCA 3T71A 3EFFB 1UWEL 3FB7B 3WKQA 1TZAA 3HE7A 2Y4SA 1AR1C 2YPLD 4JHZA 4AGNA 3R06A 4GAFB 4B9ZA 1RUQL 1HEZA 1HWWA 1EWHA 2J1YA 2WSDA 3HUJE 1WS7A 2DQDL 1OQXA 2E9IA 5FUZL 3N91A 2BK8A 3WSQL 2F5AH 4YFLF 1UWFA 1U8PB 2CBPA 4PG2A 4PY7A 3K6FA 4PY8I 2A74A 3RWHB 3VDCA 3ZHDA 3O6FA 4RMTA 2EEBA 4HEME 4JRXA 5D2NA 2CDEA 3OHXB 5C0BB 2VQ1A 1SXNA 5GZNA 2XG5A 4QRQB 2EUVA 3MV11 3CVDA 3LKOB 4EOWL 5JHDD 2GC7C 2UZXA 4U4BA 2ADGB 2NY7H 2K45A 3Q06A 3DYPA 3HNTL 1UT1A 1IGCL 3PWVA 4BSVA 4I1NB 2YS4A 3FFDA 4XCCL 4PHZA 3WN6A 3ET9F 4Z7WB 4L4VB 1XF3A 4WWPA 1L9OA 5I5MA 1A47A 1MF2H 3IGFA 4ANXA 1RP9A 2MNUA 1TKWB 4FG4A 3TBCA 3WLBA 4AUUA 4I0PD 1U2HA 1UM6H 3GLDA 3GLEA 4YWGH 1TCRA 4A04A 5FK9A 3UG3A 1OCOB 1VFBB 3EGDB 3ZE0F 4XMKL 3WIIH 4ODHL 2HAZA 3TT1L 4OZHE 2XACC 2IH3A 2Z92B 2NW2B 5IOPB 4RAUB 3VFOA 4WAFA 4MA7H 5EDSA 5INCA 2VLRE 1MJJA 1VB9A 4X2UA 2YA2A 3K1DA 3OSKA 1TQCB 1RAMA 1VZHA 3DGCR 4X9YA 1ODUA 1YNKL 1G94A 4LO9A 5IB5A 3SYQA 1WBZB 2NT0A 4KX7A 4G8IA 2CHXA 1REIA 3RB5A 5TQ0L 4MD0A 5D72H 4JHBA 1JHKL 2A5UA 2GIMA 2ZSVA 3LKPB 1R1CA 3UJJH 3FHQA 4UM9A 5IW3A 1D5ZB 5CSBA 5L4MA 1I1RA 1V55B 2P8PB 1ITCA 2ZX5A 1Q0XH 3PP4H 3GYRA 1UASA 2CRIA 3NSFA 4E9TA 4RESB 2QADB 3G5XA 3TVMA 2ZG3A 3EJPA 1RI8A 3VH8G 3HC2A 4O2CB 3QG7H 4JFPB 4HCRL 4LSPH 3QZOA 2ICWB 2DH3A 2XXGA 2NW3B 4NO2B 5DQDL 4DETA 2NPLX 5EEYA 3DX7B 2X4PA 4PBVC 3CFDA 2J44A 1J1PL 3IK2A 2Y1AA 4WW2C 3WJJC 4G8GA 1ORSA 2R1WA 3MJ9L 4X6DF 3TA3C 3FB8B 3Q7JA 3FFCD 1A4KB 3D39D 2AQNA 4X8GA 1JK8A 2P49B 3T6QC 3QZNA 3WAJA 2Z8RA 3MROB 1WCBB 5CAYB 5FFLA 1ACZA 4P9HC 5B8CC 3LIZH 4ZRGA 4XBPB 3VXQA 5AOMA 3GI8H 4QIRA 3GWJA 1OF2A 3VRJB 4NDMB 3DHJA 3LQAL 5T1MB 3SDCA 1U3HC 1P7QD 1J1OL 3F5WA 3K0YA 4J5VA 1YQVL 2NR6D 3UTSE 3K2MC 4U1KB 1ZANH 1KACB 4RFNB 2AS5M 5EN2A 1JRHI 3RWJB 5D71H 5EZOH 2F18A 4U05A 4Q74A 1XGTA 2H1PL 1OTSC 2HVJA 3FT2A 3V0IA 2YBRB 4Z3TA 4ISVA 4PGCA 4D0CA 5G2NA 3EGXA 4J3UA 3HI6L 2J8UF 3U83A 3D33A 4JEGB 2DQHL 4J2QA 3V4UL 2A1WL 1TPXB 5FB8A 3PDOA 4IOIA 4GKOA 1KJVB 4DAGH 4PREA 2WLIB 5GGVY 2BXYA 4P59H 2X6BA 5HGBA 5LXGH 1RUAL 5TDPB 4WWKB 4NFCA 4DK5A 2J72A 4PJAA 1R4XA 4ZPVB 4F7PB 2F58H 4JPQA 3LHPL 1NDGB 3HPJB 5BZDB 4RA3A 4XCFL 4CRPA 3QXWA 1I3RB 1OT1A 1AR1B 3W3BA 4L9LA 4XNAA 2WXHA 2GJ6E 1M57B 4UV7L 5BS0A 1MQ8A 2G60L 5C9JA 3LRHA 4JLRA 4MB1A 4WFEE 2XZCL 1YYMH 4P5TC 5DZOA 2NY0C 3ME0A 2L7EA 4HJEA 4LSTH 1KZYA 1T6WA 4LDOB 1UWYA 1L0YA 2VO5A 1NL0H 5IT2L 2K3TA 5B3NA 2I7OA 5E9AA 3D07A 3RUGB 4FXGC 3T08A 4BKTC 5EU6A 4HOXA 5F7DB 3R1GL 1T5WB 1HL5A 1QR1A 3RAJL 4R9HA 1K6QH 1CT8A 3TO2A 2VKWA 4JKPH 3C08H 3QE5A 4FLOA 5ECGA 4F8NA 1CXLA 1BP3B 4B53A 4AV4A 4KJYB 3CX5J 4MYWB 1S7QB 3ULVE 4PMFA 3SBRA 3U0WL 3EJSA 4N4YB 4MSWB 5E7BA 1QFWH 3FTVA 1CICC 5EO9B 4CMHC 4NQDB 5KSUA 3GJFH 3DXAD 5I26A 2OLDA 3ECUA 3KGSA 3LNEA 1AD9B 2WBXA 4Q9QH 5CSGA 2TAAA 4KKLC 4FN0A 4N8CH 1MCWM 4WK4B 2F1AA 3NA4A 3EGSA 4Q0XH 5IUSA 4ZFGL 2C5DC 2J6EL 2WYIA 2VAAA 5CJOL 1G0XA 3II1A 3L3OC 4FX5A 1URLA 1M53A 1XF4A 5CU9A 4EN3C 1I8UA 3HG1D 1QRNB 4DEPB 1RV6X 3WO3B 2QQLL 3FPXA 4C57C 5DD0L 3L3DB 5JXAL 1P1ZB 4OSUH 5CP3A 2BXZA 4ZMWA 4X5LA 5T33H 3UPRA 1BVOA 4YHNB 4PRPB 4JN2B 3LZFH 1I1AD 3DIFB 4M5ZL 4ENEC 4HJUA 1FZJB 1FNAA 2JTDA 5K9OA 4FI6A 1JXJA 2P3YA 4J6RL 4MD4A 1KYFA 2VITA 4WRLA 2XPZA 4QLWA 2XVLA 1UOVA 1C5BH 5BJTB 3IETB 5HHOA 2E27L 4OFYA 2WGXA 5IWLA 1BG1A 3E8UL 5GGVL 4WWNA 3CN2A 4L3ED 5GQBA 3L3IA 1IC5H 5IESH 1Q94A 3F7YA 1A66A 3W2DL 3GSNH 4M03A 5FM5M 3HZMA 3A4DA 4OGAD 2JJSC 5DURB 1UWEH 2Q7YB 1RY7B 5T8IA 3QFJE 1CFVL 1VPOL 1ZPUA 2BCKB 4L4VE 4JG0L 4OFDA 4XX5A 5D70L 5E9DE 4X4MA 1E6OH 1O6TA 2XYBA 3D3VB 4XBGB 2JQAA 4PI0A 1FYTA 1L9NA 3Q6GL 4X6EB 2NY5L 4GBXC 4ORZC 4WW2B 3JBG7 2WZPD 1U8KA 2AXFA 5I1EH 3TA3B 3WEAA 1SXCA 1ZIAA 4PRHD 4XPBH 5I9QC 3KLHD 1XF2A 5IHWA 1EV2E 1L7IL 1NINA 3RZCC 4W6WB 1UB6B 2VABA 4HUXA 4JFQA 3WCYA 2HT2C 5HYQA 1BYOA 1VLXA 3V7AG 5B8CB 1MVUB 2WXOA 3B2VL 3OX8A 1T4WA 4WSJA 1CD1B 3KPOB 2B20A 1U3HB 4U33A 4WK0B 4JM0A 1AE6L 2H32A 1AKJB 2R4SL 2QPFA 3LIUA 4N86A 4OCMC 3D2TA 2VISA 4J12A 3FTUA 3LXUX 2YGQA 3ISWA 4APXB 5KJ4A 3F58H 4K8RL 1P4LA 5EV7A 3FS9A 3IJHB 3GSRA 3FC8A 1SF5A 3ZY7A 2X2YA 5HPMB 3L81A 1H9DA 5FFOA 2APSA 2HJKA 4XMKH 2ISDA 5JW3L 3GZQA 3QC6X 3TYFB 3QDME 4XRCB 2F19H 1FLTX 3UH8A 5GGSA 4PS8A 5E8OB 4C8XA 1V7MH 4FI8A 1A7RL 3X14B 3VWKC 1XXDC 3SY6A 2EKJA 1OCZB 4FLRA 5C0AD 3EH4B 2Y6TE 3FSOA 4WSKA 2FCBA 1B0IA 2Q5BA 3T8XB 1NBVL 4HIIA 2OFQA 3RVUC 2FJHA 4QKXB 2UY6B 3VXRA 4MWFB 1NLDH 2YWZA 5EU3A 1JGEA 3VSTA 4RAVB 3GSVB 1ANUA 2ERJC 1QKZL 2PCFA 1AIFA 3GDCA 2VLKA 1Z2KA 3H9SA 4A2GA 4ZX4A 4LARL 3D0VA 1S7TB 4YMPA 2NTFA 3D12B 1NSNH 5PCYA 1WBYB 1MQKH 2D3VA 1YDPA 2RFXB 4NO3B 4P5TB 4J27A 1A6AB 3S34L 2VC2B 2NY0B 2JI3A 4HGKC 4UYQA 5GGUA 3VD1A 4P2QE 1BJ8A 4R90H 1FHNA 3FU7B 4LNRB 5HGAA 2VXVL 5DQ9B 1YVLA 4H8UA 2PWGA 3L1GA 2OMWB 3VFGH 3AJ7A 3LZQA 1UTDA 4FJZA 4FXGB 4ZMYA 1KCRH 3RI5F 3C6EA 4KAQL 2MPAL 2KPWA 3U1SL 1D5MA 1QLEL 4RIRB 3PWJB 3T3MF 1HSBA 3DA0A 3WFDL 1QSFB 4PJ5B 4ATWA 5K9JL 2TRYA 3MJ9H 1JPTL 2Q76A 3VFWA 4NJAH 2I32A 2WLKA 3IDUA 5DVKA 2NQDA 3S37L 3ARTA 4JO4H 4HLZG 4MNGA 4UDTB 4CMHB 2P5WD 1JZJA 3BPLC 3DYOA 2G2RA 3O11B 4HH8A 2AKRB 4MFHA 3GC3A 5JUEL 1PG7X 2R0WL 3C5XA 2NCMA 5BRZB 1UVQB 5DQJA 1G84A 3LTVA 1PX3A 4HU2A 2BVPB 4OJFL 3MODL 1LMIA 1PPIA 4F2MB 1BXUA 3LQAH 4PJCA 5IJKC 1NFKA 3FTSA 4QY8A 1I8MA 3O2DH 4UILH 4PJGA 2A38A 5TFSL 2X87A 2JKWA 3E9UA 5DK2A 3L3OB 3NZHL 3UMNA 2CHWA 3QWRA 5LBVA 3TEXA 1N0XH 1W0WA 3NRQA 5FW8A 4EN3B 4E5XB 1TZGH 5B4MD 32C2A 1CN4A 3D2UD 1MI5B 4UQBA 3D4ZA 5HYFA 2P52A 1LWRA 4Y4KC 3LQZB 1N4XL 2WKOF 3G04B 1OSPL 4GSQA 2J1KA 3BKJL 3HI6H 3V5KB 3WFHA 5DI8B 4YDIH 2GUYA 4PP1C 4PRBA 4LT7A 4BQBA 4NJ9L 2NY2C 4LLUA 1F2XK 1EO8H 4XTRC 5A6MA 4U7KA 1RK0B 2WVTA 4HJGB 3GINA 3GXPA 4MJ6A 1JK8B 4GKNA 4FF9A 5E1GA 3ZIYA 2VDLL 4H1LH 2BP0A 5EPMA 3I6GB 4XMTA 1IC1A 5LLIC 1JZ6A 3SE4A 3HNVH 1H3VA 3LS5L 3MRNB 4HS6A 2BIPA 1SLVA 3ARYA 1DQIA 2YD2A 4HWZA 5I0WA 2AHIA 3ZDYE 2ED6A 2Y2TA 3QUKA 1CZ8H 1BZEA 4J3BA 3S96A 1H6TA 4GBXB 3QS2A 1ZJBA 3OC5A 4G6KH 4W9GC 1HL9A 4ZW8A 2KDGA 4R84A 5F88A 5I9QB 3MHZA 4WTZG 1S7WB 3EJJX 5D1ZC 4X83A 2EC9U 4YBQD 4IMKA 5GS0C 3ESUF 4HF5L 4R0LC 3RAJH 5KTEL 1W72B 4UT7L 1MCPH 3W9DA 3CSPA 3QH3B 2ZP8A 2XXFA 3NMEA 1ZDQA 1FI8C 3LRGA 3HTLX 2R2CA 4N0CD 4Y5VA 2YMOA 3Q13A 3LMJL 3V4VB 4PRPE 2XRAH 4O51A 3VTTA 1MXDA 4W9IC 4JANB 4QHNB 2C9UA 2YXVA 4UM8B 4JFOA 2MCMA 3WU1A 2BNUA 3ABZA 1ZHKA 2XWDA 1FGNL 4UYPA 4AEIH 4ZAKC 4OB5L 2XKUA 4TULL 3NABH 2R29L 3PHAA 1IAIM 1QAWA 2CO2A 3V6ZA 1SN5A 1KENH 3U4AA 4ZUVB 1E4HA 1F3JB 1RHFA 1I7UB 3VWKB 4NUQA 3AZUA 4L2YA 5DDHA 3ZR6A 1DBAL 1TVBB 4K9EC 3C8KB 3KJ6L 3KE0A 3D05A 2APFA 2CKBB 2D3NA 3ZTJG 1M6OB 4HJ0D 1KWGA 4RDQG 5IHBA 1E40A 1SBSH 1CGWA 2FQDA 4N5ED 1R3JA 3ZPDA 4BZ1L 1YN6B 5CHNA 5LCVH 1Z6JT 3H2WA 3RURA 3M07A 3UZEC 3L7FB 1KPUA 3RJOA 5IQ7H 1KPRB 1MY7A 4UZGA 4FC3E 5C07D 1YHPA 2ERJB 2BY3A 4A2EA 3BN9C 4CW1A 4Y1SA 2AANA 3VGAC 4ADIA 4UT6A 1V3LA 4YUEH 5IROC 1GJUA 3MXWL 4P8QA 2WD0A 5I0YA 1IVLA 1I7RB 1OAKH 2EDQA 2LHAA 1MJ8L 3CUPA 1H0DB 3ILQC 4NQCE 2H0JA 3MNZA 2G9KA 1QEWB 1CDCA 3BDYH 4NM4L 5C2BH 4ZSOA 1QEXA 4P0DA 3JWDL 4PLJC 3PAZA 5KSAC 2HFFB 3OPZH 4QRFA 1FVEA 3PIQA 2H41A 2F74B 4KMQA 1MRFL 4KVCL 4UOJA 3HRZA 4GEIA 5C08D 3ARDC 3IJYB 4E9QA 3PWNA 4PG9A 3MLTB 1E8WA 4N9GB 3RRQA 1IU1A 3HB3C 4AOFA 5I19H 2IPUK 5DTFB 1UZ8A 4N3UA 2ESVA 4JFYB 3Q48A 1R6VA 2V2WB 4HZ1A 4YGVB 5DHXB 4BFOA 1DBJL 3I02B 2NY4C 2ZCHH 3S8WA 3SE6A 3BPLB 3FB5A 2PWHA 2UUDK 4OD3H 1YYLH 2KHAA 5E94A 4NC2B 1LEKA 3WFEH 3TNMB 1WVZA 2HG5B 4ONGH 4U0QB 2Q7AA 1OSZB 3QJTB 2WNXA 5CLTA 4M1GH 4UT9H 3VDBA 1Z3RA 4WSGA 3BWAA 1U93A 3MBEC 4U31A 5DSCA 1Z5HA 3UZVB 2B14A 1NBYA 2BINA 4ZPTB 3Q5OA 4GYBA 4KH9A 1HJCA 3N85L 1J9SA 3OKKA 4RH4A 1T4KB 2YUZA 1F3DJ 3DX9A 4AM0B 1AVAA 4NQVA 3A4AA 1NMCC 1RMFL 1VGKB 1T83C 1RUPL 2BMKB 4FYRA 3RY4A 4M8UA 2WMPB 4NQTA 4Y4KB 3CNKA 1K8DB 4MXVF 3S4SB 4TSCH 3REWA 4M7LT 1EHXA 1HX0A 4HPHA 2HFEB 4I88A 3TPKA 2ICCA 3WXWL 1P0SE 4BFIA 3K71B 4AVJA 2EEFA 5IKCB 2NY2B 2KLRA 3EYSL 5ESQB 4U6VL 1KGWA 4YPJA 3MGOA 2WP3O 1NIFA 3H3KA 1G0YR 1WFJA 1YNTB 5DZVA 3L16A 2DYPA 5LGHH 2R56L 4HG4K 5C0DA 5IJCC 2I9LB 2ZOTA 4AYFA 1JDDA 3QDGB 1S7VB 2DQIL 3G5ZB 3PL6C 2WQWA 5KVDL 4KUCD 1KOAA 3L4CA 4BQ6A 4DJMA 3OKMA 3ENEA 1U58A 2Q8BL 2VR4A 4XNYL 4NNPL 1Q1JH 4RGNC 4LE8A 4LPTA 1A7NH 1F0LA 1I1YB 4TSBL 3QZWG 1CJYA 5JW5B 4UIKH 3NSDA 4QXGH 3JVFC 2NQCA 3FUHA 4FEIA 4HEPG 4NQEE 1J5OL 4RLDA 5I6OA 4F2ME 3T77A 2XHNA 1BOYA 1MFAH 1PSKL 2ZUWA 5D1ZB 5D2LF 4FYSA 3SDAD 2OXHA 2YQBA 4R7VA 4W6YB 1UACH 1XGQA 5BVPH 2ILLA 1BAFH 4DGYH 2ZCKL 4R0LB 2ITEA 2DQUL 3I84A 2VMJA 1LE5A 2X4SA 4Y9BA 3T2NL 2QPSA 1MLCB 3LPFA 1MNNA 1IFRA 2FEJA 2X3AA 4F7MA 1NKGA 5EIVA 4XAWH 4A2HA 3QSKB 4JMXA 3BAIA 4PJHA 3UCQA 4ZO7A 4ZAKB 1D7DA 4CC4A 5I76B 1UJ3C 1FFQA 3LZLA 3LZPA 4JFXB 1DVFD 2JF1A 2VLJB 3DOSA 4DUXA 4KRNA 4BELD 4KJPD 4LEOA 5I6KA 1JNNL 1WHOA 1SYSB 3DV6A 4IMLB 5E5UB 4YXLH 2E8YA 4W68A 2X1QA 3IFNL 5I8OL 5E4EC 5EF3A 4XCNB 1G7IB 4GI9A 4KTYA 2Q8AL 1F56A 3T9WA 3ZDZB 3SQBB 1KELL 2APTA 4WGWB 5FYLL 3LRKA 3R0MA 5BMFH 1RULH 3VGAB 1X9UA 4UOW1 4AY0A 2NDFA 2PYEA 3CVHB 3CDGA 4PJ7F 3CVBA 3EG9B 3FO1B 1N68A 2AJXH 3DRTA 2DQ6A 4E5XG 1HH9B 5IIEA 1LO5A 5KSAB 2ZKHL 1MFCH 1M1XA 5FGCE 1ZHNB 2XA8L 1Z9NA 2C4XA 2KS0A 2FO4A 4FULA 2DLFH 4GUQA 2C26A 2QGBA 4U1JB 3ARDB 3OBAA 5D7JA 5H37A 4C59B 2VDKL 5IB1A 3HB3B 2AW2A 4Z7VB 1G7LB 4O02L 4BGDA 3HMXL 5DJYB 3PG2A 2NY4B 4MBOA 5IW1A 3BGAA 5BVJA 3CLFL 4X9IA 1KPVB 1GSKA 3QVAA 1J9TA 1TIUA 1HI6A 1CFMA 2RTTA 2X9YA 4P2RE 1JV2B 4G6AD 2AFNA 2NY3D 4X4KA 2A4EA 3MYJB 3V6OA 1H9VA 3B4NA 1QFWM 1N7ML 4XODA 3KXFA 1BVKA 1MW3A 1NCNA 2O6DA 2FX7L 3MBEB 4EIGB 1E27B 5E1IA 2TSAA 5EZIH 1TETL 2YKLL 5DD6A 2BX5A 4DPRA 4IIZA 2WXGA 3TBVB 2CCVA 3MRIA 5GHWL 4S1QH 4E0RB 4K73A 1WEJL 4NGHL 1NMCB 3MV7A 1WWBX 1WFMA 4NRYA 6FABH 2OTWB 3PABB 2IANE 4ZS6C 3N41B 4G1MA 1CI3M 2CO7A 2XTSA 3LRSA 3FQ4A 1L5GA 3IM1A 2F8VA 4ACTA 3V5DB 5IVXF 5SWQB 1ZV5A 1T22A 4PW9A 4C56B 2WXLA 3QR0A 3N1QC 1KG0B 4P9MH 3X11B 1WG3A 2ZUTA 3L2LA 4Z8FH 5F96L 3J7HA 2BWDA 1TENA 1IEBB 1IAIL 1KCLA 3BT0A 2EQDA 3QULB 1HJBC 2X4NB 4O00A 4LIQL 2FSEA 1P2CA 3HC0B 5DYOA 2YD4A 2P7TB 1RK1A 3L95B 3PL6B 2Y7LA 1H3XA 4NZ8A 3MV9D 1WSST 1XCWA 3P9MA 5FUCC 5DS8A 4FNLH 4F37K 4JRYE 4RGNB 4WGVB 5B21A 5DRXA 1FQ9C 1NBQA 2AV1A 4LOUC 1UWGL 3BIKA 2KLTA 5H94B 1FA4A 4U6HB 3CFBB 2VDNB 4GKSA 3N2JA 4P99A 2GIXA 3U36A 4WV1A 5CUSL 1RJZA 4IK6A 1RURL 5KOVC 1PJWA 3V5HB 2B0SL 2VZTA 4XC3L 1FIGH 2XBZA 1ETZB 1S7SB 5FFGA 2DD8L 2P24A 3WL9B 5I66A 2GHWB 3TYGL 4DK6A 3RIFF 3TWYA 4E9WA 1MCJA 2XI9A 5GXBB 2AJUL 1AXIB 5DMKA 5AOLA 4CADA 2OXGB 2CAKA 3D4YA 2QQNL 1ZGLM 4NHCL 3PUCA 3KCPA 3MRQA 3OR7B 4Z3EA 4FQQA 5CKGA 5FGBC 5G5DB 5C0FB 2BNRA 3ULSB 5LBSH 3WKMH 5D8JH 4RGMC 3LKSB 5I1JL 5E08H 5J6GA 1FFNB 3VXSD 1KJMB 1A4BA 1IO4C 4J6IA 1ND0A 4JREC 4LCCA 5I1HH 4M00A 1UJ3B 2FWSA 3MV01 4A7VA 5KBPA 3O8XC 4BFJA 1OGPA 2AJSH 3INUL 2Y0SA 4MMXA 2VLLA 1XV8A 4Y9CA 2IQAB 2ZX9A 3EJRA 4Y16C 4M7LL 4I3SL 4UINH 3QPQD 2G2NA 3MA9L 2OX5A 4L3FA 4N8VB 5IEKB 5J3HD 4O2EA 3MRPA 4PD4J 3TL5A 3B8SA 3FQNB 2H1LM 4K3JL 4OUUA 3R7QA 2X1WL 3GMNB 2ITDA 1BM7A 3EXLA 3V4PL 4FNSA 4M1CD 2YFNA 2BNQD 2XG4A 4XN1A 1TTFA 5E4EB 2IPKA 3ARFA 5K9KB 4HJSA 5AW1B 4AC4A 2EO1A 4QKTA 2DM3A 4B9CA 1F4YH 1ZKAA 3LKRA 4S0TD 5JORB 1K2DB 3CMOH 1EZLA 4H40A 4U6VH 1SY6L 4JFED 2AK4A 2ZWLT 5EH1A 4HHAB 5DZJA 2ORBL 3CX2A 2CBQA 1N0LA 2Z4TA 4G1EA 4HJJL 4CVZB 5K1NA 4FQ1L 1GHFL 4XPHL 1VEOA 3FB6B 1MRCL 3RVWD 1Z5LA 4GMSL 3T4AC 2DQIH 4O5LH 5IUCA 2A9AA 3MI6A 3FMGH 3T6VA 4HJIA 3EYVB 1NWOA 4G6JL 3RKDC 3S4SG 4YHIA 5EC2B 3FT4B 1ACYH 4FNUA 2IFFH 4XN9A 4AQ8C 4HU8A 2BRRL 1HNFA 4UOW0 1EZVX 3RBGA 1BF5A 5KVGE 4JM4L 4OKVA 4NKQB 3HI5L 3CXDL 2A2QT 3ZX1A 5KSVA 2A6DB 4WI4A 4JG9A 4M6ML 1DJHA 2MNWA 1OCWL 2OR9L 1U8CB 1OL0A 1PSKH 3QJHA 2F7PA 2VLJE 1CFTA 4UQEA 3ZHNA 2JELH 1LO2H 1MCWW 2E6PA 3LQMA 4V1DD 4JB9L 2K6ZA 1RD6A 4HS3A 5SWZA 4NAQA 5MERA 3OR6A 4GRWE 2DKSA 1FE8L 1PY4A 1MJ7H 3MV8B 5F9OH 5FA4A 4KNUA 3SE8L 4IOSA 4AE0A 3UAFA 1QRKA 4D0DA 2H47C 1CL7L 2CGRH 5FYJD 2ZIDA 5LGYA 4DKDC 5J06A 4KK5D 1SNRA 3O45A 1GC1H 1YEGL 4ZOAA 5BNXD 1V3MA 5EBWA 5B38B 1MPAL 3ZDZE 1KGYE 2J6EA 3LY6A 2XNAB 4MQ7A 4JG1L 4EUPA 3F7LA 3GPEA 2ZJSH 3UAJA 4PJFF 4R3SA 4D8PB 3N40F 3NGBC 3TWCH 3T0ED 2WQAA 2DBLL 2AQRA 1A7OH 3X3FL 1N9PA 2WAHA 2EADA 4RCAA 3WELA 1FL5A 4K7FB 4DN4H 4DKTA 5CBAA 4KK6D 4QRPA 5BUPA 4F8PA 3QQ9C 4I77H 1OE3A 2ETWA 3P77A 4FNQA 4PIBA 1OARL 4AC2A 3KPLB 5C0ND 3TPUB 1WH0A 2YAOA 4GAAA 4TRPH 3KL3A 2P28B 1YJDH 3JWOH 5D5MA 4Z7NF 4HWUA 3IKCB 2A73A 3OSVA 3CK0H 4P23C 4JO3H 3ZR5A 2DQFB 1KB5A 1LM8V 1P5VB 4X4YA 5IFAL 3VSQA 5JXED 5F7YC 3K80A 2CPUA 3FOLA 3VGEA 3CH8A 2AEOA 3ARVA 1HS6A 5KSBE 1ZLEA 4OIIH 2FLMA 4G5ZH 1FUNA 4NC1E 1MHEA 1G7QB 2J8HA 5DMGC 5IMOB 4TNWK 2AEIT 4YE4H 3UPCA 1GS7A