2BWJA

Structure of adenylate kinase 5
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
b'GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE 5
publication title Structure of Adenylate Kinase 5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bwjA00
3X1ZA 4LBVA 1JEEA 4GT1A 4WW0A 5FTJA 3DVLA 2L0XA 4FN5A 3RS2A 2XXAA 3G5UA 4EJSB 3V9PA 1N5KA 1OH8A 1G19A 1KK2A 3C8UA 4QBGB 2GESA 3AUXA 2HF9A 2BHRA 5L3SB 1W36C 2D3WA 4AKIA 1Z08A 2ZJAA 1E9CA 2FH5B 2QE7A 4TLCA 3TRFA 2GJKA 4QRHA 3NBXX 5LBIA 4KO8A 3CPHA 4JLBA 1Q1QA 2QA5A 3VR2A 1IM2A 1R0YA 2ERYA 1G8PA 2IYVA 3GLHE 4DWJA 2UVQA 2FDCA 3EPLA 2R6CA 1P5ZB 2ZVPX 4ZDWA 1QHSA 1SXJB 5AUNB 5FPSA 1AZSC 1ZM7A 1M7GA 2LCFA 1YRAA 3QF4B 2ZSFA 1I4LD 2ZQ5A 3K0SA 1UAAA 2HJVA 1N6KA 1ZIPA 4DBLC 2XITA 4NYMQ 4JL6A 3PJRA 4K8OA 4V0NA 4Y0VA 2Q9CA 3FMOB 4KFUA 2A78A 3G82C 3L0IB 1UJ2A 3KJEA 3DMNA 5DO9A 2GAOA 3QKTA 2D74A 1ZAKA 2BCJQ 2ZI9A 3K09C 3U3RA 3U61B 4ZI2A 4Y0AA 3N70A 2R6AA 2WJJA 1SVLA 3AP3A 3WXMA 3NH9A 4B6EA 2VRWA 1IN6A 4PFSA 2ZI5A 1W4RA 3KXKA 2FJUA 1KI2A 1EGAA 1ZNWA 2JLRA 2ASEA 1YE8A 4V0KA 2C96A 2IUSA 2P3SA 3KZ1E 1BIFA 4B32A 3B9QA 4LHWA 4HAYA 4EFMA 1E96A 2BVNA 3R8FA 1RRPA 5DHFA 4FMCF 2OFWA 4OJKA 2WWIA 4NYIR 2AFIE 2WWYA 1K5DA 2ZRHA 5HZHA 3GJ4A 3TUJC 2A30A 4PZYA 4KLZA 1E79D 2JJ2D 4C30A 4BLQA 1KDOA 1AKYA 2BBTA 4L16A 3OAAD 5D3MB 1LTQA 1D8TA 1I4TD 3TBKA 1YVDA 2AX4A 2XTNA 1DAEA 1KI4A 2EWVA 5JS7A 1W36B 2REOA 4YMWA 4PC3A 3NTUA 1KMQA 3SQWA 5EUMA 4W5HA 1Z6XA 2ZJYA 4HSEA 1P9RA 4TYNA 2J87A 4AWXA 2MMCA 4A0HA 3KB2A 2EFDB 4B3BA 1KMHA 2KJQA 2W0SA 3O8CA 2E87A 5GADl 2NPIA 3I72A 2IYQA 2VYFA 2W6IA 3THOA 5DN6D 5EP1A 5JFGA 3P1JA 4HB0A 3LAWA 1Z2CA 3AUYA 3HU2A 3BB3A 4NHOA 4B6FA 2FV8A 2ZYUX 3QBTA 2ZAOA 3WBKA 4QBIA 3AKYA 3EG5A 4MYUA 3AKCA 1HTWA 1VCMA 2GK7A 4AIIA 4DCVA 5A4JA 4LV8B 4C0SA 1VCNA 1IJEA 1SGWA 2IHBA 4Q5IA 1VDZA 4Q7KA 1JR3A 2BBOA 4DRZA 2NTYC 2ODEA 1YJ5A 3LX8A 4D4MA 5IT5A 4FWTA 1XD2A 5FBLB 2CJWA 2EFGA 3CRQA 1Z0IA 2JLSA 2P6NA 4HDQB 4M22A 4QGGA 4B73A 1Q1BA 2CBZA 2OSBA 1TF5A 5KHOC 4HZUB 1WQ1R 4BZQA 1MO6A 4TN1A 4US1R 4DLTA 1E0SA 2GBLA 3IBYA 3Q85A 5DE3A 1RRCA 5BXQC 3H86A 4TL9A 4Q18A 4KJZA 1G8HA 1JECA 4RZUA 5F9FA 1NKSA 4EIWA 4CT4B 1BMFA 3FMIA 3ZH9B 5L3VA 2GRJA 1WBDA 2H17A 5JJKA 2RB4A 1G5TA 1GOTA 2X2FA 3MLEA 4IDNA 3TW4A 4B48A 2O8DB 2BMFA 2NIPA 4EDHA 1Z0JA 2ERXA 4LOAA 4P4TA 1P9NA 3UPUA 1NRJB 5CJ2A 5FBQB 5L3SA 4A92A 2YOFA 3EZ6A 5DLQC 1F3OA 2UZIR 3AGPA 2JLUA 5J4VA 1QG2A 4JLVA 5FOTA 1D9XA 5FUXA 4LJ7A 4QHTA 1H8HA 1NG9A 4JLAA 3ZVMA 5FI0B 5M04A 2YOGA 4ACAA 4L5BA 1YKSA 4A6XA 4LHVA 1SXJA 2VSFA 4JSTA 4YC7A 3EPJA 3KTAA 2QTFA 3QF4A 3RAPR 3LNCA 3FOZA 2GVDC 1UF9A 2EYUA 4ILEA 4I1OA 4BLOA 1G7RA 1OF1A 4WXPA 2W6ID 1NBME 1U90A 3TSZA 3PEYA 1KSGA 1W49A 1NLYA 1DG3A 4PHTA 1TUIA 2BKUA 4CW7A 4RD2A 4CGZA 2FWRA 4TZ6A 4D0GA 1LFDB 3MWLA 5KNBA 2P6RA 1G8FA 2HCBA 3GJ5A 3KJHA 1W5TA 2ATVA 3LLUA 1LNZA 1IXRC 4Z8XA 2H1LA 2XZOA 1L7VC 3EA5A 1OKKA 1GWNA 1G18A 2VP6A 1Q21A 1U0LA 2FZLA 1JR3D 1E3MA 3QKUA 3RC3A 4XVRA 1E2FA 1ETUA 2ZM5A 1P2TA 4IDHA 3CWZA 5EQTA 4QM7A 1Z8FA 1T3LA 3A8TA 3SEAA 1ZNYA 3CNOA 5F9HA 2HYIC 4QJ4A 4DJTA 3TGPA 1AKEA 5E4FA 5AWFC 1QDEA 3E1SA 3EC1A 4II7A 4ASUD 4LYAA 3B7GA 4OI2A 2H18A 3WRXC 3T1QA 1Z22A 3LRPA 4F93B 4NCNA 1XPOA 1TEXA 1YHNA 3A4NA 4U02A 5BQ5A 4B3XA 5EE5B 2J0UB 2J7PA 2CDNA 2ZRDA 4LPSA 3UATA 1D9ZA 5D3MA 1E2QA 1AK2A 1XMJA 4AKHA 1NLZA 4X8LA 1KK0A 1Z83A 4R9UC 2JDIA 4BFXA 1FNMA 1SVSA 2ZIAA 3LVRE 3R20A 1E1RA 4I1UA 1RRFA 5C18A 3RS4A 1MR3F 2CLCX 3KJGA 3NG1A 3SFVA 1BS1A 4JLDA 2NQ2C 1EFCA 2ZRIA 3VU9B 4PHFA 5BN5A 5KTYA 1DAMA 4D81A 1GL9B 1NVVQ 1E99A 1N0VC 2NO7A 5KPJA 4KFSA 5J4HA 2FNAA 2DYKA 1WP9A 3CZPA 3M1IA 1ZC4A 3SYKA 3OE7A 2XB2A 2J0SA 1HV8A 1CKEA 1W5SA 1KZ7B 1N6LA 4GBMA 1Z3IX 1R0ZA 4RKFA 121PA 2WKRA 4LC0A 1SVKA 2R6DA 3NWJA 2AK2A 5AK0A 3O8DA 4ACBA 3K09A 5G41A 3P4YA 2ZR9A 4BASA 3PUWA 1I2MA 1U2RA 2PJZA 4MQBA 3SI7A 1YR8A 3C41J 1OE0A 3IQXA 3PQCA 4ON9A 3TW8B 1AJEA 1MOZA 3LLMA 4IFBA 2EWWA 1XCPA 4JYCA 1OFUX 1KKLA 1ANKA 1AZTA 3KKQA 2VHQA 2I3BA 2OCAA 1Z47A 4UNNA 1E1QA 3RC8A 4YDSA 3EA0A 2YWEA 4D0LB 3PUYA 1EG7A 1OKKD 1QVAA 2WIBA 3A1TA 2ZJZA 3LBNA 3OEEA 4PZLA 1T8UA 1NJGA 3BERA 1T9HA 1WRBA 3VX3A 2FSIA 3VNUA 3GLGE 5EP4A 1F2TB 2IYTA 3RYTC 3GPLA 2JLXA 3EASA 4GP7A 3R8CA 4DLXA 4R2HA 1VHLA 1AQYA 2IS4A 1S3GA 4ZCIA 1G21E 3PCRB 2QM7A 3RNLA 1ZW6A 2O8DA 2FPLA 2ZE7A 1J8YF 3LQRA 1RVDA 2V9PA 3C16C 1ZNZA 2C98A 3WMGA 4O3MA 4D2IA 1G4UR 3QPVA 3FTQA 4G5GA 5JLJA 1LF5A 5E3HA 4DDUA 4H1UA 3QKSA 3KQUA 2J7PD 3KXIA 5C1BA 3NHAA 2MSDB 2MMGA 2RGXA 3IBGA 3TK1A 4F4CA 2FE4A 1UEJA 4LJAA 4UXHA 2V55B 4RZXA 2JDID 1DPFA 2F1RA 4PAQA 2DFTA 3AF2A 4LI0A 4V0OA 1D6JA 1DAGA 3N5CA 3AVWA 1L2TA 1QBKC 3MG9A 5EXPA 4V02A 4MYTA 1DG1G 2RGGA 3QOFA 1FPMA 3ADBA 1GIAA 1S4QA 1UBGA 2QM8A 3DO6A 4LY6A 4UXJA 3SYLA 2IW3A 3KQHA 2QBYB 3AM1A 2O8CB 2IXFA 1RYFA 2HLDA 2WWGA 3TR0A 4B34A 3W90A 3QUSA 4LUCA 2VP9A 1P61B 4ESVA 4QJ3A 2IXGA 3K0CC 4D6PA 2LKDA 1HUQA 2R2AA 3OE7D 5AR1A 1AGRA 1HH4A 2OUKA 4RD4A 5AJXA 4V0LA 5BN3A 2X77A 2BV3A 1OB5A 1OXUA 3TUZC 3FKQA 3C15C 4D26A 2WWFA 2ATXA 4B3DA 5SZJA 2ZR0A 2QRNA 1OFTA 2YNMA 1IN8A 1XCGB 1GSIA 1GNRA 1UM8A 3X1DA 1SVMA 2QI9C 2IC5A 4URWR 1M34E 4M1KA 1SVWA 2VBCA 1M2OB 3NBZC 4MUAA 221PA 1UADA 5C2JB 3I8SA 3THWB 4US0R 4AC9A 5SZKB 2AD5A 1DBSA 1L8QA 4C0LA 1E9EA 2ODNA 2OG2A 2QP4A 3A1WA 4D4JA 4D80A 1FUKA 5FPTA 3B82A 4OQNA 2J0UA 4QG7A 1DAHA 2J0QA 3OEED 4WZBE 2DHRA 1CR0A 1W1WA 2JATA 3C5HA 2OEPA 1ESNA 2CE2X 2RGNA 2Q3FA 3NXSA 1TQ2A 2GEVA 3QVUA 4PANA 4MRVA 3B1WA 3D7MA 2G1JA 1OV4A 3H4MA 4A2WA 3FHTA 4EUNA 4A6PA 1VTKA 3SBDA 3VU9A 5JRZA 4KBFA 4F91B 3D8BA 3I62A 3H0KA 2PX0A 3KXLA 4MH0R 4AG5A 3SOPA 4WZAE 3TSOA 2J45A 3AVYA 1LW7A 3RWOA 1GAJA 2IF0A 1PVOA 3CUEF 2FEOA 1DE0A 2BOVA 1ZM3A 4PO8A 1EFTA 2GZHA 4TMVA 3GLHB 2GF9A 1TQDA 4MA4A 2HEIA 1IY0A 5FUYA 1CLUA 1P2SA 1R10A 4C0BA 2ZU6A 4GRAA 3U7GA 4G5OA 1R2QA 4X8OA 4RJLA 3LXXA 1CJMA 2IUUA 1DS6A 3THXB 3LY5A 4HUQB 4PQYA 2I1QA 5HZKA 2VHUA 4NCKA 1UKZA 2OILA 4YXWA 3F8TA 5FTLA 2JLWA 2IYUA 2QAGA 4GNKA 1G3RA 2FMXA 4AD8A 3NDPA 4KV9A 4DT1B 2F7SA 2WAXA 1T91A 3TLXA 4EFLA 3AVVA 4IKEA 2OT3B 4RCZA 1CBUA 1LS6A 4RZ2A 1NY6A 1IN7A 1F2TA 3F0TA 4D4KA 4GP6A 3GJ8A 3K70B 2A9KA 3RHFA 1DOAA 1CP2A 3U6KA 3GQBA 4DDWA 3D6TB 2IX3A 2CE7A 2RH5A 1RW4A 3TH5A 5LD2C 1Z2AA 3M4YA 4MDFA 2N46A 3SN6A 4D82A 3JZAA 2ZROA 1GNPA 1NNEA 4PR0A 3DHWC 2EW1A 5HE9A 4JL8A 1E69A 2BMJA 1FP7A 3WYAA 5JSZB 5DYIA 3HYRA 2X19A 3ICEA 2QMEA 1OHHA 4C9BA 3ADKA 4WZ6A 2D2FA 3IHWA 1OXTA 2KWIA 1SVOA 5JS8A 1E0KA 4BRWA 2C9OA 1OT3A 1E2DA 3ADCA 2O8CA 2QBYA 4ZDJA 4Q7JB 3DM9B 3T15A 1TUEA 1A5TA 1SULA 1G3IA 1II8B 2X1VA 2ZE5A 2IS2A 2CVFA 1BKDR 1B0UA 2D7DA 4R2IA 2RGAA 2YOHA 1QHGA 1Z0DA 2Q21A 1M74A 1DELA 1ZUNB 3F5FA 3FFAA 2Z4RA 2WOJA 3MWKA 4Q02A 5EZ6B 3EC2A 2Q6TA 1VG1A 4AYWA 5JWOA 5CITA 1RRGA 3WMEA 4MRRA 3VFDA 2QPOA 1P75A 2OCBA 3BAFA 2FZ4A 3NHBA 3QEJA 3TQFA 1XWIA 1DVRA 2TMKA 1CTQA 5FPYA 4YXWD 2FEMA 4K46A 1GRRA 3THWA 4HLDA 1J7KA 5AUPB 2IBMA 4BUJA 1JJVA 3Q7QA 2WJHA 1Z29A 4Q9LA 5UKDA 4JVLA 5CK5A 1B23P 4JS0A 5J4YA 2ZR7A 1IOZA 5K8TA 3R7WB 3DZDA 5LD2B 4QNRA 3KQNA 2XNSA 1ZNXA 2J41A 5AJWA 2WWHA 4QFMA 1JEDA 1FZQA 1T0JB 3KFXA 4OK5A 3KX2A 4TMKA 5CYOA 4Q4LA 2PMDA 1DO0A 1VG9B 2QPAA 2V1XA 2B7BA 5KDDA 3E70C 4YMVA 4OJQA 2FPKA 1YZTA 2ZJ8A 4WXRA 1AS2A 2C04A 3U6BA 2XGJA 4QBFA 2O0KA 3KKNA 3U3OA 4Q7LA 3S1AB 3KKOA 3RDPA 5H8WA 3ASYA 1OW3B 3ZQJA 2RGCA 2IS1A 1T6NA 4CIDA 1LY1A 3LXRA 3PR1A 3JVVA 1N6PA 1PUJA 1LS1A 3U4QB 3GLHA 1FTSA 3TE6A 3C5CA 4URVR 4JLOA 2PZEA 5B2ZA 3CR8A 1ZM9A 1TF2A 1KNXA 2BMDA 1RPZA 4YMTA 2ZRCA 1U99A 4IOMA 4JZKA 5AJZA 4XD7A 3AVUA 2R44A 3THXA 4PX9A 2WSSA 5EP2A 2LKCA 3T1TA 4HUQA 4KYIB 2EVWX 4Q4JB 4E09A 2CL7X 2W2VA 1D2EA 5IF9A 1E6CA 3OIUA 3ZVLA 1ZCBA 4BQSA 2GHIA 2YZ2A 3IHLA 2GJ8A 4DT1A 4OI4A 1HEIA 3UXMA 3I3SR 4DEXA 5BYKA 2QNRA 5AJVB 4EPXA 1SKQA 4ARZB 3BH0A 3W3ZB 4ZCMA 3Q9LA 4BFVA 2GXSA 2VLIA 3NEYA 3CKLA 4GL2A 4LC1A 4QL3A 2AD1A 4CZ2A 5LPNA 2R62A 4MKIA 3SJZA 1TAGA 2Z6VA 1E94E 2N1BA 1ONBA 5EE0A 4M9SA 5HTKA 3GLIB 1VG0B 2B8TA 5EE1A 2A5JA 3LH5A 2W00A 4NU0A 1ZM4A 1U9IC 3C4JA 5TY0A 1AGPA 2YC4C 4B43A 4M1WA 4TZ0A 2DFKB 1M7HA 2AHOA 3T1VA 2H16A 1MRSA 3GFOA 4YLGA 5FL3A 4E22A 1T8TA 2KB0A 5JSZA 4IXNA 2ZRBA 1ZRHA 1J90A 2H7VA 5EP3A 4JVNA 1MT0A 2HCJB 4GMXA 1G16A 4OQXA 1AS0A 1FQKA 2ODWA 2ZE8A 4QBHA 5KUTA 5JWRA 1UBEA 5FOWA 3I8XA 5GJVC 4BE7B 3CIOA 4OI0A 2QORA 4TL8A 1E4YA 2YINC 5JMTA 1W4AA 2ZJ5A 4PAOA 1II8A 2GTPA 1XZPA 3AP2A 2B7CA 2WKPA 1GRNA 5FFMA 3QEOA 1DTSA 5HKKD 3IO5A 2OFOA 2Z4SA 4JLKA 1WCV1 1K8RA 1VCOA 1EK0A 1Q44A 1ZD8A 2QTHA 2H8KA 3AVTA 3OF5A 4L9SA 2HYDA 2F1JA 2ZUDA 3D3QA 1JPNA 2EU8A 2IYWA 2CLDX 2R6FA 2C99A 3DDCA 1KGDA 1KSJA 4XSHA 4LK2A 4NDZA 5IK2A 1O87A 1NKTA 1EFRA 2WSSD 1G64A 4AKGA 4U5XA 2W83A 4NYMR 4XH9B 5CK4A 2REBA 3VKHA 4Q21A 1JBKA 2QE7D 4KVAA 3OIWA 1OH7A 3BFVA 4L9WA 8OHMA 2G0NA 2IXEA 1IN4A 3WMFA 2PCLA 4XJXA 3R7WA 4LJ4A 5HCNA 4GOXA 1ZVQA 3K9HA 2ZJOA 3A6PC 2JASA 3RS7A 2H57A 4V03A 3WNDA 4DC9A 3VR1A 3GLGB 3KQKA 3K9GA 1C4OA 3K70D 3U44B 1WDTA 2VEDA 5FPHA 3LBIA 1W7AA 4DB2A 3IEUA 4OHXA 4PXAA 1E9FA 4XVQA 5TDHA 4DLSA 3IQWA 2WSMA 4TLEA 1MH1A 1S3SA 2JLZA 3L82B 5KNCA 2HV8A 1UDWA 3CNLA 3ONWA 4TT3A 2IYZA 3B9PA 2V1UA 3UG7A 1W4CA 4M21A 1OLOA 3V4RA 3S1AA 3EAQA 4MKGA 1N6NA 3VR4A 4GI7A 4N0DA 3P20A 3WNBA 2FU5C 2WM9B 2WV9A 4B47A 5TVKA 3HPRA 3O8BA 3Q5DA 3U4QA 2GF0A 1XD9A 1Z0FA 1Y63A 4QXAA 4CEHB 4GFDA 3DM5A 4QM6A 3KJIA 3UMFA 2JGNA 5LB4A 2DB3A 5KOYA 4BFTA 4IRUB 1U0JA 3SDZA 3SJCA 2DFLA 2ZRLA 2ZUCA 4EJSA 3OEHA 1KK3A 1XTJA 3ETLA 2QT0A 3GJXC 1Q1EA 2WWWA 1NBMA 3WNCA 4B2PA 1QHHB 1XP8A 2YYZA 4HAZA 1WXQA 4Q4JA 5KSYA 4TYYA 4DVGA 2WWXA 4KAXA 1JNYA 2ANCA 2ZRMA 1UBFA 1H8EA 1Y3AA 3ZZTA 2DPXA 1XEWX 1NMZA 2ZSAA 4Q19A 4EFNA 4M1YA 3I73A 4EPWA 4GZMA 1ZD9A 5FBVB 3SR0A 2XOKA 3QENA 3P27A 2GK6A 1E2EA 5BWMA 1R0XA 3H2YA 1G5RA 4M1OA 1GVNB 1M6NA 4ARZA 5IK2D 3NBFA 3QXXA 1EFRD 4C3ZA 4ZV4A 3QJYA 1TF7A 1ZIOA 2BWJA 4JJZA 4LHZA 1TU4A 1LF0A 4Q03A 4BEJA 1HE8B 2ZU0C 3W5JA 4DDVA 4Q1DA 1X8LA 3QPWA 4TTQA 1E2PA 1S1MA 2ZEJA 4TLBA 2VIIA 1Q3HA 1XXHE 1YZLA 4HDOB 3B13B 4I1VA 5TARA 4RSGA 4M1TA 2QQEA 1XZQA 2RKOA 1MKYA 1YZNA 2H92A 2WPDA 1GNQA 1NVXQ 2BJVA 5JBQA 3TKLA 3R9IA 1XJQA 1MO3A 3BS4A 5B57C 1Z5ZA 3WHLA 4KCGA 3EW9A 4LBWA 2QQ0A 1II9A 2PCJA 4BFUA 4O25A 2QY9A 2D62A 4DLRA 3BFXA 3BH6A 2ORIA 2OV2A 3IKJA 3EIHA 3DOEA 1JR6A 4KBGA 3CF2A 3WBJA 3BB1A 5JWHA 1UEIA 5CDFE 3Q72A 4TYPA 2OESA 2N42A 2QSZA 4HAXA 1S8FA 2G3YA 1OFHA 2V54A 2WJIA 2BBSA 4Q9HA 4V0ME 4KODA 4R71A 4IW3B 1HE1C 2ZETA 5B58C 2JLYA 3AF1A 4TL7A 5K8LA 1KHTA 4PSVA 1XF9A 3UK6A 2WICA 4HLQB 2GXUA 1BMFD 4EQ6B 2DR3A 4E07A 3I5YA 5FTMA 2OAQ1 4PC7A 1ZD1A 2VH5R 4CDGA 3X1WA 2QZ4A 5FL7A 2MSEB 3ZYCA 1X1SA 3H1TA 3OEHD 2XSZA 4BPBA 2CXXA 3FHCB 4P4UA 3L8ZA 1TPZA 2GJ9A 4QNMA 4E03A 1IHUA 4EPVA 2GA8A 4NCIA 3QSYA 2V4ZA 4J0QA 3IUYA 4JYBA 5L3RA 1L4YA 4D0NA 3WRYC 4KXFB 4B3CA 1JAIA 3J81k 1ZCAA 2XOKD 1I4DD 3HYTA 2IS6A 1H8HD 3W9YA 3NEJA 4OK3A 2BC9A 1SXJD 1X86B 2O8BB 2ZI3A 3GLGA 3A4LA 2GXQA 3DOFA 3U44A 5G40A 4DCUA 4YQFA 2IWRA 4LWZA 3AQ4A 2PLFA 1AA9A 5GVRA 3K1JA 1IJFA 1AM4D 1MO4A 3U7EB 1DO2A 1K5GA 1KNQA 3PUZA 4KU4A 1MABB 4HZUA 3LW7A 4ZKDA 2ZYVX 4HB3A 2RCNA 1GRQA 5KSZA 1Q22A 2NMVA 1XCMA 1KJYA 3KQLA 3EZ9A 2IK8A 2QUZA 4CVNA 1PLKA 1GKYA 3Q5EA 4I99A 4DUGA 2CCKA 1SKYE 1NIJA 3FVQA 4DHEA 1NJFA 2FF7A 4BZXA 4CEHA 2NPFA 4LV6A 3WYFA 4DLYA 2CCGA 1XTRA 4IDOA 2QG6A 4XTRA 2ZS9A 2FSHA 3L0SA 3NC1C 4RVCA 3MMPA 1QHHA 1NVVR 2C03A 2VHJA 1FFHA 1AQUA 1HURA 1QHXA 1XFAA 2IEYA 2R9VA 1U0HC 4Q7MB 3ZDQA 4M9ZA 3CRW1 2V8OA 421PA 4OBEA 4Q47A 1DAFA 1W36D 5CLLA 3AVOA 4C0AC 2VTKA 1FTNA 1FMLA 3QIAA 4MRSA 5FUWA 2F3TA 3U3KA 3U7FB 1E1RD 4A0FA 1E9RA 4HLUC 2VSOA 2ZSDA 2XTMA 3BORA 4OQMA 5CM9C 5FL7D 4QC2A 3SHWA 2QAJA 2CEAA 5GJCA 4DSUA 3GP8A 3C7KA 4LDJA 1F6BA 4BZPA 1P72A 1G41A 1GFIA 4HLCA 1S1CA 2XSZD 4IDQA 3CRRA 1TADA 3REGA 1KOFA 2OFXA 3M6AA 5B30A 1F2UB 1NVUQ 3BRWD 3ZS9A 3FKSA 5KNDA 4C0HA 5EJEA 4MGZR 4NYJR 1E9BA 5DI9A 1KJZA 4ABYA 2AXPA 1DADA 5J4LA 2C2HA 1XB2A 3RRMA 3UIEA 1D2NA 3ND8A 1LVGA 4OHYA 2G9NA 1XJ0A 3EZ2A 2ZS8A 3MCAA 3NH6A 2BKEA 2D06A 3T34A 2ZANA 1KO8A 1P4SA 2FN4A 3N2EA 5CJPA 4PPNA 4OKSA 4EPRA 4OQLA 1KY2A 1S2MA 3B60A 1ZM2A 3KB1A 3T5GA 3GLIE 1XX6A 2CLSA 4DSTA 5G3ZA 3PV0A 1NVWQ 1N5JA 1ZJ6A 4IXMA 2HT6A 2XTZA 2A5DA 1GZSA 5BYJA 1E1QD 2G1KA 4HAVA 1E4VA 3GJ0A 1G3QA 4AK9A 2V3CC 1UKEA 1GKIA 3EWSA 3QE0A 5TXGA 3UANA 2O5VA 4MRNA 2I4IA 2VQSA 4QOSA 4EQ6A 4WBSA 3JVUA 3TVTA 3GLFE 1G20E 3PXGA 1E2KA 4JVSB 5LDDC 5FOUA 1JXOA 2QT1A 5TV2A 1Z6YA 3PEUA 1DAKA 2DY1A 3LWNA 4DLUA 2A7QA 4O2LA 4W5JA 6Q21A 4IFEA 4IOKA 3VHXA 4B3GA 1BOFA 3WP1B 4URZR 1E0AA 4JT4A 4UNSA 4B71A 3RSOA 2FFHA 4M0LA 3U3MA 4ITRC 2IYSA 2ZRNA 1BO6A 3A4MA 4OK6A 2CK3A 4EPTA 3MGCA 3RS3A 1W46A 4A15A 2BIFA 5GJBA 1XTIA 4P33A 1E2HA 1XEXB 5FOXA 1XNJA 4DSOA 1K6MA 3DKPA 2XNDA 4JBWA 2O8BA 4E5UA 2FSGA 1CR4A 1ESMA 2FG5A 1X3SA 2HLDD 5DHAA 3HDTA 1ZYUA 2IL1A 3HPQA 4PC2A 3QI2A 2OHFA 3WHKA 3CWQA 3FGNA 4G0NA 4MKFA 1QZXA 3C14C 2C5LA 3FE2A 3B78A 1C9KA 1P62B 4C0KA 1Z63A 1RFLA 1G7SA 1CR1A 4F7WA 1MABA 2GCOB 4I1SA 4B74A 3VQTA 1NN5A 1R7RA 2NGRA 1NSFA 2FGKA 3OFNA 1A2BA 4I4LA 2A5YB 4ZO4A 1R6BX 1Q12A 4M53A 2QGNA 2RGDA 3I4LA 3IPYA 3LW8A 4A82A 3GJ6A 5FH9A 2BEJA 3I32A 3HR7A 4TSFA 4M9QA 1OFIA 3CLVA 1IY2A 1P60A 4B44A 3B1VA 5E7IA 1T3SA 5JI2E 4XWOA 1NLFA 4FINA 4CEJB 1A1VA 2BM1A 1CULC 1NN1A 1R0WA 3BB4A 4HZIA 4BEBA 2VHCA 2YWFA 1XJCA 3FPAA 2QROA 4JLPA 5CB6A 3U5ZB 1G6HA 1XTQA 4YDHB 2QTVB 4X8HA 5EXTA 3EPKA 3KDSE 3GEIA 4S2EA 1R5OA 3GEHA 3TAHA 3LO5A 4LBZA 3CX7A 1JJ7A 3ZLJA 2P5TB 3QXSA 1CRQA 2AK3A 3AV0B 1SZPA 3IIMA 4PO1A 3FDIA 1R8SA 2GNOA 3MUFA 2AL7A 1BH2A 2BMEA 4EKDA 3KKMA 4N0EA 1O3YA 4KVGA 1N6HA 4PHHA 5JI3E 1IN5A 1JQJC 3GMTA 3P32A 4RD0A 1KZGB 2ZI4A 4OYHA 4G5QA 1E2IA 1F2UA 2B6HA 4ZI3A 4LYFA 4MRPA 3ZIAA 5J5CA 2EQBA 4DKXA 2VL7A 2Q3MA 4UNPA 1FUUA 1NL3A 1VPLA 2CVHA 2WHXA 3DMDA 4GOKA 1OYWA 4R98A 3T5DA 2HT1A 1E9SA 1OIVA 4FIDA 1G8GA 2O8EB 1RE0A 1KI3A 3PEWA 2ZPTX 2WMOB 2QRZA 2XNDD 2AWNA 4BFZA 1G8YA 2GBLC 3L0PA 1WB9A 1N5IA 2YC2C 4NH0A 3NDBB 5KPDA 3AVQA 3WP0A 1S9DA 4IJMA 1RJ9B 4LBYA 3VMFA 2YWHA 4AY2A 5JHHB 4M1SA 4URXR 1S0UA 3CM0A 4PC1A 4Q4AB 2PBRA 3RRZA 2V7QA 3ZD7A 5FOSA 1WE2A 3PUXA 2ZRAA 4CYMA 2WVJA 4RFSB 2AN9A 1E32A 4UQOA 1U94A 3EIEA 3OFND 4UKDA 4RCYA 2Z43A 1A82A 1N25A 3NIBA 4DEYA 4P0TA 4TLAA 4KLNA 1IBRA 2YHSA 2FOLA 1KK1A 2WKQA 3MRSA 4PAMA 1TQ6A 3UWKA 1OH5A 3PUVA 1YZKA 1X1RA 1ZINA 3UWOA 4DIDA 2ZI7A 2F6RA 1J8MF 1XBTA 5C4MA 2J3EA 4IDPA 1S96A 2R65A 4BLRA 1CEEA 2EFHB 1GG2A 1VYUA 5JEEA 4B2IA 2P65A 4FMDB 2ZRFA 4PTLA 5DYGA 4ESHA 1KY3A 5JCPA 2YJTD 4C2TA 2HF8A 3MWJA 4HLUA 3CONA 3SQXA 3LQQA 4IOLA 3BGWA 4K81B 1XMSA 2Q9AA 4G01B 2JLQA 5GJWC 2UZ3A 1PLLA 1T5LA 2IYYA 2JJ1A 1W4BA 3DKVA 1UKYA 1RKBA 4NKRA 1T0HB 2JLVA 1HY3A 5G53C 3K0FB 3QKRB 5FR2A 5C46F 2W0MA 3MAAC 1YR9A 3OZXA 1OHHD 1ZU5A 4OL0A 1ZP6A 2IWHA 4G5RA 1BYUA 3K0CA 4EPYA 3W8NA 3EIQA 1OYYA 4L8GA 2KE5A 5DSZA 4OQFA 1YR6A 1N6OA 1IXZA 4URYR 4U7DA 3SJAA 4GZLA 3LV8A 5EE9A 1R5NA 3GD7A 3K9LA 1DAIA 1E79A 2JJ2A 4TMWA 1YZGA 3ZS8A 1XXHB 1UPTA 2IF2A 1CR2A 4RD6A 4G5SA 4LPKA 2RAPA 4FMBB 2W2XA 5ANRB 1CIPA 1J2JA 1NN3A 4C7OB 2GCOA 2NO6A 3B1ZA 1N5LA 2P67A 3QVVA 5K8UA 3WY9A 1IY1A 1US8B 4Z54A 2ECKA 5D3QA 1Z28A 2GCPA 2PH1A 3U2QA 5A5GA 5KDOA 2J5XA 2J0VA 4A2PA 4F4JA 1TL7C 4WA7A 1IXSB 4UNRA 3QF7A 4A8JC 4NYIQ 3LBHA 2K5UA 2ZTSA 4TQUS 4U00A 2W58A 3HP1A 5DN6A 3EZFA 4TYWA 2DFNA 2V7QD 4CEJA 1KIMA 2ZRGA 1ZUHA 1OSNA 3O47A 4Q1CA 1Z6AA 1EXMA 4RD3A 3W8RA 1E2LA 1RIFA 3TJZA 4F4IA 1OB2A 3EPHA 5FR1A 4B76A 4KHZA 4LV5B 3QXHA 2D4HA 5FOVA 1CJUC 4OHWA 2XZLA 2NO9A 5DIFA 1XPRA 3RS5A 1TX4B 1G5PA 5G3YA 3MFYA 4NPHA 3KTAB 4KYUA 4Q1BA 4M8NE 2WJYA 3T1OA 2IYXA 3A36A 4NMMA 3RRNA 4HI0E 1Q1ZA 2FFQA 1EESA 3GCGA 3K0EA 1LV7A 1T4GA 4PQFA 2Y8EA 4L15A 2OLJA 3EWAA 2P5SA 3CB4A 4RFVA 5P21A 1HQYE 2D7CA 3G0HA 1CJVC 2JJ1D 4TLDA 5TB5A 3TSWA 1DARA 3ZD6A 1MO5A 2AKYA 1U8ZA 3KL4A 4CRWB 2XX3A 5EXXA 2J9RA 4JKIA 4PZZA 4Q9IA 3ND9A 4DLWA 4AG6A 1P2UA 1QHYA 2XZPA 1ELOA 2GXAA 3ICQB 2O8EA 1GL6A 4P31A 2PLRA 2FSFA 2Q3HA 3K53A 3CO5A 4M4SA 4RKEA 5IDVA 4F38A 1GKUB 4KI0A 3DEFA 1FNNA 1NG1A 2BDTA 4XD7D 2BCGY 4YMUA 3Q8XB 4LGMA 1RJ9A 4GSYA 4LJ5A 4UNQA 4A0RA 621PA 4LYHA 2OM2A 2JJ8A 4HEJA 4A8JB 2G88A 1M8PA 4Q4AA 2I1VB 2FX3A 1HT2E 4RFSA 2C77A 2W6JA 4L4UA 1U8YA 2QMUA 5BW8A 4PO9A 2HDNB 2ZAMA 3CX8A 4WAUA 1J99A 2FGJA 2VF7A 3PFIA 4NE2A 4ZPXA 3W6OA 2IYRA 2DBYA 4YONB 5JEDA 3IO3A 1SHKA 3AF0A 2RMKA 4LJ9A 1SKYB 5EXSA 4TQAA 2A2ZA 1YQTA 4UXIA 3B2EA 3VKGA 5EZ5A 3LA6A 2NO0A 4BWYA 4B75A 1OIXA 1I2DA 1KAGA 4D25A 4TTPA 2O0HA 4US2R 3CR7A 1EFUA 2FPMA 3FYHA 1YZQA 3SYNA 2QPTA 1CXZA 1AIPA 4MGIR 3N2IA 5FBRB 1VECA 1KSHA 1WF3A 2ZS7A 4DXAA 4TMXA 5CB8A 3HJNA 3X2SA 3CW2A 2PL3A 2V6IA 2Z0MA 3HWSA 4PPQA 4RD1A 3DPUA 4TMZA 3TUIC 1JXMA 2Q0HA 2HJGA 3I1FA 3K0FA 3QKRA 1F60A 5AJYA 4JLJA 4LJ6A 2XJ9A 2GWHA 3DZ8A 4IOJA 1KDTA 1XEFA 2Z5FA 5J40A 2E9SA 2O52A 1YU9A 2ZI6A 3BE4A 3SHFA 2OBNA 2XB4A 2VP2A 5ELXA 4ASUA 1P73A 2NZ8A 3QG5A 1N6RA 1F5NA 1CF4A 2CHQA 1FL9A 3W5IA 5J47A 1XXHA 2P0EA 3AB3A 3ASZA 5KO2A 3QNUA 3VR6A 4XVUA 3QY0A 2EFCB 821PA 1R8QA 1P6XA 2EYQA 3QBVA 4C7OA 1HT1E 1JR3E 4LJYA 1US8A 3REFA 1P7CA 3IEVA 1FMJA 3QQ5A 5AUQA 2VF8A 5JJLA 1W48A 3MWYW 1ZUIA 2FA9A 4NBSA 3TIFA 1Q3TA 3ECCA 3ZVNA 1TNDA 3BXZA 2WAYA 5B64A 2CL0X 2J59A 2W2TA 5FTKA 3BWDD 1EX6A 2RGNC 1IQPA 3CF6R 3RABA 3QKSB 1A4RA 1UFQA 1XD8A 4IEIA 1CJTC 1N3BA 4JBYA 2B21A 2NZJA 5CDFA 3ZZUA 4MDEA 5HE8A 1G4AE 2R6GA 3L2OB 1G17A 1KO5A 1Z6GA 2PT5A 2W6JD 5JHGB 1ODFA 3CNNA 2IHYA 2PZFA 5H1YA 1Z06A 4V0MA 5K8IA 4MGYR 2CHVA 3KKPA 4A2QA 1FOEB 1QG4A 1CS4C 4QHSA 3U3JA 3U60B 2NO1A 3BH7A 3GFTA 3ADDA 3ZGXA 3VX4A 3RWMB 4IVQA 5EUQB 5H68A 3Q7PA 3GLFB 3CF0A 5C4GB 4DDTA 2JAQA 4HATA 1D2MA 3B1XA 2OCYC 3FMPB 4IHQA 2O8FB 3B6EA 4MITA 5DGXA 4Q9KA 3BOSA 2NG1A 2O0JA 4B33A 3TNFA 2ZYTX 4JBXA 4TT3D 1N0UA 1RZ3A 2XJ4A 3RRYA 2ONJA 3FMFA 1G3MA 3TVDA 4A4DA 2YWGA 4B2LA 1PV4A 2WMNB 1VYVA 3BBPA 3EZ7A 2WZQA 3SNHA 2VPPA 3IGFA 1SXJE 1VCIA 2C95A 3OIYA 3GJ7A 1KI8A 2QAGC 2QN6A 3VR3A 3BD9A 4HB4A 1E0JA 4WOPA 5FPKA 3K8YA 4W5WA 5CM8B 1BYIA 4ZKEA 3I92A 4ZDIA 1NI3A 2ZREA 1YZUA 1UKVY 3HU1A 3UMRA 3E5HA 1VMAA 4IVRA 4JKYA 3AVPA 1XMVA 4O2RA 3IPXA 4B35A 1QHIA 1NBMD 4GMDA 4B3FX 4JMPA 1E2GA 1NSTA 3FHOA 4FMDF 3B85A 2PJRA 1H65A 1KI1A 4M9XA 4A8JA 4W9MC 2ZSBA 1GTVA 2IUTA 1H8ED 1FQJA 2OXCA 4BLTA 4BLSA 4C0JA 4AURA 1GITA 4GOJA 1OH6A 3AH8A 2DWOA 3MD0A 5F2EA 4JLMA 4Z51A 3IIKA 4P3YA 2X2EA 2IT1A 1KI6B 2PMKA 2ZJ2A 5CIQA 3QXCA 5IRCD 4Q1AA 1G291 1UBCA 1U9IA 2SHKA 5TMPA 1JI0A 2BEKA 2VP0A 2R8RA 4DSNA 4LYJA 5A0FA 4BGDA 1JB1A 3I61A 3L43A 4A9AA 2BJWA 4RZ3A 3BJIC 2KBEA 5LB2A 1Z07A 1ZBDA 3CH5A 4JL5A 3VTKA 2QMOA 4UJ3A 3AVXA 4R7ZA 5JECA 1KSFX 1E98A 1KDPA 2WBLC 2RGEA 3AEZA 2RHDA 4URUR 5FTNA 1KI7A 2F1HA 2WPDD 2YKGA 4QHYA 2WJVA 2ZVQX 4F92B 2PEZA 4N3NA 1PUIA 3PEVA 1R5BA 5CIWA 3GEEA 1VG8A 1F48A 2P2LA 4Q1FA 2OXRA 3B5JA 2OZEA 1QVRA 1L4UA 1OXVA 5EE3A 1E2NA 4HYYA 3M0EA 1S9HA 1XU4A 3NKVA 4G3XA 2B92A 2QAGB 2ODBA 4NYJQ 5KSOA 3B1YA 1KAOA 2ONKA 3DL0A 3ZZ0A 1JQLB 1JAHA 1NIPA 3K9NA 1MV5A 2AR7A 4AKEA 1SVIA 4TTRA 2C9CA 1MRNA 1XDBA 2ZJBA 3RVBA 4TL6A 1NY5A 4PC6A 3B8HA 2NOAA 3LFUA 4NCHA 2Z83A 3THYB 3NBYC 3IDQA 2G83A 1COWA 2ZUBA 2QENA 1KDRA 1OJLA 1KO7A 2GDJA 4G1UC 1NF3A 4JSYA 5SZHB 4XWAA 1E2MA 4C0QC 4BFWA 1FX0B 4PHGA 2X8AA 5AUOB 2ANBA 2G6BA 2OE2A 4HB2A 5DI3B 3L0OA 4LHXA 3GLIA 4H1VA 4GDFA 1RC8A 2QEQA 1EWRA 3L8YA 1RYHA 3MSXA 4PQRA 1KJWA 1XEWY 4CT5A 2AKAB 3KUDA 3A37A 2CNWA 1A7JA 1M1YE 1QF9A 3E2IA 3NC0C 3CX6A 4UJ5A 2GILA 5CLQA 1CJKC 1V5WA 3CH4B 4D4LA 4O0MA 2VHTA 1G9XA 3OHMA 3EX7C 3H84A 3PG5A 3WYGA 1GUAA 1TMKA 1SHZA 4Q01A 4NONA 3EARA 1Q57A 3CPEA 3SC3A 4RY2A 1X6VA 3GLFA 2ZXUA 1U8AA 4OHZA 2A5FA 2EFEB 4Q4HB 3VKWA 4ZIRB 2O8FA 3VR5A 4XWKA 1GP2A 2AXNA 4FXPA 1OPXA 4LSGA 3RANA 4FCWA 1M7BA 1CU1A 4MYCA 3R9XA 5JCZA 3AP1A 3PVSA 1E9AA 3BK7A 3CRVA 2ZE6A 5HR5A 4LHYA 4QGFA 3LVQE 1VYTA 5E7JA 3LD9A 5H70A 2QGZA 3V00A 1AN0A 3ZQ6A 1UDXA 2ZSEA 2GAAA 4KFTA 4DCSA 3W6PA 4DUGD 4NP6A 2OBLA 1GL7A 3RLFA 2YVUA 2P6UA 4IVPA 4ZDKA 2ORVA 2WIAA 2ORWA 4FMCB 4C2UA 3AF4A 5KSPA 2J1LA 4DCTA 1G1MA 1W47A 2IYLD 1OIWA 1N6IA 1NP6A 5DNYB 4GPTA 4DB4A 1C1YA 2VP4A 4HAWA 4PSKA 2G77B 3SFZA 2GJSA 3AKEA 2CMKA 4OHVA 2JCSA 1IONA 1IAQA 2F43B 2F3RA 2FFAA 4ERNA 3K70C 3T61A 4XIGS 1XMIA 4TWZA 1U98A 1G6OA 5KU1A 5L3QB 4DIEA 4MUBA 4FCTA 5J4KA 2REXB 4QJ5A 3I5XA 5F3WB 4P32A 4CEIB 1QRAA 4OI1A 1W2GA 1Z0KA 4M2LA 4QKQA 3K0AB 2F9MA 1KI6A 2GEDA 1COWD 3QXJA 4DLVA 3TR5A 2GCNA 2ZITA 4TMTA 4KITB 2GKSA 3FWYA 2IA5A 3X1YA 3T35A 3RS0A 4H9GA 1VIYA 2CL6X 4PPFA 3X1XA 2OBMA 4CF7A 4JJKA 5CYPA 2PX3A 2CHGA 3T12A 2MSCB 2JA1A 3AKDA 3CBQA 3QG1A 4XTCS 2GVZC 2AWOA 2IEZA 3AF3A 4Z1MA 3SS8A 4P4SB 2QSYA 4MGKR 3EXAA 3FKSD 3BC1A 4DLZA 3MJHA 1ZU4A 4Q00A 2CNWD 2XAUA 3O8RA 3GFPA 1P2VA 3CZQA 4KSCA 4W7SA 1WMSA 3OIVA 3U7HB 2Q9BA 2BM0A 2GJAA 2BBWA 2JEOA 4JVMA 1NMXA 2OCPA 1E9DA 4LCBA 2DWQA 2XXAB 1WA5A 3KFVA 1A2KC 1P9WA 3JZMA 3PITA 1VKJA 1R4AA 2PT7A 2HUPA 4BECA 4AYXA 1J70A 2B8WA 1EFHA 2VP5A 2VO1A 1CRPA 1II0A 2DWPA 5GVSA 1WBBA 3IILA 2GZDA 1XTSA 4HUTA 1TEVA 1GILA 2YV5A 5FI1B 4FWIB 4Z8YA 2UKDA 2ZRJA 1NN0A 1T3HA 1EX7A 2V6JA 4XOIA 3SU8A 1G7TA 4C4PA 5IHPA 1TQ4A 4ZCLA 4DZZA 1D5CA 3UKDA 3VHLB 3F3YA 3OESA 1E2JA 4KFRA 2KI5A 3A58B 1FP6A 3SJBA 1W0JA 3IIJA 3THYA 1X8JA 4WIAA 1XPUA 4DCNA 1LB1B 1KYIA 2JIZA 3HR8A 4TQ9A 2F9LA 2PZGA 1G7CA 1QHNA 2CCJA 1W0KA 5FBWB 4JLNA 2H5EA 1OXXK 4MYHA 4NTZA 3P26A 3VAAA 4S35A 1FX0A 2ZYWX 4KSBA 721PA 2ZRPA 5JRJA 2QL6A 5DI3A 2WJGA 2FFBA 3V4FA 1PJRA 4Q66C 5BN4A 4Q48A 3A1VA 4NZYA 1GM5A 2QMHA 4LJ8A 2GZAA 1U81A 2J7KA 2ZRKA 4FW9A 5JZVA 3FFBA 2QU8A 2HXSA 4X8MA 3RSLA 1KTVA 2CK3D 3P4XA 2LWIA 3HU3A 1JALA 4AI6A 1EWQA 3W3AA 3TQCA 5E7MA 1OXSC 2PEYA 5HPYB 4WVFA 2RGBA 4JIMA 1AS3A 3A1UA 4M1MA 4YMSA 3W6NA 2OLKA 3A1SA 1KI9A 2AFHE 5E95A 2F1IA 4Q4HA 4Z1MD 4ZIRA 4Q9JA 1FW6A 2QP3A 2KSQA 2G0TA 1T5IA 2KBFA 5KYKA 1Z0AA 2QP9X 4LX0A 3SE0A 2WTUA 1HQCA 4PPGA 3UMSA 4PSAA 3D31A 4JT2A 1N2CE 4A0GA 4IEEA 5DH9A 4EJSC 2VA8A 5KDLA 5SZIA 1Z6TA 2C9YA 4FD2A 3CRMA 3W34A 4POAA 1YRBA 1Q0UA 1VHTA 3PENA 2XEXA 1KKMA 1HYQA 1KMHB 3CPJB 4A36A 2E1RA 3BFKA 2F55A 4TSFD 3GJ3A 1W44A 5FUVA 1P3JA 2OAP1 4QGAA 5JJIA 1ZMXA 1XRJA 1G3UA 1DEKA 1KO4A 3QPUA 4BFYA 1Q20A 1SXJC 1YR7A 2RHMA 4NL4H 4QGHA 2F43A 4FI3C 3T06B 4BFSA 2A3RA 4N1AA 4AYTA 3R9WA 5HCIA 4I81A 3Q3JB 1XTKA 3TMKA 2C78A 3UG6A 5F98A 2D2EA 5L3QA 1X8KA 1SQ5A 2J46A 521PA 2GEUA 3FB4A 4CEIA 1W0JD 4EAQA 4HAUA 1TU3A 1NMYA 1PLJA 2JIZD 1HA3A 3K0AA 2HXYA 1N0WA 3SZRA 1XEXA 3ZVRA 1TTTA 1XD2B 1KO1A 2WOOA 1W0KD 1PZNA 2CJWB 3KUCA 4XSGA 4A1FA 3TAUA 1ZC3A 2GETA 3NVAA 3PIRA 2A5GA 4LZZA 2VSXA 4TYQA 3VNVA 4BLPA 2DCUA 4P4SA 5L8VA 3MJRA 3BIFA 4Q1EA 5DISB 1JPJA 3ZJYA 5HKKA 3SBEA 4NCJA 4MKHA 4HDCA 3OAAA 3ZIAD 1V43A 4LRWA 1VIAA 2OO7A 2C8VA 3LX5A 4FCVA 1GDDA 1W2HA 3LDAA 3AGQA 4BRUA
chains in the Genus database with same CATH superfamily
1YWGO 2JBHA 4MB6A 3AHEA 3HJAA 3M5DA 4P3OA 3X1ZA 1JSXA 5KNBH 3O3CA 4HGZA 4FN5A 3WYBA 1QYRA 1OUMA 2ZTVA 3G5UA 4EJSB 4DJEC 1X19A 4RVOA 5JW6A 1G19A 1KK2A 4QBGB 5IC6A 4AP6A 4FX2A 3OKCA 4O4JA 4OIMA 2YUIA 4Q3OA 3ZIDA 4ZTZB 2HF9A 1GQFA 3VYSB 4MUHA 3PICA 1Z08A 1P3DA 4ZAVA 3ZU4A 4G4IA 4XM0A 2HRZA 2W9XA 4UCFA 1Z0SA 2GKOA 2QE7A 3PBKA 1HO3A 2GJKA 4LECA 4QRHA 3HKBB 5ERGB 5LBIA 3TRFA 3WZLA 1EIZA 1F6DA 3CTMA 3MXOA 2DBZA 3WNQA 1GZVA 2ZJ4A 1R0YA 1A8IA 3SXPA 1J23A 1M2WA 4DG8A 1PYGA 1FYXA 4RZSA 4FMPA 2WB4A 1XAJA 2WU0A 4XEUA 3CFYA 1FFXB 1SXJB 5AUNB 5LLDA 4DV1B 5FPSA 4AO6A 2YFKA 3N5KA 1YRAA 1BXKA 2YHUA 3R3WA 2H2AA 1A9XA 1NUUA 2IOFA 1A9SA 1JF8A 2Z2JA 1S2OA 4IQFA 4OUKX 4RPGA 1UAAA 2P3LA 1BVRA 1DQNA 3ILXA 1RZRA 4V0NA 4CN9A 1G6KA 2VUSA 3HV0A 3I34X 3TG2A 3T3MB 1UJ2A 5DO9A 1FYDA 3T3DA 2BZGA 5HCUA 2WABA 1MUUA 3K9CA 4UPVA 3WDLA 4DILA 1ZAKA 4JC0A 2Y1OA 1E63A 4C4RA 4C7XA 1CUEA 3JALA 1OWOA 5DTQA 1QQBA 3OCXA 3DTTA 1SU8A 4ZI2A 3U61B 3GH1A 1N5RA 4NFHA 3WLSA 4N49A 1SVLA 3GNLA 3RVMA 5C51B 2D7JA 2VRWA 3FBWA 1IN6A 3I04A 2R1ZA 1W4RA 1ZH0A 4HNUA 5KMGA 3DB1A 2FJUA 2W4MA 5H9WA 2CXOA 1ZNWA 2JLRA 3LP6A 5LZ8A 4E5SA 3JWHA 3DO8A 1XL1A 2C96A 4GOMD 5J2UF 2P3SA 1YB4A 5E0KB 1COZA 1JHZA 4DMLA 2GASA 1DAPA 3AFIA 4GPD1 4FMCF 1ZH6A 2IPMA 1Z6PA 2ESRA 1BH6A 2XWQA 2ZYSA 3M5WA 5HZHA 1ZK4A 1KJJA 3U31A 4BO7A 3SP1A 3ETJA 4PRYA 1D0IA 1E79D 2JJ2D 1W75A 5C9ZA 1AKYA 1GUDA 4D0RA 2ZCUA 3MXTA 4ZHSA 1Z8DA 4GBJA 3NHSA 2YFQA 1DC6A 3IOCA 1D8TA 5DYWA 1NAIA 3TBKA 3FOEC 2XUOA 5JS7A 2AZXA 1W36B 4HZGA 4YMWA 1P4HA 4PC3A 4L3OA 4M37A 1KMQA 4YI5A 1NW4A 4KJXA 5EUMA 4W5HA 1UMDA 4MHSA 2V5AA 4HSEA 1DKPA 1K86A 3HEMA 4EO7A 2VC2B 4ZARA 4TYNA 3O31A 4E4TA 2MMCA 3F5QA 2WIKA 3KE9A 3RBZA 1YB1A 4EHFA 1ZRSA 4QFCA 1YH3A 1CY1A 3EXEB 2R96A 3L1JA 5DNUA 5GADl 2NPIA 3MVEA 3EGOA 1SBIA 2QD4A 1ITZA 1KMCA 3MWEA 1SG9A 3IQGX 5JFGA 3S3TA 3P9RA 1O1YA 4K9SA 2H08A 3KLBA 3I37X 2GD1O 3P1JA 1Z2CA 4OHMA 1W35A 4GPZA 4D41A 5A2QA 3P2EA 3H2BA 3M4XA 5AW7A 1JAXA 1SXIA 2J30A 3LDUA 1Z8HA 3NASA 1EBUA 4UC0A 4B6FA 4F3RA 4YCAA 1OAKA 2ZAOA 1F17A 1PTJA 3KV3O 2QTMA 3FHJA 3EG5A 4MYUA 3BVPA 3AKCA 2GK7A 4HVTA 4DCVA 5A4JA 4C0SA 4C4AA 2DFVA 1ZOLA 2PHZA 3L7NA 5B3JA 5A02A 1J2YA 2V7WA 1BXRA 1VGRA 2YZ7A 1KBOA 2NTYC 5CCBA 1FK8A 2FRDC 3RREA 4Z4FA 2ODTX 1NVFA 4GG1A 4O4JF 2CJWA 3CRQA 2QUHA 2JLSA 1MAVA 2P6NA 3FXAA 4B81A 4E6PA 3W5AA 3E5MA 4B3TB 1SJ9A 1K7EB 5ADHA 3R7AA 3IE0A 1Q1GA 1MO6A 1ZSYA 3DV0A 5CD9A 1K9SA 4ZJZA 4DLTA 1JDNA 1E0SA 1JKMA 4K8RB 4KEAA 3CJTA 2B1IA 5TT1A 3D7KA 2ZT8A 3OZGA 4ZZ3A 4YRGA 4UVIA 2JHCA 3SBOA 5L40A 1YHYA 2W48A 1ND5A 1V47A 3FDJA 1T2AA 4LRYA 4Q18A 3MINA 4ZXPA 4C78A 5F9FA 2PO5A 3HLKA 2CV2A 1RCTE 1ZX1A 3L7YA 5KBYA 2I7CA 5KVAA 2P4HX 3SX4A 1UZMA 3NHZA 3NLLA 3V3TA 2YASA 1ZIXA 1N2EA 1KMNA 1O9BA 2C0PA 2FKNA 3ECSA 3MIIA 4RQAA 2X0FA 1CUHA 3TW4A 4QE3A 4RNCA 4EDHA 4QO8A 4BNUA 4K2HA 1VPWA 5JVDF 4C89A 4JXJA 2P9HA 1P9NA 3UPUA 1AGXA 3FR8A 5HJ5A 3DNMA 4A92A 3HN2A 2UZIR 4DA0A 5KJCA 4WINA 3S6JA 3D3NA 1J00A 3VBCA 1SH7A 4C43A 1MNQA 4JLVA 4I36A 4KHPB 4BQPA 1XZNA 5FHQA 4J9UE 4DAOA 3PT5A 1D9XA 2SICE 5DOVA 3CN7A 4UHBA 4LJ7A 1LXCA 4C20A 1U5BB 4QHTA 4ATNA 5C4IA 1UBNA 3JATA 3ZVMA 3VVBA 2I2XB 3OTHA 4L5BA 4A6XA 1XU7A 2QRVA 4QXOA 4QU0A 1Z2PX 1AD2A 1DFHA 2K4MA 3ACBA 4JUFA 4J1QA 1AKQA 4JSTA 4M0EA 4YC7A 3CUWA 3KTAA 1BDMA 2QTFA 3QF4A 3LNCA 2GVDC 1EK1A 2Y6UA 1BX0A 5IG2A 1OF1A 4WXPA 1Y6ZA 1DLIA 3ED1A 2PT9A 2Y6VA 1W49A 1NLYA 5IKEA 3OTOB 1DG3A 3PEYA 3ZXSA 2BKUA 1H5NA 2WUEA 3JYPA 5HF8A 3S2YA 3W9BA 4CW7A 5DIZA 4DZRA 3CCBA 4DA9A 1IIRA 2OG1A 1R6XA 2FOXA 5JRDS 3UZUA 3MGAA 2I78A 1KVUA 2I99A 4MI9A 1M2GA 3B53X 5BN3B 1IOVA 5EHQA 3CUUA 2ATVA 2NVBA 3LHKA 3M4NA 2IDZA 2ST1A 2ZYRA 2EDAA 3DPSA 3EA5A 3FPFA 1O94A 4PAGA 1G18A 3RE1A 4HC4A 1S7CA 1HORA 2OK7A 1U0LA 1EJBA 3ETCA 3ONVA 4L4SA 4IIEA 3RC3A 2ZM5A 2HIMA 2I7XA 4GZ3A 4PWZA 5JS6A 1P2TA 2A3NA 2J6HA 3G9UA 4K6CA 2A4MA 5EQTA 1Z8FA 3A8TA 5F9HA 2OB2A 1AKEA 3F2VA 4EMUA 4RNDB 3EC1A 4LAFA 4XM1A 4EW3A 3CA8A 3IMGA 2V98A 3SF0A 1KRWA 3WGJA 1PR3A 2DBVO 2H18A 4MEJA 3WRXC 4FE3A 3V8EA 1LJLA 1JZSA 5DCWA 2Z1MA 4D02A 1ENPA 1H1TA 1Q0ZA 1TM5E 3ESRA 1YHNA 5F33A 3SIWA 2DR0A 2ZJ0A 3A4NA 4IV5A 4RVFA 2J7PA 3JQ8A 1ZD2P 2ZRDA 5C31A 3TCXB 5D3MA 4BNDA 1XMJA 5LMZA 4AKHA 5AM3A 4HS4A 1Z83A 2JDIA 1SVSA 1XV5A 2ZIAA 5C81A 1TXGA 4MPRA 1OV6A 2C4TA 2OD7A 1MR3F 1BS1A 3HA5A 5LZ9A 3EQ9A 2Z6QA 4GM1A 4NLLA 2B30A 3S2SA 5L4SA 1Z3CA 3D4OA 2X1HA 5BN5A 4BCCA 3M89A 3LP5A 3IURA 1HPLA 2VJMA 1VJCA 3RJ9A 4RSRA 2NO7A 4L08A 2R6ZA 2GZRA 2FNAA 3P2KA 1C4XA 2DYKA 5G1PA 4Y18A 1JHYA 1P81A 1ZC4A 3GZNA 4LOIA 3CIFA 1ISMA 1TMGE 1ZONA 3KD3A 4CR6A 2YYSA 3H5IA 4JC4A 3V32A 2PVSA 3CUVA 4LZNA 1D07A 1IBKB 3ZWXA 1R0ZA 1MX5A 3IBCA 1UBOS 4WFKA 2WLSA 2QLTA 3F9RA 2JG3A 4DCJA 1KAMA 4QUHA 1OGJA 3LDGA 2AK2A 3R5TA 4JODA 5D3ZA 3E3AA 3KSAC 4EB0A 3O8DA 4RORA 2YZMA 3JZDA 3OUTA 1L4KA 3OQVA 3IQXA 4ON9A 5A4DA 2B69A 1AJEA 1W1IA 2Z2ZA 2OHOA 1ZLYA 2EWWA 1WKCA 4JYCA 1LDYA 1EJ2A 1SKBA 5ICEA 2Q4OA 1H3EA 1ANKA 3UHPA 4RDXA 1AZTA 2E4YA 3KKQA 2I3BA 2PL1A 2QLBA 3WBFA 1P6QA 4LXQA 3K73O 2OHXA 1XK6A 4Z4HA 1I7SB 2YWEA 1C29B 1PZHA 2QMQA 3LYAA 3SXUA 3W8EA 1SBNE 5K20A 3CLSD 3OUUA 2WAAA 3E9ZA 1KQ3A 5KYVA 3A1TA 3KTDA 2GRAA 3LBNA 3OEEA 1T8UA 4L78A 2VH1A 3B3QA 2FEKA 5B1IA 4BP3A 1Z88A 4K9PA 3VNUA 1IJKA 1QF7A 1F2TB 4PZAA 1Z45A 2XXBA 3EASA 3PD1A 3P9CA 2IS4A 1RTTA 4B87A 1S3GA 3F49S 1O95A 3IBFA 1I7PA 3NQ41 4LOHA 3GQBB 5DZSA 3WGUA 1IMJA 1ZW6A 3I52A 2BN4A 4IDGA 2FPLA 1HQKA 1WKVA 2JCVA 1L4BA 1QHFA 3LQRA 1KE2A 2B4QA 5GMOA 3AEYA 2HMTA 4KH0A 1G4UR 3QPVA 1GGVA 2Z9BA 1LK5A 1P1HA 1TJ4A 4PNPA 3R7BA 1EAMA 5TRTA 2AFHB 3W78A 2YJZA 1E1YA 4K5QA 4RU1A 4JI5B 2GO7A 4CF5A 1PSDA 3RFCA 3ZI4A 4PTZA 4JB3A 2ARKA 3C6XA 3ENQA 2VAWA 2W8BB 4PRLA 3SSOA 5HUQA 4QSMA 4DIKA 4Z53A 2FE4A 2JI8A 4C6TA 2DOKA 3DOIA 4MIKA 1YIAA 3NTOA 4LI0A 3TBHA 3N5CA 1L2TA 4EJ6A 1JEAA 1QBKC 2H9YA 4V02A 1LVUA 1VL2A 1DG1G 2EGUA 3I3OA 1FPMA 5ITZA 1ZOIA 5KYXA 1UBGA 2QM8A 4LY6A 4UHFA 3SYLA 4EFDA 2IW3A 3KQHA 4WEQA 2I54A 1UT6A 1R27A 3TR0A 1PJQA 3P9SA 1MAAA 3PT9A 2G1AA 3OPVA 2AHRA 4IIJA 4YJGA 1DCTA 1ISPA 1NI4B 5ESWA 1UEXC 1BRTA 2ZULA 4RHCA 3UKOA 4QJ3A 2PIDA 2GPSA 2LP4Y 4GYJA 1HUQA 4IJUA 3O7MA 3CT4A 3R6DA 1GZHB 5AR1A 2NQTA 4BP1A 4I1YA 1PEDA 2OUKA 3IUNA 2C5SA 4RD4A 5AJXA 4ZTBA 3OQIA 5CLJA 2WZBA 4Q1VA 5JSFA 1H2HA 1OXUA 4WZBA 4V0RA 5TMBA 4ZZIA 2WFLA 1V1MA 5G0TA 2ZR0A 3DSRA 1LK0A 3V8RA 2P7HA 3OWXA 1GSIA 3DAYA 2JA2A 2VUHB 2OP0A 3IV7A 2XR1A 2RB5A 4YYEA 2Z4TA 4J2TA 1M2OB 2O54A 4WQMA 1UADA 3PRHA 5C2JB 5JATA 2HBRA 1DT5A 2GD2A 3BHMA 2QRPA 3NO4A 4HNRA 4OB7A 3TOZA 1WABA 1VPDA 2HN9A 2WJWA 3ESZA 5SZKB 3ZE8A 1GUYA 3VKVA 1E1NA 1E9EA 1XN4A 3TDMA 3E5NA 1R9NA 4UAVA 3QX3A 2QJRA 4YJFA 1V6SA 4HX9A 2AFRA 2BDUA 4NRDA 4WESB 4UTNA 3B82A 3HWX1 3R1IA 1SKMA 1QF6A 1ISJA 2QRGA 4MW1A 5LNK6 2J0UA 5CIYA 1U04A 4AMYA 1J07A 4N82A 3KZVA 1Z74A 1VBFA 2FUG1 1MTOA 1DIBA 1VRCA 3AIIA 3BG5A 4RE6A 1YB2A 1VM6A 2RGNA 3D4LA 3T7JA 2VTVA 1C9YA 1HRDA 2GEVA 1RTKA 3D7MA 4Z4GA 1BA2A 1OV4A 1GGKA 2A1TS 4A2WA 3VPAA 3DXFA 1IH8A 2Y76A 4GZ6A 4LTMA 3BCUA 2AEFA 3SBDA 1TYAE 1VPEA 2NYRA 4KBFA 4ZVMA 3C4QA 5HJ2A 4NI5A 4DLAA 4KWIA 4F91B 2PX0A 4E7PA 5CVDA 2J45A 2DQYA 2JGMA 3E35A 4J3FA 3RWOA 4OQDA 1PVOA 1CUAA 1BDJA 1KFBB 2FEOA 4V0QA 2VQDA 1XNHA 3BHJA 2WKWA 1K3TA 1I4EB 3RU9A 3R4VA 4WNAA 5BOSB 5KREA 3B7WA 4YRQA 2GZHA 4JCCA 1F4VA 1N0HA 1F06A 1XZBA 1LSUA 3R2JA 4R54A 5HIKA 4KPEC 5A0VA 1IY0A 2A35A 2HUNA 4J0DA 1CLUA 1P2SA 1Y3BE 5FUYA 2A8YA 4CG3A 3U7GA 4GRAA 4X7MA 5CM2Z 4IIBA 3W5HA 3AERB 1T1JA 3NT5A 4RJLA 1S2NA 3AEXA 2GYWA 3THXB 3ZN2A 3LY5A 1UANA 4HUQB 4PQYA 5HZKA 1DBPA 1KQPA 2VHUA 1UKZA 3OO0A 2OILA 5TVGA 2DQSA 3IPAA 3TSCA 1JQDA 2FTKE 4MV9A 3F8TA 1YC5A 2JLWA 1XVAA 1DJMA 2J08A 2PKWA 2IHKA 4PZCA 5IVDA 1A9ZA 2HMVA 4GNKA 3TFQA 4RV5A 5AO9A 3V1NA 1K8ZB 3TSAA 3A3PA 4RTRA 2FMXA 4AD8A 3KEMA 4HNHA 2AUNA 2CXQA 1JDSA 2F7SA 4Q0MA 2BRUA 3B12A 1ZS9A 4IKEA 2OQVA 4R1PA 4J8PA 5I4KA 1JU9A 2X13A 4INJA 4MVJP 3A3KA 4RZ2A 4EDFA 1XHFA 1IN7A 2I80A 4J0JA 1A9YA 3RW9A 3I6BA 1QHEA 4GI2A 4U0JA 3FUTA 3UMBA 4QVIA 2A9KA 1DOAA 2YV2A 3TZKA 3LT1A 3WLAA 5I7SA 5INTA 1G2PA 2UUPA 4N8SA 4UM5A 4DDWA 3D6TB 3GU3A 2E55A 1U2GC 3EQ6A 3RV4A 3FGPA 3FRIA 3TH5A 5HF9A 4BFCA 1VE5A 1EXDA 1YZ3A 4IIJF 1Z2AA 4G81A 4GLOA 2HRRA 1Y8QA 1JG4A 4UQLA 1LQTA 1T3TA 4GVPA 4MDFA 2N46A 3SN6A 5EHGA 1CFJA 3JZAA 2B8NA 3SDSA 1VP9A 3DVSX 1VBKA 3PPVA 1FYFA 3QK7A 4QIHA 4DQXA 3AM5A 2O0LA 2V6BA 1PQPA 4CCAA 2EW1A 3W7VA 4G37A 1UQUA 1FP7A 1N2CA 2QMEA 1CZHA 1AMNA 1K5PA 1JN0A 3HY3A 4WZ6A 3KB6A 1YAHA 5AKYA 4HG2A 5A04A 3OZDA 5BSTA 4J0GA 4UAJA 1NW6A 2C9OA 1PQWA 3MTDA 4RJKA 3WFJA 3NWPA 4UPEA 3ZHZA 1MB9A 5B2FA 4KXWA 3ADCA 2QBYA 5G1OA 4ZDJA 1FC0A 4Z2AA 3WL4A 4NBNA 1SULA 5A9SB 3L7DA 2CVFA 3CMCO 1Z56C 1B0UA 4G65A 1AXGA 2GPBA 2P40A 4R2IA 5AK5A 2YOHA 5H83A 1QHGA 2Q21A 1KPGA 4XRRA 4MZDA 1BHO1 3NPMA 4PQEA 3V8BA 3F5FA 1LI5A 1ZUNB 5A4AA 1JIXA 2IP2A 4TZTA 4Q4CA 4RLQA 3MWKA 4MWCA 5L9AA 4KXQA 1YB7A 1RJWA 3EVBA 3NAZA 5KNCH 2V0GA 5TEWA 2E5WA 4EHNA 3E3MA 3LGXA 2VCEA 5ALFA 4AYWA 1G8MA 2E3JA 3H13A 5DVZA 5CITA 2XCIA 5AW0A 5JWOA 3KC2A 5DXJA 4EUEA 1YFLA 1IQRA 3E48A 4YS6A 3WIVA 1MRZA 3VR4H 2II6A 4RTMA 3TIVA 2ODPA 3TQFA 3DBOB 1DVRA 1NFRA 1WNTA 2XTJA 1CTQA 4YXWD 1JSCA 1J7KA 1AKWA 2QUJA 2IBMA 4P3KA 3IL2A 3L7CA 3PC3A 4K3UA 3C1UA 5AXBA 3UHFA 1CE8B 1U3FA 1V7ZA 3HUEA 4ADSG 2OWEA 1QRRA 3FUXA 6AT1A 4JS0A 5J4YA 2FUEA 1XZCA 1IOZA 3L92A 3UC5A 3R7WB 3MAGA 4DJDC 4QNRA 3KQNA 5AH0A 4ROTA 2CD9A 4D8VA 4DMRA 2FPGB 2XNSA 2XYVA 1P0QA 3GG9A 4WGFA 4QRDA 3GPDG 2PL9A 1D1QA 2Y0PA 1XGKA 3KFXA 2HO5A 4NS4A 2UUBB 4J2OA 3H2IA 1U8TA 5I7AA 1Y9DA 3C3WA 4I9GA 2YBDA 2BGTA 3TMAA 2B7BA 5T57A 1CUIA 3D2AA 3HJRA 3WLTA 3WWDA 1L5HB 4PCUA 5ICCA 3ADPA 4WXRA 3E9EA 3NHUA 4Q82A 3AUTA 2GO1A 3R0QA 2PJDA 1NUPA 1WTAA 4QBFA 4QPPA 3H6GA 3PHBE 3U4CA 2O3UA 3V97A 5TPWA 3S1AB 3KKOA 2C4VA 7AT1A 1V5EA 3RDPA 2PXXA 1BX3A 5H8WA 1J8FA 1XPJA 2RGCA 5HF6A 2GB4A 3O4JA 4CIDA 3RK4A 1LY1A 3PR1A 4UOEA 2NTNA 1O4VA 1E61A 1HT3A 4V2UA 1G42A 2O7NA 1LS1A 3U4QB 3GLHA 2V3WA 1DFGA 3TE6A 1FJGB 3EQZA 3NX4A 2R86A 2QD3A 3WGLA 1KNXA 2J32A 4OFZA 3SZ3A 2OHVA 4UUAA 2FZEA 2NZVG 2ZRCA 2YQ4A 3TI9A 3F8WA 3ADOA 4JZKA 5AVVA 4RLHA 4XD7A 2O2XA 1PGNA 3AVUA 2AMLA 2C1XA 1A8HA 3JQAB 3NOOA 2WSSA 1QFXA 4Q4JB 3RIXA 4IJ5A 3SKYA 1KOJA 1ULSA 1DTWA 1IK4A 2W2VA 1KJ9A 4DRYA 9ABPA 5EGSA 3OX1A 4QICA 5K7SA 4JUDX 3W9SA 4MRMB 3FTDA 4L75A 4FYHA 5CT5A 4BQSA 4LRXA 5L7WA 2N75A 3IHLA 1C1XB 2G5GX 4KG7A 1HEIA 1JQ3A 5KB3A 4DEXA 1LBHA 1RS0A 2J9FA 2QNRA 1NVKA 3L7KA 3BH0A 3W3ZB 4Z6KA 2FP4B 4ZCMA 4BFVA 1ECCA 4F5EA 5LNK1 4XJVA 1IMOA 4ZZ1A 5IULC 1E2BA 4GL2A 2I2CA 4LC1A 3L6CA 3AEKA 3ZW8A 4CZ2A 5JXGA 2ZG6A 2A57A 2Z6VA 3GXBA 2P6MA 2VNJA 1ONBA 3U7QB 4FYYA 5LQRA 2HMYB 2PXCA 2B8TA 2G6TA 1SPBS 2GPNA 1ZM4A 3ACDA 4RKWA 2WIDA 2YHAA 2WTXA 3MS7A 3ZNNA 2VPYA 3T41A 4B43A 2JFUA 3VZBA 4TZ0A 1JV2B 1A9OA 1Y89A 2H16A 4CMIA 2NACA 5FL3A 1P1IA 3QMVA 1T8TA 5A3SA 2ZUFA 5JSZA 2XWJI 5IT9A 4I4CA 5KYUB 2ZRBA 2Y1KA 3MTEA 2XUDA 4JYMA 4QQNA 4YAJA 5EP3A 4GMXA 3ZI7A 3DDOA 1AKRA 1G16A 2AF4C 1Z5UA 1SFRA 2BPOA 2R1UA 4FHGA 1C3OB 4ME6A 3B20A 2ZE8A 4P82A 5BPHA 3UTDA 3FSGA 1WDMA 3AZPA 5IYZB 5FOWA 3I8XA 4TL8A 1E89A 4F72A 2VDVE 3FYUA 3UT0A 3D8HA 2ZCJA 2Y9MB 2ZJ5A 1E5QA 4FVTA 4PAOA 1AF4A 2Z98A 5BWCA 3CZ9A 3VC7A 2XT0A 2V5VA 2GF2A 2DPLA 3ODGA 3D6UA 5FFMA 1Y6RA 2DBRA 1X13A 2JFNA 2KMLA 3IAS6 1U6KA 3MD9A 3WYDA 4F2GA 3JAMA 4MTLA 2J0EA 5D00A 4KQMA 2Z4SA 1WCV1 1BCRB 1K8RA 1MAWA 1EK0A 1NVDA 3JQRA 3N75A 2H8KA 4DWWA 2PSHA 2UXDB 1XRRA 3FGOA 2GBIA 2AR0A 3E3NA 5B1SA 4WLOA 4EHLA 2R6FA 2M6RA 3HY6A 2XRMA 2JFPA 2JVKA 1KGDA 2VK1A 3CBGA 3GRZA 1VKZA 4LK2A 1P4JA 3FWPA 4MVYA 2LCQA 3B7PA 4RTSA 3AR6A 4Q37A 3INRA 4OQZA 2AS0A 3OSZA 4R9NA 3R76A 1NRWA 1SUFA 4YCJA 3QIVA 3PKJA 4MULA 3F6EX 5D7BA 4CMEC 5B5SA 2REBA 3PWTA 4L8VA 4CNQA 5C8YB 3LGAA 5FX2A 5L51A 3VKHA 2QJTA 4TV9B 3EOBI 4BMCA 4L9WA 8OHMA 4ZAFA 2G0NA 4KK4A 3RVOA 2VA9A 3VR2D 2WFZA 3ISVA 1PR5A 5EXEA 4PFJA 5JFOA 1HDCA 1U2GA 2WAMA 1YL6A 4X5OA 3T7RA 3IIIA 1ZVQA 2LXNA 4EELA 1Q6ZA 2A59A 2ZJOA 3BHNA 4HQRA 1PJ8A 5KIAA 4G9GA 3RS7A 2H57A 4DC9A 3HKDA 1IG0A 5H81A 1ADGA 1QGED 1X77A 4GWLA 5B1DA 4Z7JA 3TEFA 3IPRA 4WMLA 1YDHA 2QYHA 3F4BA 2VEDA 4UEJA 4FOPA 1J5EB 4IWXA 4I55A 4OHXA 5KQGA 4PXAA 2OP1A 3KU1A 3AC0A 4XIYA 5ALJA 3UJNA 1JEJA 1MX3A 3OX3A 4MWOA 4TLEA 3VSDA 2X8WA 3HDQA 4FFVA 1BE8A 4XLLA 2RH4A 5IEBA 4IHAA 3ZNQA 2GPYA 4F71A 4F9TA 1RWMA 4TT3A 5BT8A 1BROA 4F6LA 4OM8A 2VYCA 4AZTA 1MORA 1TJNA 1P1KA 1OLOA 4QUBA 4W6ZA 4F96A 1HDGO 3IEPA 4RM2A 3HBMA 5AK3A 1N6NA 3WSVA 2AB0A 1PWHA 2QWXA 4GI7A 4N0DA 4N9QA 4RBNA 2P9ZA 4G4SP 5TVKA 3VM6A 3BILA 4ZOAA 3JX9A 4UE6A 3ANTA 3O21A 3LK6A 3F6BX 2IIBA 1C7JA 1SBHA 3KJIA 2JGNA 1I5EA 1K75A 1WX1A 2IP4A 3HCOA 4QAQA 3MELA 3SDZA 3PDIB 4XA8A 4DCGA 1USIA 4OYYA 2ZUCA 2LBPA 3WISA 3OEHA 1XTJA 4IS3A 3STWA 1Q1EA 1NBMA 2XYRA 1JHOA 3GNTA 4DAEA 4AF7A 4TYYA 1Z36A 1IUNA 2ID4A 2ANCA 3CHYA 4GP9A 4NDAA 5FBZA 3UJHA 2B35A 1H8EA 2J85A 4MO2A 3ZWCA 1Z4PX 1XEWX 4M1EA 5CFPA 3DMYA 1N92A 2OXEA 4BB0A 3GBVA 2AOWA 3KLNA 5EQJB 3I73A 3A1CA 4GZMA 1ZD9A 2Q5FA 3IMEA 3CPSA 3LPMA 4YI3A 4FYMA 3SR0A 1H85A 1V8ZA 3L6EA 3QENA 3EZLA 2AX3A 2C2MA 1E2EA 3IP3A 2UUOA 1DINA 4MLDA 5B30A 1LK7A 1Q2XA 3NDBB 1G5RA 4ARZA 5J3JA 1M6NA 5IK2D 2HX1A 4KR6A 1PNQA 2E1PA 4QRIA 4XOUA 1F0YA 4YRDA 1EFRD 3NM4A 4C3ZA 3B51X 2BWJA 3QJYA 4LHZA 4Q03A 1TU4A 3UKJA 4AJ9A 1PAUA 3OM1A 3CVVA 2ENUA 3KXPA 2AC2A 1RADA 5FBHA 1X8LA 2PR2A 3QPWA 1E2PA 2ZEJA 3HO8A 4TLBA 5AW4A 2HBYA 1FXSA 1Q3HA 2O23A 4I1VA 3OIGA 3P96A 3RARA 3U7IA 1IUPA 2DPHA 3ID6C 1GKKA 1YOVB 1PFVA 4PE5B 4CLOB 3UW1A 1NVXQ 1PDWA 5JBQA 4G0VA 1WW3A 2X0JA 3FCSB 3IEMA 3A3NA 2PV0A 2QLFA 4YVFA 4P0QB 4O25A 3M7IA 3TEMA 1LTKA 1UWCA 1L5LA 1OILA 4DLRA 5C5EA 3OBBA 4LGVA 1SCUB 3FJYA 2ORIA 3IDZA 2AUMA 1LLDA 3IKJA 3IBSA 3C2QA 3DOEA 5EL0A 3WBJA 1U3WA 5KNCD 1FQOA 4QEZA 2F3UA 1B6SA 3PPYA 1UEIA 3EVCA 2ZFUA 5EJ4A 1SB8A 3Q72A 2RJNA 4QBTA 2OESA 2N42A 2GM9A 2ZBRA 1SC3A 5FCDA 2G3YA 1OFHA 3NIFB 3AEUB 4UEQA 3VR4D 3EK2A 4YUVA 3A2NA 1K5HA 4IW3B 2YYAA 4XLTA 2JLYA 1WJGA 2NV2B 2BE9A 4HLQB 1NJ2A 2IEAA 3PZRA 2IEGA 4EQ6B 3EHDA 2Y67A 3D3KA 1KBZA 3EIFA 3PC2A 2C4MA 4CDGA 3X1WA 1VBNA 1V9CA 4MGHA 5JCJA 3WWZA 3H9BA 3JARB 2G0AA 5HIJA 3AUSA 1HGXA 2X0EA 2XSZA 2CXXA 3EGIA 1FUIA 4PZEA 3B3AA 4QNMA 3ZGLA 3O03A 3BZWA 1CZKA 1QGZA 3VHXB 2YQ5A 1CUWA 4J0QA 4JYBA 4ZT5A 2JIMA 4E5VA 1O9HA 4NV1A 3NKLA 2FVYA 3QX9A 4TKMA 1DAOA 4FKBA 2Q50A 2XZDA 2EHDA 1FU4A 3K31A 5H59A 3NRCA 3B1FA 3S4YA 2XOKD 4QDKA 1I4DD 3DOHA 3WLNA 1NPDA 4ETNA 3PR3A 4H27A 4PVDA 5IMSA 4OK3A 1QP0A 3LT2A 4ZJUA 5JNLA 4XR4A 3UQYS 4DJ5X 1SXJD 1K06A 4MV8A 1QKKA 1ML4A 1H9AA 3NUGA 3DOFA 3U44A 2QTTA 5G40A 5AVJA 1Y34E 1QC5B 4YQFA 2Q6KA 4P93A 3SVLA 1GQQA 3MOGA 4HDMB 1D1SA 2PLFA 1SOUA 2J07A 4MLCA 3S2FA 2YWXA 5GVRA 2NUBA 1E20A 5ALYA 1UM9A 3AUJB 2G5CA 1AM4D 2TRSB 4N5LA 4EGSA 1DO2A 1K5GA 3P0JA 4HYQA 4GLJA 4HAOA 1QK5A 4I5IA 1SUAA 1UT8A 3HBAA 1MABB 3K4PA 4WK6A 5TQ2A 2P2ZA 1I2AA 1XRPA 4HB3A 4ZKDA 4XQEA 3PNBA 4FFBA 4YRTA 2IRWA 4PY2A 3EZ9A 3C24A 3EXG1 4MW0A 5DXAA 1GKYA 3NFRA 1RZUA 1NX9A 2Y92A 1VLMA 1KA9H 4HKTA 2FF7A 4BZXA 1H2FA 1KEWA 1J5XA 4FI3F 2DT5A 3D7NA 3DMGA 4HDRB 1Z34A 4UCXA 2ES4A 2YY6A 1XTRA 2H7CA 2Q1TA 1JMYA 3LC0A 4FJ1A 4Q34A 2QN7A 1Z4IA 3H5OA 1Q2UA 3NC1C 5HMMA 1G8AA 2C2BA 1W581 1C2TA 2C5GA 5DM4A 1FFHA 2R7LA 4YP6A 1AQUA 4Q7MB 4XWYA 1PDOA 2ZB7A 1WMEA 4M9ZA 4BQOA 3FNEA 3V4LA 3LC7O 421PA 1PJBA 4XDHA 4ZHQA 3WV5A 2QUIA 1W36D 1R4MA 3EHEA 1FF9A 1OI4A 3ZKWB 1FMLA 3HN7A 1BDIA 1IL0A 4OBBA 1UXOA 3ZBTA 1GTMA 1GZ5A 2I8AA 4J94A 2QT9A 5SICE 5AVWA 2QAJA 3CZMA 3H2KA 4PIMA 3C7KA 4LDJA 4DSUA 1P72A 1PT5A 2JH3A 1GFIA 3JQBC 1XZGA 4HGQA 4HLCA 2GCIA 3OFVA 2CKMA 1M34A 4FK8A 1E3QA 4JEIA 1TADA 4F11A 3ZWKA 4NCAA 4ZQGA 5K4AA 2FW0A 1VB3A 3M6AA 5FT9A 2P30A 1FBNA 1MG5A 3COWA 5H16A 1JDTA 4EI2A 5EJEA 1LVHA 3O1JC 3EAFA 4NYJR 1E9BA 1KRXA 3PIIA 4G0QA 3DE0X 4UZFA 4OXKA 1KS9A 3G9QA 3C3EA 1N9GA 2B4TO 4OCZA 3T1HB 4GBGA 4BEVA 5AKZA 3UIEA 5KKCA 1LVGA 4OHYA 4ZO8A 2G9NA 2ZS8A 3MCAA 3NH6A 3T34A 4HDSA 1C7ZA 2NZXA 3E27A 1KO8A 4D9NA 2OAGA 3C6KA 3FVRA 2VJLA 4KR2A 1G59A 3UB3A 4EPRA 2BLNA 1KY2A 3PNYA 1CQIA 1L4FA 1RMYA 2ETVA 3BE6A 5FNVA 1PS8A 3QY9A 4OHKA 1NVWQ 1G9TA 2H11A 1VGVA 2UYQA 3FPBA 3M9WA 2Q7OE 3GGCA 4RMIA 2ZB4A 4OSEA 3CGGA 5I47A 1L9XA 4KMOA 1E1QD 2G1KA 5GM1A 1B4DA 3WGOA 3ESQA 4HTAA 4TKLA 1KH3A 1E4VA 1GTRA 1MJFA 4JUBA 3M9LA 5J58A 3EH1A 1X9HA 3S5JA 3VU8A 4QXQA 3UK7A 3EWSA 4G56A 3N2KA 4F2WA 3FDFA 4W5RA 2I4IA 3DOUA 5J2UB 3WGGA 1BG6A 5JROA 1JEQA 4WBSA 1N7IA 3BGSA 1F38A 4CQNA 2FN8A 3IOYA 4JVSB 5LDDC 5CHEA 3Q10A 5ALTA 3AFHA 2PQ0A 2L17A 3CCCA 5FOUA 1LFAA 5TV2A 3QGMA 3K9FC 1NGSA 3AOEC 3RF6A 3LWNA 2ZQYA 2TMDA 4O2LA 4W5JA 4IFEA 4P3XA 1OBHA 3D3WB 1Q50A 3IJEB 4JBNA 1W52X 1JLHA 4BVEA 3LYUA 2C07A 4OKNA 3TVYA 3NRBA 4UTRA 3QEAZ 3U4DA 1ZFNA 3FBTA 4TTSA 1U5CA 2P6OA 3BD8A 4URZR 5ECYA 5AVZA 1X7HA 3R77A 2IOQA 1E0AA 5I9LA 1B15A 1PCXA 2BHLA 3IAFA 3U3MA 4F3NA 1T4CB 2ZRNA 4PSUA 4P7JA 4Y2JA 3L6BA 1NNI1 2XKKA 2O2JA 1BO6A 1ONNA 1OFUA 2C2YA 3A4MA 1KYXA 1WULS 2ZWVA 1V8DA 3IRUA 2BIFA 3MGCA 4FZRA 4JOBA 4RXUA 4P33A 4EUKA 1D4AA 1U1CA 4LWPA 1R12A 4FFRA 4RKRA 1U02A 4TX1A 3A9SA 3Q12A 2FSGA 4AAYA 4E5UA 3QHPA 1NQOA 1HEYA 4FGZA 3D4NA 1X3SA 5DHAA 3HDTA 3CSSA 5AVUA 3GN2A 3HPQA 4PC2A 1Z5OA 3P9ZA 3QI2A 5M3BA 3CWQA 1A50B 2OZLA 1NXPA 3TXAA 4E88A 5KOHB 3RVDA 2YXBA 4D9JA 5MFZA 1RAFA 4JX8A 2GN0A 2I7TA 3GCZA 3NJ8A 1XVVA 1G7SA 3U7JA 1XSEA 1V8BA 1CR1A 1EDEA 2FMFA 1UKBA 2AI2A 2N47A 2W93A 3GIDA 1NSFA 4ZHQF 5AVYA 1TI7A 3QYPA 1ILEA 1A2BA 1LC3A 1NVTA 5C53B 4Y2HA 1LPPA 3EDMA 5CAEA 4FGLA 5THQA 2BEJA 4RTLA 5JJ5A 3ZY6A 3A6EA 3MTAA 4RK1A 4HQOA 5IM4A 1YU6A 1OFIA 1IIBA 2MSLA 1T3SA 3KOZA 1NLFA 3PGJA 4FINA 1F7UA 4DMMA 1BE0A 1UQTA 2ETXA 2XHEA 3EW7A 5H7XA 4HZIA 3VVLA 3TZBA 1U0EA 1XJCA 5TF4A 1YKGA 3OT1A 4JLPA 2FSPA 2AE2A 4YDHB 1ECPA 5BNIA 3C6BA 1NLMA 2BM8A 2I29A 4EJ2A 2GLTA 3CC8A 5A06A 3GEIA 3GRKA 2NSHA 3GEHA 3M81A 4S2EA 4YB8A 3TAHA 1DC3A 1K7YA 3CX7A 5EAIA 2P5TB 4A8PA 4XPZA 2X42A 3D3JA