2BWJA

Structure of adenylate kinase 5
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
196
Chain Sequence
GFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLATE KINASE 5
publication title Structure of Adenylate Kinase 5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 196
sequence length 196
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2005-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bwjA00
1PZNA 1XZQA 4PXAA 2GCPA 4TQAA 1JR3E 1NJFA 2PLRA 2WMOB 1FNNA 3HPQA 4DLTA 2IW3A 4E5UA 1ZVQA 1Q1ZA 3TAUA 2OXRA 3LFUA 5DYGA 3K70C 4IDQA 4Q18A 3ZD7A 2K5UA 3KKOA 1ZINA 3MG9A 3QSYA 1F2UB 1MOZA 2QL6A 3JZAA 2WKPA 4O25A 4BFVA 2JDID 4B43A 2FE4A 4RZ2A 1KAGA 1EK0A 1G8YA 4OHYA 1DVRA 4LHYA 4TLEA 4C7OB 3FHCB 1KY2A 2OCYC 4M22A 4NBSA 1T91A 1W46A 1Q3HA 1X1RA 5E7JA 4S2EA 1NVWQ 4L5BA 2W83A 2ZI9A 3SC3A 1NY6A 2CL7X 5J4LA 3CX8A 1UKYA 3QI2A 5BN5A 1N6KA 2I1VB 1NP6A 2WSMA 1LVGA 3OESA 1E79D 3EPHA 1BMFD 1D5CA 5DE3A 1Z29A 2RGCA 1SQ5A 4AKHA 2J3EA 1OH7A 4Y0VA 4PQYA 1E0AA 2RH5A 1DAEA 4KJZA 4QXAA 4CEHB 2IHBA 2J5XA 2WAYA 2ZI3A 1R2QA 4LYFA 1S3SA 5F2EA 3SYKA 2IWRA 4EPRA 4PPQA 1Q1QA 3DHWC 3V9PA 1XD2B 2HYDA 1OHHA 3VR6A 3GJ0A 1JR3D 1FPMA 5FOXA 3RRYA 2O8BA 2CCGA 3MD0A 5C4MA 4PC3A 2O8EB 3QJYA 4NH0A 2B8WA 1OV4A 4FWIB 2OBNA 3B2EA 2HLDD 3W8RA 1P62B 1IN5A 4BFYA 4G5SA 4C4PA 2IYQA 5GJWC 1NL3A 2D06A 2O8FA 3C8UA 1DELA 1ZUHA 2XTMA 1FX0B 1KDPA 1R0YA 4L9SA 4UXIA 4Q9IA 2D4HA 4IOMA 2CE7A 3CR7A 3SDZA 2ZRCA 3KTAB 1U94A 3KUDA 3GLHE 3TUIC 5FPYA 1CIPA 2QMEA 2ANBA 2ZTSA 3AF0A 2GCNA 3HU2A 3ZJYA 4ESHA 4KITB 4IVPA 1AQYA 1KMQA 2XNDD 4YONB 3U60B 3C41J 3SNHA 4TYNA 1ZNWA 3VR2A 4IW3B 4JVNA 3UWKA 2ZU6A 3KQLA 1N2CE 4B3CA 1GILA 1Z6YA 1KDTA 1ZM7A 2JEOA 4BLPA 1J2JA 2AWOA 1J99A 1KI1A 5KDLA 2WPDD 4MGKR 2B8TA 3Q7PA 3MUFA 5C1BA 4FCTA 4BEJA 1OT3A 2ZUDA 5B64A 1X8JA 1SKQA 2QMUA 1EX6A 1FMLA 1O3YA 2OT3B 3AKEA 3GLHB 2JLRA 3VQTA 1H8HA 1IN4A 1YZGA 5FR2A 3QXSA 5B57C 1XU4A 3NC0C 3T1OA 4C0LA 4Z8XA 4JLPA 2NO7A 2UZIR 1E3MA 2QI9C 5HZKA 2BBTA 2ZR0A 4P4UA 5GVRA 4EPTA 1DG1G 3DL0A 2QAGA 3OE7A 4TL8A 3SYLA 3T35A 1CR4A 4B47A 2BCJQ 1RIFA 2QM8A 1KI7A 4A8JC 3JVUA 4ACBA 4MKHA 1D9ZA 3QOFA 5BQ5A 5CLQA 1NKTA 1UBGA 2BMDA 2LKCA 2QORA 1NN5A 2IYZA 4GT1A 1G3UA 4D4LA 2WAXA 1DPFA 1LY1A 4QJ4A 4RD1A 3UPUA 1N6IA 1EFRA 1N5IA 3NH9A 1GL9B 1M6NA 2JATA 4MRVA 1UEJA 4OK6A 3D3QA 5L3QB 1FTSA 2XTNA 3MAAC 4ZKEA 2RGAA 3HYTA 4MYCA 3A1TA 1HE1C 5FTKA 1A1VA 4XD7A 4HYYA 1Z0KA 1CEEA 3L0IB 2H1LA 2J0UB 2KWIA 1ZRHA 3ZDQA 4Q03A 4CVNA 2DFTA 2EFEB 2WIAA 2ZIAA 4LOAA 1NSTA 2GZHA 4NPHA 3P4XA 4NL4H 1UBEA 3O8RA 3MMPA 5H8WA 1XP8A 1P9RA 2VQSA 1E9EA 3L2OB 1KYIA 1WBBA 1YHNA 2ZSDA 4PX9A 4NDZA 4U02A 3MSXA 1E2QA 2AXPA 2QPOA 2FZ4A 3QPUA 1OYYA 1CXZA 4Q4HA 1P60A 2V54A 3PXGA 2BMEA 2RGDA 4IEEA 1G9XA 2JASA 2AD1A 4R9UC 3VMFA 1EWQA 4TT3D 3ZVRA 4DRZA 3U3MA 2IS1A 5EXSA 5EE3A 4TMTA 4NCNA 721PA 1QHSA 2BWJA 3I92A 4OHZA 1QG2A 3C16C 1OFUX 3IEUA 3AKYA 1IY2A 4II7A 1Z08A 3BORA 3ZGXA 4GOKA 2RAPA 2BJVA 3ASYA 4HZUA 1G3QA 4B3DA 2ZE8A 2ZR9A 5JECA 2BBSA 5AUNB 2WHXA 3BIFA 3FB4A 1R8SA 4DLZA 2QT0A 1II8A 4F4JA 4RVCA 2ZSBA 4M2LA 1P9WA 1T3SA 2OFWA 1G291 5HPYB 2OSBA 3BXZA 2WM9B 1YKSA 2NGRA 1TNDA 4MRRA 4ZDJA 5IF9A 3IIMA 2XZLA 1XTJA 4Q9HA 5LBIA 3AM1A 4Q66C 3CNLA 5KUTA 2W6JD 3OZXA 2OM2A 2QPTA 3LW7A 1Z5ZA 1EFHA 4UJ3A 2X2EA 2ATVA 1QG4A 2PMKA 2QP3A 2YC2C 1VYUA 2JDIA 1V43A 4CEJB 1DAFA 4IHQA 3B82A 4GL2A 1KHTA 4L16A 3SE0A 1E9FA 1W36C 4CEIA 3MLEA 1F48A 4JLMA 4EPYA 2NTYC 3QF7A 4Q19A 1S8FA 1P3JA 4JVMA 2ZREA 5AJYA 4D4KA 4ZDWA 4LBYA 1T8UA 3GFTA 3BBPA 1LF0A 1TF5A 3K09A 3KXKA 2OXCA 2ZRGA 1Z83A 2R6FA 4CZ2A 2IF2A 2EU8A 5EZ6B 1QHNA 4LK2A 2DY1A 4EJSB 1KJWA 2IXGA 1NLFA 1YR7A 3BH6A 1F5NA 4HAVA 2ZE5A 1E4YA 4R2IA 3QXCA 3MWLA 4R71A 1BYUA 5DHAA 5JEDA 1IAQA 4P4TA 1E79A 2REBA 1Z6TA 2Z4RA 4M21A 1BMFA 1GZSA 2J9RA 3U3RA 4EFLA 1F2UA 3TJZA 4KCGA 3KJEA 1Z28A 3LQRA 4I81A 4Q4JB 4A0HA 2FSIA 5JCPA 2V1XA 3PUXA 4NP6A 1N5JA 2GZAA 2PEYA 3TUZC 3BE4A 4M1WA 2FA9A 4GOXA 2OZEA 2LWIA 3QKRA 4C7OA 4C2UA 1JJ7A 4FINA 4NYIR 1HT2E 4JZKA 1T6NA 1JECA 4Q7LA 2GBLC 3UATA 1AZTA 2EW1A 4M1OA 2G3YA 1ESMA 4LC0A 4A2QA 1JR3A 3DVLA 3K0FB 2GK6A 4AD8A 1P2SA 3A4LA 5GJBA 1T8TA 4UNSA 4QBIA 2WKQA 2I3BA 3VR5A 3QKUA 2BMJA 2QTFA 4O2LA 4Q1BA 2MSDB 3KQHA 3PEVA 5BYKA 4UNRA 1YZTA 3EPKA 2PZGA 2ZXUA 1XD8A 1OKKA 1YRAA 2BM1A 2CE2X 2HLDA 3B78A 4B75A 1R10A 4HDOB 1N0WA 2C77A 2VSXA 5DI9A 4IOLA 5DH9A 1NVXQ 1S9HA 4RCZA 2C96A 2QQEA 2AFIE 3EZ2A 8OHMA 4CEHA 4DDVA 4OQLA 5IK2D 4EFNA 3MWJA 5JEEA 4KO8A 1QBKC 4A0GA 3AGQA 1KI3A 2E9SA 3CRRA 4XVRA 2YWGA 2GJSA 2V7QD 1XD2A 3CRW1 2RGXA 2CLCX 4ZV4A 2F1IA 1L4YA 5HZHA 1TUIA 1XJCA 4B33A 1T3LA 2O8EA 2ORIA 3ZVMA 3Q3JB 2UVQA 3GJXC 4US0R 1CU1A 1IJFA 1VCNA 2GETA 4IDNA 3WHLA 4C9BA 3ZIAD 4QGGA 4FWTA 4R98A 5LPNA 3E70C 2XNDA 2ZRFA 5TB5A 3KL4A 2ZYTX 1ZM4A 2G83A 1RFLA 2AK2A 2W0MA 3IPXA 4LI0A 4QL3A 521PA 1IN8A 1GOTA 2OCBA 2WJHA 4URXR 2JLXA 3EPJA 3ECCA 1OFTA 5F9FA 4X8LA 4X8OA 2WWIA 1OPXA 1E9BA 2OG2A 5CYPA 3W90A 2ZUBA 2WPDA 3LLMA 1VECA 1SULA 4PAQA 3KDSE 4IEIA 1G4AE 2VHQA 3W6OA 1Z0FA 2F1RA 5FBWB 2BEKA 2HXSA 2W0SA 4J0QA 5KSPA 4DZZA 2J87A 4LYJA 1G21E 4OKSA 5HCIA 1O87A 2Q3FA 2PCJA 2P67A 5J4YA 2JLQA 2FH5B 4M9XA 3ONWA 5JJLA 1TUEA 3AP3A 4JJKA 5AWFC 1RJ9A 2D2EA 2P6UA 4FMDB 4E22A 4JBXA 3TW4A 4JL8A 4HLUA 2J7KA 3EIQA 2CL0X 4W5JA 3V4FA 5FPHA 3ZD6A 2RGEA 2IBMA 3SJAA 2IEYA 3B9PA 4NYJR 1S4QA 4G5GA 1N3BA 2ZE7A 5EE0A 3GQBA 3GLHA 2PMDA 2J45A 4A2WA 3I62A 1OXSC 4EKDA 3U44B 2WKRA 2ZAOA 3ICEA 3UXMA 1GVNB 3RNLA 2C5LA 1H8ED 2IA5A 5FI0B 5IRCD 4DSUA 1ZCAA 5IDVA 1B0UA 4F93B 4EPWA 3RRZA 2AXNA 2V4ZA 3LY5A 5JMTA 4QFMA 4ZI2A 2VRWA 1PVOA 4NCKA 5JHGB 1VPLA 4JT2A 1NMZA 4PAMA 1F6BA 2JLZA 3CBQA 5FBVB 4ZKDA 4UNPA 1ANKA 1Q1BA 2G0TA 3NC1C 3K0AA 4DCTA 2CHVA 2GDJA 5K8IA 1DO2A 2GF9A 5EXPA 1OXVA 4LHVA 4GOJA 1DAKA 4Q4LA 3BFKA 1T5LA 2FN4A 4QBFA 5CJ2A 1U0JA 1GIAA 3KFXA 1ZNZA 5KYKA 3GLFB 2AD5A 3BB1A 3T15A 1AIPA 4DUGD 4WZAE 4XVUA 2NOAA 3ZZ0A 1ZC4A 3L82B 3HWSA 1HEIA 1KO4A 2ZRMA 5L3QA 4TT3A 2ZRJA 2L0XA 4HAUA 4HUQB 4L9WA 2J0UA 4NONA 5UKDA 3RHFA 1SGWA 2NG1A 1Q57A 2BIFA 1KI4A 2FV8A 1SZPA 1YR8A 1W0JD 2YZ2A 1E6CA 5TDHA 3ZYCA 5SZKB 4DXAA 3IHLA 1LW7A 3ZS8A 1AJEA 1NI3A 4BQSA 4D4MA 4DIDA 3WRYC 2O5VA 3G82C 3PIRA 3BC1A 4G5QA 5FI1B 1OH6A 1UKEA 1PV4A 1NG9A 3RYTC 4D81A 1Z0DA 1Z06A 5L3VA 1HYQA 2XZPA 4NYMR 1RYHA 1NSFA 2AFHE 3RWOA 4RZXA 5JI3E 3THXB 3MGCA 3B6EA 5J4VA 2CJWB 2OCPA 4MH0R 4Z51A 5FBRB 4P31A 2W6JA 3ICQB 1ZU4A 4V03A 1XD9A 4GMDA 3LBHA 2AHOA 4HLCA 4G5RA 2QP4A 3PVSA 2ZSAA 2ODNA 2VO1A 3PCRB 3SI7A 1FQJA 1C1YA 4PFSA 3GFPA 5TXGA 2FG5A 4QNRA 1N6LA 1ZIPA 5CYOA 1L7VC 1CS4C 5KPDA 1KMHB 1I2MA 2ECKA 2RGBA 4AURA 2FX3A 4DT1B 2WJIA 1D6JA 2ZRPA 5JLJA 3LV8A 4MGZR 2OEPA 4C0HA 3C4JA 4KSCA 3RANA 3CKLA 4I4LA 3KQUA 2BC9A 1R0WA 1KK0A 2YOFA 4A0RA 2ZI4A 1K5DA 4DB2A 3LW8A 3G5UA 1UKVY 1FQKA 1GRQA 3NKVA 5EUQB 1BS1A 5KNCA 3LNCA 4IJMA 4O2RA 5FUYA 4YMUA 3S1AA 3B13B 4YMTA 4CEJA 1TQDA 1AM4D 3CPHA 3JVVA 1WF3A 3BOSA 1BYIA 2MMCA 3QEJA 5EJEA 2QSZA 2JLYA 1Z63A 1YQTA 4LJ6A 2BJWA 2EFHB 3P20A 1CBUA 5AJWA 3U5ZB 1RE0A 4TMXA 1SXJC 1YZKA 1F60A 2BKEA 3BH7A 5FL3A 4YXWD 4TYYA 4PPFA 4EJSA 5JSZA 3TRFA 5GADl 4F4IA 3Q8XB 3AH8A 4YMSA 1W48A 1VTKA 2JLVA 4XWOA 1N6PA 3QF4B 2HF8A 1RW4A 2GXSA 4U5XA 1XMJA 1W4CA 1NMYA 4XTRA 5FH9A 2VL7A 4NU0A 4V0ME 5IK2A 2ZQ5A 2OLKA 2WJVA 3CO5A 4TL6A 4KSBA 3RSLA 2DYKA 4ZCMA 4DHEA 1RC8A 4UNQA 1I4DD 3HYRA 4PHTA 4CW7A 4OHVA 2V7QA 1XTKA 2J0VA 4V0KA 1QHIA 3ASZA 4HAWA 3I61A 2WWHA 1G5TA 4NHOA 2ZJAA 5C46F 2PL3A 3K0FA 4WBSA 5FL7D 3A36A 2A9KA 2NO1A 1RZ3A 1HQCA 1QVRA 4YQFA 3VNUA 2PCLA 5K8UA 3LVQE 3CRMA 1TMKA 2GZDA 3T5DA 1E0KA 2EYUA 5EE9A 5H70A 1GRRA 3CX7A 3KKNA 3B8HA 4UQOA 4OJQA 3WBJA 821PA 5CDFE 2OLJA 1W1WA 2H7VA 4F4CA 2NZJA 3IBGA 1GG2A 4JIMA 3LVRE 3RRNA 5KO2A 1G7SA 3THYB 1CRQA 3AVWA 1OW3B 1N5LA 2VBCA 1NN1A 1DAGA 2HEIA 1MRNA 4G5OA 1E96A 3QUSA 4I1SA 2IYRA 3CH4B 3AEZA 4GDFA 1U0HC 1LNZA 1YU9A 3O8CA 2ZSEA 2QAJA 4E07A 1U9IC 2ZS7A 3AF2A 5FFMA 1UBCA 4XSGA 1M7BA 4URVR 1QZXA 3BK7A 4B48A 4H1VA 2ZSFA 1KSGA 2ZM5A 1CTQA 1QDEA 3EWSA 2IX3A 4W9MC 1KK2A 2VF8A 5CK4A 4MGIR 3W3AA 2ZVQX 1S2MA 1ZNYA 4RD3A 2GXAA 4D80A 4DC9A 4V02A 5HE9A 4BPBA 1K8RA 2B6HA 2TMKA 4E03A 1YR9A 1H8EA 4PO1A 2F9LA 1WMSA 4LJ8A 2Y8EA 4PR0A 3PUZA 4CIDA 2EFGA 1G8PA 2ATXA 2O0KA 4Q02A 2JIZD 1G16A 2KSQA 1NY5A 2ZE6A 1E0SA 3C5HA 4JVSB 3N2EA 1VKJA 3SFZA 2C98A 4XWAA 3I8XA 4BRUA 2WJGA 1W5TA 4TYQA 1E2LA 5TMPA 2QMOA 2RGNC 2GEDA 1WA5A 3CR8A 5DI3B 4Q1AA 4MYTA 1V5WA 3C14C 4JS0A 1J7KA 2QY9A 3H2YA 5G3ZA 3AKDA 4OL0A 1VCOA 2BKUA 4ACAA 5DNYB 2OUKA 5DHFA 3U44A 3SN6A 3LD9A 1EXMA 2Z83A 4M53A 5J5CA 4JYCA 1NN3A 3IKJA 1OKKD 2ZUCA 3AKCA 2CEAA 3A37A 3AUXA 3NEYA 4DUGA 3PG5A 3K0CC 2W58A 4RFSB 2WV9A 3R7WB 2G77B 4DLUA 1W4RA 3D31A 1FZQA 1OE0A 2R9VA 1CJTC 2VP4A 1IXRC 2IS2A 4FMCB 2A30A 4TQ9A 1ZYUA 1AKEA 2YKGA 2LCFA 2EWVA 3FKQA 3QXXA 4D25A 3CZQA 2NO0A 4PSKA 3A1UA 4HLDA 3WBKA 1OYWA 1QHHB 1W0JA 1X8LA 4UJ5A 1KKMA 1Q0UA 1MKYA 4JBWA 4TSFD 2J0SA 2G88A 3BB4A 2FPLA 3RC8A 2O0JA 2F43B 1N6RA 4N1AA 3GJ3A 5GVSA 5DYIA 4US2R 1WQ1R 3L0SA 3L8YA 4FI3C 2J46A 4XH9B 3C15C 2YC4C 1ZJ6A 3KXLA 5SZIA 1U2RA 3AVVA 3DEFA 1TQ4A 2BEJA 2OHFA 5J4KA 2KB0A 2NO6A 4AY2A 3ADBA 4HLQB 1G64A 2CLDX 2G0NA 4KAXA 4HUQA 4JLDA 4DIEA 3CONA 3RS3A 4TL9A 1LFDB 5CIWA 4TTRA 4FD2A 4DDWA 3OHMA 4G3XA 5EZ5A 4BUJA 4N0EA 1E98A 4AYTA 3NBFA 2WWXA 1JJVA 1K6MA 1U99A 2V6IA 2QP9X 5C2JB 2Z4SA 4JBYA 3SQWA 2A7QA 1Z3IX 5H68A 2WSSD 4M9QA 4US1R 2JCSA 3EC2A 4ARZB 2QGNA 2VH5R 4B6FA 1AK2A 3NH6A 1SVLA 2FFQA 2YV5A 1SXJE 1T0HB 3A1WA 2ODWA 3F0TA 3R20A 3W34A 1MR3F 2XOKD 3DZDA 2CJWA 4C3ZA 3W6PA 1G3MA 1J90A 3EG5A 3CWQA 1BO6A 1E2EA 3OAAD 2VEDA 1AS2A 1KZ7B 5TARA 2O0HA 4DCSA 1QHYA 1TTTA 3VX4A 4TMZA 4OQNA 5KHOC 3QKSB 3EC1A 4FW9A 3SR0A 1R5OA 3X2SA 4IOKA 4K8OA 4PAOA 4B2IA 3SHFA 3I5XA 2GA8A 2ANCA 1XB2A 3MWKA 5CIQA 3WYFA 1NRJB 2XZOA 2A5GA 3IQWA 1R5BA 4Q1CA 5G3YA 3A6PC 1KMHA 4PANA 4DT1A 3ADDA 3VU9B 3CH5A 4PZLA 3KZ1E 4BFZA 1EESA 2WICA 5FPSA 2FPKA 4GSYA 1SXJB 3TQFA 5BN4A 3QG1A 3EASA 4YXWA 5EP3A 1XRJA 2CHGA 4KV9A 4FMDF 3GLIB 4N0DA 1Q3TA 3CF6R 4HAYA 2VLIA 2ZRAA 1SKYE 4DVGA 2ZEJA 2ZRKA 4B3XA 1XPRA 1XXHB 2Q9AA 3OEEA 1E2HA 3U7EB 3REFA 2QTHA 4A82A 4X8MA 1JPJA 1KJYA 2V3CC 3GEEA 3PITA 1QRAA 1NVVQ 4KODA 3SOPA 1FTNA 5FOUA 3CNNA 2CL6X 4GRAA 3AF4A 4AKIA 2Q9CA 4P4SB 2O52A 2JLSA 2CCKA 1SXJD 2FJUA 1D2EA 4CT5A 2P3SA 4LPKA 1TADA 4C0QC 5KSYA 3EW9A 3EZ9A 5FL7A 4LUCA 2XGJA 2IYTA 2KJQA 2J7PD 4PZYA 2W2XA 1DAIA 3VR4A 4QHSA 3HR7A 2FOLA 1SKYB 1NF3A 3QPVA 4DWJA 4LPSA 3QF4A 1PLJA 2GEUA 2YWHA 4KVGA 1CR1A 1K5GA 1OXUA 3KB1A 2VA8A 3QBTA 3QENA 4WZ6A 4U7DA 3FMFA 1GITA 3B5JA 2HF9A 4QBHA 3UG7A 1U98A 1G6OA 3WRXC 3U4QB 4D4JA 2JJ8A 4M9ZA 2J41A 3GMTA 1LTQA 1XNJA 5KOYA 1E99A 4Z1MD 1Y63A 1XCGB 4Q9KA 5H1YA 1EX7A 2OE2A 1FOEB 5BYJA 4MDEA 1AS3A 3IEVA 3K70B 4WW0A 1NVUQ 3LAWA 3QBVA 1RKBA 2PLFA 1G18A 1GL7A 5B30A 1JQJC 1R5NA 4JLAA 2JAQA 4V0MA 4HDCA 2DWPA 2F3RA 4OJKA 2QQ0A 1G3IA 4JSYA 1LS6A 3T1QA 2YINC 3FMOB 1KO8A 3AUYA 2ZJOA 4TLCA 4JT4A 1M8PA 3VKGA 2OFXA 1IJEA 2QAGC 3TR0A 1OXXK 3UIEA 3K9HA 2ZITA 3WNBA 2FZLA 2IEZA 1KK3A 2HCJB 2XAUA 2LKDA 4IFBA 4D0NA 1ZC3A 1ZD9A 4MGYR 4C0JA 3M0EA 3BD9A 1MABB 2MSEB 3TNFA 3WMEA 2P6RA 5F3WB 5JZVA 2OBMA 3K70D 2P65A 2CVHA 3A58B 6Q21A 5JJKA 1B23P 2FSHA 1IM2A 3PFIA 3LA6A 1G1MA 4LV8B 2QMHA 4DDTA 4BFTA 1XEWX 1SVWA 2ZAMA 5CM8B 4YMVA 2F55A 1E9DA 2ZRDA 2B7BA 2JIZA 3EA5A 4BFWA 1G5RA 1AZSC 5FOTA 1ZMXA 3IUYA 5CDFA 3KJHA 3CUEF 3LLUA 2ZJYA 1SVKA 1NG1A 3U6BA 2IF0A 3TE6A 4PHHA 4LRWA 1QVAA 3I8SA 4FN5A 1Z2AA 2PX0A 5CM9C 5L3RA 3K0EA 3I3SR 1ZBDA 5JWRA 2D3WA 4TMWA 2D7DA 2BBWA 4JLBA 1MO3A 1A4RA 2R6DA 3MWYW 4Q7MB 4D0LB 3E2IA 2EVWX 3E5HA 4W7SA 4OYHA 4Q47A 4IOJA 3AP1A 1KAOA 1KJZA 3TVTA 3KUCA 1XEFA 1MO6A 3KB2A 4BRWA 5KNDA 1SVSA 3NBZC 3LX5A 2C95A 3MRSA 3WMGA 2P5SA 4LV5B 4BZPA 1KNXA 3F3YA 4NCJA 4PC6A 5G41A 3HU1A 1P2UA 1I4LD 3HDTA 2FWRA 3LWNA 4Q9JA 1OIWA 3T5GA 3P32A 4WA7A 3ETLA 3X1DA 3R9XA 2OBLA 1F3OA 2FNAA 3THOA 4XSHA 5E3HA 3PJRA 3HR8A 2YNMA 4DEXA 2DFNA 4U00A 4TSFA 4F38A 4QJ5A 4EPXA 2YWFA 1W0KD 1XF9A 4B73A 3SJCA 2R2AA 1XEWY 4TLAA 2ORVA 3W5JA 4CGZA 3EZ6A 4BLSA 1EGAA 3TQCA 4GZLA 3OIYA 4Q7KA 1GNQA 3RVBA 2XXAB 1E2IA 3DDCA 1P9NA 1CP2A 2D74A 1FX0A 4Q7JB 3UMSA 3CB4A 3SEAA 3Q7QA 3BH0A 4BWYA 1OFIA 4ERNA 4TTQA 2PX3A 3ZVLA 2ZRNA 4F92B 3KTAA 3GJ5A 3QQ5A 3W5IA 5FR1A 2F43A 3CIOA 4Y0AA 4EAQA 2WSSA 2CLSA 1ESNA 3A1SA 4CRWB 3LRPA 2KBFA 1S0UA 4HAZA 3EIEA 3NHAA 3K9LA 1HT1E 4WIAA 1W44A 4OK3A 4ZIRB 2XOKA 2REXB 2X1VA 3KKPA 2NPFA 2D2FA 2J59A 2RHMA 1EG7A 3W6NA 1HA3A 4XIGS 1JAHA 4A8JB 3OAAA 1W2GA 2NZ8A 4AYWA 4PQRA 2JA1A 2ZJ8A 2UZ3A 1G8FA 1T4GA 2D7CA 1TPZA 1GL6A 3W8NA 1KSHA 2ZJ2A 3B1YA 2FF7A 2QSYA 421PA 3ZLJA 3V4RA 5A5GA 2ZRLA 1FL9A 5C18A 4ARZA 3OEHD 5DISB 1MRSA 4FMBB 3I73A 1A7JA 4Q9LA 4YC7A 4L15A 3U3OA 3GLFE 2QU8A 5JHHB 1W4AA 4MKGA 4QGFA 5EP1A 4P3YA 1W5SA 2OV2A 2X8AA 3FFBA 2R65A 2GJKA 3IO5A 4QJ3A 2IC5A 4QG7A 1HUQA 2P6NA 3ZZTA 2O8DB 4WXPA 3QKSA 1RRPA 2VIIA 3VX3A 4LJ7A 1U0LA 5JBQA 2O8BB 2C03A 4PSAA 2QROA 4I99A 1UAAA 4QRHA 5BWMA 3ZZUA 1VG1A 2Q3HA 4AG6A 2VHJA 5AR1A 1KDOA 3TVDA 1S96A 1JPNA 1FUKA 1OLOA 2WJJA 3KFVA 4EUNA 4DSOA 1VG9B 5EXXA 3SBEA 1OXTA 1R8QA 1C4OA 2KBEA 3MCAA 1I2DA 1SXJA 4MQBA 1OB5A 1GM5A 4Z54A 2C04A 5DIFA 4A6XA 4UXJA 3GD7A 1VHTA 1VCMA 1LB1B 4RD6A 1M2OB 1KO1A 1ZP6A 1E1QD 2J7PA 3GFOA 5FOSA 4CDGA 2N46A 3IQXA 2IXEA 4LBWA 3VTKA 4DLWA 1XBTA 1OB2A 3GPLA 2IK8A 3QXHA 4RD0A 4A1FA 1G20E 3U2QA 2GVDC 4KVAA 4LJYA 4DCUA 2JLWA 4JMPA 3TLXA 2EFCB 2R62A 4BZXA 4L4UA 1RVDA 2ZYVX 2GWHA 4P4SA 2ZI7A 2ZU0C 2DCUA 2UKDA 1YZQA 4D0GA 2BVNA 3EAQA 2E1RA 4Z1MA 2IYLD 5CB6A 4RFVA 1UEIA 2FGJA 3ZH9B 1L2TA 4OI4A 1CR2A 2A5YB 2E87A 1KOFA 4LYHA 3WMFA 1UDXA 2FPMA 2ZPTX 4FMCF 1KZGB 3NDPA 1KI8A 4AKEA 4O3MA 1LS1A 5CK5A 3F5FA 2B7CA 1Q20A 1XMSA 3IILA 4HB4A 4MRSA 5FUXA 5TVKA 4B44A 3BFXA 3DOEA 4OHWA 3IO3A 1W36B 1IXSB 3WHKA 2XEXA 1E69A 2ONKA 2ZETA 3AP2A 3LH5A 3DM9B 5KTYA 3U4QA 4KFTA 2GAAA 1CJKC 3GLGE 3H4MA 1TL7C 4JVLA 5AJZA 2ODEA 2FU5C 3J81k 1ZM2A 2QE7D 2AKYA 2GCOB 3PQCA 1DAHA 4UKDA 4IVRA 1TF7A 2R8RA 1E4VA 4MUBA 4AK9A 4Q1FA 2C99A 1JEEA 3I1FA 2V55B 1AGPA 4BEBA 3UMRA 5J47A 2V1UA 3KQKA 2BM0A 3Q72A 1X6VA 2CXXA 4K81B 1N25A 1XPOA 5B2ZA 1N0UA 1W36D 4PC7A 1FUUA 1KK1A 4HB0A 1G41A 1E32A 4LJ4A 4M1SA 3M6AA 2RKOA 5D3QA 1KI2A 3TK1A 4BECA 1N0VC 4NYIQ 3TSOA 1GKYA 1P2TA 1Z0JA 2N1BA 2ERXA 4POAA 3GLGB 3FOZA 5FTLA 4HAXA 4IXNA 2REOA 5LB4A 4KHZA 3D8BA 1OJLA 2A2ZA 4IDHA 1TX4B 3PUWA 2FEMA 2AWNA 2ZANA 1MABA 3NBYC 4QGAA 1G7TA 2IT1A 1E9AA 2BDTA 5EQTA 1DEKA 4FCVA 5FOVA 5A4JA 5BN3A 2OAP1 4KYUA 4HB3A 1KTVA 3FMIA 4Q4JA 3OEED 2VP2A 5KSZA 4URUR 5EE5B 3KJGA 2QG6A 2HT1A 2WTUA 2AK3A 1XCMA 4G01B 4LBZA 4BLQA 3DKVA 4WXRA 2PT7A 3EA0A 2IS6A 5KDDA 2AR7A 1QHXA 4ON9A 2VHUA 4AI6A 1II9A 4ZCLA 5TY0A 3THWB 1FFHA 3X1XA 5AJXA 4A4DA 2PJZA 5LD2C 4W5WA 4TN1A 5AJVB 4OI0A 1KKLA 4PC2A 4TTPA 1W0KA 3CPJB 3DMNA 2DWQA 4NCHA 1WXQA 5KPJA 3ZVNA 4LYAA 1P5ZB 1W7AA 1VIAA 4QKQA 2DPXA 2W6ID 4DJTA 4HZUB 3DO6A 1D8TA 1YR6A 3I4LA 3K0CA 1GSIA 3M1IA 4H9GA 2ZI5A 2OCAA 4MKFA 2IYWA 2C2HA 4TWZA 3GEHA 2H16A 4M8NE 4WOPA 4TLDA 2XJ9A 4GP7A 2YJTD 5DSZA 1NBME 1TAGA 2A5FA 4RZUA 4PSVA 1BH2A 4PO8A 5FUVA 2ZS9A 3U61B 4ZCIA 2XNSA 5FPKA 4RKEA 1SHZA 1T3HA 4URWR 3W3ZB 5CB8A 1RYFA 3AVXA 1G19A 3R9WA 3AVYA 2GAOA 1VYVA 2FSFA 4ZPXA 3OFND 1X1SA 3B1XA 5FPTA 3WP0A 5JRJA 1UJ2A 4C0SA 3ZQ6A 1OH5A 3B60A 2XXAA 3SJZA 1G5PA 2XB2A 5HKKD 4EPVA 2H8KA 3SU8A 1W49A 4PO9A 3T61A 1WE2A 621PA 4DLVA 2R6GA 3T12A 4N3NA 1EWRA 4B3FX 4HUTA 1WB9A 1XTRA 2IWHA 4JLVA 3KQNA 2Q0HA 4QHTA 4D6PA 2MSCB 4URZR 4NYJQ 2H17A 4RD4A 3JZMA 1RRFA 1WP9A 2JGNA 4M0LA 4WZBE 4A2PA 1TU4A 2B21A 3D6TB 3LXXA 2ZRIA 1GUAA 3FWYA 4Q1DA 3GJ4A 1G17A 1TF2A 3U7GA 3AVOA 1BKDR 3OEHA 3TKLA 2Q3MA 3K9NA 1M74A 3AGPA 2WVJA 1DBSA 1WRBA 1PUJA 4PTLA 3VHLB 3I5YA 3EIHA 3QKRB 1EFTA 4PHGA 4Z8YA 4ZIRA 4XJXA 3WP1B 3BJIC 3TUJC 5AUPB 3QVVA 5FOWA 2HXYA 4OBEA 2G9NA 4KYIB 4LBVA 1E2GA 2QPAA 4A8JA 2GTPA 2QENA 1VYTA 3LBNA 3R8CA 2G1KA 1KO7A 2CNWD 1D2NA 1IXZA 1NBMD 2AN9A 2FMXA 4EJSC 2NMVA 2QGZA 4LX0A 4HZIA 1M7GA 3H84A 3U7FB 1KI6B 3NXSA 4EQ6B 1E2JA 3P4YA 1KO5A 1ZD1A 2BBOA 2V6JA 1GP2A 4BLRA 3UMFA 1DO0A 1P73A 4NKRA 4DDUA 4HDQB 4PQFA 1JEDA 2QBYB 3SHWA 3SBDA 2DFKB 4TMVA 2C78A 5SZJA 2ODBA 3GP8A 1NKSA 2OO7A 4ASUD 2CK3D 1E1QA 3RAPR 4MA4A 4BE7B 4EFMA 5FTNA 3TW8B 1BIFA 2HV8A 2O8DA 4Q21A 3VR3A 2C8VA 3D7MA 4PPNA 5B58C 5FTJA 4QC2A 4ZI3A 2WOJA 1S1CA 1I4TD 1JALA 1G6HA 3FFAA 1MT0A 5HE8A 4K46A 2IXFA 3NTUA 1XEXB 4QBGB 1ZM3A 1HH4A 4JLNA 1E2PA 4OQXA 1W47A 3UK6A 5HR5A 2I4IA 4JJZA 3GLFA 4GPTA 1UBFA 4DEYA 3MJHA 2D62A 2YWEA 4JLKA 4NYMQ 5JWHA 3VR1A 4NMMA 1E2DA 3BWDD 1LV7A 4FCWA 1ZCBA 5FUWA 2HJGA 1AS0A 1VG0B 1XJ0A 1FNMA 2O8CB 2OAQ1 4TQUS 3CX6A 3O8DA 2XX3A 4ABYA 2XSZD 3PR1A 3RWMB 2GNOA 2ZJ5A 3RS5A 4M1MA 3FMPB 3MJRA 2ZYWX 2H57A 4JL6A 5M04A 1OIVA 2HDNB 2J0QA 4MKIA 3T06B 5IT5A 5KDOA 2V9PA 2WZQA 1G7CA 4YMWA 5L3SB 2GF0A 5D3MB 1RJ9B 2GKSA 4DCVA 2WOOA 3H0KA 4LWZA 2KI5A 2QE7A 5JS8A 2BHRA 2ORWA 4OQFA 3SYNA 5IHPA 3THXA 3PV0A 3CW2A 1A82A 3EARA 2FSGA 4F7WA 3GLIE 4BZQA 1ONBA 1Q12A 4GZMA 2A5DA 3UWOA 3PUVA 1D2MA 2GXQA 2EYQA 4G1UC 4P0TA 1ZM9A 4YDSA 4DB4A 1FP6A 1RRCA 4ESVA 3K1JA 3TAHA 3RS2A 3A8TA 1VCIA 1XXHE 3DZ8A 3IGFA 5J40A 3QY0A 3REGA 4B71A 5DN6D 1A2BA 4A6PA 5DGXA 3DOFA 1TQ6A 4L8GA 4PHFA 3C5CA 4OQMA 2IYSA 2F1HA 4D82A 1KNQA 2JJ1D 4XTCS 2RB4A 2OESA 2IYYA 4Q5IA 2GCOA 1DE0A 3K9GA 2VYFA 2CMKA 3ND8A 5E7IA 3W9YA 2ONJA 2F3TA 4NCIA 2V8OA 2VTKA 1DAMA 3K0AB 2AX4A 1UFQA 1HURA 1F2TB 2IUSA 4JYBA 1UDWA 3I32A 3NBXX 4KXFB 1Z6XA 4EIWA 1TU3A 2ZJZA 1U81A 3TH5A 1E1RD 5KU1A 2BMFA 2WWFA 2Q9BA 2KE5A 1S9DA 5F9HA 3L0PA 1Z6AA 5L8VA 1R7RA 2GILA 2QM7A 2IS4A 4MRNA 3GLGA 2R6AA 3VHXA 2GBLA 2WWGA 1SVMA 3AV0B 4KU4A 3N5CA 2X2FA 2XITA 1X86B 1G8GA 5LD2B 4NTZA 1NN0A 3CF0A 4PC1A 3UG6A 3X1YA 1J70A 3BAFA 3KKMA 4OI1A 1GNPA 5KSOA 1L4UA 3QEOA 2W6IA 2ZR7A 3L43A 1CJMA 4P32A 4A36A 5AUOB 1NNEA 3B85A 2VSOA 1PLLA 4ITRC 3RABA 5FBLB 3TIFA 4LZZA 4AIIA 1SVOA 3NWJA 2PJRA 3AVTA 4M1YA 4S35A 3CPEA 4B2LA 1KIMA 4WVFA 4B76A 3SJBA 1G7RA 1YJ5A 5A0FA 5JJIA 2W2VA 1GRNA 5K8TA 3THWA 3RC3A 3AVPA 4RY2A 4XOIA 2CCJA 2YVUA 3P27A 4OK5A 5P21A 3VFDA 2GJ8A 1DS6A 2HUPA 4H1UA 4KLZA 2IYVA 2WWWA 2FFHA 4KFRA 5HCNA 5F98A 4IKEA 2Q21A 3R9IA 1ELOA 3OFNA 3PEYA 2RGGA 1ZIOA 4C0AC 4IFEA 2IUTA 1NMXA 4BLOA 1XMVA 1ZU5A 5CJPA 4IDOA 3RDPA 5HKKA 2DWOA 2X19A 1AN0A 5J4HA 5BXQC 5GJVC 2PEZA 1R6BX 3SZRA 2RCNA 4YLGA 4C2TA 1XTQA 2VPPA 5AK0A 1PUIA 1GNRA 1UF9A 3THYA 2RHDA 4AYXA 2P0EA 4DSNA 4WAUA 1VHLA 4KBFA 1JB1A 4M1KA 3FE2A 1P4SA 2FFAA 4JKYA 3FHTA 1TEXA 2N42A 4JSTA 1AGRA 3PEUA 1GKUB 1XJQA 1Z07A 2QUZA 3S1AB 4DLRA 3AF3A 1FP7A 4ZO4A 5E7MA 3V00A 3UKDA 3G0HA 1G3RA 4IRUB 2NPIA 4LHWA 3TSZA 4F91B 3B1ZA 1VDZA 1Z8FA 4URYR 1JI0A 4LDJA 3RS4A 3ZS9A 2EWWA 2F6RA 2R6CA 2QEQA 1R0XA 1DOAA 1GDDA 2IYUA 4KFSA 4C30A 1OH8A 2CNWA 3QIAA 5E95A 3A4MA 1FMJA 1NBMA 4GBMA 5EXTA 3PEWA 3F8TA 2Q6TA 1UADA 3TR5A 3UANA 5DO9A 3VAAA 1QF9A 1N5KA 2ZVPX 1KSJA 2QZ4A 1XFAA 4MYUA 4DSTA 3WXMA 1CULC 2DHRA 3LDAA 4LV6A 2GESA 4A92A 2BV3A 1T9HA 3CZPA 1XTIA 4TYWA 1R4AA 4XWKA 3AB3A 3U3JA 1MH1A 3Q5EA 3X1ZA 1RPZA 3IHWA 1ZUNB 1SVIA 3HP1A 1CR0A 2FGKA 3RS7A 4B2PA 1Z2CA 2ZYUX 3E1SA 4G0NA 2H5EA 3EZ7A 1JR6A 1ZD8A 3CM0A 3HJNA 4ASUA 2A78A 2CK3A 4TMKA 3NG1A 3AVUA 4LJ9A 4TZ6A 1Z22A 1US8B 4Q4AB 4BASA 3TGPA 4IXMA 1CKEA 5JWOA 4AKGA 5DI3A 4AWXA 3EWAA 1KI6A 3HU3A 3O8BA 3NVAA 4EQ6A 3LO5A 1Z0AA 3VKWA 1HTWA 1UPTA 3AQ4A 4IVQA 1E9CA 4QGHA 4GFDA 4ZDKA 1XCPA 2H18A 3LBIA 1JBKA 2F7SA 1TQ2A 3QNUA 4OI2A 2QBYA 3EPLA 4YDHB 1T5IA 5JSZB 1QHGA 1E2KA 2W00A 2QRNA 4RFSA 2Z43A 3R7WA 3Q9LA 1VMAA 3TSWA 3P1JA 4KFUA 2QA5A 3IPYA 3KX2A 1GWNA 1A5TA 3BGWA 1VG8A 3FKSD 4EDHA 1IN7A 2I1QA 2BCGY 3LQQA 1KY3A 5JRZA 2A3RA 4A15A 4JLOA 4O0MA 5G40A 1Q21A 2PZEA 2XSZA 4DLYA 4R2HA 1QHHA 2HCBA 3CNOA 4QNMA 3KJIA 1COWD 4RCYA 1J8MF 1N6OA 2QNRA 4DBLC 1XEXA 1OSNA 1E2FA 2B92A 2XB4A 2VP9A 2HJVA 4HB2A 3FYHA 2BOVA 3BB3A 1ZW6A 3L8ZA 3WYGA 2VHCA 4JL5A 4V0NA 4RD2A 1YVDA 3B9QA 4TLBA 3U3KA 5GJCA 3WNCA 2IYXA 4B6EA 5JS7A 4M1TA 2O8CA 4IDPA 2JJ2D 1XWIA 3K53A 3K09C 3NEJA 1Z47A 4I1VA 1WBDA 2SHKA 4HI0E 1XZPA 5C4GB 4LHXA 4A0FA 5DN6A 4AG5A 3IIJA 3OIVA 3T1TA 1KI9A 3WYAA 1CF4A 2YOGA 1SHKA 3KXIA 1FW6A 2VP6A 1AKYA 5L3SA 5D3MA 1DARA 1M7HA 2MMGA 5KNBA 5CLLA 2JJ1A 2YOHA 3N2IA 2RMKA 1IBRA 3FGNA 5ELXA 4LSGA 5K8LA 2EFDB 1ETUA 1IONA 1S1MA 1NJGA 2Z6VA 1J8YF 2GRJA 1AA9A 2OILA 2NQ2C 1N6HA 1RRGA 3FHOA 1P72A 3FPAA 4HATA 4DLXA 3K8YA 1EFUA 4OHXA 5EP2A 1BOFA 1E1RA 2NIPA 5CITA 2ZRBA 3C7KA 4LC1A 3GJ7A 3K0SA 2HT6A 3IBYA 1IQPA 4NZYA 3O47A 2EQBA 3QE0A 4FXPA 1GKIA 2P2LA 1M1YE 3RS0A 1DG3A 1HQYE 3M4YA 4PZZA 1MO4A 3R8FA 3VU9A 4X8HA 4MRPA 1GAJA 1UKZA 2ZJBA 2WWYA 3DPUA 1OIXA 3A1VA 2G6BA 2WBLC 2O8FB 2F9MA 2QRZA 4M9SA 1E2NA 3NHBA 3GLIA 4CYMA 1YZNA 4GP6A 1E9SA 3MFYA 4KBGA 2DBYA 1F2TA 3QPWA 4HEJA 3DMDA 4MYHA 1OHHD 1IHUA 4B34A 4HSEA 1C9KA 2C9CA 3B1WA 5EP4A 3U7HB 1XXHA 1T0JB 1DTSA 1UM8A 4W5HA 4LGMA 2F1JA 1XPUA 1NIPA 2GEVA 1NLYA 1G4UR 4CF7A 3LX8A 4LHZA 4R7ZA 1A2KC 1XDBA 1JAIA 1IOZA 1YZUA 3CRVA 3GCGA 3IDQA 1E0JA 2GVZC 3I72A 2GXUA 3T1VA 3ADKA 3H86A 2ZI6A 3U6KA 5FBQB 3TMKA 1E9RA 2PBRA 5SZHB 3Q5DA 2NO9A 3X1WA 3T34A 4C0BA 4GI7A 3L0OA 4FIDA 4JKIA 4B3GA 1ZNXA 4I1OA 1YZLA 4D26A 3B1VA 3H1TA 3CWZA 1Z6GA 3ND9A 3QVUA 2CHQA 4UXHA 2PZFA 4DLSA 3RLFA 1P75A 2CBZA 2IUUA 3DM5A 1KDRA 2PT5A 3FVQA 4QHYA 4TYPA 1KGDA 2VP0A 4C0KA 4LJ5A 4PPGA 1U8YA 2VP5A 1IN6A 1X3SA 2XTZA 4UNNA 4NE2A 4V0LA 3EX7C 5FTMA 1LF5A 2QAGB 5TV2A 3OF5A 2VHTA 1GTVA 5JI2E 4HLUC 4BFSA 3P26A 5G53C 1Y3AA 4RJLA 4GMXA 3BFVA 5DLQC 3ZQJA 3FDIA 5JFGA 2CDNA 3N70A 5LDDC 3BERA 1R0ZA 3GJ8A 2QTVB 1HV8A 2ASEA 1JXOA 2GJAA 1VIYA 2ZROA 4GNKA 4MUAA 4LCBA 4B32A 2FEOA 1U9IA 1H8HD 1YE8A 3GEIA 3DKPA 1NIJA 1PLKA 4LY6A 2DB3A 4TZ0A 3B7GA 3SQXA 4I1UA 2PH1A 4MITA 2IHYA 4QM6A 3OE7D 1ZUIA 3QKTA 4D2IA 2A5JA 3NIBA 1WDTA 3IIKA 2H92A 4RSGA 1H65A 1D9XA 2VSFA 1U8AA 3VKHA 5JCZA 1NLZA 1Q44A 3AF1A 3SFVA 2J1LA 1ODFA 1M34E 3BS4A 2VF7A 2Z0MA 4E09A 2X77A 1TEVA 4QM7A 2FDCA 2HYIC 2AKAB 4JLJA 3OIWA 4Q00A 1EFCA 1EFRD 1U90A 1II0A 1IY0A 3PUYA 4Q4HB 3OIUA 3RRMA 4A9AA 2G1JA 1JNYA 4M4SA 5ANRB 2QN6A 1W4BA 1OF1A 4MDFA 1CJVC 3FTQA 4B35A 3ADCA 2C9OA 2RGNA 2ZS8A 3CF2A 1Q1EA 1MV5A 1HY3A 2WIBA 3EZFA 1ZAKA 2YHSA 5EUMA 1JXMA 1L8QA 2AL7A 4XD7D 2Z5FA 1CLUA 2CVFA 3A4NA 4DKXA 1KSFX 1Q22A 1Z0IA 2DR3A 4RZ3A 4QOSA 3VNVA 3TBKA 5LB2A 4BFXA 1JQLB 3HPRA 3RSOA 5E4FA 121PA 1CJUC 2ERYA 1NVVR 1P7CA 4AC9A 1XMIA 4B3BA 2IL1A 1OFHA 3SS8A 4Q1EA 1II8B 4B74A 2GHIA 4TL7A 3QXJA 1P6XA 1US8A 4RKFA 2FFBA 1YRBA 3FKSA 4KI0A 1E94E 5HTKA 2DFLA 1PJRA 3GJ6A 4Q4AA 4BLTA 2QT1A 3CLVA 5EE1A 4Q01A 4ZDIA 3AVQA 1GFIA 5AUQA 2ZRHA 1P2VA 1COWA 3NDBB 4ILEA 1XX6A 1DADA 1WCV1 1P61B 1HE8B 2YYZA 3ZIAA 1IY1A 4P33A 221PA 4XVQA 2WMNB 4KLNA 3EXAA 3QG5A 2OFOA 1MO5A 3LXRA 4LJAA 4CT4B 3Q85A 2P5TB 4BFUA 2XJ4A 4Q48A 2WJYA 1S3GA 1X8KA 1XTSA 4CEIB 1W2HA 2W2TA 1CRPA 1AQUA 1E2MA 1N6NA 3KKQA 4V0OA 1U8ZA 4BGDA 2R44A 1G8HA 2GK7A 5BW8A 4DCNA 3BRWD 3CRQA 3WNDA 3PENA 2GJ9A 3WY9A 2JJ2A 2C9YA 2JLUA
chains in the Genus database with same CATH superfamily
3IMGA 4PXAA 1MQAA 4YRLA 3LI2A 1JR3E 4G9GA 4O02B 2WMOB 5IM5A 5CT9A 3HPQA 2FRVA 3KDAA 1WCYA 3AR8A 2VCHA 3JATB 1ZVQA 2G5GX 1FVFA 3Q7RA 3ZUGA 1ZGGA 5HVNA 1A4UA 4PLTA 3QYFA 5DYGA 4X1YB 3Q12A 1A2QA 3M34A 1N1MA 2K5UA 2VYCA 3BN3A 1JSZA 3RYIB 1ZINA 1RBZA 3A4VA 4JP1A 3PQFA 4C06A 1J9EA 2FB9A 2VPTA 2WKPA 3HBMA 3QFSA 5CT6A 3RVMA 3T7TA 3UF0A 4B43A 3H5RA 5E2IA 2FE4A 5EYPA 2D8AA 4FX5A 4KEAA 1RI3A 4WY5A 4WWHA 4Y67A 1G8YA 1V48A 2GGSA 2PQ6A 2XWSA 4YREA 2PX6A 3EZGA 3IR5A 2HK9A 3TQIA 4C7OB 1WL8A 4OHCA 2OCYC 4JI0B 5KYUB 3WL6A 2FUCA 4S2EA 1JH9A 2IVZA 2W83A 4NE9A 2CYBA 3VA7A 2IJGX 4LK3A 1DXOA 3P7MA 4L6AA 3E9QA 4DF3A 2I62A 3D4OA 3H16A 1SBQA 1MPTA 3OTOB 4YGYA 5L7YA 2JFVA 2WSMA 1ULBA 1NP6A 2I1VB 3IELA 3V34A 4MV4A 4NXMB 1E79D 4ZI7F 5LR6A 4XIYA 1D5CA 1DIAA 2RGCA 4C7KA 4GC9A 1E92A 1JYFA 3LC1O 1CQJA 4Y0VA 4FYKA 5A9SA 2R6HA 1O57A 2RH5A 1DAEA 2XI4A 4GAEA 4QXAA 4TWBA 5AW7A 1SUWA 5MFPA 4CEHB 2IHBA 1QSGA 2DUJA 2OV3A 2ICAA 2DPGA 3C98A 3FJYA 2VDQB 1CT9A 1DQZA 1OVGA 2R4UA 1A3CA 1GGNA 2VWQA 3DHWC 5FKJA 3T6KA 1XD2B 1QGUB 3V9PA 3WWDA 4E14A 2A0WA 3G9UA 3RRYA 1JR3D 2QLLA 5AI0A 3ZV6A 1Y6FA 2O59A 4UHEA 4TKVA 1UMBB 2Y67A 1C1HA 1UC5B 1XVVA 3BQMB 3CH7A 2B82A 2WKSA 5JCOA 3OLXA 4F60A 5A4KA 5AW3A 1G5HA 5HWSA 3RAFC 4HGOA 3AIMA 1U0BB 3WB1A 3B2EA 2V59A 1J5EB 3A3NA 4FXOA 2IY9A 5LL6P 3G2IA 3PNMA 4R3UC 3DE4X 2IYQA 4C4PA 2X8JA 2CVPA 1IMOA 4PLFA 2H4JA 2O8FA 2VJCA 1ZUHA 3C8UA 1PVDA 1FX0B 1GQYA 4WBNB 4AZTA 2IXTA 3H1FA 2ECPA 3RVPA 2QAIA 1XRPA 3G2QA 4UXIA 1IQ0A 4Q9IA 3NNNA 4BU0A 4K28A 1RHRA 1XTVA 4IOMA 1QKKA 4DSZA 4EI9A 2HHCA 1V9LA 2RONA 2FTKE 3K4PA 1G8MA 4U4AA 3L3BA 2ZUEA 2QM3A 1T24A 1TVCA 5AQEA 3UMGA 2QZPA 1R0SA 1WNFA 2NZWA 1WB5A 3LOPA 3OZ7A 1U3GA 2QMEA 4NPCA 4RSHA 1VE6A 2YY7A 1M1XB 5L51A 1XLTA 4ESHA 4KITB 4DC0A 3GCZA 1NZFA 1ORRA 1ORWA 2G09A 2ZTHA 3BMOB 2EIXA 3R4CA 4LXTA 4RE5A 4X0EA 2BFDA 2BP7A 3UYKA 4WOBA 5IVPA 1UMCA 1WKCA 5TT0A 1PF7E 2I67A 1OBCA 2H2WA 2PT6A 4PFKA 1CG6A 1L7XA 3UWKA 4LGVA 3KQLA 5AVSA 4HGNA 2XVZA 1WUHS 2XUQA 4MLPA 2HCRA 3RARA 1N2CE 1ZEJA 1XUOA 5F2OA 4B3CA 1KDTA 3WO0A 3ABSB 1UFRA 2AWOA 1VQ1A 5D87A 1TO2E 1KI1A 1NX6A 2B8TA 2DETA 3NONA 3Q7PA 5FRDA 1AXGA 3MUFA 4QDUA 3VO1A 4DLAA 3EOAI 3FPFA 3VH1A 4JIGA 5B64A 1SKQA 1EX6A 3GLHB 1O3YA 3E48A 3K1AB 3VQTA 1N78A 2HA7A 1H8HA 1I9CA 4EO4A 3QU2A 3NYRA 5FR2A 2PO5A 3VDQA 4E2ZA 1Z73A 3QXSA 4TT8A 5B57C 4P7KA 3O95A 1LCIA 3T1OA 4DY4A 2B4QA 2UZIR 1YSCA 4UVGA 4NE7A 3KEOA 3RUCA 1TCUA 2CYAA 4JDUA 1WVMA 1XCBA 3C0KA 3RUAA 2ZR0A 4RY9A 1XNQB 4EKIA 2HGSA 4TSKA 1R9JA 2VSQA 1DG1G 4TL8A 2QAGA 2Q4OA 4BO6A 1CR4A 4J2HA 2BCJQ 4O5OA 3Q3CA 1PGJA 4UM5A 3RUPA 1Z6PA 3OE1A 2HEGA 1KI7A 4EW6A 5JD6A 1OLSA 4AJKA 3EW7A 1K3UB 5K5EA 1I3CA 4D9HA 1NKTA 3BICA 5FWXB 2QTVA 2LKCA 1UWKA 4DNXA 3DDNA 2QR5A 4MMZB 4D4LA 3GLSA 1LZKA 1YMQA 2WAXA 2C8KA 3G5LA 2PX4A 1Z4LA 1DPFA 1LY1A 4IIJA 1V7CA 2AC2A 2QWXA 1GCUA 3EQ7A 4BO8A 2JRCA 3NWOA 1JUDA 4IDAA 5HS4A 1GL9B 4XGIA 2JCBA 1XZCA 3COSA 4RPKA 2X8WA 3G89A 4EQZA 7MDHA 5EJ9A 5K0TA 1G38A 3H9BA 5L3QB 3BL5A 1Y6QA 2XGMA 3F7MA 3MAAC 1T1JA 4G23A 4P3OA 1O97C 1VRCA 1A1VA 1X1CA 5E4YA 4HYYA 3R7SA 3L0IB 2CXSA 2H1LA 2J0UB 1JU9A 2KWIA 2XCOA 2JGDB 3V7NA 3EEOA 2IXAA 3H5LA 2XMCA 3HKCB 4Q03A 1HL7A 2EFEB 4CVNA 4BCBA 5LP6A 1IBKB 5C37A 3ZNOA 1WXFA 3LVFO 5FO1A 5ALQA 5IASA 1RM0A 5IJ9A 1XP8A 3RUIA 4GX0A 2P6OA 1AUPA 2WQ7A 1WBBA 2Y92A 4EO7A 2LBPA 2I87A 2XUPA 2QPOA 4NECA 5JAMA 2EHDA 2X5JO 2ZSUA 4BO1A 1EFPB 3H87A 1I1NA 4RGBA 1YRWA 1GCIA 1YB2A 1QFMA 1BXRA 4GKBA 2G76A 4IEEA 4XGKA 1G9XA 5EVCA 4E0BA 4WKBA 4R9UC 5F5XA 2I2CA 4YI3A 3V8PA 4KXMA 4DRZA 2IS1A 3W9SA 4J0EA 1KYWA 1QO7A 4IFIA 721PA 1SOMA 2G5PA 3E2PA 4UM9B 3PCTA 3SICE 5ALDA 4OHZA 1UINA 3U4DA 3CLUC 3IEUA 4YR7A 3U3ZA 3UCEA 1DRUA 3ZVKA 3UJ9A 3MQ4A 2IPLA 1POXA 5KIAA 2YV1A 3ZGXA 3QOYA 3M49A 1DEHA 1G66A 1W35A 2ZIZA 2ZR9A 1M2EA 1B8VA 4DQDA 5I7HA 1XCOA 4DLZA 1Z2NX 4F4JA 5JMOA 1IUKA 3MCZA 4ZVNA 1H2BA 2JH3A 7ABPA 1RP7A 1UPXA 2ZSIA 2RBEA 1T9KA 3EHEA 3JSXA 1SMKA 2OSBA 4IZIA 2QVXX 2WM9B 4BNYA 2VH1A 1WCIB 3KYDB 4TVBA 5J58A 1FB5A 1TNDA 2KQUA 4IWYA 4J6EA 4ARUA 4ZDJA 5JYDA 2FWIA 1RRKA 5LNK6 4P6VF 2H08A 1K8ZB 3T3NA 1QP7A 3AM1A 3QU9A 4Q66C 1K89A 4QQ8A 1I0IA 3E3MA 4E21A 1T1GA 4NJMA 4L28A 3ED5A 3M4JA 1IOVA 3LW7A 2H1WA 4UPEA 4IGAA 5KYWB 3ZE1B 3BE6A 3DZBA 3EZXA 1QG4A 1UM9A 2YC2C 3A05A 3ND5A 3TINA 1VYUA 1PQYA 1WXHA 2JDIA 4IHQA 3CCCA 3B82A 3ZNPA 2HNKA 4GL2A 4L16A 5LMZA 1W36C 3A27A 3J81A 3QIVA 1JWAB 2V98A 1NW5A 3ZN2A 2RGUA 1EFDN 1S8FA 4KDFA 2ZREA 1FYXA 5AJYA 3BEOA 4ZDWA 4MAFA 4UD6A 5JSUA 5IT0A 1HPLA 3ZV4A 1T8UA 2WUGA 5AM1A 3GZNA 4E5MA 3BBPA 4J94A 4NSNA 5BYBA 2ZRGA 1Z83A 2R6FA 4QEDA 1BU8A 2EU8A 1JG3A 1V1MB 3CB2A 4LK2A 2RHLA 3LUJA 4GE3A 1YR7A 2HRCA 2IY7A 2WYWA 3BH6A 4R2IA 1QTIA 5DHAA 4YP6A 4DY6A 1NUUA 5AHOA 1D09A 4P4TA 2REBA 2P2GA 3NX4A 3NOXA 4X7RA 4Y9RA 2OQVA 3RYHA 3U3RA 4BRZA 1GPJA 1F2UA 5I47A 4KCGA 3KJEA 4H3KB 5KNCD 1FUEA 1VP3A 5JCPA 4KLAA 1FBNA 4HWKA 4GKAA 4GPAA 5DHSA 2PMEA 4F6RA 3QKRA 3QNWA 1H4TA 4CUJA 1FSPA 1GPYA 2R3SA 4IQ0A 1JHYA 1PG5A 3DA8A 1JECA 3OZBA 1JDBC 1AZTA 2OP0A 4K6CA 4LOLA 5EZYA 1SUFA 4K3UA 4ZV7A 3G1WA 3WTCA 4E70A 2OHVA 5DF1A 2O5CA 4BZWA 3DVLA 2C4NA 5E38A 5BQFA 5IT9A 1BE6A 4R81A 3OTWA 2H2FA 3C39A 4J7CA 4K7JA 5I7VA 4G8CA 4KACA 3K8QA 4O2LA 5JCJD 4HQOA 3R5XA 3OQNA 2V0GA 3PEVA 5E6SA 3EVGA 1BDBA 2CD9A 3HE3A 3FTNA 4J0HA 1XD8A 2HA6A 4IMPA 4H17A 4H1HA 3L7LA 2HLDA 2JHGA 3E7WA 4NULA 4EH1A 4QXOA 1KH3A 3GOHA 4HDOB 1NW3A 4IOLA 3DV0A 5DH9A 5H3LA 1M5RA 2C96A 1NT2A 2AFIE 4ZZ2A 4CTMA 4YBRA 3G7NA 4OQLA 4F11A 1U9JA 2GN0A 3MWJA 5JJBA 5HQ3B 3JYLA 4Z4IA 4ZZ0A 3AGQA 1K8XB 4XW2A 2H59A 2E9SA 1EHIA 4XVRA 1PWYE 2V97A 2V7QD 2XTAA 3CRW1 5A3SA 4JUAA 1Y6GA 1LU9A 1C30A 1L4YA 3RSQA 1CQZA 3WLSA 5HZHA 1B4DA 1TUIA 1XJCA 4MGEA 4ECAA 2QMYA 1NR1A 1ONOA 4KIFA 1KHHA 3AFNA 4J1NA 1SOWA 4YUVA 2ORIA 5U1PA 3ZVMA 2VQ6A 1U2EA 2JAPA 2PWAA 3QTBA 1EJ0A 2PWBA 4Y6QA 1P1KA 5BMVB 5E1DA 4AW9A 1UKBA 3WHLA 3D6JA 3QQPA 3ZIAD 1EEXB 2FW0A 2PUVA 5DVZA 3SFTA 5LPNA 2XTJA 4X20A 2H06A 2ZYTX 3F6EX 1RFLA 1PX0A 4G5XA 1VI2A 1T4BA 2W0MA 3IJEB 3OEWA 4KQWA 1AKVA 5AI4A 3X43A 4QL3A 4JNCA 4E1AA 2O4UX 1NVDA 2OCBA 5D6OA 3WLFA 2OGUA 3ECCA 4ZVUA 4URXR 2JLXA 5F9FA 2Y9PB 3FWNA 4PR3A 5EJIA 1KYZA 3VSAA 2HBRA 1E9BA 3W90A 4A27A 2ZUBA 3HO8A 1Q11A 4EECA 3U1VA 2VAXA 2ZZMA 2VI5A 4AS2A 1G4AE 3REOA 1XQ6A 2C4WA 5FBWB 2P11A 3AYZB 3LRTA 3ICCA 4R4JA 4K9SA 5HUJA 3TIIA 2W6CX 1J20A 3BE5A 6NULA 1A98A 1N7IA 2AEEA 1VL8A 1O87A 1V4BA 1DL5A 2LPMA 5HCIA 2PCJA 3G85A 5AK6A 3TTTA 4EEKA 1U4SA 4V0RA 5J4YA 2EJUA 2JLQA 3TG8A 4I4TF 1EVKA 1TUEA 3O83A 2VNIA 4DILA 1NFFA 1ZGJA 4MI3A 5BSMA 1DEXA 4PGMA 2MINA 3HKBB 3ABZA 1RJ9A 3TMYA 1YQGA 1LLFA 1U8TA 3AUUA 2J7KA 3EIQA 2CL0X 2QMQA 5D6NA 4JYAB 3RRXA 4RMJA 3ZD6A 4CKWA 2RGEA 4N0QA 1E2UA 3H1PA 2WMYA 2WF8A 3G0IA 2IEYA 1WM1A 4Y6GB 3W5SA 5FEMA 5HCUA 3PJEA 3UFBA 1SHTX 1RWNA 2ZZKA 3QEBZ 4G5GA 2ZE7A 3W3AD 3KOXA 1EQAA 2BL4A 3SG0A 2J45A 1SU8A 1ZZGA 2CSXA 5I6DA 3LT2A 3QRWA 3A7DA 1G21B 3M2PA 2XVXA 3UXMA 3TFWA 3RNLA 2C5LA 1ODTC 2IA5A 5FI0B 3ML1A 4DV1B 2QLJA 4F93B 3CRZA 2HX1A 5BR4A 5K0BA 2P1DA 2Q2WA 1Y8ZA 4JN6B 2VRWA 3PFBA 2XVAA 4NCKA 3X2EA 1LRKA 4Y2QA 3KYCA 1HSOA 3U3XA 4F2DA 1NMZA 1UANA 1I1HA 4R9NA 4V2IA 1ZBQA 2CUZA 1F6BA 4JX8A 5E1BA 3RODA 1OX5A 5JUWA 2B4RO 3O91A 4ZKDA 1KRXA 2FHSA 5AT1A 2OA0A 2ISCA 2XW6A 4L0DA 2B94A 3FH0A 1RYYA 3H83A 5A0TA 1WUYA 4RQBA 4X1IA 3S2IA 3COYA 4LHVA 1C3VA 4GOJA 2BAGA 4CETA 3GBPA 3KUKA 4CMHA 1IZ7A 1QH8A 3BFKA 2JW5A 3HI4A 5CJ2A 4LE0A 2V7GA 3TSAA 4FWBA 4WCFB 3T99A 3HUDA 1GIAA 5C5CA 2VZ0A 4P7FA 2AD5A 4QQRA 4UBNA 5CNJA 3PQ8A 1DDIA 1GFZA 2CNBA 1JVBA 5B1YA 2B9EA 4XFJA 3D8TA 4GE0A 1OR8A 2ZRJA 4M37A 3URKA 3SM9A 4HAUA 3E7FA 3AETA 4UQLA 4BNLA 1DB3A 2I5PO 3H6KA 1SGWA 4NXNB 1PGQA 4L5JA 4TWAA 1RBYA 1PFQA 2NG1A 5CX1B 2Y0BA 3DYBA 5IDWA 1KI4A 1NVKA 2FV8A 3CN9A 3JPYA 1E6CA 5SZKB 2JBHA 3IHLA 5K45A 3ZGZA 1LW7A 4ZGGA 2CFRA 4JEHA 1NI3A 4NV0A 4DIDA 5HGXA 3WRYC 4CFZA 3M4XA 3BC1A 1MGOA 1MOPA 2DQSA 1MNAA 4J29A 4JITA 5LP1A 4YRQA 2NSLA 1GRCA 1ENZA 5L3VA 1HYQA 1E6LA 2GLXA 4CE6A 1NSFA 1BMTA 4X95A 5HKBA 4H4DA 3MGCA 2Q9UA 1CNFA 2WVAA 5A6SB 4MH0R 3ZU4A 3MTIA 3V3KA 4DRXB 2VWHA 1CUFA 5CG1A 2NYVA 1O5IA 4AX8A 3ICQB 4DMHA 4ZAVA 3W5VA 2BZ0A 2AHOA 3B12A 5A5EA 4HLCA 4R1OA 3PDCA 2QP4A 4U0KA 4OUKX 4WVLA 1M0SA 4C5BA 3NETA 2ODNA 4PE5B 4HX2A 4U2KA 4AKIA 1GTRA 1SY7A 1SC6A 5FPPA 4YYEA 5M2QA 2FG5A 4DG8A 1ZIPA 3ICVA 5CYOA 1PDWA 1X94A 1CS4C 3G49A 2ECKA 2I4RA 1J8VA 4DT1B 5LQRA 1UWCA 1X38A 4LEIA 2ZRPA 4EHHA 1SCBA 4X93A 4PYJA 1PAUA 1QLJA 2AFHB 1L8XA 2OEPA 3OUTA 1JDJA 3NVDA 1MEOA 1Z16A 3CKLA 4Y6RA 3KQUA 2FMHA 1NU8A 1PBNA 3G2JA 5EEGA 5HF6A 2IHNA 1KK0A 1IQRA 1P7PA 2QN7A 4LCEA 3TN7A 4RJTA 2ZI4A 1K5DA 4PCLA 4TKLA 4C4SA 3LW8A 1P33A 1R9GA 3G5UA 3NO4A 4IFTA 3V1NA 4DDKA 1GRQA 2RJNA 3MT0A 1BS1A 5EUQB 1IAVA 1RC1A 3LNCA 1FK8A 3OCVA 4FEGA 4FYHA 4M87A 3S1AA 4CEJA 2A9VA 1ZI6A 5EJGA 2DHEA 1T0PA 2GLTA 4YAIA 4EA9A 4NMWA 4KO3S 5EXEA 5TX7A 1YQDA 1ZCFA 3S44A 4B3MB 1D3AA 4IQ4A 4U2FA 3TFQA 1Z63A 1KJJA 3AUJB 1Y4ZA 4G86A 4CDNA 3FOFC 2Q3LA 1CIVA 2BJWA 2I4MA 3P20A 4RKYA 4JB8A 4TMXA 3EQ2A 2VNAA 3N75A 4WCDA 4E1VA 1FDIA 4YXWD 1G4HA 4MWZA 4PPFA 3JQAD 5A1TA 3B9RA 3R0IA 1M8GA 3FYSA 4NY1A 3HJRA 2ZW9A 1P81A 2RJ3A 2R1TA 3TRFA 4P2GA 4CQMB 1B26A 1Z4KA 1EP1B 1Z13A 5EFZA 4A26A 3VVMA 1JJIA 1QYXA 5EIHA 4DBLE 1EVIA 3ZCXA 1HWYA 2EV9A 3QF4B 1RW4A 5C8YF 1OWPA 2GXSA 3TXXA 1XMJA 3CMCO 3WO1A 3L7AA 2VL7A 3GPDG 5FH9A 3G9QA 1Y4DE 2WDZA 2ZQ5A 2PFKA 3M70A 4Y6LA 1ECCA 3BSFA 3ZE6A 4MW6A 4UFPA 1G60A 4M6WB 1QQAA 1XTKA 1HORA 1F14A 5IT4A 2AG8A 3DLCA 3HGQA 2WWHA 5IZCC 4W8HA 2VCYA 2HIHA 3K0FA 4WBSA 4RHTA 3NWBA 1VGRA 4OTZA 2QUJA 2A9KA 1YVEI 2NO1A 1Y0BA 3HVRA 1M66A 1MJGA 3L7KA 4JEUA 1PW5A 2Q0SA 3PPXA 3T5PA 3LVQE 5CR9A 4CV0A 4EY3A 1U0FA 4D4IA 2NU9B 3LCUA 3QX3A 3BMQA 4B80A 2DSTA 3KKNA 4P7BA 3RB8A 3B8HA 3FRHA 3I9V6 3JQBA 4F0JA 3DV9A 3WBJA 821PA 1ZMBA 3GFGA 2VYNA 2HI0A 4H1WA 1AMUA 5DMHA 1O95A 2H7VA 3BGIA 3I04M 3C6KA 1W93A 1UZAA 3Q0TA 4LVUA 1QWSA 3QLTA 2ONZA 2VNJA 3JQ8B 2NZJA 3IBGA 4UVIA 3WFZA 1G55A 4AMBA 3QMWA 5CB4A 4PY2A 3INGA 3GJZA 4JIMA 4Y7DA 2RB5A 2B8NA 3CUUA 4HQFA 3KZXA 2ZB4A 2A1TS 4LRQA 1RMYA 5IFKA 1Q0TA 3AVWA 3SYMA 3PDJA 2R7NA 1TYCA 2VBCA 3TOXA 3WI7A 1DAGA 3HJAA 2WD7B 4BN5A 1R88A 3DFUA 4G5OA 2NV0A 3QUSA 4ID9A 1SHJA 1ZA2A 4CGYA 2PLWA 3FCSB 3LPDA 5DM0A 3UCXA 1VE9A 1QM5A 2ZSEA 3BGVA 3D1LA 2YL2A 4TUYB 3WQHA 4E07A 4KXNA 1O1YA 3CWCA 5F5LA 4QICA 5FFMA 3N05A 5LA6B 3U4CA 3EGXB 4C76A 2UU9B 1QZUA 2IX9A 2PZMA 1UBCA 1MC4A 3LZDA 1M7BA 3NHZA 3ED1A 4WXYB 2VHVA 2XQGA 4R1TA 2E4YA 1ARZA 1FXSA 5F35A 1X7WA 2FEPA 1ZK1A 3K6SA 4X91A 4RQUA 4ZJZA 2BGGA 1TA0A 2E4UA 2VF8A 5K0ZA 4DR2B 1S2MA 4RD3A 4JEIA 3MWDA 3QV1A 1E66A 4PGFA 1P9LA 3L7CA 4Q12A 4Z9FA 1GRVA 3QWAA 7MHTA 5BRAA 2WT4A 1OY1A 5KTMA 4DV3B 4ZVRA 1SUBA 4LJ8A 2H7XA 3NALA 3KAPA 3VVLA 5IMSA 3CKYA 4OFZA 3F8SA 2EZUA 5EGSA 4YAGA 1Y4AE 4EUSA 3O4RA 2JIZD 2KSQA 4L76A 1NU6A 4HNHA 3C5HA 1G8KA 2VJBA 1YA4A 3ILYA 1K9VF 3AUTA 5A7HA 4R83A 2C8JA 3IPLA 2YIMA 1H2XA 4XWAA 5THQA 3I8XA 4BRUA 3ZPXA 5IYZF 4S2UA 1W5TA 3JWHA 3JZFA 2EZTA 4TYQA 5FA5A 4GF5A 4EF6A 3R9XB 1EP9A 3U13A 2GN9A 4LAFA 3RVQA 3T0GA 1BD4A 5DI3B 5FUQA 4H35A 4L4ZA 4MYTA 2ECOA 3QVGA 5HOQA 4WZBB 3N76A 1C0EA 1J7KA 4FDVA 4D4GA 2RBKA 5K0EA 2FPIB 3FTDA 3K9QO 3U44A 5LQSA 3TR6A 5EQJB 1R74A 5KYVA 3FUTA 4HQRA 4YPOA 1EXMA 4N39A 3BHNA 3ESCA 1NN3A 1KOGA 5HJ5A 4L4XA 5KNDD 2ZWOA 4XYGA 2MJLA 3JRXA 4RIIA 3HZRA 4DV4B 1C3OB 1XJ5A 3TOSA 1FZQA 4ER6A 3AUAA 2G67A 2R9VA 1GKLA 4H0CA 4MWGA 4C4RA 4BO3A 1HSZA 1TTPB 1UJBA 5JANA 5FNVA 1M8JA 2QTLA 2WU8A 5CNKA 4OGLA 5G4KB 3CZQA 1GPWB 4G5HA 2NO0A 4N9QA 3A1UA 1PJQA 2ZP1A 3NNDA 4MUHA 5E8RA 1PI3A 1QHHB 1W0JA 3EF1A 4UJ5A 1KKMA 5EXDA 2HMSA 4JBWA 2J0SA 5F5NA 3G5AA 2O0JA 5DJ5A 2R8OA 1A9YA 1N6RA 1K7CA 3ID6C 5GVSA 1T2UA 1G5QA 2VDUE 3MEQA 3L0SA 5DYIA 4HTAA 2EDCA 4FI3C 5IMBA 4JXZA 5F4ZA 1P18A 1Y98A 3C15C 1WSAA 1KAMA 2PTGA 4HDNB 3W0LB 1Q0LA 4CF6A 2KX7A 3I6MA 2OHFA 2BT4A 1I94B 3OY2A 5H83A 4BQFA 1HRDA 2R2GA 2K6GA 2UVDA 4G2NA 1TA4A 2BFBB 3U0VA 2JG3A 3O8OB 3B6MA 1RIIA 4L0QA 4AZWA 1NMSA 2OTCA 3NEPX 1LFDB 3KVOA 3DBLA 4FD2A 4DDWA 1KMNA 1V11B 3QNMA 4L3VA 4WPGA 5EZ5A 3TRDA 1R4NB 3VSCA 4BEVA 5CFQA 1YTUA 4BO2A 4K86A 2PX5A 2QYOA 2WWXA 1Q77A 2A57A 2J09A 1U99A 2YRWA 4KUGA 1EGMB 2E18A 2VOEA 1RD4A 4JBYA 5LDGA 1Q7EA 1XGKA 2ZBQA 3SKYA 4E5VA 1LBIA 2NXJA 4US1R 5FLXA 2YDXA 3EC2A 1SBCA 3PI6A 4R8LA 3AY3A 1YQQA 2R68A 2VH5R 3DBVO 3G68A 4PU0A 5BY2A 5A9RA 2FFQA 2ZXFA 4RMIA 1SXJE 1T0HB 3LBAA 3W34A 2E5LB 3BD7A 3CUVA 1XMPA 4E2XA 3V4PB 4DMCA 2CJWA 4QUJA 2PZKA 3PXXA 4C3ZA 2WYVA 2JFQA 3RHTA 1V3QE 1BE0A 4QELA 1Y5RA 2Q5HA 1E2EA 2PGIA 3CWQA 4LQDA 4X7MA 4C01A 1WCXA 2W42A 4D92A 1UMDA 5KHOC 4RFLA 1JA9A 4M3NA 3SR0A 4LZLA 3N8HA 1P6UA 2OR3A 1SZJG 3RUFA 4LKOA 4YLEA 4P5DA 5HX7A 3T5AA 3I5XA 2ANCA 2LIPA 1HTTA 3MWKA 3LIIA 5DOZA 1NRJB 5KSWB 2XZOA 4RPIA 1R5BA 4ZAXA 3ES9A 4QPCA 2O50A 1AQLA 3ECSA 2C07A 3KEFA 5G3YA 3VGJA 3VU9B 4ALMA 3W6ZA 3O03A 5F52A 4GSYA 2AS0A 4PZEA 4WFIA 2XYRA 4OHRA 3EASA 1ZOLA 4NENA 2A0YA 1T5TA 3SOZA 4KV9A 3ZX4A 5CG2A 5JOQA 3H99A 1O9HA 1RS0A 2OC9A 4AXBA 2OXFA 4YT2A 3TDKA 3S99A 4RTNA 3CF6R 1CUDA 2XCQA 4HAYA 2VLIA 1SKYE 4G89A 4QJBA 3ECAA 3AJ9A 3I9NA 3AL2A 5DNWA 4DIUA 2PS9A 4DBVO 3FA2A 1M6EX 1U7ZA 2Q9AA 4KQEA 3REFA 1ST3A 5AM4A 1H4SA 3A1FA 3HVUA 3H4VA 1INLA 1Z6ZA 2VAWA 1H85A 4HVLA 1V9SA 1N2ZA 3CNNA 4O6VA 3T5MA 1AB6A 1B93A 1OASA 1WG8A 2OCLA 1FDSA 3CF4A 3HADA 4FHFA 3CJQA 4P4SB 2C2MA 3MSCA 1SXJD 4W5OA 1D2EA 4CT5A 2P3SA 4TV8F 4F4HA 4I66A 3N74A 1O6BA 4N5HX 5FL7A 2FKAA 1ITZA 3R5TA 1LH0A 3Q9UA 1EB8A 3G0CA 3HUEA 3IQEA 4OUDA 4J7AA 2J7PD 2BGTA 5EIAA 4GXTA 4AUEA 4ZGWA 4ALJA 4KGXA 5ALHA 1XQ1A 3O8QA 2DY0A 4LPSA 4YH1A 1CS0A 1PFKA 1T9BA 1UC8A 1YULA 2R7MA 1REQA 2YWHA 1IXKA 3FNQA 5HF8A 4UCWA 2VA8A 1E8MA 4JZYA 5DNAA 5EMHA 4JI6B 4QEKA 4MVWA 1GGEA 3V4LA 1QB8A 1P44A 3PRHA 4M38A 1X9GA 4FFVA 1O7JA 1TU0A 2PFGA 5ALZA 1XCJA 2NLOA 3PDHA 3U4QB 3IP8A 4ZQIA 1ZL2A 3E9DA 4IV5A 2YCBA 5KTOA 2GMWA 3D7LA 4M9ZA 5FJJA 1TA9A 13PKA 2I6XA 2Y66A 4Z1MD 1ZN9A 3JQGA 3EFOB 3VZDA 4ZK2A 1JDSA 1XCGB 4Q9KA 4HX9A 1U3VA 4FDLA 4HN4B 2NNLD 2FW6A 1XMOB 1WQ4A 4MR8B 1FOEB 1WBJB 3UT5B 3IEVA 3K70B 4UU1A 4WW0A 1UBMS 4PLWA 2QD4A 3FMGA 1NVUQ 2JARA 1RKBA 1USGA 2DTDA 1G18A 2NXNA 1NWCA 2AR9A 3A70A 3HO6A 3INNA 3MS4A 5TQ0B 3ZHOA 5JJ5A 1NJ8A 1PV1A 3Q7IA 4TV9F 4V1CB 4ZOCA 4JSYA 1B8PA 4Z9XA 5LYJB 3L02A 3BXFA 2QQ5A 3NT2A 2GARA 3ZTTA 4HXFB 4P0QB 4WADA 1KO8A 4AJLA 1MDBA 2BFWA 2FUKA 5C1DA 1M8PA 1J8DA 2FHPA 2OFXA 2WP8J 1P0MA 1IRXA 3GZTB 3JYOA 2GN6A 4KGDA 4MV1A 4QATA 3S2YA 3TR0A 2BI4A 3VYWA 4BLVA 1OXXK 1YDFA 3HXKA 3MTEA 3JR7A 1QORA 3UIEA 1PGNA 1Q17A 1CWUA 1KK3A 2XAUA 3AEUB 3P9KA 3R74A 5JQGB 4WKGA 1ZD9A 4MGYR 1N5OX 2X1MA 3M0EA 3KAKA 3AILA 5FB3A 2EW8A 1SC9A 3GEMA 5JJKA 5BN3B 2FSHA 2J3JA 3PFIA 1B23P 4WESB 5IULC 2ZAMA 5CM8B 2CYCA 4J0KA 1E9DA 5IBRA 3HCPA 2B7BA 4YIKA 4XLZA 4BFWA 4BATA 4YJ3A 4CCSA 1CLEA 2P4QA 3N8GA 5KX5B 3G8CA 4AF7A 5F7OA 1NG1A 1LSUA 1XRMA 3LFHA 2H51A 4DABA 2PZAA 4FN5A 1PWXA 3AG5A 4RU1A 1P2GA 2J3HA 5CM9C 3I3SR 2Q29A 2BR5A 4S24A 1N3YA 2D3WA 2WHYA 2BBWA 4JLBA 3BFPA 1MO3A 3N2ZB 3OTHA 4L22A 3W2IA 1O94D 1T9GS 1T36A 1NQUA 4NZOA 3RTAA 2EVWX 2OUIA 3MBKA 4MQLA 4OYHA 4Q47A 4XWTA 4EF4A 4ZD6A 5KNBH 3G9XA 3KQQA 1C0LA 3KUCA 4MNTA 3LX5A 1CZOA 1L1EA 3RIXA 4BBAA 3CJRA 3DE7X 3E35A 2BYTA 1T6XA 2FMFA 1H9AA 2G28A 2PXXA 2WUFA 3H5VA 2DBVO 4MYDA 4PC6A 2D0IA 4RDHA 1JQEA 1KOLA 3WR5A 3ZV7A 2H7YA 3FRIA 3HU1A 3KCNA 1TC1A 4BU1A 4KR0A 3DP9A 2FWRA 2PGJA 2YJZA 4MGHA 3TO5A 4RH3A 2F64A 4JXKA 1CZHA 1X1EA 5ALGA 4B4DA 3B6JA 2FNAA 4F4DA 5CFOA 3THOA 5E3HA 2NTEA 3RASA 4OHUA 5CBPA 1N2JA 3GUYA 4FC7A 3GLTA 4JC4A 4KQGA 3HR8A 5LMCA 2YNMA 2JGJA 2PWPA 2XQJA 4ILKA 4PNPA 4U00A 3V6LA 4HUTA 2E7ZA 4LDNA 3ODPA 4LZPA 1PGPA 1H9BA 2BF4A 3RF7A 3RTGA 1UMBA 4AM8A 4G4JA 1XMQB 4DSAA 4KH1A 5FD8A 3TCNA 3WB0A 2WIGA 3S8YA 1V9CA 5IN5A 3E9EA 3F1KA 3L0BA 4BLSA 4ZN6A 1BXKA 3M3PA 2JPDA 3E15A 1P91A 3FLMA 4CU5A 1GNQA 2FEXA 4L3OA 3WLKX 3CS3A 3WGHA 1CP2A 2RH8A 2E4WA 3EXHA 1FX0A 4H27A 4Q7JB 3UMSA 1RQNA 2Z58A 4YEDA 3Q2IA 1BDMA 4MVJI 2JH8A 1OFIA 1U1IA 3K72B 4TTQA 2XYHA 1ULZA 3A9VA 1L5MA 1P2DA 3OX1A 1F6DA 2JLCA 5DEOA 4F92B 2QY6A 1DOHA 3MTBA 4N9WA 5CXUA 2F00A 2OSVA 3MCVA 4A10A 2P9CA 3BJZA 3B6ZA 4J90A 3I39X 4N3AA 3W2GA 3WBBA 5AK4A 1YHZA 3KZMA 2ZUWA 3CIOA 4Y0AA 4MMXB 1YD7A 3OZVA 4EAQA 2PGAA 1ZGZA 2EF0A 2Q4EA 3DNMA 3A1SA 3IBCA 2IUYA 1ZK2A 3DLAA 1FJHA 4MXDA 5TQJA 4QLBA 4OHMA 2HU8A 2KBFA 3EIEA 3N58A 2D0OB 2L42A 2PYZA 3AF5A 4QDTA 4WIAA 4H6WA 4ND2A 4RY8A 3SLKA 2HQ1A 2XOKA 2REXB 1V16A 1OAOC 1PX2A 3DC2A 3L1KA 2VLBA 3RSHA 2OHGA 3HU5A 3WWCA 5JNLA 3AB7A 1EG7A 4Q16A 4XIGS 3BBLA 4YQZA 3W8DA 1D03A 1G98A 2EGHA 1V5IA 3OAAA 5K99A 1Y3FE 3AONB 3IPAA 3H97A 2ODPA 2HKIA 2DPLA 3B7WA 1OX6A 1T5OA 1BX0A 1T4GA 2D7CA 8ABPA 1AHPA 1TPZA 2X9VA 3SGLA 2AB0A 3F49S 5AHXA 2ET6A 1GL6A 3BZWA 3TIXB 5CYGA 3A7EA 1VFPA 1MJHA 4MCJA 3B1YA 1ISJA 1MJFA 1G8AA 5IXYA 3F73A 3GDOA 1NW6A 1WSBA 421PA 3ZLJA 5A5GA 5ABPA 2ZRLA 5C18A 3PNVA 4WK2B 4ZOLA 3HSSA 3OEHD 5DISB 2GRAA 5REQB 4OCZA 2VPWA 1Z8DA 4FMBB 4YC7A 4FDUA 4Q9LA 9ATCA 3GLFE 1K75A 5A4FS 1C4KA 2P77A 4PIVA 3T5TA 2ZJ1A 4BKMA 4MKGA 1V3UA 1C8KA 3EG9A 5ER6A 1LI5A 1YV9A 4ZT3A 3D0RA 1YA8A 5KAMA 2X8AA 2I6FA 3FFBA 1L7QA 1KEPA 3CEPB 4TVOA 3TQSA 1VBKA 3IEPA 1HOXA 1WHSA 1HUQA 1EDEA 2YY5A 3K5HA 1FYVA 1QQ5A 1SB9A 2W6NA 4JD5A 4MYRA 2XBMA 4YP1A 4I3FA 3V5NA 4WXPA 5HJ2A 1RRPA 3WRWA 2M9MA 5JBQA 1A96A 2HPAA 2C03A 1U1EA 1D2RA 1NQ5A 4BNKA 4E3WA 5BWMA 3CSDA 4JLSA 1UBKS 1UAAA 3A6FA 2CT8A 3ZH2A 1N77A 4GLJA 1ZI9A 1KDOA 4Y6SA 3ETDA 1U2QA 3PIIA 1JPNA 1RWQA 2V9ZA 2EKQA 2WJJA 4LZOA 1YS9A 4MZXA 2HAEA 1FU8A 1M3SA 4RESA 3L6OO 3UFXB 3MLAA 4ARBA 4D3XA 4KPEC 3K9FC 4J9VA 3SBEA 4D0RA 3C70A 5FTWA 3UN1A 5K01A 3KSZO 2WU4A 3TXYA 3V4VB 3IP1A 1X1BA 3PKIA 3PHLA 4KUHA 1IMJA 3ILHA 5GP1A 3UJ3X 4ND7A 3FAKA 1VCMA 2QN9A 3AUFA 4MQMA 1VDMA 5JNTA 3MXOA 1JR4A 1KO1A 4L4RA 1E1QD 2GPJA 4LZNA 1FFSA 4J2TA 2G06A 1RYBA 3NNSA 1L5FA 2YJ6A 3IQXA 4FFSA 2IXEA 2J4CA