2BWUA

Asp271ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGAITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwuA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwuA02
1Y1NA 5D6EA 4U70A 4R60A 4FLKA 3BITA 2BH3A 4IPAA 2V6CA 2BWSA 4PV4A 1A16A 5CNXA 2B3LA 1N51A 3PKDA 2GU7A 4FLIA 1QXYA 2BHBA 3PKAA 5CE6A 3RORA 4U76A 4RZYA 2BB7A 2V3YA 1MATA 3FMRA 2GTXA 2G6PA 1C27A 2NQ6A 4RGZ1 2GU4A 5JI6A 3CTZA 2P99A 5FCFA 1BOAA 3OOOA 1B59A 1XGMA 4FLJA 2P98A 5E5BA 4JUQA 2BHDA 1W7VA 1C22A 4U75A 4FO8A 2Q92A 2GU5A 4PNCA 1W2MA 3L24A 2GGCA 2EA4A 3D27A 4U6ZA 4U71A 3CB5A 3IL0A 5JHUA 1BN5A 1XGOA 1JAWA 3S6BA 3BIQA 1QXZA 2GG5A 2BWWA 1XGSA 3OVKA 2MATA 3QOCA 2ADUA 3PN9A 1O0XA 3I7MA 4U69A 3MX6A 1B6AA 5JFRA 1YW7A 1KP0A 4MATA 3PKEA 4U1BA 2Q93A 3PEBA 1KQ9A 1WL9A 2BHAA 4KM3A 4ZNGA 2Q8KA 2ZSGA 2BWXA 4IU6A 1C23A 5FCHA 3FMQA 1WBQA 5D6FA 1XGNA 3L7GA 1KQ0A 1YVMA 2DFIA 2Q96A 1R5GA 4IKUA 1YW9A 4IF7A 3TAVA 4OOKA 4U73A 2OKNA 4RZZA 3FM3A 5CIKA 2GG3A 1M35A 4U6CA 2GG9A 3BIPA 4IKSA 5CDLA 4A6VA 2GGBA 4FUKA 2GA2A 1R58A 3CB6A 1CHMA 2EVMA 2BWVA 4S00A 3PKCA 2V3XA 4U6WA 2EA2A 2BWYA 4ZWOA 4U6EA 3IU7A 2GG7A 4IDYA 4IKTA 1WL6A 3TB5A 2OAZA 2GG0A 1R5HA 2IW2A 2BHCA 4IKRA 2P9AA 4ZWPA 3MR1A 3O5VA 1WKMA 4U6JA 4EGEA 1YW8A 4FO7A 2Q95A 2NQ7A 5E2CA 1QZYA 3IU8A 1YJ3A 1C21A 1QXWA 4B28A 2Q94A 4QR8A 2EVCA 3Q6DA 2HOWA 4FKCA 1C24A 1WY2A 2GZ5A 4FLLA 4HXXA 3IG4A 5CDVA 3MATA 2BWTA 2B3KA 2B3HA 2GU6A 4IECA 5CLSA 5CDEA 3RVAA 2BN7A 4A6WA 1WLRA 1PV9A 3PKBA 4S2TP 1XNZA 4S2RP 2EVOA 2BWUA 4S01A 3IU9A 4Z7MA 2GG8A 4ZWUA 2V3ZA 1WN1A 2GG2A
chains in the Genus database with same CATH superfamily
1Y1NA 5D6EA 4U70A 4R60A 4FLKA 3BITA 2BH3A 4IPAA 2V6CA 2BWSA 4PV4A 1A16A 5CNXA 2B3LA 1N51A 3PKDA 2GU7A 4FLIA 1QXYA 2BHBA 3PKAA 5CE6A 3RORA 4U76A 4RZYA 2BB7A 2V3YA 1MATA 3FMRA 2GTXA 2G6PA 1C27A 2NQ6A 4RGZ1 2GU4A 5JI6A 3CTZA 2P99A 5FCFA 1BOAA 3OOOA 1B59A 1XGMA 4FLJA 2P98A 5E5BA 4JUQA 2BHDA 1W7VA 1C22A 4U75A 4FO8A 2Q92A 2GU5A 4PNCA 1W2MA 3L24A 2GGCA 2EA4A 3D27A 4U6ZA 4U71A 3CB5A 3IL0A 5JHUA 1BN5A 1XGOA 1JAWA 3S6BA 3BIQA 1QXZA 2GG5A 2BWWA 1XGSA 3OVKA 2MATA 3QOCA 2ADUA 3PN9A 1O0XA 3I7MA 4U69A 3MX6A 1B6AA 5JFRA 1YW7A 1KP0A 4MATA 3PKEA 4U1BA 2Q93A 3PEBA 1KQ9A 1WL9A 2BHAA 4KM3A 4ZNGA 2Q8KA 2ZSGA 2BWXA 4IU6A 1C23A 5FCHA 3FMQA 1WBQA 5D6FA 1XGNA 3L7GA 1KQ0A 1YVMA 2DFIA 2Q96A 1R5GA 4IKUA 1YW9A 4IF7A 3TAVA 4OOKA 4U73A 2OKNA 4RZZA 3FM3A 5CIKA 2GG3A 1M35A 4U6CA 2GG9A 3BIPA 4IKSA 5CDLA 4A6VA 2GGBA 4FUKA 2GA2A 1R58A 3CB6A 1CHMA 2EVMA 2BWVA 4S00A 3PKCA 2V3XA 4U6WA 2EA2A 2BWYA 4ZWOA 4U6EA 3IU7A 2GG7A 4IDYA 4IKTA 1WL6A 3TB5A 2OAZA 2GG0A 1R5HA 2IW2A 2BHCA 4IKRA 2P9AA 4ZWPA 3MR1A 3O5VA 1WKMA 4U6JA 4EGEA 1YW8A 4FO7A 2Q95A 2NQ7A 5E2CA 1QZYA 3IU8A 1YJ3A 1C21A 1QXWA 4B28A 2Q94A 4QR8A 2EVCA 3Q6DA 2HOWA 4FKCA 1C24A 1WY2A 2GZ5A 4FLLA 4HXXA 3IG4A 5CDVA 3MATA 2BWTA 2B3KA 2B3HA 2GU6A 4IECA 5CLSA 5CDEA 3RVAA 2BN7A 4A6WA 1WLRA 1PV9A 3PKBA 4S2TP 1XNZA 4S2RP 2EVOA 2BWUA 4S01A 3IU9A 4Z7MA 2GG8A 4ZWUA 2V3ZA 1WN1A 2GG2A
chains in the Genus database with same CATH topology
1Y1NA 5D6EA 4U70A 4R60A 4FLKA 3BITA 2BH3A 4IPAA 2V6CA 2BWSA 4PV4A 1A16A 5CNXA 2B3LA 1N51A 3PKDA 2GU7A 4FLIA 1QXYA 2BHBA 3PKAA 5CE6A 3RORA 4U76A 4RZYA 2BB7A 2V3YA 1MATA 3FMRA 2GTXA 2G6PA 1C27A 2NQ6A 4RGZ1 2GU4A 5JI6A 3CTZA 2P99A 5FCFA 1BOAA 3OOOA 1B59A 1XGMA 4FLJA 2P98A 5E5BA 4JUQA 2BHDA 1W7VA 1C22A 4U75A 4FO8A 2Q92A 2GU5A 4PNCA 1W2MA 3L24A 2GGCA 2EA4A 3D27A 4U6ZA 4U71A 3CB5A 3IL0A 5JHUA 1BN5A 1XGOA 1JAWA 3S6BA 3BIQA 1QXZA 2GG5A 2BWWA 1XGSA 3OVKA 2MATA 3QOCA 2ADUA 3PN9A 1O0XA 3I7MA 4U69A 3MX6A 1B6AA 5JFRA 1YW7A 1KP0A 4MATA 3PKEA 4U1BA 2Q93A 3PEBA 1KQ9A 1WL9A 2BHAA 4KM3A 4ZNGA 2Q8KA 2ZSGA 2BWXA 4IU6A 1C23A 5FCHA 3FMQA 1WBQA 5D6FA 1XGNA 3L7GA 1KQ0A 1YVMA 2DFIA 2Q96A 1R5GA 4IKUA 1YW9A 4IF7A 3TAVA 4OOKA 4U73A 2OKNA 4RZZA 3FM3A 5CIKA 2GG3A 1M35A 4U6CA 2GG9A 3BIPA 4IKSA 5CDLA 4A6VA 2GGBA 4FUKA 2GA2A 1R58A 3CB6A 1CHMA 2EVMA 2BWVA 4S00A 3PKCA 2V3XA 4U6WA 2EA2A 2BWYA 4ZWOA 4U6EA 3IU7A 2GG7A 4IDYA 4IKTA 1WL6A 3TB5A 2OAZA 2GG0A 1R5HA 2IW2A 2BHCA 4IKRA 2P9AA 4ZWPA 3MR1A 3O5VA 1WKMA 4U6JA 4EGEA 1YW8A 4FO7A 2Q95A 2NQ7A 5E2CA 1QZYA 3IU8A 1YJ3A 1C21A 1QXWA 4B28A 2Q94A 4QR8A 2EVCA 3Q6DA 2HOWA 4FKCA 1C24A 1WY2A 2GZ5A 4FLLA 4HXXA 3IG4A 5CDVA 3MATA 2BWTA 2B3KA 2B3HA 2GU6A 4IECA 5CLSA 5CDEA 3RVAA 2BN7A 4A6WA 1WLRA 1PV9A 3PKBA 4S2TP 1XNZA 4S2RP 2EVOA 2BWUA 4S01A 3IU9A 4Z7MA 2GG8A 4ZWUA 2V3ZA 1WN1A 2GG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1N A;  5D6E A;  4U70 A;  4R60 A;  4FLK A;  3BIT A;  2BH3 A;  4IPA A;  2V6C A;  2BWS A;  4PV4 A;  1A16 A;  5CNX A;  2B3L A;  1N51 A;  3PKD A;  2GU7 A;  4FLI A;  1QXY A;  2BHB A;  3PKA A;  5CE6 A;  3ROR A;  4U76 A;  4RZY A;  2BB7 A;  2V3Y A;  1MAT A;  3FMR A;  2GTX A;  2G6P A;  1C27 A;  2NQ6 A;  4RGZ 1;  2GU4 A;  5JI6 A;  3CTZ A;  2P99 A;  5FCF A;  1BOA A;  3OOO A;  1B59 A;  1XGM A;  4FLJ A;  2P98 A;  5E5B A;  4JUQ A;  2BHD A;  1W7V A;  1C22 A;  4U75 A;  4FO8 A;  2Q92 A;  2GU5 A;  4PNC A;  1W2M A;  3L24 A;  2GGC A;  2EA4 A;  3D27 A;  4U6Z A;  4U71 A;  3CB5 A;  3IL0 A;  5JHU A;  1BN5 A;  1XGO A;  1JAW A;  3S6B A;  3BIQ A;  1QXZ A;  2GG5 A;  2BWW A;  1XGS A;  3OVK A;  2MAT A;  3QOC A;  2ADU A;  3PN9 A;  1O0X A;  3I7M A;  4U69 A;  3MX6 A;  1B6A A;  5JFR A;  1YW7 A;  1KP0 A;  4MAT A;  3PKE A;  4U1B A;  2Q93 A;  3PEB A;  1KQ9 A;  1WL9 A;  2BHA A;  4KM3 A;  4ZNG A;  2Q8K A;  2ZSG A;  2BWX A;  4IU6 A;  1C23 A;  5FCH A;  3FMQ A;  1WBQ A;  5D6F A;  1XGN A;  3L7G A;  1KQ0 A;  1YVM A;  2DFI A;  2Q96 A;  1R5G A;  4IKU A;  1YW9 A;  4IF7 A;  3TAV A;  4OOK A;  4U73 A;  2OKN A;  4RZZ A;  3FM3 A;  5CIK A;  2GG3 A;  1M35 A;  4U6C A;  2GG9 A;  3BIP A;  4IKS A;  5CDL A;  4A6V A;  2GGB A;  4FUK A;  2GA2 A;  1R58 A;  3CB6 A;  1CHM A;  2EVM A;  2BWV A;  4S00 A;  3PKC A;  2V3X A;  4U6W A;  2EA2 A;  2BWY A;  4ZWO A;  4U6E A;  3IU7 A;  2GG7 A;  4IDY A;  4IKT A;  1WL6 A;  3TB5 A;  2OAZ A;  2GG0 A;  1R5H A;  2IW2 A;  2BHC A;  4IKR A;  2P9A A;  4ZWP A;  3MR1 A;  3O5V A;  1WKM A;  4U6J A;  4EGE A;  1YW8 A;  4FO7 A;  2Q95 A;  2NQ7 A;  5E2C A;  1QZY A;  3IU8 A;  1YJ3 A;  1C21 A;  1QXW A;  4B28 A;  2Q94 A;  4QR8 A;  2EVC A;  3Q6D A;  2HOW A;  4FKC A;  1C24 A;  1WY2 A;  2GZ5 A;  4FLL A;  4HXX A;  3IG4 A;  5CDV A;  3MAT A;  2BWT A;  2B3K A;  2B3H A;  2GU6 A;  4IEC A;  5CLS A;  5CDE A;  3RVA A;  2BN7 A;  4A6W A;  1WLR A;  1PV9 A;  3PKB A;  4S2T P;  1XNZ A;  4S2R P;  2EVO A;  2BWU A;  4S01 A;  3IU9 A;  4Z7M A;  2GG8 A;  4ZWU A;  2V3Z A;  1WN1 A;  2GG2 A; 
#chains in the Genus database with same CATH topology
 1Y1N A;  5D6E A;  4U70 A;  4R60 A;  4FLK A;  3BIT A;  2BH3 A;  4IPA A;  2V6C A;  2BWS A;  4PV4 A;  1A16 A;  5CNX A;  2B3L A;  1N51 A;  3PKD A;  2GU7 A;  4FLI A;  1QXY A;  2BHB A;  3PKA A;  5CE6 A;  3ROR A;  4U76 A;  4RZY A;  2BB7 A;  2V3Y A;  1MAT A;  3FMR A;  2GTX A;  2G6P A;  1C27 A;  2NQ6 A;  4RGZ 1;  2GU4 A;  5JI6 A;  3CTZ A;  2P99 A;  5FCF A;  1BOA A;  3OOO A;  1B59 A;  1XGM A;  4FLJ A;  2P98 A;  5E5B A;  4JUQ A;  2BHD A;  1W7V A;  1C22 A;  4U75 A;  4FO8 A;  2Q92 A;  2GU5 A;  4PNC A;  1W2M A;  3L24 A;  2GGC A;  2EA4 A;  3D27 A;  4U6Z A;  4U71 A;  3CB5 A;  3IL0 A;  5JHU A;  1BN5 A;  1XGO A;  1JAW A;  3S6B A;  3BIQ A;  1QXZ A;  2GG5 A;  2BWW A;  1XGS A;  3OVK A;  2MAT A;  3QOC A;  2ADU A;  3PN9 A;  1O0X A;  3I7M A;  4U69 A;  3MX6 A;  1B6A A;  5JFR A;  1YW7 A;  1KP0 A;  4MAT A;  3PKE A;  4U1B A;  2Q93 A;  3PEB A;  1KQ9 A;  1WL9 A;  2BHA A;  4KM3 A;  4ZNG A;  2Q8K A;  2ZSG A;  2BWX A;  4IU6 A;  1C23 A;  5FCH A;  3FMQ A;  1WBQ A;  5D6F A;  1XGN A;  3L7G A;  1KQ0 A;  1YVM A;  2DFI A;  2Q96 A;  1R5G A;  4IKU A;  1YW9 A;  4IF7 A;  3TAV A;  4OOK A;  4U73 A;  2OKN A;  4RZZ A;  3FM3 A;  5CIK A;  2GG3 A;  1M35 A;  4U6C A;  2GG9 A;  3BIP A;  4IKS A;  5CDL A;  4A6V A;  2GGB A;  4FUK A;  2GA2 A;  1R58 A;  3CB6 A;  1CHM A;  2EVM A;  2BWV A;  4S00 A;  3PKC A;  2V3X A;  4U6W A;  2EA2 A;  2BWY A;  4ZWO A;  4U6E A;  3IU7 A;  2GG7 A;  4IDY A;  4IKT A;  1WL6 A;  3TB5 A;  2OAZ A;  2GG0 A;  1R5H A;  2IW2 A;  2BHC A;  4IKR A;  2P9A A;  4ZWP A;  3MR1 A;  3O5V A;  1WKM A;  4U6J A;  4EGE A;  1YW8 A;  4FO7 A;  2Q95 A;  2NQ7 A;  5E2C A;  1QZY A;  3IU8 A;  1YJ3 A;  1C21 A;  1QXW A;  4B28 A;  2Q94 A;  4QR8 A;  2EVC A;  3Q6D A;  2HOW A;  4FKC A;  1C24 A;  1WY2 A;  2GZ5 A;  4FLL A;  4HXX A;  3IG4 A;  5CDV A;  3MAT A;  2BWT A;  2B3K A;  2B3H A;  2GU6 A;  4IEC A;  5CLS A;  5CDE A;  3RVA A;  2BN7 A;  4A6W A;  1WLR A;  1PV9 A;  3PKB A;  4S2T P;  1XNZ A;  4S2R P;  2EVO A;  2BWU A;  4S01 A;  3IU9 A;  4Z7M A;  2GG8 A;  4ZWU A;  2V3Z A;  1WN1 A;  2GG2 A; 
#chains in the Genus database with same CATH homology
 1Y1N A;  5D6E A;  4U70 A;  4R60 A;  4FLK A;  3BIT A;  2BH3 A;  4IPA A;  2V6C A;  2BWS A;  4PV4 A;  1A16 A;  5CNX A;  2B3L A;  1N51 A;  3PKD A;  2GU7 A;  4FLI A;  1QXY A;  2BHB A;  3PKA A;  5CE6 A;  3ROR A;  4U76 A;  4RZY A;  2BB7 A;  2V3Y A;  1MAT A;  3FMR A;  2GTX A;  2G6P A;  1C27 A;  2NQ6 A;  4RGZ 1;  2GU4 A;  5JI6 A;  3CTZ A;  2P99 A;  5FCF A;  1BOA A;  3OOO A;  1B59 A;  1XGM A;  4FLJ A;  2P98 A;  5E5B A;  4JUQ A;  2BHD A;  1W7V A;  1C22 A;  4U75 A;  4FO8 A;  2Q92 A;  2GU5 A;  4PNC A;  1W2M A;  3L24 A;  2GGC A;  2EA4 A;  3D27 A;  4U6Z A;  4U71 A;  3CB5 A;  3IL0 A;  5JHU A;  1BN5 A;  1XGO A;  1JAW A;  3S6B A;  3BIQ A;  1QXZ A;  2GG5 A;  2BWW A;  1XGS A;  3OVK A;  2MAT A;  3QOC A;  2ADU A;  3PN9 A;  1O0X A;  3I7M A;  4U69 A;  3MX6 A;  1B6A A;  5JFR A;  1YW7 A;  1KP0 A;  4MAT A;  3PKE A;  4U1B A;  2Q93 A;  3PEB A;  1KQ9 A;  1WL9 A;  2BHA A;  4KM3 A;  4ZNG A;  2Q8K A;  2ZSG A;  2BWX A;  4IU6 A;  1C23 A;  5FCH A;  3FMQ A;  1WBQ A;  5D6F A;  1XGN A;  3L7G A;  1KQ0 A;  1YVM A;  2DFI A;  2Q96 A;  1R5G A;  4IKU A;  1YW9 A;  4IF7 A;  3TAV A;  4OOK A;  4U73 A;  2OKN A;  4RZZ A;  3FM3 A;  5CIK A;  2GG3 A;  1M35 A;  4U6C A;  2GG9 A;  3BIP A;  4IKS A;  5CDL A;  4A6V A;  2GGB A;  4FUK A;  2GA2 A;  1R58 A;  3CB6 A;  1CHM A;  2EVM A;  2BWV A;  4S00 A;  3PKC A;  2V3X A;  4U6W A;  2EA2 A;  2BWY A;  4ZWO A;  4U6E A;  3IU7 A;  2GG7 A;  4IDY A;  4IKT A;  1WL6 A;  3TB5 A;  2OAZ A;  2GG0 A;  1R5H A;  2IW2 A;  2BHC A;  4IKR A;  2P9A A;  4ZWP A;  3MR1 A;  3O5V A;  1WKM A;  4U6J A;  4EGE A;  1YW8 A;  4FO7 A;  2Q95 A;  2NQ7 A;  5E2C A;  1QZY A;  3IU8 A;  1YJ3 A;  1C21 A;  1QXW A;  4B28 A;  2Q94 A;  4QR8 A;  2EVC A;  3Q6D A;  2HOW A;  4FKC A;  1C24 A;  1WY2 A;  2GZ5 A;  4FLL A;  4HXX A;  3IG4 A;  5CDV A;  3MAT A;  2BWT A;  2B3K A;  2B3H A;  2GU6 A;  4IEC A;  5CLS A;  5CDE A;  3RVA A;  2BN7 A;  4A6W A;  1WLR A;  1PV9 A;  3PKB A;  4S2T P;  1XNZ A;  4S2R P;  2EVO A;  2BWU A;  4S01 A;  3IU9 A;  4Z7M A;  2GG8 A;  4ZWU A;  2V3Z A;  1WN1 A;  2GG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...