2BWUA

Asp271ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGAITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwuA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwuA02
5D6EA 2DFIA 4RZZA 2B3KA 3BIQA 4Z7MA 4ZNGA 5FCHA 1BN5A 2Q93A 2BWSA 1JAWA 1QXYA 1CHMA 1KP0A 2G6PA 1W2MA 1QXZA 2BWTA 3O5VA 1O0XA 3FM3A 3IU8A 4S01A 4IPAA 3IL0A 1MATA 4U6EA 5JI6A 1YW9A 1KQ9A 2GG8A 1WKMA 1QZYA 3D27A 1A16A 3PN9A 4FLKA 2BWUA 4EGEA 1C21A 5CE6A 2V6CA 4U73A 3RORA 4FO7A 4IF7A 4JUQA 4ZWOA 3S6BA 2GU4A 4U70A 5CIKA 2GZ5A 3I7MA 1B6AA 2V3YA 4B28A 1BOAA 2B3HA 4IECA 2ZSGA 1R5GA 2NQ6A 1WN1A 5JFRA 4S2TP 2GA2A 2GU6A 3L24A 2GU7A 2BHBA 4FUKA 2V3ZA 4FO8A 2P98A 2V3XA 1R5HA 1WY2A 2P99A 3QOCA 3Q6DA 1WL6A 2BHDA 2ADUA 4U6WA 1QXWA 2GU5A 4S00A 2EA4A 4KM3A 4ZWUA 1C22A 4RGZ1 4IKRA 4ZWPA 3BIPA 4IDYA 2OKNA 3IU9A 4S2RP 3OVKA 2MATA 2GGBA 1XGNA 2BN7A 5CDLA 3PEBA 3FMQA 4HXXA 4RZYA 2P9AA 2BWYA 2B3LA 1KQ0A 4IKTA 5FCFA 1WLRA 4U6JA 3IU7A 2Q95A 2BWXA 3PKCA 1PV9A 3CB6A 4R60A 1XGSA 3MR1A 5CDVA 4OOKA 4U69A 2BHCA 3PKEA 3CTZA 2BHAA 4U75A 5E5BA 5D6FA 2GG2A 1C24A 1R58A 3IG4A 5E2CA 5CDEA 5CLSA 1W7VA 4U76A 1YJ3A 4PNCA 3TAVA 2BWVA 2IW2A 4FLLA 4FKCA 4U6CA 4IU6A 3FMRA 3RVAA 2GG3A 2GG7A 4FLJA 1B59A 3CB5A 4U1BA 1XGMA 4MATA 1Y1NA 2GG0A 4U71A 1XNZA 2OAZA 2Q8KA 2Q92A 1YW7A 4FLIA 2Q94A 2GTXA 2BH3A 1YVMA 2GG5A 2GG9A 5CNXA 2EVCA 3PKBA 4IKSA 1XGOA 3BITA 3PKAA 1M35A 4PV4A 1YW8A 2EVMA 1WL9A 2GGCA 4QR8A 1WBQA 5JHUA 2BWWA 2NQ7A 1N51A 3TB5A 3PKDA 4U6ZA 3L7GA 2EA2A 1C23A 2BB7A 1C27A 2EVOA 3MATA 2Q96A 4A6WA 3MX6A 2HOWA 4IKUA 4A6VA 3OOOA
chains in the Genus database with same CATH superfamily
5D6EA 2DFIA 4RZZA 2B3KA 3BIQA 4Z7MA 4ZNGA 5FCHA 1BN5A 2Q93A 2BWSA 1JAWA 1QXYA 1CHMA 1KP0A 2G6PA 1W2MA 1QXZA 2BWTA 3O5VA 1O0XA 3FM3A 3IU8A 4S01A 4IPAA 3IL0A 1MATA 4U6EA 5JI6A 1YW9A 1KQ9A 2GG8A 1WKMA 1QZYA 3D27A 1A16A 3PN9A 4FLKA 2BWUA 4EGEA 1C21A 5CE6A 2V6CA 4U73A 3RORA 4FO7A 4IF7A 4JUQA 4ZWOA 3S6BA 2GU4A 4U70A 5CIKA 2GZ5A 3I7MA 1B6AA 2V3YA 4B28A 1BOAA 2B3HA 4IECA 2ZSGA 1R5GA 2NQ6A 1WN1A 5JFRA 4S2TP 2GA2A 2GU6A 3L24A 2GU7A 2BHBA 4FUKA 2V3ZA 4FO8A 2P98A 2V3XA 1R5HA 1WY2A 2P99A 3QOCA 3Q6DA 1WL6A 2BHDA 2ADUA 4U6WA 1QXWA 2GU5A 4S00A 2EA4A 4KM3A 4ZWUA 1C22A 4RGZ1 4IKRA 4ZWPA 3BIPA 4IDYA 2OKNA 3IU9A 4S2RP 3OVKA 2MATA 2GGBA 1XGNA 2BN7A 5CDLA 3PEBA 3FMQA 4HXXA 4RZYA 2P9AA 2BWYA 2B3LA 1KQ0A 4IKTA 5FCFA 1WLRA 4U6JA 3IU7A 2Q95A 2BWXA 3PKCA 1PV9A 3CB6A 4R60A 1XGSA 3MR1A 5CDVA 4OOKA 4U69A 2BHCA 3PKEA 3CTZA 2BHAA 4U75A 5E5BA 5D6FA 2GG2A 1C24A 1R58A 3IG4A 5E2CA 5CDEA 5CLSA 1W7VA 4U76A 1YJ3A 4PNCA 3TAVA 2BWVA 2IW2A 4FLLA 4FKCA 4U6CA 4IU6A 3FMRA 3RVAA 2GG3A 2GG7A 4FLJA 1B59A 3CB5A 4U1BA 1XGMA 4MATA 1Y1NA 2GG0A 4U71A 1XNZA 2OAZA 2Q8KA 2Q92A 1YW7A 4FLIA 2Q94A 2GTXA 2BH3A 1YVMA 2GG5A 2GG9A 5CNXA 2EVCA 3PKBA 4IKSA 1XGOA 3BITA 3PKAA 1M35A 4PV4A 1YW8A 2EVMA 1WL9A 2GGCA 4QR8A 1WBQA 5JHUA 2BWWA 2NQ7A 1N51A 3TB5A 3PKDA 4U6ZA 3L7GA 2EA2A 1C23A 2BB7A 1C27A 2EVOA 3MATA 2Q96A 4A6WA 3MX6A 2HOWA 4IKUA 4A6VA 3OOOA
chains in the Genus database with same CATH topology
5D6EA 2DFIA 4RZZA 2B3KA 3BIQA 4Z7MA 4ZNGA 5FCHA 1BN5A 2Q93A 2BWSA 1JAWA 1QXYA 1CHMA 1KP0A 2G6PA 1W2MA 1QXZA 2BWTA 3O5VA 1O0XA 3FM3A 3IU8A 4S01A 4IPAA 3IL0A 1MATA 4U6EA 5JI6A 1YW9A 1KQ9A 2GG8A 1WKMA 1QZYA 3D27A 1A16A 3PN9A 4FLKA 2BWUA 4EGEA 1C21A 5CE6A 2V6CA 4U73A 3RORA 4FO7A 4IF7A 4JUQA 4ZWOA 3S6BA 2GU4A 4U70A 5CIKA 2GZ5A 3I7MA 1B6AA 2V3YA 4B28A 1BOAA 2B3HA 4IECA 2ZSGA 1R5GA 2NQ6A 1WN1A 5JFRA 4S2TP 2GA2A 2GU6A 3L24A 2GU7A 2BHBA 4FUKA 2V3ZA 4FO8A 2P98A 2V3XA 1R5HA 1WY2A 2P99A 3QOCA 3Q6DA 1WL6A 2BHDA 2ADUA 4U6WA 1QXWA 2GU5A 4S00A 2EA4A 4KM3A 4ZWUA 1C22A 4RGZ1 4IKRA 4ZWPA 3BIPA 4IDYA 2OKNA 3IU9A 4S2RP 3OVKA 2MATA 2GGBA 1XGNA 2BN7A 5CDLA 3PEBA 3FMQA 4HXXA 4RZYA 2P9AA 2BWYA 2B3LA 1KQ0A 4IKTA 5FCFA 1WLRA 4U6JA 3IU7A 2Q95A 2BWXA 3PKCA 1PV9A 3CB6A 4R60A 1XGSA 3MR1A 5CDVA 4OOKA 4U69A 2BHCA 3PKEA 3CTZA 2BHAA 4U75A 5E5BA 5D6FA 2GG2A 1C24A 1R58A 3IG4A 5E2CA 5CDEA 5CLSA 1W7VA 4U76A 1YJ3A 4PNCA 3TAVA 2BWVA 2IW2A 4FLLA 4FKCA 4U6CA 4IU6A 3FMRA 3RVAA 2GG3A 2GG7A 4FLJA 1B59A 3CB5A 4U1BA 1XGMA 4MATA 1Y1NA 2GG0A 4U71A 1XNZA 2OAZA 2Q8KA 2Q92A 1YW7A 4FLIA 2Q94A 2GTXA 2BH3A 1YVMA 2GG5A 2GG9A 5CNXA 2EVCA 3PKBA 4IKSA 1XGOA 3BITA 3PKAA 1M35A 4PV4A 1YW8A 2EVMA 1WL9A 2GGCA 4QR8A 1WBQA 5JHUA 2BWWA 2NQ7A 1N51A 3TB5A 3PKDA 4U6ZA 3L7GA 2EA2A 1C23A 2BB7A 1C27A 2EVOA 3MATA 2Q96A 4A6WA 3MX6A 2HOWA 4IKUA 4A6VA 3OOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6E A;  2DFI A;  4RZZ A;  2B3K A;  3BIQ A;  4Z7M A;  4ZNG A;  5FCH A;  1BN5 A;  2Q93 A;  2BWS A;  1JAW A;  1QXY A;  1CHM A;  1KP0 A;  2G6P A;  1W2M A;  1QXZ A;  2BWT A;  3O5V A;  1O0X A;  3FM3 A;  3IU8 A;  4S01 A;  4IPA A;  3IL0 A;  1MAT A;  4U6E A;  5JI6 A;  1YW9 A;  1KQ9 A;  2GG8 A;  1WKM A;  1QZY A;  3D27 A;  1A16 A;  3PN9 A;  4FLK A;  2BWU A;  4EGE A;  1C21 A;  5CE6 A;  2V6C A;  4U73 A;  3ROR A;  4FO7 A;  4IF7 A;  4JUQ A;  4ZWO A;  3S6B A;  2GU4 A;  4U70 A;  5CIK A;  2GZ5 A;  3I7M A;  1B6A A;  2V3Y A;  4B28 A;  1BOA A;  2B3H A;  4IEC A;  2ZSG A;  1R5G A;  2NQ6 A;  1WN1 A;  5JFR A;  4S2T P;  2GA2 A;  2GU6 A;  3L24 A;  2GU7 A;  2BHB A;  4FUK A;  2V3Z A;  4FO8 A;  2P98 A;  2V3X A;  1R5H A;  1WY2 A;  2P99 A;  3QOC A;  3Q6D A;  1WL6 A;  2BHD A;  2ADU A;  4U6W A;  1QXW A;  2GU5 A;  4S00 A;  2EA4 A;  4KM3 A;  4ZWU A;  1C22 A;  4RGZ 1;  4IKR A;  4ZWP A;  3BIP A;  4IDY A;  2OKN A;  3IU9 A;  4S2R P;  3OVK A;  2MAT A;  2GGB A;  1XGN A;  2BN7 A;  5CDL A;  3PEB A;  3FMQ A;  4HXX A;  4RZY A;  2P9A A;  2BWY A;  2B3L A;  1KQ0 A;  4IKT A;  5FCF A;  1WLR A;  4U6J A;  3IU7 A;  2Q95 A;  2BWX A;  3PKC A;  1PV9 A;  3CB6 A;  4R60 A;  1XGS A;  3MR1 A;  5CDV A;  4OOK A;  4U69 A;  2BHC A;  3PKE A;  3CTZ A;  2BHA A;  4U75 A;  5E5B A;  5D6F A;  2GG2 A;  1C24 A;  1R58 A;  3IG4 A;  5E2C A;  5CDE A;  5CLS A;  1W7V A;  4U76 A;  1YJ3 A;  4PNC A;  3TAV A;  2BWV A;  2IW2 A;  4FLL A;  4FKC A;  4U6C A;  4IU6 A;  3FMR A;  3RVA A;  2GG3 A;  2GG7 A;  4FLJ A;  1B59 A;  3CB5 A;  4U1B A;  1XGM A;  4MAT A;  1Y1N A;  2GG0 A;  4U71 A;  1XNZ A;  2OAZ A;  2Q8K A;  2Q92 A;  1YW7 A;  4FLI A;  2Q94 A;  2GTX A;  2BH3 A;  1YVM A;  2GG5 A;  2GG9 A;  5CNX A;  2EVC A;  3PKB A;  4IKS A;  1XGO A;  3BIT A;  3PKA A;  1M35 A;  4PV4 A;  1YW8 A;  2EVM A;  1WL9 A;  2GGC A;  4QR8 A;  1WBQ A;  5JHU A;  2BWW A;  2NQ7 A;  1N51 A;  3TB5 A;  3PKD A;  4U6Z A;  3L7G A;  2EA2 A;  1C23 A;  2BB7 A;  1C27 A;  2EVO A;  3MAT A;  2Q96 A;  4A6W A;  3MX6 A;  2HOW A;  4IKU A;  4A6V A;  3OOO A; 
#chains in the Genus database with same CATH topology
 5D6E A;  2DFI A;  4RZZ A;  2B3K A;  3BIQ A;  4Z7M A;  4ZNG A;  5FCH A;  1BN5 A;  2Q93 A;  2BWS A;  1JAW A;  1QXY A;  1CHM A;  1KP0 A;  2G6P A;  1W2M A;  1QXZ A;  2BWT A;  3O5V A;  1O0X A;  3FM3 A;  3IU8 A;  4S01 A;  4IPA A;  3IL0 A;  1MAT A;  4U6E A;  5JI6 A;  1YW9 A;  1KQ9 A;  2GG8 A;  1WKM A;  1QZY A;  3D27 A;  1A16 A;  3PN9 A;  4FLK A;  2BWU A;  4EGE A;  1C21 A;  5CE6 A;  2V6C A;  4U73 A;  3ROR A;  4FO7 A;  4IF7 A;  4JUQ A;  4ZWO A;  3S6B A;  2GU4 A;  4U70 A;  5CIK A;  2GZ5 A;  3I7M A;  1B6A A;  2V3Y A;  4B28 A;  1BOA A;  2B3H A;  4IEC A;  2ZSG A;  1R5G A;  2NQ6 A;  1WN1 A;  5JFR A;  4S2T P;  2GA2 A;  2GU6 A;  3L24 A;  2GU7 A;  2BHB A;  4FUK A;  2V3Z A;  4FO8 A;  2P98 A;  2V3X A;  1R5H A;  1WY2 A;  2P99 A;  3QOC A;  3Q6D A;  1WL6 A;  2BHD A;  2ADU A;  4U6W A;  1QXW A;  2GU5 A;  4S00 A;  2EA4 A;  4KM3 A;  4ZWU A;  1C22 A;  4RGZ 1;  4IKR A;  4ZWP A;  3BIP A;  4IDY A;  2OKN A;  3IU9 A;  4S2R P;  3OVK A;  2MAT A;  2GGB A;  1XGN A;  2BN7 A;  5CDL A;  3PEB A;  3FMQ A;  4HXX A;  4RZY A;  2P9A A;  2BWY A;  2B3L A;  1KQ0 A;  4IKT A;  5FCF A;  1WLR A;  4U6J A;  3IU7 A;  2Q95 A;  2BWX A;  3PKC A;  1PV9 A;  3CB6 A;  4R60 A;  1XGS A;  3MR1 A;  5CDV A;  4OOK A;  4U69 A;  2BHC A;  3PKE A;  3CTZ A;  2BHA A;  4U75 A;  5E5B A;  5D6F A;  2GG2 A;  1C24 A;  1R58 A;  3IG4 A;  5E2C A;  5CDE A;  5CLS A;  1W7V A;  4U76 A;  1YJ3 A;  4PNC A;  3TAV A;  2BWV A;  2IW2 A;  4FLL A;  4FKC A;  4U6C A;  4IU6 A;  3FMR A;  3RVA A;  2GG3 A;  2GG7 A;  4FLJ A;  1B59 A;  3CB5 A;  4U1B A;  1XGM A;  4MAT A;  1Y1N A;  2GG0 A;  4U71 A;  1XNZ A;  2OAZ A;  2Q8K A;  2Q92 A;  1YW7 A;  4FLI A;  2Q94 A;  2GTX A;  2BH3 A;  1YVM A;  2GG5 A;  2GG9 A;  5CNX A;  2EVC A;  3PKB A;  4IKS A;  1XGO A;  3BIT A;  3PKA A;  1M35 A;  4PV4 A;  1YW8 A;  2EVM A;  1WL9 A;  2GGC A;  4QR8 A;  1WBQ A;  5JHU A;  2BWW A;  2NQ7 A;  1N51 A;  3TB5 A;  3PKD A;  4U6Z A;  3L7G A;  2EA2 A;  1C23 A;  2BB7 A;  1C27 A;  2EVO A;  3MAT A;  2Q96 A;  4A6W A;  3MX6 A;  2HOW A;  4IKU A;  4A6V A;  3OOO A; 
#chains in the Genus database with same CATH homology
 5D6E A;  2DFI A;  4RZZ A;  2B3K A;  3BIQ A;  4Z7M A;  4ZNG A;  5FCH A;  1BN5 A;  2Q93 A;  2BWS A;  1JAW A;  1QXY A;  1CHM A;  1KP0 A;  2G6P A;  1W2M A;  1QXZ A;  2BWT A;  3O5V A;  1O0X A;  3FM3 A;  3IU8 A;  4S01 A;  4IPA A;  3IL0 A;  1MAT A;  4U6E A;  5JI6 A;  1YW9 A;  1KQ9 A;  2GG8 A;  1WKM A;  1QZY A;  3D27 A;  1A16 A;  3PN9 A;  4FLK A;  2BWU A;  4EGE A;  1C21 A;  5CE6 A;  2V6C A;  4U73 A;  3ROR A;  4FO7 A;  4IF7 A;  4JUQ A;  4ZWO A;  3S6B A;  2GU4 A;  4U70 A;  5CIK A;  2GZ5 A;  3I7M A;  1B6A A;  2V3Y A;  4B28 A;  1BOA A;  2B3H A;  4IEC A;  2ZSG A;  1R5G A;  2NQ6 A;  1WN1 A;  5JFR A;  4S2T P;  2GA2 A;  2GU6 A;  3L24 A;  2GU7 A;  2BHB A;  4FUK A;  2V3Z A;  4FO8 A;  2P98 A;  2V3X A;  1R5H A;  1WY2 A;  2P99 A;  3QOC A;  3Q6D A;  1WL6 A;  2BHD A;  2ADU A;  4U6W A;  1QXW A;  2GU5 A;  4S00 A;  2EA4 A;  4KM3 A;  4ZWU A;  1C22 A;  4RGZ 1;  4IKR A;  4ZWP A;  3BIP A;  4IDY A;  2OKN A;  3IU9 A;  4S2R P;  3OVK A;  2MAT A;  2GGB A;  1XGN A;  2BN7 A;  5CDL A;  3PEB A;  3FMQ A;  4HXX A;  4RZY A;  2P9A A;  2BWY A;  2B3L A;  1KQ0 A;  4IKT A;  5FCF A;  1WLR A;  4U6J A;  3IU7 A;  2Q95 A;  2BWX A;  3PKC A;  1PV9 A;  3CB6 A;  4R60 A;  1XGS A;  3MR1 A;  5CDV A;  4OOK A;  4U69 A;  2BHC A;  3PKE A;  3CTZ A;  2BHA A;  4U75 A;  5E5B A;  5D6F A;  2GG2 A;  1C24 A;  1R58 A;  3IG4 A;  5E2C A;  5CDE A;  5CLS A;  1W7V A;  4U76 A;  1YJ3 A;  4PNC A;  3TAV A;  2BWV A;  2IW2 A;  4FLL A;  4FKC A;  4U6C A;  4IU6 A;  3FMR A;  3RVA A;  2GG3 A;  2GG7 A;  4FLJ A;  1B59 A;  3CB5 A;  4U1B A;  1XGM A;  4MAT A;  1Y1N A;  2GG0 A;  4U71 A;  1XNZ A;  2OAZ A;  2Q8K A;  2Q92 A;  1YW7 A;  4FLI A;  2Q94 A;  2GTX A;  2BH3 A;  1YVM A;  2GG5 A;  2GG9 A;  5CNX A;  2EVC A;  3PKB A;  4IKS A;  1XGO A;  3BIT A;  3PKA A;  1M35 A;  4PV4 A;  1YW8 A;  2EVM A;  1WL9 A;  2GGC A;  4QR8 A;  1WBQ A;  5JHU A;  2BWW A;  2NQ7 A;  1N51 A;  3TB5 A;  3PKD A;  4U6Z A;  3L7G A;  2EA2 A;  1C23 A;  2BB7 A;  1C27 A;  2EVO A;  3MAT A;  2Q96 A;  4A6W A;  3MX6 A;  2HOW A;  4IKU A;  4A6V A;  3OOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...