2BWUA

Asp271ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGAITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwuA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwuA02
2BN7A 4RZYA 3FMQA 2V3XA 1O0XA 1YW9A 2OAZA 4IKRA 2P9AA 5D6EA 2EVCA 4ZWUA 4HXXA 3OVKA 5CDVA 2BHCA 3MATA 4PNCA 3IU9A 2BWVA 2GG0A 2GU7A 5CDLA 2B3KA 4U71A 2BHAA 1JAWA 4IKSA 2BHBA 5CIKA 1MATA 1C21A 1XNZA 3RORA 4Z7MA 1CHMA 2GTXA 2BWYA 1C27A 1WL9A 1C24A 3IG4A 2BWSA 1YVMA 3I7MA 1M35A 2GG7A 2BHDA 2MATA 2Q8KA 3BIPA 1BN5A 5E2CA 5JFRA 2Q93A 3BITA 3IL0A 4U76A 3PEBA 1W2MA 4R60A 1KQ0A 1YJ3A 1W7VA 1QXWA 3FM3A 4U75A 1R5HA 4S2RP 5FCFA 4FLJA 1KQ9A 2BWUA 1WN1A 2BWTA 2OKNA 1WKMA 1XGSA 2GG2A 4IDYA 5CLSA 3IU7A 5CDEA 4IECA 4IU6A 5CNXA 1QZYA 2V3ZA 5D6FA 1YW8A 3FMRA 2EVMA 3L7GA 2Q92A 2GGBA 1QXYA 1PV9A 2GZ5A 1QXZA 1XGMA 4ZWPA 2ZSGA 2G6PA 1N51A 2P99A 4U70A 1BOAA 4U6JA 3PKDA 2BWXA 5E5BA 1XGNA 4EGEA 2EA2A 4RGZ1 2GU5A 3PKBA 3O5VA 4PV4A 2DFIA 2Q94A 3RVAA 1C23A 3MR1A 5JHUA 2BH3A 4FKCA 4U6WA 1WLRA 2V3YA 4KM3A 2BB7A 4FUKA 1B6AA 4S2TP 4U73A 4IKTA 2V6CA 3CTZA 3Q6DA 1R5GA 2GU4A 3TAVA 3S6BA 4RZZA 2GU6A 2GA2A 3PKCA 1KP0A 1WL6A 3MX6A 4U1BA 4IKUA 3CB6A 2GG5A 4B28A 3QOCA 4MATA 3CB5A 4S00A 4FLKA 2Q95A 4FLIA 2BWWA 2EA4A 3IU8A 4OOKA 3D27A 3OOOA 2HOWA 2GG9A 1C22A 4U6EA 2NQ7A 4S01A 2IW2A 5JI6A 4ZWOA 1YW7A 2EVOA 2GG3A 4IPAA 1B59A 1A16A 2B3HA 3PN9A 4ZNGA 1XGOA 2GG8A 2P98A 1WY2A 4A6WA 4JUQA 4FO8A 3PKAA 3TB5A 4U6CA 4U6ZA 2ADUA 2B3LA 4FO7A 3BIQA 2NQ6A 3PKEA 3L24A 1Y1NA 2GGCA 1WBQA 4QR8A 2Q96A 5CE6A 4FLLA 1R58A 5FCHA 4U69A 4A6VA 4IF7A
chains in the Genus database with same CATH superfamily
2BN7A 4RZYA 3FMQA 2V3XA 1O0XA 1YW9A 2OAZA 4IKRA 2P9AA 5D6EA 2EVCA 4ZWUA 4HXXA 3OVKA 5CDVA 2BHCA 3MATA 4PNCA 3IU9A 2BWVA 2GG0A 2GU7A 5CDLA 2B3KA 4U71A 2BHAA 1JAWA 4IKSA 2BHBA 5CIKA 1MATA 1C21A 1XNZA 3RORA 4Z7MA 1CHMA 2GTXA 2BWYA 1C27A 1WL9A 1C24A 3IG4A 2BWSA 1YVMA 3I7MA 1M35A 2GG7A 2BHDA 2MATA 2Q8KA 3BIPA 1BN5A 5E2CA 5JFRA 2Q93A 3BITA 3IL0A 4U76A 3PEBA 1W2MA 4R60A 1KQ0A 1YJ3A 1W7VA 1QXWA 3FM3A 4U75A 1R5HA 4S2RP 5FCFA 4FLJA 1KQ9A 2BWUA 1WN1A 2BWTA 2OKNA 1WKMA 1XGSA 2GG2A 4IDYA 5CLSA 3IU7A 5CDEA 4IECA 4IU6A 5CNXA 1QZYA 2V3ZA 5D6FA 1YW8A 3FMRA 2EVMA 3L7GA 2Q92A 2GGBA 1QXYA 1PV9A 2GZ5A 1QXZA 1XGMA 4ZWPA 2ZSGA 2G6PA 1N51A 2P99A 4U70A 1BOAA 4U6JA 3PKDA 2BWXA 5E5BA 1XGNA 4EGEA 2EA2A 4RGZ1 2GU5A 3PKBA 3O5VA 4PV4A 2DFIA 2Q94A 3RVAA 1C23A 3MR1A 5JHUA 2BH3A 4FKCA 4U6WA 1WLRA 2V3YA 4KM3A 2BB7A 4FUKA 1B6AA 4S2TP 4U73A 4IKTA 2V6CA 3CTZA 3Q6DA 1R5GA 2GU4A 3TAVA 3S6BA 4RZZA 2GU6A 2GA2A 3PKCA 1KP0A 1WL6A 3MX6A 4U1BA 4IKUA 3CB6A 2GG5A 4B28A 3QOCA 4MATA 3CB5A 4S00A 4FLKA 2Q95A 4FLIA 2BWWA 2EA4A 3IU8A 4OOKA 3D27A 3OOOA 2HOWA 2GG9A 1C22A 4U6EA 2NQ7A 4S01A 2IW2A 5JI6A 4ZWOA 1YW7A 2EVOA 2GG3A 4IPAA 1B59A 1A16A 2B3HA 3PN9A 4ZNGA 1XGOA 2GG8A 2P98A 1WY2A 4A6WA 4JUQA 4FO8A 3PKAA 3TB5A 4U6CA 4U6ZA 2ADUA 2B3LA 4FO7A 3BIQA 2NQ6A 3PKEA 3L24A 1Y1NA 2GGCA 1WBQA 4QR8A 2Q96A 5CE6A 4FLLA 1R58A 5FCHA 4U69A 4A6VA 4IF7A
chains in the Genus database with same CATH topology
2BN7A 4RZYA 3FMQA 2V3XA 1O0XA 1YW9A 2OAZA 4IKRA 2P9AA 5D6EA 2EVCA 4ZWUA 4HXXA 3OVKA 5CDVA 2BHCA 3MATA 4PNCA 3IU9A 2BWVA 2GG0A 2GU7A 5CDLA 2B3KA 4U71A 2BHAA 1JAWA 4IKSA 2BHBA 5CIKA 1MATA 1C21A 1XNZA 3RORA 4Z7MA 1CHMA 2GTXA 2BWYA 1C27A 1WL9A 1C24A 3IG4A 2BWSA 1YVMA 3I7MA 1M35A 2GG7A 2BHDA 2MATA 2Q8KA 3BIPA 1BN5A 5E2CA 5JFRA 2Q93A 3BITA 3IL0A 4U76A 3PEBA 1W2MA 4R60A 1KQ0A 1YJ3A 1W7VA 1QXWA 3FM3A 4U75A 1R5HA 4S2RP 5FCFA 4FLJA 1KQ9A 2BWUA 1WN1A 2BWTA 2OKNA 1WKMA 1XGSA 2GG2A 4IDYA 5CLSA 3IU7A 5CDEA 4IECA 4IU6A 5CNXA 1QZYA 2V3ZA 5D6FA 1YW8A 3FMRA 2EVMA 3L7GA 2Q92A 2GGBA 1QXYA 1PV9A 2GZ5A 1QXZA 1XGMA 4ZWPA 2ZSGA 2G6PA 1N51A 2P99A 4U70A 1BOAA 4U6JA 3PKDA 2BWXA 5E5BA 1XGNA 4EGEA 2EA2A 4RGZ1 2GU5A 3PKBA 3O5VA 4PV4A 2DFIA 2Q94A 3RVAA 1C23A 3MR1A 5JHUA 2BH3A 4FKCA 4U6WA 1WLRA 2V3YA 4KM3A 2BB7A 4FUKA 1B6AA 4S2TP 4U73A 4IKTA 2V6CA 3CTZA 3Q6DA 1R5GA 2GU4A 3TAVA 3S6BA 4RZZA 2GU6A 2GA2A 3PKCA 1KP0A 1WL6A 3MX6A 4U1BA 4IKUA 3CB6A 2GG5A 4B28A 3QOCA 4MATA 3CB5A 4S00A 4FLKA 2Q95A 4FLIA 2BWWA 2EA4A 3IU8A 4OOKA 3D27A 3OOOA 2HOWA 2GG9A 1C22A 4U6EA 2NQ7A 4S01A 2IW2A 5JI6A 4ZWOA 1YW7A 2EVOA 2GG3A 4IPAA 1B59A 1A16A 2B3HA 3PN9A 4ZNGA 1XGOA 2GG8A 2P98A 1WY2A 4A6WA 4JUQA 4FO8A 3PKAA 3TB5A 4U6CA 4U6ZA 2ADUA 2B3LA 4FO7A 3BIQA 2NQ6A 3PKEA 3L24A 1Y1NA 2GGCA 1WBQA 4QR8A 2Q96A 5CE6A 4FLLA 1R58A 5FCHA 4U69A 4A6VA 4IF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BN7 A;  4RZY A;  3FMQ A;  2V3X A;  1O0X A;  1YW9 A;  2OAZ A;  4IKR A;  2P9A A;  5D6E A;  2EVC A;  4ZWU A;  4HXX A;  3OVK A;  5CDV A;  2BHC A;  3MAT A;  4PNC A;  3IU9 A;  2BWV A;  2GG0 A;  2GU7 A;  5CDL A;  2B3K A;  4U71 A;  2BHA A;  1JAW A;  4IKS A;  2BHB A;  5CIK A;  1MAT A;  1C21 A;  1XNZ A;  3ROR A;  4Z7M A;  1CHM A;  2GTX A;  2BWY A;  1C27 A;  1WL9 A;  1C24 A;  3IG4 A;  2BWS A;  1YVM A;  3I7M A;  1M35 A;  2GG7 A;  2BHD A;  2MAT A;  2Q8K A;  3BIP A;  1BN5 A;  5E2C A;  5JFR A;  2Q93 A;  3BIT A;  3IL0 A;  4U76 A;  3PEB A;  1W2M A;  4R60 A;  1KQ0 A;  1YJ3 A;  1W7V A;  1QXW A;  3FM3 A;  4U75 A;  1R5H A;  4S2R P;  5FCF A;  4FLJ A;  1KQ9 A;  2BWU A;  1WN1 A;  2BWT A;  2OKN A;  1WKM A;  1XGS A;  2GG2 A;  4IDY A;  5CLS A;  3IU7 A;  5CDE A;  4IEC A;  4IU6 A;  5CNX A;  1QZY A;  2V3Z A;  5D6F A;  1YW8 A;  3FMR A;  2EVM A;  3L7G A;  2Q92 A;  2GGB A;  1QXY A;  1PV9 A;  2GZ5 A;  1QXZ A;  1XGM A;  4ZWP A;  2ZSG A;  2G6P A;  1N51 A;  2P99 A;  4U70 A;  1BOA A;  4U6J A;  3PKD A;  2BWX A;  5E5B A;  1XGN A;  4EGE A;  2EA2 A;  4RGZ 1;  2GU5 A;  3PKB A;  3O5V A;  4PV4 A;  2DFI A;  2Q94 A;  3RVA A;  1C23 A;  3MR1 A;  5JHU A;  2BH3 A;  4FKC A;  4U6W A;  1WLR A;  2V3Y A;  4KM3 A;  2BB7 A;  4FUK A;  1B6A A;  4S2T P;  4U73 A;  4IKT A;  2V6C A;  3CTZ A;  3Q6D A;  1R5G A;  2GU4 A;  3TAV A;  3S6B A;  4RZZ A;  2GU6 A;  2GA2 A;  3PKC A;  1KP0 A;  1WL6 A;  3MX6 A;  4U1B A;  4IKU A;  3CB6 A;  2GG5 A;  4B28 A;  3QOC A;  4MAT A;  3CB5 A;  4S00 A;  4FLK A;  2Q95 A;  4FLI A;  2BWW A;  2EA4 A;  3IU8 A;  4OOK A;  3D27 A;  3OOO A;  2HOW A;  2GG9 A;  1C22 A;  4U6E A;  2NQ7 A;  4S01 A;  2IW2 A;  5JI6 A;  4ZWO A;  1YW7 A;  2EVO A;  2GG3 A;  4IPA A;  1B59 A;  1A16 A;  2B3H A;  3PN9 A;  4ZNG A;  1XGO A;  2GG8 A;  2P98 A;  1WY2 A;  4A6W A;  4JUQ A;  4FO8 A;  3PKA A;  3TB5 A;  4U6C A;  4U6Z A;  2ADU A;  2B3L A;  4FO7 A;  3BIQ A;  2NQ6 A;  3PKE A;  3L24 A;  1Y1N A;  2GGC A;  1WBQ A;  4QR8 A;  2Q96 A;  5CE6 A;  4FLL A;  1R58 A;  5FCH A;  4U69 A;  4A6V A;  4IF7 A; 
#chains in the Genus database with same CATH topology
 2BN7 A;  4RZY A;  3FMQ A;  2V3X A;  1O0X A;  1YW9 A;  2OAZ A;  4IKR A;  2P9A A;  5D6E A;  2EVC A;  4ZWU A;  4HXX A;  3OVK A;  5CDV A;  2BHC A;  3MAT A;  4PNC A;  3IU9 A;  2BWV A;  2GG0 A;  2GU7 A;  5CDL A;  2B3K A;  4U71 A;  2BHA A;  1JAW A;  4IKS A;  2BHB A;  5CIK A;  1MAT A;  1C21 A;  1XNZ A;  3ROR A;  4Z7M A;  1CHM A;  2GTX A;  2BWY A;  1C27 A;  1WL9 A;  1C24 A;  3IG4 A;  2BWS A;  1YVM A;  3I7M A;  1M35 A;  2GG7 A;  2BHD A;  2MAT A;  2Q8K A;  3BIP A;  1BN5 A;  5E2C A;  5JFR A;  2Q93 A;  3BIT A;  3IL0 A;  4U76 A;  3PEB A;  1W2M A;  4R60 A;  1KQ0 A;  1YJ3 A;  1W7V A;  1QXW A;  3FM3 A;  4U75 A;  1R5H A;  4S2R P;  5FCF A;  4FLJ A;  1KQ9 A;  2BWU A;  1WN1 A;  2BWT A;  2OKN A;  1WKM A;  1XGS A;  2GG2 A;  4IDY A;  5CLS A;  3IU7 A;  5CDE A;  4IEC A;  4IU6 A;  5CNX A;  1QZY A;  2V3Z A;  5D6F A;  1YW8 A;  3FMR A;  2EVM A;  3L7G A;  2Q92 A;  2GGB A;  1QXY A;  1PV9 A;  2GZ5 A;  1QXZ A;  1XGM A;  4ZWP A;  2ZSG A;  2G6P A;  1N51 A;  2P99 A;  4U70 A;  1BOA A;  4U6J A;  3PKD A;  2BWX A;  5E5B A;  1XGN A;  4EGE A;  2EA2 A;  4RGZ 1;  2GU5 A;  3PKB A;  3O5V A;  4PV4 A;  2DFI A;  2Q94 A;  3RVA A;  1C23 A;  3MR1 A;  5JHU A;  2BH3 A;  4FKC A;  4U6W A;  1WLR A;  2V3Y A;  4KM3 A;  2BB7 A;  4FUK A;  1B6A A;  4S2T P;  4U73 A;  4IKT A;  2V6C A;  3CTZ A;  3Q6D A;  1R5G A;  2GU4 A;  3TAV A;  3S6B A;  4RZZ A;  2GU6 A;  2GA2 A;  3PKC A;  1KP0 A;  1WL6 A;  3MX6 A;  4U1B A;  4IKU A;  3CB6 A;  2GG5 A;  4B28 A;  3QOC A;  4MAT A;  3CB5 A;  4S00 A;  4FLK A;  2Q95 A;  4FLI A;  2BWW A;  2EA4 A;  3IU8 A;  4OOK A;  3D27 A;  3OOO A;  2HOW A;  2GG9 A;  1C22 A;  4U6E A;  2NQ7 A;  4S01 A;  2IW2 A;  5JI6 A;  4ZWO A;  1YW7 A;  2EVO A;  2GG3 A;  4IPA A;  1B59 A;  1A16 A;  2B3H A;  3PN9 A;  4ZNG A;  1XGO A;  2GG8 A;  2P98 A;  1WY2 A;  4A6W A;  4JUQ A;  4FO8 A;  3PKA A;  3TB5 A;  4U6C A;  4U6Z A;  2ADU A;  2B3L A;  4FO7 A;  3BIQ A;  2NQ6 A;  3PKE A;  3L24 A;  1Y1N A;  2GGC A;  1WBQ A;  4QR8 A;  2Q96 A;  5CE6 A;  4FLL A;  1R58 A;  5FCH A;  4U69 A;  4A6V A;  4IF7 A; 
#chains in the Genus database with same CATH homology
 2BN7 A;  4RZY A;  3FMQ A;  2V3X A;  1O0X A;  1YW9 A;  2OAZ A;  4IKR A;  2P9A A;  5D6E A;  2EVC A;  4ZWU A;  4HXX A;  3OVK A;  5CDV A;  2BHC A;  3MAT A;  4PNC A;  3IU9 A;  2BWV A;  2GG0 A;  2GU7 A;  5CDL A;  2B3K A;  4U71 A;  2BHA A;  1JAW A;  4IKS A;  2BHB A;  5CIK A;  1MAT A;  1C21 A;  1XNZ A;  3ROR A;  4Z7M A;  1CHM A;  2GTX A;  2BWY A;  1C27 A;  1WL9 A;  1C24 A;  3IG4 A;  2BWS A;  1YVM A;  3I7M A;  1M35 A;  2GG7 A;  2BHD A;  2MAT A;  2Q8K A;  3BIP A;  1BN5 A;  5E2C A;  5JFR A;  2Q93 A;  3BIT A;  3IL0 A;  4U76 A;  3PEB A;  1W2M A;  4R60 A;  1KQ0 A;  1YJ3 A;  1W7V A;  1QXW A;  3FM3 A;  4U75 A;  1R5H A;  4S2R P;  5FCF A;  4FLJ A;  1KQ9 A;  2BWU A;  1WN1 A;  2BWT A;  2OKN A;  1WKM A;  1XGS A;  2GG2 A;  4IDY A;  5CLS A;  3IU7 A;  5CDE A;  4IEC A;  4IU6 A;  5CNX A;  1QZY A;  2V3Z A;  5D6F A;  1YW8 A;  3FMR A;  2EVM A;  3L7G A;  2Q92 A;  2GGB A;  1QXY A;  1PV9 A;  2GZ5 A;  1QXZ A;  1XGM A;  4ZWP A;  2ZSG A;  2G6P A;  1N51 A;  2P99 A;  4U70 A;  1BOA A;  4U6J A;  3PKD A;  2BWX A;  5E5B A;  1XGN A;  4EGE A;  2EA2 A;  4RGZ 1;  2GU5 A;  3PKB A;  3O5V A;  4PV4 A;  2DFI A;  2Q94 A;  3RVA A;  1C23 A;  3MR1 A;  5JHU A;  2BH3 A;  4FKC A;  4U6W A;  1WLR A;  2V3Y A;  4KM3 A;  2BB7 A;  4FUK A;  1B6A A;  4S2T P;  4U73 A;  4IKT A;  2V6C A;  3CTZ A;  3Q6D A;  1R5G A;  2GU4 A;  3TAV A;  3S6B A;  4RZZ A;  2GU6 A;  2GA2 A;  3PKC A;  1KP0 A;  1WL6 A;  3MX6 A;  4U1B A;  4IKU A;  3CB6 A;  2GG5 A;  4B28 A;  3QOC A;  4MAT A;  3CB5 A;  4S00 A;  4FLK A;  2Q95 A;  4FLI A;  2BWW A;  2EA4 A;  3IU8 A;  4OOK A;  3D27 A;  3OOO A;  2HOW A;  2GG9 A;  1C22 A;  4U6E A;  2NQ7 A;  4S01 A;  2IW2 A;  5JI6 A;  4ZWO A;  1YW7 A;  2EVO A;  2GG3 A;  4IPA A;  1B59 A;  1A16 A;  2B3H A;  3PN9 A;  4ZNG A;  1XGO A;  2GG8 A;  2P98 A;  1WY2 A;  4A6W A;  4JUQ A;  4FO8 A;  3PKA A;  3TB5 A;  4U6C A;  4U6Z A;  2ADU A;  2B3L A;  4FO7 A;  3BIQ A;  2NQ6 A;  3PKE A;  3L24 A;  1Y1N A;  2GGC A;  1WBQ A;  4QR8 A;  2Q96 A;  5CE6 A;  4FLL A;  1R58 A;  5FCH A;  4U69 A;  4A6V A;  4IF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...