2BWUA

Asp271ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGAITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwuA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwuA02
2ZSGA 1M35A 2GG2A 1WL9A 2BWSA 2GG7A 2GU7A 4FLKA 3FMQA 3PKBA 4IKUA 5D6FA 1R5GA 2OKNA 2Q95A 4U6WA 2B3KA 2GU6A 2GG3A 4IKRA 1C22A 1YW9A 4IPAA 2EA2A 2V6CA 3OVKA 5D6EA 5CDEA 1WLRA 4ZWPA 4U1BA 2Q8KA 5FCHA 3I7MA 2IW2A 1WN1A 2BWVA 5CLSA 4IF7A 2P9AA 2GG0A 3L7GA 3IG4A 3OOOA 4QR8A 2Q92A 3QOCA 1MATA 1R5HA 3MR1A 1XGNA 4IECA 3MATA 3PEBA 4B28A 2EVMA 2BHBA 2V3ZA 5E5BA 2BN7A 2P98A 3FM3A 1QXWA 1KQ9A 3BITA 2B3HA 3O5VA 2ADUA 2BWXA 1C24A 3S6BA 4FLLA 4A6WA 2GZ5A 3Q6DA 5CDLA 4A6VA 4R60A 3IU7A 2NQ7A 2MATA 3CB5A 5CNXA 2V3XA 1R58A 3PKAA 5E2CA 4U76A 2BH3A 2G6PA 3BIQA 2GG8A 2EVOA 1WKMA 3CTZA 1B6AA 2GTXA 5CE6A 1WY2A 3RVAA 4FUKA 1KP0A 4ZWUA 4ZNGA 1BN5A 1XGOA 1XGMA 5FCFA 3PKDA 1A16A 4S2TP 3PKCA 2NQ6A 1KQ0A 1O0XA 4KM3A 4RZYA 3CB6A 4PNCA 1YVMA 4U73A 4IKTA 1B59A 4S00A 1YJ3A 4FKCA 2Q96A 1QXYA 4MATA 4IKSA 2OAZA 4PV4A 4FO7A 1JAWA 1XGSA 2BWTA 4S2RP 3TAVA 4IDYA 1QXZA 1WL6A 4FLJA 1C23A 4HXXA 2Q94A 3D27A 1YW7A 2GU5A 4FO8A 4U71A 2Q93A 4RZZA 5JHUA 4RGZ1 2BWUA 2EA4A 2GA2A 5CIKA 5CDVA 2P99A 2BHAA 1C27A 4ZWOA 3PKEA 5JI6A 3IU8A 1XNZA 4U6EA 2BWYA 3FMRA 4S01A 2BHDA 1W7VA 2GG9A 2BHCA 3MX6A 3BIPA 2EVCA 3IU9A 1C21A 1N51A 4Z7MA 2GGCA 2GGBA 2GG5A 4U6CA 3L24A 4U69A 4U75A 1W2MA 3IL0A 4JUQA 4OOKA 1BOAA 4U70A 1PV9A 2V3YA 3RORA 1Y1NA 1YW8A 2DFIA 4IU6A 2B3LA 1CHMA 5JFRA 4U6ZA 1QZYA 3PN9A 4EGEA 2GU4A 3TB5A 1WBQA 4U6JA 2BB7A 2BWWA 4FLIA 2HOWA
chains in the Genus database with same CATH superfamily
2ZSGA 1M35A 2GG2A 1WL9A 2BWSA 2GG7A 2GU7A 4FLKA 3FMQA 3PKBA 4IKUA 5D6FA 1R5GA 2OKNA 2Q95A 4U6WA 2B3KA 2GU6A 2GG3A 4IKRA 1C22A 1YW9A 4IPAA 2EA2A 2V6CA 3OVKA 5D6EA 5CDEA 1WLRA 4ZWPA 4U1BA 2Q8KA 5FCHA 3I7MA 2IW2A 1WN1A 2BWVA 5CLSA 4IF7A 2P9AA 2GG0A 3L7GA 3IG4A 3OOOA 4QR8A 2Q92A 3QOCA 1MATA 1R5HA 3MR1A 1XGNA 4IECA 3MATA 3PEBA 4B28A 2EVMA 2BHBA 2V3ZA 5E5BA 2BN7A 2P98A 3FM3A 1QXWA 1KQ9A 3BITA 2B3HA 3O5VA 2ADUA 2BWXA 1C24A 3S6BA 4FLLA 4A6WA 2GZ5A 3Q6DA 5CDLA 4A6VA 4R60A 3IU7A 2NQ7A 2MATA 3CB5A 5CNXA 2V3XA 1R58A 3PKAA 5E2CA 4U76A 2BH3A 2G6PA 3BIQA 2GG8A 2EVOA 1WKMA 3CTZA 1B6AA 2GTXA 5CE6A 1WY2A 3RVAA 4FUKA 1KP0A 4ZWUA 4ZNGA 1BN5A 1XGOA 1XGMA 5FCFA 3PKDA 1A16A 4S2TP 3PKCA 2NQ6A 1KQ0A 1O0XA 4KM3A 4RZYA 3CB6A 4PNCA 1YVMA 4U73A 4IKTA 1B59A 4S00A 1YJ3A 4FKCA 2Q96A 1QXYA 4MATA 4IKSA 2OAZA 4PV4A 4FO7A 1JAWA 1XGSA 2BWTA 4S2RP 3TAVA 4IDYA 1QXZA 1WL6A 4FLJA 1C23A 4HXXA 2Q94A 3D27A 1YW7A 2GU5A 4FO8A 4U71A 2Q93A 4RZZA 5JHUA 4RGZ1 2BWUA 2EA4A 2GA2A 5CIKA 5CDVA 2P99A 2BHAA 1C27A 4ZWOA 3PKEA 5JI6A 3IU8A 1XNZA 4U6EA 2BWYA 3FMRA 4S01A 2BHDA 1W7VA 2GG9A 2BHCA 3MX6A 3BIPA 2EVCA 3IU9A 1C21A 1N51A 4Z7MA 2GGCA 2GGBA 2GG5A 4U6CA 3L24A 4U69A 4U75A 1W2MA 3IL0A 4JUQA 4OOKA 1BOAA 4U70A 1PV9A 2V3YA 3RORA 1Y1NA 1YW8A 2DFIA 4IU6A 2B3LA 1CHMA 5JFRA 4U6ZA 1QZYA 3PN9A 4EGEA 2GU4A 3TB5A 1WBQA 4U6JA 2BB7A 2BWWA 4FLIA 2HOWA
chains in the Genus database with same CATH topology
2ZSGA 1M35A 2GG2A 1WL9A 2BWSA 2GG7A 2GU7A 4FLKA 3FMQA 3PKBA 4IKUA 5D6FA 1R5GA 2OKNA 2Q95A 4U6WA 2B3KA 2GU6A 2GG3A 4IKRA 1C22A 1YW9A 4IPAA 2EA2A 2V6CA 3OVKA 5D6EA 5CDEA 1WLRA 4ZWPA 4U1BA 2Q8KA 5FCHA 3I7MA 2IW2A 1WN1A 2BWVA 5CLSA 4IF7A 2P9AA 2GG0A 3L7GA 3IG4A 3OOOA 4QR8A 2Q92A 3QOCA 1MATA 1R5HA 3MR1A 1XGNA 4IECA 3MATA 3PEBA 4B28A 2EVMA 2BHBA 2V3ZA 5E5BA 2BN7A 2P98A 3FM3A 1QXWA 1KQ9A 3BITA 2B3HA 3O5VA 2ADUA 2BWXA 1C24A 3S6BA 4FLLA 4A6WA 2GZ5A 3Q6DA 5CDLA 4A6VA 4R60A 3IU7A 2NQ7A 2MATA 3CB5A 5CNXA 2V3XA 1R58A 3PKAA 5E2CA 4U76A 2BH3A 2G6PA 3BIQA 2GG8A 2EVOA 1WKMA 3CTZA 1B6AA 2GTXA 5CE6A 1WY2A 3RVAA 4FUKA 1KP0A 4ZWUA 4ZNGA 1BN5A 1XGOA 1XGMA 5FCFA 3PKDA 1A16A 4S2TP 3PKCA 2NQ6A 1KQ0A 1O0XA 4KM3A 4RZYA 3CB6A 4PNCA 1YVMA 4U73A 4IKTA 1B59A 4S00A 1YJ3A 4FKCA 2Q96A 1QXYA 4MATA 4IKSA 2OAZA 4PV4A 4FO7A 1JAWA 1XGSA 2BWTA 4S2RP 3TAVA 4IDYA 1QXZA 1WL6A 4FLJA 1C23A 4HXXA 2Q94A 3D27A 1YW7A 2GU5A 4FO8A 4U71A 2Q93A 4RZZA 5JHUA 4RGZ1 2BWUA 2EA4A 2GA2A 5CIKA 5CDVA 2P99A 2BHAA 1C27A 4ZWOA 3PKEA 5JI6A 3IU8A 1XNZA 4U6EA 2BWYA 3FMRA 4S01A 2BHDA 1W7VA 2GG9A 2BHCA 3MX6A 3BIPA 2EVCA 3IU9A 1C21A 1N51A 4Z7MA 2GGCA 2GGBA 2GG5A 4U6CA 3L24A 4U69A 4U75A 1W2MA 3IL0A 4JUQA 4OOKA 1BOAA 4U70A 1PV9A 2V3YA 3RORA 1Y1NA 1YW8A 2DFIA 4IU6A 2B3LA 1CHMA 5JFRA 4U6ZA 1QZYA 3PN9A 4EGEA 2GU4A 3TB5A 1WBQA 4U6JA 2BB7A 2BWWA 4FLIA 2HOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  1M35 A;  2GG2 A;  1WL9 A;  2BWS A;  2GG7 A;  2GU7 A;  4FLK A;  3FMQ A;  3PKB A;  4IKU A;  5D6F A;  1R5G A;  2OKN A;  2Q95 A;  4U6W A;  2B3K A;  2GU6 A;  2GG3 A;  4IKR A;  1C22 A;  1YW9 A;  4IPA A;  2EA2 A;  2V6C A;  3OVK A;  5D6E A;  5CDE A;  1WLR A;  4ZWP A;  4U1B A;  2Q8K A;  5FCH A;  3I7M A;  2IW2 A;  1WN1 A;  2BWV A;  5CLS A;  4IF7 A;  2P9A A;  2GG0 A;  3L7G A;  3IG4 A;  3OOO A;  4QR8 A;  2Q92 A;  3QOC A;  1MAT A;  1R5H A;  3MR1 A;  1XGN A;  4IEC A;  3MAT A;  3PEB A;  4B28 A;  2EVM A;  2BHB A;  2V3Z A;  5E5B A;  2BN7 A;  2P98 A;  3FM3 A;  1QXW A;  1KQ9 A;  3BIT A;  2B3H A;  3O5V A;  2ADU A;  2BWX A;  1C24 A;  3S6B A;  4FLL A;  4A6W A;  2GZ5 A;  3Q6D A;  5CDL A;  4A6V A;  4R60 A;  3IU7 A;  2NQ7 A;  2MAT A;  3CB5 A;  5CNX A;  2V3X A;  1R58 A;  3PKA A;  5E2C A;  4U76 A;  2BH3 A;  2G6P A;  3BIQ A;  2GG8 A;  2EVO A;  1WKM A;  3CTZ A;  1B6A A;  2GTX A;  5CE6 A;  1WY2 A;  3RVA A;  4FUK A;  1KP0 A;  4ZWU A;  4ZNG A;  1BN5 A;  1XGO A;  1XGM A;  5FCF A;  3PKD A;  1A16 A;  4S2T P;  3PKC A;  2NQ6 A;  1KQ0 A;  1O0X A;  4KM3 A;  4RZY A;  3CB6 A;  4PNC A;  1YVM A;  4U73 A;  4IKT A;  1B59 A;  4S00 A;  1YJ3 A;  4FKC A;  2Q96 A;  1QXY A;  4MAT A;  4IKS A;  2OAZ A;  4PV4 A;  4FO7 A;  1JAW A;  1XGS A;  2BWT A;  4S2R P;  3TAV A;  4IDY A;  1QXZ A;  1WL6 A;  4FLJ A;  1C23 A;  4HXX A;  2Q94 A;  3D27 A;  1YW7 A;  2GU5 A;  4FO8 A;  4U71 A;  2Q93 A;  4RZZ A;  5JHU A;  4RGZ 1;  2BWU A;  2EA4 A;  2GA2 A;  5CIK A;  5CDV A;  2P99 A;  2BHA A;  1C27 A;  4ZWO A;  3PKE A;  5JI6 A;  3IU8 A;  1XNZ A;  4U6E A;  2BWY A;  3FMR A;  4S01 A;  2BHD A;  1W7V A;  2GG9 A;  2BHC A;  3MX6 A;  3BIP A;  2EVC A;  3IU9 A;  1C21 A;  1N51 A;  4Z7M A;  2GGC A;  2GGB A;  2GG5 A;  4U6C A;  3L24 A;  4U69 A;  4U75 A;  1W2M A;  3IL0 A;  4JUQ A;  4OOK A;  1BOA A;  4U70 A;  1PV9 A;  2V3Y A;  3ROR A;  1Y1N A;  1YW8 A;  2DFI A;  4IU6 A;  2B3L A;  1CHM A;  5JFR A;  4U6Z A;  1QZY A;  3PN9 A;  4EGE A;  2GU4 A;  3TB5 A;  1WBQ A;  4U6J A;  2BB7 A;  2BWW A;  4FLI A;  2HOW A; 
#chains in the Genus database with same CATH topology
 2ZSG A;  1M35 A;  2GG2 A;  1WL9 A;  2BWS A;  2GG7 A;  2GU7 A;  4FLK A;  3FMQ A;  3PKB A;  4IKU A;  5D6F A;  1R5G A;  2OKN A;  2Q95 A;  4U6W A;  2B3K A;  2GU6 A;  2GG3 A;  4IKR A;  1C22 A;  1YW9 A;  4IPA A;  2EA2 A;  2V6C A;  3OVK A;  5D6E A;  5CDE A;  1WLR A;  4ZWP A;  4U1B A;  2Q8K A;  5FCH A;  3I7M A;  2IW2 A;  1WN1 A;  2BWV A;  5CLS A;  4IF7 A;  2P9A A;  2GG0 A;  3L7G A;  3IG4 A;  3OOO A;  4QR8 A;  2Q92 A;  3QOC A;  1MAT A;  1R5H A;  3MR1 A;  1XGN A;  4IEC A;  3MAT A;  3PEB A;  4B28 A;  2EVM A;  2BHB A;  2V3Z A;  5E5B A;  2BN7 A;  2P98 A;  3FM3 A;  1QXW A;  1KQ9 A;  3BIT A;  2B3H A;  3O5V A;  2ADU A;  2BWX A;  1C24 A;  3S6B A;  4FLL A;  4A6W A;  2GZ5 A;  3Q6D A;  5CDL A;  4A6V A;  4R60 A;  3IU7 A;  2NQ7 A;  2MAT A;  3CB5 A;  5CNX A;  2V3X A;  1R58 A;  3PKA A;  5E2C A;  4U76 A;  2BH3 A;  2G6P A;  3BIQ A;  2GG8 A;  2EVO A;  1WKM A;  3CTZ A;  1B6A A;  2GTX A;  5CE6 A;  1WY2 A;  3RVA A;  4FUK A;  1KP0 A;  4ZWU A;  4ZNG A;  1BN5 A;  1XGO A;  1XGM A;  5FCF A;  3PKD A;  1A16 A;  4S2T P;  3PKC A;  2NQ6 A;  1KQ0 A;  1O0X A;  4KM3 A;  4RZY A;  3CB6 A;  4PNC A;  1YVM A;  4U73 A;  4IKT A;  1B59 A;  4S00 A;  1YJ3 A;  4FKC A;  2Q96 A;  1QXY A;  4MAT A;  4IKS A;  2OAZ A;  4PV4 A;  4FO7 A;  1JAW A;  1XGS A;  2BWT A;  4S2R P;  3TAV A;  4IDY A;  1QXZ A;  1WL6 A;  4FLJ A;  1C23 A;  4HXX A;  2Q94 A;  3D27 A;  1YW7 A;  2GU5 A;  4FO8 A;  4U71 A;  2Q93 A;  4RZZ A;  5JHU A;  4RGZ 1;  2BWU A;  2EA4 A;  2GA2 A;  5CIK A;  5CDV A;  2P99 A;  2BHA A;  1C27 A;  4ZWO A;  3PKE A;  5JI6 A;  3IU8 A;  1XNZ A;  4U6E A;  2BWY A;  3FMR A;  4S01 A;  2BHD A;  1W7V A;  2GG9 A;  2BHC A;  3MX6 A;  3BIP A;  2EVC A;  3IU9 A;  1C21 A;  1N51 A;  4Z7M A;  2GGC A;  2GGB A;  2GG5 A;  4U6C A;  3L24 A;  4U69 A;  4U75 A;  1W2M A;  3IL0 A;  4JUQ A;  4OOK A;  1BOA A;  4U70 A;  1PV9 A;  2V3Y A;  3ROR A;  1Y1N A;  1YW8 A;  2DFI A;  4IU6 A;  2B3L A;  1CHM A;  5JFR A;  4U6Z A;  1QZY A;  3PN9 A;  4EGE A;  2GU4 A;  3TB5 A;  1WBQ A;  4U6J A;  2BB7 A;  2BWW A;  4FLI A;  2HOW A; 
#chains in the Genus database with same CATH homology
 2ZSG A;  1M35 A;  2GG2 A;  1WL9 A;  2BWS A;  2GG7 A;  2GU7 A;  4FLK A;  3FMQ A;  3PKB A;  4IKU A;  5D6F A;  1R5G A;  2OKN A;  2Q95 A;  4U6W A;  2B3K A;  2GU6 A;  2GG3 A;  4IKR A;  1C22 A;  1YW9 A;  4IPA A;  2EA2 A;  2V6C A;  3OVK A;  5D6E A;  5CDE A;  1WLR A;  4ZWP A;  4U1B A;  2Q8K A;  5FCH A;  3I7M A;  2IW2 A;  1WN1 A;  2BWV A;  5CLS A;  4IF7 A;  2P9A A;  2GG0 A;  3L7G A;  3IG4 A;  3OOO A;  4QR8 A;  2Q92 A;  3QOC A;  1MAT A;  1R5H A;  3MR1 A;  1XGN A;  4IEC A;  3MAT A;  3PEB A;  4B28 A;  2EVM A;  2BHB A;  2V3Z A;  5E5B A;  2BN7 A;  2P98 A;  3FM3 A;  1QXW A;  1KQ9 A;  3BIT A;  2B3H A;  3O5V A;  2ADU A;  2BWX A;  1C24 A;  3S6B A;  4FLL A;  4A6W A;  2GZ5 A;  3Q6D A;  5CDL A;  4A6V A;  4R60 A;  3IU7 A;  2NQ7 A;  2MAT A;  3CB5 A;  5CNX A;  2V3X A;  1R58 A;  3PKA A;  5E2C A;  4U76 A;  2BH3 A;  2G6P A;  3BIQ A;  2GG8 A;  2EVO A;  1WKM A;  3CTZ A;  1B6A A;  2GTX A;  5CE6 A;  1WY2 A;  3RVA A;  4FUK A;  1KP0 A;  4ZWU A;  4ZNG A;  1BN5 A;  1XGO A;  1XGM A;  5FCF A;  3PKD A;  1A16 A;  4S2T P;  3PKC A;  2NQ6 A;  1KQ0 A;  1O0X A;  4KM3 A;  4RZY A;  3CB6 A;  4PNC A;  1YVM A;  4U73 A;  4IKT A;  1B59 A;  4S00 A;  1YJ3 A;  4FKC A;  2Q96 A;  1QXY A;  4MAT A;  4IKS A;  2OAZ A;  4PV4 A;  4FO7 A;  1JAW A;  1XGS A;  2BWT A;  4S2R P;  3TAV A;  4IDY A;  1QXZ A;  1WL6 A;  4FLJ A;  1C23 A;  4HXX A;  2Q94 A;  3D27 A;  1YW7 A;  2GU5 A;  4FO8 A;  4U71 A;  2Q93 A;  4RZZ A;  5JHU A;  4RGZ 1;  2BWU A;  2EA4 A;  2GA2 A;  5CIK A;  5CDV A;  2P99 A;  2BHA A;  1C27 A;  4ZWO A;  3PKE A;  5JI6 A;  3IU8 A;  1XNZ A;  4U6E A;  2BWY A;  3FMR A;  4S01 A;  2BHD A;  1W7V A;  2GG9 A;  2BHC A;  3MX6 A;  3BIP A;  2EVC A;  3IU9 A;  1C21 A;  1N51 A;  4Z7M A;  2GGC A;  2GGB A;  2GG5 A;  4U6C A;  3L24 A;  4U69 A;  4U75 A;  1W2M A;  3IL0 A;  4JUQ A;  4OOK A;  1BOA A;  4U70 A;  1PV9 A;  2V3Y A;  3ROR A;  1Y1N A;  1YW8 A;  2DFI A;  4IU6 A;  2B3L A;  1CHM A;  5JFR A;  4U6Z A;  1QZY A;  3PN9 A;  4EGE A;  2GU4 A;  3TB5 A;  1WBQ A;  4U6J A;  2BB7 A;  2BWW A;  4FLI A;  2HOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...