2BWUA

Asp271ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGAITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwuA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwuA02
4U69A 1WN1A 2Q95A 4FUKA 2V3XA 1KP0A 5D6FA 3I7MA 1XGNA 2Q96A 2GTXA 3OVKA 4MATA 2P9AA 4QR8A 4FLKA 1QXWA 1C21A 1A16A 2GG7A 4PV4A 1XGMA 2BHAA 2GG5A 2GG2A 2GZ5A 4U76A 3IG4A 2BN7A 3CB6A 1KQ9A 4FO7A 5CDEA 3PKDA 5FCHA 2B3HA 3OOOA 4RGZ1 3PKAA 5E2CA 4FLJA 1R5HA 3BIPA 2ADUA 2GG0A 2Q92A 3FM3A 1C23A 4B28A 3L7GA 3QOCA 1JAWA 2BHCA 1QXZA 2BWYA 4IDYA 3FMRA 4FKCA 1O0XA 1Y1NA 1YVMA 4IKTA 4IECA 4IPAA 3BIQA 2Q8KA 1R5GA 3Q6DA 2BWSA 2BWXA 2BHDA 1N51A 1CHMA 2HOWA 3IU7A 2ZSGA 4RZYA 4U71A 4HXXA 4ZWUA 3BITA 1KQ0A 1MATA 3IU8A 2G6PA 1XGOA 4IKRA 1R58A 1BOAA 2BHBA 2V3YA 5CNXA 1YW7A 5CLSA 3O5VA 4ZNGA 1C27A 3PKBA 4OOKA 4S2TP 1BN5A 3RVAA 2BH3A 1M35A 2DFIA 4IF7A 4U6EA 5D6EA 3TAVA 3PN9A 4A6WA 2B3LA 4IKSA 1WL9A 1B6AA 4IKUA 2P99A 1WKMA 2GU7A 3MX6A 2Q94A 4JUQA 2GG8A 2V6CA 1PV9A 2EVCA 4R60A 2MATA 1W7VA 4EGEA 2BWTA 5CDLA 2EVOA 1YW9A 1C24A 1WLRA 3CTZA 1B59A 2IW2A 4U73A 4S2RP 4U6WA 3D27A 2EA2A 4Z7MA 4S01A 1YJ3A 3MR1A 3L24A 4FLLA 2GG3A 2GGBA 1YW8A 3CB5A 4FO8A 2GA2A 3IL0A 4ZWOA 1WL6A 2GG9A 2EVMA 2GU6A 3FMQA 2Q93A 5JHUA 3S6BA 1XNZA 2P98A 3TB5A 4U6JA 2BWUA 4KM3A 4U1BA 5JI6A 1QXYA 1XGSA 3MATA 2OAZA 3IU9A 3RORA 1W2MA 5E5BA 4PNCA 3PEBA 4ZWPA 3PKEA 4U6CA 1WY2A 4A6VA 5CIKA 5CDVA 2OKNA 2BWVA 4FLIA 4U70A 5JFRA 2B3KA 2BB7A 4IU6A 1QZYA 4U6ZA 5CE6A 1C22A 2EA4A 5FCFA 2NQ7A 4U75A 2NQ6A 2GU5A 3PKCA 1WBQA 2GU4A 2GGCA 4RZZA 2V3ZA 4S00A 2BWWA
chains in the Genus database with same CATH superfamily
4U69A 1WN1A 2Q95A 4FUKA 2V3XA 1KP0A 5D6FA 3I7MA 1XGNA 2Q96A 2GTXA 3OVKA 4MATA 2P9AA 4QR8A 4FLKA 1QXWA 1C21A 1A16A 2GG7A 4PV4A 1XGMA 2BHAA 2GG5A 2GG2A 2GZ5A 4U76A 3IG4A 2BN7A 3CB6A 1KQ9A 4FO7A 5CDEA 3PKDA 5FCHA 2B3HA 3OOOA 4RGZ1 3PKAA 5E2CA 4FLJA 1R5HA 3BIPA 2ADUA 2GG0A 2Q92A 3FM3A 1C23A 4B28A 3L7GA 3QOCA 1JAWA 2BHCA 1QXZA 2BWYA 4IDYA 3FMRA 4FKCA 1O0XA 1Y1NA 1YVMA 4IKTA 4IECA 4IPAA 3BIQA 2Q8KA 1R5GA 3Q6DA 2BWSA 2BWXA 2BHDA 1N51A 1CHMA 2HOWA 3IU7A 2ZSGA 4RZYA 4U71A 4HXXA 4ZWUA 3BITA 1KQ0A 1MATA 3IU8A 2G6PA 1XGOA 4IKRA 1R58A 1BOAA 2BHBA 2V3YA 5CNXA 1YW7A 5CLSA 3O5VA 4ZNGA 1C27A 3PKBA 4OOKA 4S2TP 1BN5A 3RVAA 2BH3A 1M35A 2DFIA 4IF7A 4U6EA 5D6EA 3TAVA 3PN9A 4A6WA 2B3LA 4IKSA 1WL9A 1B6AA 4IKUA 2P99A 1WKMA 2GU7A 3MX6A 2Q94A 4JUQA 2GG8A 2V6CA 1PV9A 2EVCA 4R60A 2MATA 1W7VA 4EGEA 2BWTA 5CDLA 2EVOA 1YW9A 1C24A 1WLRA 3CTZA 1B59A 2IW2A 4U73A 4S2RP 4U6WA 3D27A 2EA2A 4Z7MA 4S01A 1YJ3A 3MR1A 3L24A 4FLLA 2GG3A 2GGBA 1YW8A 3CB5A 4FO8A 2GA2A 3IL0A 4ZWOA 1WL6A 2GG9A 2EVMA 2GU6A 3FMQA 2Q93A 5JHUA 3S6BA 1XNZA 2P98A 3TB5A 4U6JA 2BWUA 4KM3A 4U1BA 5JI6A 1QXYA 1XGSA 3MATA 2OAZA 3IU9A 3RORA 1W2MA 5E5BA 4PNCA 3PEBA 4ZWPA 3PKEA 4U6CA 1WY2A 4A6VA 5CIKA 5CDVA 2OKNA 2BWVA 4FLIA 4U70A 5JFRA 2B3KA 2BB7A 4IU6A 1QZYA 4U6ZA 5CE6A 1C22A 2EA4A 5FCFA 2NQ7A 4U75A 2NQ6A 2GU5A 3PKCA 1WBQA 2GU4A 2GGCA 4RZZA 2V3ZA 4S00A 2BWWA
chains in the Genus database with same CATH topology
4U69A 1WN1A 2Q95A 4FUKA 2V3XA 1KP0A 5D6FA 3I7MA 1XGNA 2Q96A 2GTXA 3OVKA 4MATA 2P9AA 4QR8A 4FLKA 1QXWA 1C21A 1A16A 2GG7A 4PV4A 1XGMA 2BHAA 2GG5A 2GG2A 2GZ5A 4U76A 3IG4A 2BN7A 3CB6A 1KQ9A 4FO7A 5CDEA 3PKDA 5FCHA 2B3HA 3OOOA 4RGZ1 3PKAA 5E2CA 4FLJA 1R5HA 3BIPA 2ADUA 2GG0A 2Q92A 3FM3A 1C23A 4B28A 3L7GA 3QOCA 1JAWA 2BHCA 1QXZA 2BWYA 4IDYA 3FMRA 4FKCA 1O0XA 1Y1NA 1YVMA 4IKTA 4IECA 4IPAA 3BIQA 2Q8KA 1R5GA 3Q6DA 2BWSA 2BWXA 2BHDA 1N51A 1CHMA 2HOWA 3IU7A 2ZSGA 4RZYA 4U71A 4HXXA 4ZWUA 3BITA 1KQ0A 1MATA 3IU8A 2G6PA 1XGOA 4IKRA 1R58A 1BOAA 2BHBA 2V3YA 5CNXA 1YW7A 5CLSA 3O5VA 4ZNGA 1C27A 3PKBA 4OOKA 4S2TP 1BN5A 3RVAA 2BH3A 1M35A 2DFIA 4IF7A 4U6EA 5D6EA 3TAVA 3PN9A 4A6WA 2B3LA 4IKSA 1WL9A 1B6AA 4IKUA 2P99A 1WKMA 2GU7A 3MX6A 2Q94A 4JUQA 2GG8A 2V6CA 1PV9A 2EVCA 4R60A 2MATA 1W7VA 4EGEA 2BWTA 5CDLA 2EVOA 1YW9A 1C24A 1WLRA 3CTZA 1B59A 2IW2A 4U73A 4S2RP 4U6WA 3D27A 2EA2A 4Z7MA 4S01A 1YJ3A 3MR1A 3L24A 4FLLA 2GG3A 2GGBA 1YW8A 3CB5A 4FO8A 2GA2A 3IL0A 4ZWOA 1WL6A 2GG9A 2EVMA 2GU6A 3FMQA 2Q93A 5JHUA 3S6BA 1XNZA 2P98A 3TB5A 4U6JA 2BWUA 4KM3A 4U1BA 5JI6A 1QXYA 1XGSA 3MATA 2OAZA 3IU9A 3RORA 1W2MA 5E5BA 4PNCA 3PEBA 4ZWPA 3PKEA 4U6CA 1WY2A 4A6VA 5CIKA 5CDVA 2OKNA 2BWVA 4FLIA 4U70A 5JFRA 2B3KA 2BB7A 4IU6A 1QZYA 4U6ZA 5CE6A 1C22A 2EA4A 5FCFA 2NQ7A 4U75A 2NQ6A 2GU5A 3PKCA 1WBQA 2GU4A 2GGCA 4RZZA 2V3ZA 4S00A 2BWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U69 A;  1WN1 A;  2Q95 A;  4FUK A;  2V3X A;  1KP0 A;  5D6F A;  3I7M A;  1XGN A;  2Q96 A;  2GTX A;  3OVK A;  4MAT A;  2P9A A;  4QR8 A;  4FLK A;  1QXW A;  1C21 A;  1A16 A;  2GG7 A;  4PV4 A;  1XGM A;  2BHA A;  2GG5 A;  2GG2 A;  2GZ5 A;  4U76 A;  3IG4 A;  2BN7 A;  3CB6 A;  1KQ9 A;  4FO7 A;  5CDE A;  3PKD A;  5FCH A;  2B3H A;  3OOO A;  4RGZ 1;  3PKA A;  5E2C A;  4FLJ A;  1R5H A;  3BIP A;  2ADU A;  2GG0 A;  2Q92 A;  3FM3 A;  1C23 A;  4B28 A;  3L7G A;  3QOC A;  1JAW A;  2BHC A;  1QXZ A;  2BWY A;  4IDY A;  3FMR A;  4FKC A;  1O0X A;  1Y1N A;  1YVM A;  4IKT A;  4IEC A;  4IPA A;  3BIQ A;  2Q8K A;  1R5G A;  3Q6D A;  2BWS A;  2BWX A;  2BHD A;  1N51 A;  1CHM A;  2HOW A;  3IU7 A;  2ZSG A;  4RZY A;  4U71 A;  4HXX A;  4ZWU A;  3BIT A;  1KQ0 A;  1MAT A;  3IU8 A;  2G6P A;  1XGO A;  4IKR A;  1R58 A;  1BOA A;  2BHB A;  2V3Y A;  5CNX A;  1YW7 A;  5CLS A;  3O5V A;  4ZNG A;  1C27 A;  3PKB A;  4OOK A;  4S2T P;  1BN5 A;  3RVA A;  2BH3 A;  1M35 A;  2DFI A;  4IF7 A;  4U6E A;  5D6E A;  3TAV A;  3PN9 A;  4A6W A;  2B3L A;  4IKS A;  1WL9 A;  1B6A A;  4IKU A;  2P99 A;  1WKM A;  2GU7 A;  3MX6 A;  2Q94 A;  4JUQ A;  2GG8 A;  2V6C A;  1PV9 A;  2EVC A;  4R60 A;  2MAT A;  1W7V A;  4EGE A;  2BWT A;  5CDL A;  2EVO A;  1YW9 A;  1C24 A;  1WLR A;  3CTZ A;  1B59 A;  2IW2 A;  4U73 A;  4S2R P;  4U6W A;  3D27 A;  2EA2 A;  4Z7M A;  4S01 A;  1YJ3 A;  3MR1 A;  3L24 A;  4FLL A;  2GG3 A;  2GGB A;  1YW8 A;  3CB5 A;  4FO8 A;  2GA2 A;  3IL0 A;  4ZWO A;  1WL6 A;  2GG9 A;  2EVM A;  2GU6 A;  3FMQ A;  2Q93 A;  5JHU A;  3S6B A;  1XNZ A;  2P98 A;  3TB5 A;  4U6J A;  2BWU A;  4KM3 A;  4U1B A;  5JI6 A;  1QXY A;  1XGS A;  3MAT A;  2OAZ A;  3IU9 A;  3ROR A;  1W2M A;  5E5B A;  4PNC A;  3PEB A;  4ZWP A;  3PKE A;  4U6C A;  1WY2 A;  4A6V A;  5CIK A;  5CDV A;  2OKN A;  2BWV A;  4FLI A;  4U70 A;  5JFR A;  2B3K A;  2BB7 A;  4IU6 A;  1QZY A;  4U6Z A;  5CE6 A;  1C22 A;  2EA4 A;  5FCF A;  2NQ7 A;  4U75 A;  2NQ6 A;  2GU5 A;  3PKC A;  1WBQ A;  2GU4 A;  2GGC A;  4RZZ A;  2V3Z A;  4S00 A;  2BWW A; 
#chains in the Genus database with same CATH topology
 4U69 A;  1WN1 A;  2Q95 A;  4FUK A;  2V3X A;  1KP0 A;  5D6F A;  3I7M A;  1XGN A;  2Q96 A;  2GTX A;  3OVK A;  4MAT A;  2P9A A;  4QR8 A;  4FLK A;  1QXW A;  1C21 A;  1A16 A;  2GG7 A;  4PV4 A;  1XGM A;  2BHA A;  2GG5 A;  2GG2 A;  2GZ5 A;  4U76 A;  3IG4 A;  2BN7 A;  3CB6 A;  1KQ9 A;  4FO7 A;  5CDE A;  3PKD A;  5FCH A;  2B3H A;  3OOO A;  4RGZ 1;  3PKA A;  5E2C A;  4FLJ A;  1R5H A;  3BIP A;  2ADU A;  2GG0 A;  2Q92 A;  3FM3 A;  1C23 A;  4B28 A;  3L7G A;  3QOC A;  1JAW A;  2BHC A;  1QXZ A;  2BWY A;  4IDY A;  3FMR A;  4FKC A;  1O0X A;  1Y1N A;  1YVM A;  4IKT A;  4IEC A;  4IPA A;  3BIQ A;  2Q8K A;  1R5G A;  3Q6D A;  2BWS A;  2BWX A;  2BHD A;  1N51 A;  1CHM A;  2HOW A;  3IU7 A;  2ZSG A;  4RZY A;  4U71 A;  4HXX A;  4ZWU A;  3BIT A;  1KQ0 A;  1MAT A;  3IU8 A;  2G6P A;  1XGO A;  4IKR A;  1R58 A;  1BOA A;  2BHB A;  2V3Y A;  5CNX A;  1YW7 A;  5CLS A;  3O5V A;  4ZNG A;  1C27 A;  3PKB A;  4OOK A;  4S2T P;  1BN5 A;  3RVA A;  2BH3 A;  1M35 A;  2DFI A;  4IF7 A;  4U6E A;  5D6E A;  3TAV A;  3PN9 A;  4A6W A;  2B3L A;  4IKS A;  1WL9 A;  1B6A A;  4IKU A;  2P99 A;  1WKM A;  2GU7 A;  3MX6 A;  2Q94 A;  4JUQ A;  2GG8 A;  2V6C A;  1PV9 A;  2EVC A;  4R60 A;  2MAT A;  1W7V A;  4EGE A;  2BWT A;  5CDL A;  2EVO A;  1YW9 A;  1C24 A;  1WLR A;  3CTZ A;  1B59 A;  2IW2 A;  4U73 A;  4S2R P;  4U6W A;  3D27 A;  2EA2 A;  4Z7M A;  4S01 A;  1YJ3 A;  3MR1 A;  3L24 A;  4FLL A;  2GG3 A;  2GGB A;  1YW8 A;  3CB5 A;  4FO8 A;  2GA2 A;  3IL0 A;  4ZWO A;  1WL6 A;  2GG9 A;  2EVM A;  2GU6 A;  3FMQ A;  2Q93 A;  5JHU A;  3S6B A;  1XNZ A;  2P98 A;  3TB5 A;  4U6J A;  2BWU A;  4KM3 A;  4U1B A;  5JI6 A;  1QXY A;  1XGS A;  3MAT A;  2OAZ A;  3IU9 A;  3ROR A;  1W2M A;  5E5B A;  4PNC A;  3PEB A;  4ZWP A;  3PKE A;  4U6C A;  1WY2 A;  4A6V A;  5CIK A;  5CDV A;  2OKN A;  2BWV A;  4FLI A;  4U70 A;  5JFR A;  2B3K A;  2BB7 A;  4IU6 A;  1QZY A;  4U6Z A;  5CE6 A;  1C22 A;  2EA4 A;  5FCF A;  2NQ7 A;  4U75 A;  2NQ6 A;  2GU5 A;  3PKC A;  1WBQ A;  2GU4 A;  2GGC A;  4RZZ A;  2V3Z A;  4S00 A;  2BWW A; 
#chains in the Genus database with same CATH homology
 4U69 A;  1WN1 A;  2Q95 A;  4FUK A;  2V3X A;  1KP0 A;  5D6F A;  3I7M A;  1XGN A;  2Q96 A;  2GTX A;  3OVK A;  4MAT A;  2P9A A;  4QR8 A;  4FLK A;  1QXW A;  1C21 A;  1A16 A;  2GG7 A;  4PV4 A;  1XGM A;  2BHA A;  2GG5 A;  2GG2 A;  2GZ5 A;  4U76 A;  3IG4 A;  2BN7 A;  3CB6 A;  1KQ9 A;  4FO7 A;  5CDE A;  3PKD A;  5FCH A;  2B3H A;  3OOO A;  4RGZ 1;  3PKA A;  5E2C A;  4FLJ A;  1R5H A;  3BIP A;  2ADU A;  2GG0 A;  2Q92 A;  3FM3 A;  1C23 A;  4B28 A;  3L7G A;  3QOC A;  1JAW A;  2BHC A;  1QXZ A;  2BWY A;  4IDY A;  3FMR A;  4FKC A;  1O0X A;  1Y1N A;  1YVM A;  4IKT A;  4IEC A;  4IPA A;  3BIQ A;  2Q8K A;  1R5G A;  3Q6D A;  2BWS A;  2BWX A;  2BHD A;  1N51 A;  1CHM A;  2HOW A;  3IU7 A;  2ZSG A;  4RZY A;  4U71 A;  4HXX A;  4ZWU A;  3BIT A;  1KQ0 A;  1MAT A;  3IU8 A;  2G6P A;  1XGO A;  4IKR A;  1R58 A;  1BOA A;  2BHB A;  2V3Y A;  5CNX A;  1YW7 A;  5CLS A;  3O5V A;  4ZNG A;  1C27 A;  3PKB A;  4OOK A;  4S2T P;  1BN5 A;  3RVA A;  2BH3 A;  1M35 A;  2DFI A;  4IF7 A;  4U6E A;  5D6E A;  3TAV A;  3PN9 A;  4A6W A;  2B3L A;  4IKS A;  1WL9 A;  1B6A A;  4IKU A;  2P99 A;  1WKM A;  2GU7 A;  3MX6 A;  2Q94 A;  4JUQ A;  2GG8 A;  2V6C A;  1PV9 A;  2EVC A;  4R60 A;  2MAT A;  1W7V A;  4EGE A;  2BWT A;  5CDL A;  2EVO A;  1YW9 A;  1C24 A;  1WLR A;  3CTZ A;  1B59 A;  2IW2 A;  4U73 A;  4S2R P;  4U6W A;  3D27 A;  2EA2 A;  4Z7M A;  4S01 A;  1YJ3 A;  3MR1 A;  3L24 A;  4FLL A;  2GG3 A;  2GGB A;  1YW8 A;  3CB5 A;  4FO8 A;  2GA2 A;  3IL0 A;  4ZWO A;  1WL6 A;  2GG9 A;  2EVM A;  2GU6 A;  3FMQ A;  2Q93 A;  5JHU A;  3S6B A;  1XNZ A;  2P98 A;  3TB5 A;  4U6J A;  2BWU A;  4KM3 A;  4U1B A;  5JI6 A;  1QXY A;  1XGS A;  3MAT A;  2OAZ A;  3IU9 A;  3ROR A;  1W2M A;  5E5B A;  4PNC A;  3PEB A;  4ZWP A;  3PKE A;  4U6C A;  1WY2 A;  4A6V A;  5CIK A;  5CDV A;  2OKN A;  2BWV A;  4FLI A;  4U70 A;  5JFR A;  2B3K A;  2BB7 A;  4IU6 A;  1QZY A;  4U6Z A;  5CE6 A;  1C22 A;  2EA4 A;  5FCF A;  2NQ7 A;  4U75 A;  2NQ6 A;  2GU5 A;  3PKC A;  1WBQ A;  2GU4 A;  2GGC A;  4RZZ A;  2V3Z A;  4S00 A;  2BWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...