2BX3A

Crystal structure of sars coronavirus main proteinase (p43212)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
source organism Sars coronavirus sin2774
molecule tags Hydrolase
molecule keywords MAIN PROTEINASE
total genus 89
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A02
1V2WT 2GKVE 4GSOA 1TGCA 5F6MA 3LU9B 1A5HA 5FCKA 1P09A 5FCRA 1WYKA 4U01A 1PPCE 3Q00A 4B2CA 2ZG0H 2AMPA 3GDUA 2PKAA 1LKAA 5JBAS 1MQ6A 1E36B 4WH8A 4YT7H 3SV2H 2M5TA 1H9IE 1BTWA 4A7IB 3RXFA 4FUCA 3ZZ7A 4HTCH 1UTPA 1YPJH 2RDLA 1WUNH 3E3TA 4VGCC 1T8OA 2AGIX 1C5SA 1XXDA 4ABDA 1UK3A 1TOCB 3RMNH 1P2QA 1GJDB 1A4WH 1VJ9U 5E2OA 2ZO3H 1ZHPA 2G55A 1LQEA 5LGOA 1Z71A 2P93A 1O2KA 4X2WA 3RXEA 3ZZ5A 1TRMA 1V2OT 5IYTA 1P06A 1P3CA 4U32A 3RDZA 4DURA 3VPKA 3H5CB 2OC7A 2O9QA 2H5DA 3L3TA 2BDYA 3E16B 2SNWA 1AKSB 1LPGB 3F9FA 1O3OA 4WJG2 2A45B 3A7WA 1CHOG 3U9AH 4AG2A 1IQMA 1ETTH 3GOVB 1EZXC 1SGCA 1A61H 1ETSH 3ELAH 3GYMA 3FZZA 1LHDH 2A2QH 1OWJA 1G36A 1MU6B 2WUBA 4Z6AH 2ZECA 4ZH8A 1ELDE 2TPIZ 1GI7B 4X1SU 2NU0E 2QA9E 8GCHF 1CVWH 2XC5A 1UCYH 1MD8A 4VGCB 1XKAC 3HK3B 1A0JA 1DXWA 1TQ0B 4X8UH 3GY6A 2A5IA 1O5BB 5C1XA 2FODA 4ZKOU 1HB0B 2PV9B 1G3EA 1FPCH 2P3FH 1O3GA 4RKJB 3FFGA 3HKJB 4MPVA 1GVZA 5FPSA 3FP8E 3PMAB 1ANEA 2EC9H 1A0LA 3D62A 2PKSC 3RXQA 1GJ5H 3LGIA 3RLYH 4FVDA 1EJNA 1L0ZA 4BNRA 2B0FA 4A5TS 1KTTB 2OC0A 3RMOH 5HYOA 1FY8E 4NA7A 4NG9H 4AFUA 1FDPA 1A2CH 1CA0C 2BLOA 2G4UA 1C2DA 3C1KA 1JIMA 3ESTA 1PPEE 1AE5A 2LIZA 1QGFA 1DLKB 1NRQH 1NRRH 2BTCE 7LPRA 2ZCKP 5TJXA 2BDBA 1QJ6B 1SGNE 2JETC 4WF8A 2R9PA 1CE5A 3PV4A 2QCYA 3D65E 1H4WA 2FS8A 4NA8A 1GGDC 1UVSH 3U8OH 3SW2B 4JMYA 3LONA 2QC2A 4I8LA 4I32A 1DSUA 2A32A 2XRCA 6ESTA 2W7UA 1D6RA 1PPGE 2VWLA 1VGCB 1EJAA 5JPMH 3RM0H 1SBWA 2Y81A 2GCTC 2A4RA 3MH5A 4E7RG 1THRH 1BZXE 4FUIA 2ZDNA 2A2XH 3TJUA 1JBUH 2GCHG 1OWIA 1RIWB 4B1TA 1ELVA 4YO9A 1KXCA 4BAMB 3T28A 1QTFA 2A7JA 3SGAE 2Y82A 1T8NA 3VXEH 3DUXH 3SNAA 4ZXYH 1GBLA 1VCWA 6GCHG 1YLDA 1TYNA 2TGPZ 5K0HA 5IDKA 4HI3A 5CE1A 1C2GA 2SGAA 1YKTA 2G51A 4AFSA 2GV6A 2RCEA 1J14A 2UUFB 2VB0A 2QV1A 1K22H 2G00A 3HATH 1Q3XA 1DY9A 5F8XA 4CR9A 1V2ST 2FIRH 2G5NA 4ABHA 1K2I1 1C1TA 1T4VH 2ZTXA 3A89A 2Z9IA 2H9HA 3BIUH 3QO6A 3LKWA 4K8BA 1THPB 1O3IA 4O3UA 2ZFSA 1QA7A 3URDA 2ZU3A 3NK8A 2GDDA 4ZROA 4YESB 1D4PB 3UOPA 4ZHAA 1UTQA 2XWBI 3UQOA 2FDAA 1FI8A 1HPGA 3VXFH 1TGBA 1C4V2 3T29A 2XYAA 3VGCB 1OYTH 5J4SA 5FHTA 5GJ4B 1PJPA 1IHSH 2BVRH 3QGNB 1IQHA 1AVGH 1SQTA 5T6DA 2P94A 1EATA 1EPTC 2WYGA 3H7TA 1C5LH 3A8BA 1PPBH 2BDGA 1F2SE 4JZFH 2P95A 4IW4E 3M5MA 2C93B 2PSYA 3RXOA 1PYTC 5C2ZA 2FOBA 1MTSA 4NSYA 3NKKA 2PLXA 4U2WA 3ZVBA 1C5TA 1P2IA 1HUTH 1W10U 1QRWA 4X6MA 3O8BA 3SJIA 1P01A 2AGGX 4X2YA 2QXJA 2PTNA 1J8AA 1C1VH 5DG6A 4YLUA 5C1YA 2ZU2A 3RUOA 3ZVAA 8KME2 3LJJA 1GJAB 5ABWA 2FOHA 3A83A 2XBVA 3MTYA 2Q6FA 1MH0A 1Y3XA 4FXGH 1MKWK 1MQ5A 1O32A 2F3CE 5FAHA 2A5AA 1KXEA 1W12U 2BDHA 1Y8TA 2Y80A 1DOJA 1OWHA 3A88A 3OY5U 2J38A 1EASA 5DP6A 1HDTH 1PFXC 5FX5A 1B7XB 2ZPRA 4OS7A 3B23B 4WXVA 2GZ8A 1DFPA 1LKBA 2A1DB 1ZSLA 3LGUA 4MVNA 4CRBA 2FX6A 2R3UA 2OC1A 3QUMP 2YOLA 2TRMA 1BCUH 1BTXA 4WMEA 1T31A 1IHTH 1ZOMA 2J34A 1P3EA 4GUXA 5JB9S 1TBRH 2FLBH 3EGKH 2ZEBA 1SR5C 1GWAA 2I6SA 1ELAA 1PPHE 1O31A 1ZMLA 2ZKSA 2UWOA 4Y71A 2VIWA 2XNIA 1ZHRA 5DP4A 1V2JT 2PFEA 2NWNA 4YM9A 4X8VH 1YPMH 2V3HH 3ATWA 4JCNA 2VIVA 1SOZA 3SU3A 1CA8B 1O5EH 1V2NT 1O36A 1B0FA 1ARCA 3NCLA 2F83A 1NM6A 2ODYB 1B5GH 1S6HA 3GY2A 1P11E 1AUJA 3PWCA 1AO5A 1SB1H 1TONA 3P8GA 3TH2H 1W2KH 2WPJS 2HRVA 3QN7A 2AMDA 3UFAA 4RSPA 1O2QA 3IG6B 4CBOA 1O2WA 2FXRA 4LZ4B 4B71A 4Y10E 2P59A 1Z8IB 2K1QA 3PROA 2GX4A 5LPFA 5F03A 2HLCA 3RU4E 5HMAA 1V2PT 1WQSA 2ZFPH 1G3BA 3SJOA 1KXBA 1GMDG 2ZQ1A 4A1XA 2VIDA 4B74A 1C5RA 3SU5A 4ZKNU 1ETRH 1VCQA 5HM2A 4ZUHA 1N8OB 2VJ1A 4JK5A 5DJ7A 1P0SH 3A7TA 4MNXA 1JRSA 2ZPQA 2Q6DA 2F9UA 2VIPA 3L6PA 4M7GA 4IBLH 4UFGH 1Y5UT 2ZFTA 3U1JB 1BRBE 1EAUA 3PMHB 4LOYH 1L2EA 1TNIA 1SHYA 1MAXA 1ANDA 1UTMA 2FEQH 3LIWA 3SO3A 3SZNA 5GXPA 1XM1A 2B9LA 1ARBA 5EODA 2ASUB 1VCPA 1BUIA 1O3DA 4MPUA 2CXVA 2ALVA 5ETXA 4GPGA 3ATIA 1EZQA 3MNBA 2Y5GA 5C5NA 1GI3A 3E91A 1BITA 2ZDVH 2FI5E 3EA8A 1C2EA 2BZAA 1HAOH 1AU8A 2BDAA 3UTUH 2J4IA 1O3MA 3A85A 4WWYA 1GBAA 4A1TA 2SGQE 3NWUA 4BAHB 2ILNA 1G2LA 1TNLA 2CF9H 2Z7FE 3A7XA 1K21H 5DKMA 1HLTH 3KQCA 1MBQA 3RXTA 2XCFA 1QY6A 4H42U 1A46H 2PHBA 1SLXB 2LPRA 4YOJA 1BRAA 3ZVDA 1ZTJA 4Q7XA 1EQ9A 5JYIA 1V2QT 1BOQA 1T8MA 4AZ2B 3V0XA 2Y7XA 3LGWA 1NROH 2BHGA 4H6TA 3AASA 1ZGIA 1L4ZA 5AHGH 1YPGH 1GJBB 5DP7A 1LVOA 8ESTE 4IS5A 5EXNA 2FESH 3RXIA 1GGDB 3P8NA 2XW9A 3ZYDA 4WMFA 1NRNH 4X1PU 5DGJA 2BY6X 5ESBA 9LPRA 1C1NA 1F5LA 4I31A 1GBFA 1GCTC 5L2ZH 1YYY1 1ZSKA 3RXAA 3ODDA 3C27B 4NIVA 3V7TA 2OCVB 1YBWA 4D8NA 2C90B 2OLGA 1C9TA 5I46H 1G2MA 1LQDB 1SPJA 1TABE 1UVOA 3CP7A 1FV9A 3LDXH 5C20A 3P6ZB 1CGIE 1BT7A 3SN8A 1O2VA 1LHEH 3PB1E 1RIWC 1QJ7B 3OX7U 1GJ9B 1GDQA 1GHAG 3TITA 3BV9B 1OP2A 5FBIA 2QXIA 1GBIA 1UTJA 3BTHE 3E1XB 3RXDA 2HALA 1SGQE 1NS3A 4INHA 2CN0H 4AGKA 1TGNA 4ABAA 5DP9A 3Q3YA 2VVVA 4CHAC 1GBEA 2EI7A 4D7FA 3A87A 1GBMA 2G5VA 1GHBF 2ZDKA 2ZGBH 3LC5A 3TJVA 2NU1E 4J1YA 1ZPCA 1SLWB 1T8LA 1V2VT 3O8DA 3MU8A 5B6OA 4TYDA 4ZHMU 1FQ3A 1T32A 3ENSB 1BTUA 3S9CA 7ESTE 3SHCH 1XMNB 1HNEE 5C1UA 3SOSA 1GVLA 1GI1A 2XWAA 3MH6A 1CT2E 2FX4A 1Z8RA 2BOHB 1NFUA 1GHWH 2TGDA 1TA2A 4AOQA 4BOHA 4CRAA 3D23A 2Y5FA 3RXCA 5A8ZA 3MNSA 2FOAA 3IITA 5EQQA 1A5IA 1Q2WA 3QTVH 1C1UH 3BIVH 2A7HA 1EB2A 1O5GH 4I8GA 4KKDA 1WQVH 2BY8X 1AI8H 2V35A 4A1VA 3AAVA 1S82A 3L33A 3OY6U 3RM2H 1GHAF 3A7YA 3SV8A 1F0RA 1KDQB 2OINA 3MNCA 2SGEE 4BAQB 1GBKA 1LHGH 2ZDLA 4ZAEA 2A31A 2ZZUH 1BRCE 2BLVA 4TY7A 4IMZA 3GCTG 1SLUB 3UY9A 1O2YA 3ZVFA 3MI4A 3PWBA 1E35B 2AH4X 3GCHC 2ZHEH 5CHAB 4OS2A 4JYVH 2CGAA 2I6QA 1JMOH 1AUTC 3LGTA 2WYJA 2VH0A 3FVFB 2UUYA 3TPIZ 4FUGA 1MTUA 3HGPA 2W26A 1D3TB 1HFDA 3ZYEA 4KGAA 5EPNA 3SI4H 2WINI 3ZZCA 3M5NA 4MTBA 1AFQC 2WV4A 1H8IH 1ZSJA 2RA0A 3VEQB 4Y8YA 1QQUA 3H7OA 3A81A 3MU5A 3BTQE 4WY3A 1DITH 3MU4A 3GYLB 1DM4B 1V2KT 1VITG 1L4DA 3SGBE 1O2NA 4JZIA 2Y7ZA 1QB6A 2VIOA 1O5CB 1WSSH 1GMHF 4K1TA 1JIRA 3S69A 1NY22 1TLDA 1CT0E 1VZQH 4B73A 3EYDA 4ABIA 1BTHH 4XFQA 1OOKB 3AW0A 1TNKA 1GHVH 1W0ZU 1F0SA 1QL8A 3K6ZA 2HWLB 2D2DA 1K1OA 1O5AB 2AFQB 4UFEH 1P02A 1AWFH 1ANCA 1M9UA 3SU1A 1P2MA 2ALPA 4ABJA 2WPLS 3EQ0H 3WY8A 3TJOA 1OP8A 3SNEA 1HAVB 1MCTA 2O8MA 2CV3A 2XTTB 3AAUA 1YP9A 1YLCA 2ZF0H 1O3FA 1CO7E 3GY3A 2P3TB 1OPHB 1TBQH 2QY0B 4Q80A 1SGFG 1K1JA 2BX4A 3IWMA 2BD5A 3Q77A 4A92A 3TGJE 2BDCA 3PO1C 1RXPA 1TNJA 4NIXA 4YOGA 3ZVGA 1MTWA 1SGPE 3CS0A 1J15A 3FAOA 1FONA 3GY4A 1GBTA 1S83A 3SV6A 3SUFA 3M61U 1PQ5A 3SU4A 1N6YA 1G3DA 1P2JA 4GAWA 1Q31A 3A8AA 3DD2H 2KAIA 3VB4A 2W7SA 3PLKA 1DSTA 3TU7H 2Z9GA 3RU4D 1TX8A 2ZHDA 1CGHA 4X0WU 4AFZA 2RG3A 3BEUA 1Z1JA 1C5UA 1E37B 1LO6A 1SQOA 1ZYOA 1QIXB 1LPKB 5GPIB 3T26A 2ZU1A 1O3LA 4OGXA 4AGJA 2D8WA 4X6OA 2UWLA 1ANBA 3RXKA 2XBWA 1EPTA 1S0RA 3M5LA 2O8LA 1TGSZ 1YPLH 4YLQH 2BY5X 4D9RA 5E8EH 2UUKB 2JH5D 2GVFA 1C1QA 1BIOA 1DANH 1EXFA 1O0DH 5A0CA 1TMTH 1MKXH 2VU8E 3UPEA 5A8YA 3NXPA 4MNWA 1UHBB 1EAXA 2IN2A 1C2HA 1F7ZA 1TA6A 1J16A 4WH6A 1O3BA 3RXMA 1G32B 1BHXF 3PMBB 4AX9H 1LHCH 1FY1A 5L30H 2C8ZB 1HAXB 2LNCA 3S7HB 1BA8B 3UOUA 2NU4E 3A8DA 4QT8C 4MNVA 1P2KA 5ESTE 5I25A 2BY7X 3RMLH 1YGCH 3VB6A 3MMGA 1HJ9A 1ELBA 1ESBA 1C5WB 3GCNA 1GI2A 3PTNA 3RC5A 1RFNA 4MLFB 5BRRE 1FJSA 1GG6B 2C8XB 2FP7B 1UJ1A 4JYUH 4K1SA 1Z7KA 4GVUA 1SGRE 2ZQ2A 2ZU5A 3M7TA 4LZ1H 1LHFH 2ZFRH 1XX9A 2DUCA 2H1UA 4DG4A 2ZGXH 3KEEA 3I78A 3U8TH 1D9IA 4MQAA 2Z94A 1CA0B 1FN6A 4BTUB 1WU1A 1W14U 1CBWB 1V2LT 7KMEH 4NWLA 3FP7E 5C5OA 3PYHA 1KLJH 1PPZA 2W3IA 3F9EA 1LVMA 4ZKRU 4K1EA 4D7GA 4AYVB 4HGCA 4OGYA 1GHXH 1NTPA 1EKBB 1IQKA 1AHTH 1KLIH 1DUAA 2V3OH 2QYIA 1ZHMA 4BANB 1GI8B 2YNBA 1QBOA 3GY5A 1W7GH 3GDVA 1ABIH 2ZGCA 2GZ9A 2BD3A 1TX6A 2ZC9H 5HM9A 1S6FA 2JKHA 4IC6A 2OD3B 5EOKA 3BTEE 1O34A 1SC8U 1W0YH 3RP2A 1NFXA 3ATKA 4R8TB 1Y3WA 2GMTC 2ZGJA 1O2GH 3TJNA 4CBNA 1BMLA 3E0PB 4UONA 2WPMS 1QA0A 2GP9B 1DWEH 5EGMA 4AB8A 2PKSB 3FZDA 3SUEA 3STIA 4DOQA 1GMCG 1Y59T 4O3TA 1S81A 1HIAB 3RXGA 1IQEA 4HZHA 5T6GA 4DIIH 4WXIA 1AKSA 1J9CH 2A4OA 1O2ZA 1UMAH 2WPHS 1P9SA 1UTKA 3GY7A 4FUEA 1NPMA 4K69A 2HNTC 3QTOH 4XSKU 1X7AC 4ABEA 1GG6C 1OX1A 4I8HA 1V2RT 1MTNC 3ZZ9A 1HJ8A 1BBRK 2HNTE 3E8LA 2C3SA 4X1QU 4BAKB 3E6PH 1MUEB 1EJMA 1SSXA 3QDZB 5EQSA 1FY4A 4D9QA 1TIOA 4F4OC 3RXUA 4JZEH 4TPYA 4Z0KA 1P2NA 4HFPB 2AIQA 1AGJA 1HBTH 1DICA 3PMJA 1O2IA 4KTSA 1YC0A 1QBVH 3S9AA 5E0HA 4IC5A 5EU8A 4INLA 4NA9H 3ATLA 3SU2A 1JWTA 4ABBA 2QXGA 3S7KB 1VJAU 3VB3A 4XE4A 1FNIA 1K9OE 2GT8A 1ELFA 4Y11E 3QK1A 2FOEA 5DP5A 2A0QB 4NFEA 2PUQH 3Q3XA 4Q2KA 5GWZA 1K1IA 2ZIQH 2Z3DA 4K2YA 1LVBA 3GCTF 2A4GA 4Y8ZA 5CHAC 8GCHG 5JDUB 3OSYA 3MH4A 1SMFE 3E0NB 4OS6A 4DVAU 4GHQA 1QHRB 5DO4H 3UREA 1MTVA 1GL1A 3QZRA 3UR6A 2XC0A 1C5VA 2V6NA 3TH4H 2P8OC 1IQNA 2IPHA 3BTDE 3HPTB 1TALA 1ZJDA 4UFDH 2A4QA 4AORA 1AVXA 1AB9B 1C2FA 5F8TA 3RXPA 3S9BA 4DCDA 2B8OH 2HOBA 1OP0A 2Z6BD 4KTUA 3I77A 2FYQA 4ZXXH 3ZZ8A 4IMQA 1UK2A 1P04A 1GCTB 1OKXA 1GJ4H 3KQDA 2Z9JA 1O2MA 2K7XA 2Z3EA 1K1LA 1MD7A 1QCPA 1GVKB 1EPTB 1O3CA 2XCNA 1Z6EA 3GCOA 2OQUA 1S85A 3RXSA 3TK5A 4E06H 1O3PB 2OBQA 3RXHA 1W13U 4X8TH 4ISLA 3KN2A 1TOMH 1HAPH 1IQGA 3SGQE 2F9PA 1NC6A 1YCPH 1AE8H 4KTCA 4I8JA 3F68H 1PYTD 1KDQA 5JBBS 1O35A 2HVXA 2TIOA 1GDUA 1AZ8A 4MPWA 3MFJA 4AYYB 1V2TT 5F8ZA 4Q7YA 1DS2E 4B2BA 4DW2U 3GICB 2CHAC 1P8VC 3ZZDA 4ASHA 1H9HE 1DT2A 3P17H 1TFXA 3P8FA 2EA3A 1IQJA 4FU9A 1BJVA 4CH8B 4K60A 1L1GA 1DX5M 1KTSB 3M7UA 6LPRA 1K1NA 2F9VA 6CHAB 4J2YB 4JZ1A 2H2ZA 3A84A 4LXBH 4K3JA 1JOUB 1VITF 4TY6A 1RRKA 1OWEA 2VGCB 1XVMA 3MYWA 3KGPA 1O2JA 4MPXA 1MKWH 1FLEE 1HAYB 1MU8B 1CBWC 3OU0A 4U30A 3K65B 1A3BH 1O3HA 4O03A 1FIWA 2QF3A 3O8RA 2FS9A 1B0EA 1TPAE 1BBRH 4MNYA 1A0HB 3TIUA 2QAAA 4Y7AA 2VVUA 1N8OC 1D3DB 1ZRKA 1VITH 3GISB 1C5XB 2H6MA 4AN7A 1GI6A 2SGFE 1A1RA 4FVBA 3ZZ4A 3V3MA 2QIQA 1ORFA 1UCYK 1MZAA 2TBSA 2O8TA 3SI3H 5DK1A 2GZ7A 3UQVA 3DFJA 4DGJA 6CHAC 1O2OA 4FUBA 1AVWA 8LPRA 1RD3B 4BTTB 1ZJKA 2FOGA 1SGIB 2FOCA 1YPEH 2GT7A 1GBBA 1FZZA 1EP5A 1PQ7A 3LJOA 1GBHA 2BMGB 1TWXB 2AGEX 1TNHA 3M35A 1A3EH 2HPQH 2ZCHP 4PROA 3TVJB 2QXHA 1G30B 1KLTA 4INKA 2FM2A 1WBGB 4FUHA 1SHHB 1TGTA 1C1OA 5J4QA 1V3XA 3HKIB 2AMQA 1OWKA 5SGAE 3ZZAA 3MO9A 5DP3A 1MTNB 5T3HA 1D6WA 3SU6A 3BTFE 1ZPZA 3U8RH 3RLWH 2AEIH 1N6XA 1Y3YA 3LH1A 3ZV9A 3SJ8A 4FU8A 2DE9A 5GIBA 1ESAA 1VGCC 3P8OA 5E0JA 1TPSA 4ISOA 4OS5A 3SORA 2ZHFH 4Q7ZA 2PUXB 1GPZA 2BYAX 1DWBH 1C5ZB 1DLEA 1ZR0A 2R0LA 1AY6H 1WOFA 1O33A 2BD7A 4NZQA 1CQQA 1INCA 2SGPE 1QB9A 2BXTH 3T2NA 1W7XH 2ANMH 3U1IB 2PW8H 2GV7A 3UUZA 2FPZA 1DE7H 1O39A 2EEKA 1OYQA 4ABFA 2GCHF 4X1NU 1UTLM 2Q1JA 5L6NH 1C4U2 1SGDE 1T4UH 3BTKE 2R0KA 4ZHLU 3RXRA 3Q3KA 4R0IA 4UD9H 2FOMB 1P05A 2WPIS 1E38B 1C4Y2 1H1BA 1BTYA 1SL3A 4CRDA 1BRUP 1UVUH 1QB1A 1C9PA 2ZDMA 4X2VA 1LDTT 1O2UA 4XOJA 3JZ2B 1FY3A 1DWDH 3T62A 1CT4E 2VWNA 1F0UA 5HGGA 3SUDA 3PTBA 1FY5A 1BDAA 2VGCC 3SJ9A 2JH6D 1NRPH 2V0BA 1O3EA 3KF2A 9ESTA 5GCHG 4Y76A 1HAVA 3K9XB 2ZTZA 1NU7B 1O38A 3PLPA 2SGDE 1GHBG 2W3KA 1FPHH 1C5OH 3P95A 1A5GH 4FUJA 2D1JA 1FAKH 4B75A 1O3JA 1HXFH 1BHXB 4LK4A 1EOJA 1SGYE 1MMJN 2GCTB 1XXFA 4X2XA 4Y0YE 1AQ7A 3RXLA 3PO1B 2D26C 1W8BH 2BM2A 1LCYA 2QF0A 4CR5A 1DPOA 4XBDA 1P57B 1JXPA 5A0AE 4MDSA 3ZVEA 1W3CA 3VB5A 2FYRA 1UTNA 5JBCS 4CRFA 1WAYB 1FXYA 1GDNA 3ZZBA 3KCGH 3B9FH 5A8XA 2C8YB 2AIPA 5FXLA 1SVPA 3SV7A 1L1NA 1Y5AT 2AERH 1O2PA 1E0FD 3HK6B 3K2UA 1C2JA 3DHKH 1Z8JB 3GCHB 1O30A 3UWJH 3KQBA 3EAJA 1C5MD 1EZUC 1LTOA 4IN2A 1ZLRA 4Y8XA 1BBRE 1ELCA 1BMMH 2F9OA 3ITIA 5DPAA 2JETB 3M3SA 3P70B 3NZIA 1QL7A 1DDJA 2ODPA 4Y7BA 2P16A 5GCHF 1U6QA 4CRGA 1F92A 3U98H 2PGBB 1QURH 1GI0A 1ZGVA 1AFQB 4Y0ZE 5AFZH 3AVZA 3ODFA 1ZMJA 1QL9A 2FLRH 1H9LB 4CREA 4AB9A 2P8OB 4FU7A 1XUHA 3F1SB 3FP6E 2VIQA 4WMDA 1O2XA 1QBNA 2FO9A 1G37A 1QRXA 1SG8B 1TNGA 1O2TA 2FTMA 1QJ1B 3EA9A 1DUEA 4ZMAH 1J17T 4I33A 4ABGA 3GDSA 5G4BA 1FN8A 2B5TB 4XDEA 1V2UT 1PQAA 2VVCA 4NIWA 1ELTA 2ZU4A 1GBDA 3BN9A 2VH6A 3SQEE 2G4TA 1NO9H 2NU3E 3D49H 1IQIA 5PTPA 3KQEA 3SNCA 4NWKA 3OYPA 1FUJA 3VGCC 3MU0A 4THNH 1QQ4A 2AYWA 4OS4A 2OBOA 2Z9KA 5AVDA 3ZV8A 2F9NA 4X8SH 2BLWA 1AWHB 3BTGE 1NU9A 4GCHF 4GCHG 5DP8A 4I8KA 1C1RA 1Z8GA 3SNDA 3EBNA 1SOTA 1GCDA 1HGTH 1XUIA 1GHZA 1HXEH 3QLPH 4K8YA 2J9NA 2BQ6B 1A7SA 2PKAB 3BEFB 4SGAE 1IQLA 2OTVA 1AD8H 3TK9A 2H9TH 1RGQA 1XKBC 2THFB 5TCAA 3FANA 3ZZ6A 1CU1A 1DXPA 3OTJE 1O5DH 1ACBE 1F5KU 4UFFH 4D76A 1D3QB 4CHAB 3RXJA 3M5OA 1NN6A 1AB9C 1XUJA 2GGVB 1TQ7B 1TMBH 5CMXH 1TE0A 4Y79A 4SGBE 1O2HA 2IOTA 1BQYA 3UWIA 1BB0B 2EI6A 4NZLA 1F5RA 1GL0E 1C2MA 5FBEA 3BTWE 4BTIB 2PSXA 1HJAB 1CHGA 1GHYH 2O8UA 3RC4A 1YCPM 1PQ8A 1ZMNA 1EAWA 2VWMA 1QRZA 4BXSA 1C2IA 2ZFFH 1RJXB 1OS8A 2R2MB 1THSH 2BZ6H 1Z1IA 2ZFQH 2VNTA 3QX5H 1YPKH 2SNVA 2G52A 1K1MA 2BQWB 2CF8H 3R0FA 2A7CA 4KP0A 2EI8A 3RMMH 4CRCA 3SUGA 2ODQA 5JB8S 3DA9B 1YPHE 2PWXA 1DVAH 1EAIA 3LOXA 1UCYE 1YPHC 1V6DA 5EXLA 1EP6A 1EUFA 1GMHG 2BVSH 4X6NA 2HGTH 3TGKE 1GJCB 1OXGA 1QFKH 1TAWA 4NSVA 3BG4B 1HAHH 1TPOA 2Y5HA 1TMUH 4TWYA 2DE8A 2GMTB 5LPRA 1VR1H 2PGQB 1NFWA 1P9UA 1SGTA 2BB4A 2TGTA 3BF6H 1LMWB 4A6LA 2ANKH 4H6SB 1UTOA 2OQ5A 3SJKA 1GMDF 1WV7H 2A5KA 2SFAA 1UK4A 4FUDA 4YTAA 2UUJB 3BG4C 2CJIA 2HPPH 4DIHH 4WVPE 4DT7B 5EXMA 2JH0D 1L1JA 1KXFA 4DJZB 4YOIA 3RC6A 1MCVA 1NZQH 1C5PA 1WCZA 1CHOF 1IAUA 3SHAH 2ZP0H 4TPIZ 4JZDH 1C1SA 3UIRA 1KYNA 1AN1E 1RTKA 2ZNKH 1YM0A 3TH3H 2IJOB 5GDSH 2BD9A 2BXUH 2HNTF 5EQRA 5A0BA 3SNBA 2BD2A 5E0GA 5JBTA 5EPYA 1P12E 2AS9A 3F9GA 4MG3A 5C67A 5EW1H 3TNTA 2GTBA 3HGNA 3W95A 2OXSA 2PTCE 1IOEA 1HJAC 2ZDAH 3UNQA 1P2OA 1O2SA 1C2KA 2B7DH 1HRTH 1SI5H 3M7QA 1ZRBA 1ZTLA 1CSOE 2XBYA 3CS7A 1XUGA 2R3YA 2XC4A 1CGJE 2ZTYA 4IGDA 2QGRA 2C4FH 3KIDU 3W94A 2ZA5A 3QZQA 1FMGA 3ZVCA 4TWWA 1C1PA 1ESTA 1F0TA 1HAGE 2CHAB 1HCGA 5A2MH 5AF9H 3M37A 3LH3A 2YNAA 2ZHWH 1BJUA 5EG4A 1QR3E 2STBE 3O8CA 4RN6A 1KXAA 3SQHE 3ZZ3A 4XBBA 1BTPA 5A09A 1O2LA 1NRSH 2FI4E 2KAIB 4ISNA 1OSSA 3URCA 3MNXA 5HXFA 1TRYA 2F91A 1PPFE 5L2YH 1P03A 3A80A 2OP9A 3MO3A 2ZI2H 1IQFA 1TB6H 3N7OA 1Y5BT 2STAE 2G81E 1ABJH 1O37A 3MU1A 3A82A 7GCHF 2OC8A 3BSQA 1SFQB 1S0QA 3B8JA 4JYTA 1GBCA 2ZPSA 3MH7A 3EE0B 3M3VA 5AFYH 3T5FH 1TRNA 1W11U 1S5SA 2ANWA 2ZWLH 1O5FH 3CENA 1KSNA 2C8WB 1EB1H 1SQAA 2VWOA 4X6PA 5FX6A 1KY9A 2BD8A 4GHTA 1O3KA 1FIZA 1KXDA 4NFFA 5FPTA 1UVPA 4NGAH 2W5EA 3EDXB 5K7RA 3M36A 3A86A 1EZSC 2TGAA 1GBJA 1D3PB 2QN5T 1AZZA 1RTFB 2J2UA 3KHVA 3K6YA 3I29A 2FZZA 4AG1A 3MOCA 2RA3A 1UHBA 2WV5A 3SV9A 1MKXK 3NUMA 1DY8A 1DWCH 1O3NA 5LPEA 1C5QA 1LPZB 1N1LA 4NCYA 3V12A 4UE7H 3SU0A 1LVYA 2ZCLP 3TK6A 2ZHQH 1NT1A 3M3TA 4ZKSU 4AFQA 1HAIH 1HV7A 3DT0H 3A7ZA 3VFEA 3MHWU 3QGJA 3Q76A 5T6FA 5TCCA 1Y3VA 2GDEH 3P92A 4FUFA 4GLYA 3F9HA 3A7VA 1TX7A 1TBZH 5LH8A 4O9VA 2H9EH 2R2WU 1Y3UA 4BAOB 1WTGH 1WTHD 4ISHH 3V13A 1XUFA 2BD4A 1MZDA 5EW2H 2FMJA 2BDIA 4B76A 2VINA 3PLBA 1QNJA 2Y6TA 3ATMA 4KELA 4O97A 3BTTE 3LGYA 3NPSA 4YZUA 1MAYA 2BQ7B 4F49A 4OS1A 1ZZZA 1RS0A 3LPRA 4X1RU 1P10A 4I7YH 2FOFA 2G8TA 2H5CA 1YCPK 2ESTE 1GJ7B 1SGEE 3KNXA 1Z6JH 2WUCA 4K5ZA 3E90B 3BG8A 4UEHH 1HIAA 5H4IB 1K1PA 1EX3A 1GJ8B 4UDWH 2Z3CA 3PM3A 6GCHF 1BMAA 1C1MA 2J94A 1V2MT 3MWIU 4E05H 1ZPBA 2CMYA 3U69H 4CH2B 2WPKS 2O8WA 1BTZA 1XUKA 4NIYA 5FPYA 1G9IE 1SGFA 2XXLA 1EOLA 1C5YB 1YF4A 1JRTA 3BTME 4RKOB 3S0NA 1KIGH 1MBMA 1AFEH 2BY9X 3MO6A 4B2AA 2OUAA 1XVOA 3TGIE 4BXWA 1ELGA 3LGVA 3T27A 1GJ6A 2UWPA 2BX3A 1E34B 3UNSA 1C5NH 1ELEE 3BEIB 7GCHG 1H8DH 2F9BH 3KL6A 1C1WH 1SLVB 1HAZB 1AIXH 1RTLA 1UVTH 4IN1A 2PR3A 4ISIH 2GD4B 1GI5A 1ZTKA 2NU2E 3JZ1B 1S84A 2FWWA 3UNRA 3AW1A 3STJA 2FTLE 3RXVA 3QWCH 1AMHA 1NESE 3T25A 4Y6DA 1K28D 3F6UH 2ANYA 1GI4A 2ULLA 2Z9LA 3LC3A 3GY8A 2BOKA 4XBCA 3A8CA 3EA7A 4H4FA 4ESTE 3VB7A 1NFYA 1HYLA 3RU4T 3G01A 1UO6A 3UR9A 1OWDA 3TNSA 3RXBA 2BVXH 2XBXA 4JK6A 1TPPA 1C2LA 2FI3E 5E2PA 1T7CA 1ID5H 4E7NA 4DY7B 1O3AA 5BPEA 1BMNH 1GI9B 3DFLA 2J95A 2J92A 3SBKA 5C3NA 1FAXA 2ZGHA 3LT3A 2Q6GA 2P3UB 3R3GB 1SFIA 2BLQA 1GMCF 3TLOA 1O2RA 4YT6H 1G3CA
chains in the Genus database with same CATH superfamily
1V2WT 2GKVE 4GSOA 1TGCA 5F6MA 3LU9B 1A5HA 5FCKA 1P09A 5FCRA 1WYKA 4U01A 1PPCE 3Q00A 4B2CA 2ZG0H 2AMPA 3GDUA 2PKAA 1LKAA 5JBAS 3F2GA 1MQ6A 1E36B 4WH8A 4YT7H 3SV2H 2M5TA 1H9IE 1BTWA 4A7IB 3RXFA 4FUCA 3ZZ7A 4HTCH 1UTPA 1YPJH 2RDLA 1WUNH 3E3TA 4VGCC 1T8OA 2AGIX 1C5SA 1XXDA 4ABDA 1UK3A 3U28C 1TOCB 3RMNH 1P2QA 1GJDB 1A4WH 4I86A 1VJ9U 5E2OA 5FL7D 2ZO3H 1ZHPA 2G55A 4RT0A 1LQEA 5LGOA 1Z71A 2P93A 1O2KA 2J98A 3PRDA 4X2WA 3RXEA 3ZZ5A 1TRMA 1V2OT 5IYTA 1P06A 1P3CA 4U32A 3RDZA 4DURA 3VPKA 3H5CB 2OC7A 2O9QA 2H5DA 3L3TA 4Z1MD 2BDYA 3E16B 2SNWA 1AKSB 1LPGB 4P00A 3F9FA 1O3OA 4WJG2 2A45B 3A7WA 1CHOG 3U9AH 4AG2A 1IQMA 1ETTH 3GOVB 1EZXC 1SGCA 1A61H 1ETSH 3ELAH 3GYMA 3FZZA 1LHDH 2A2QH 1OWJA 1G36A 1MU6B 2WUBA 4Z6AH 2ZECA 2KX4A 1ELDE 3KYGA 4ZH8A 2TPIZ 1GI7B 4X1SU 2NU0E 2QA9E 8GCHF 1CVWH 2XC5A 1UCYH 1MD8A 4VGCB 1XKAC 3HK3B 1A0JA 1DXWA 1TQ0B 4X8UH 3GY6A 2A5IA 1O5BB 5C1XA 2FODA 4ZKOU 1HB0B 2WSSD 2PV9B 1G3EA 1FPCH 2P3FH 1O3GA 4RKJB 3FFGA 3HKJB 4MPVA 3DSGA 1GVZA 5FPSA 3FP8E 3PMAB 1ANEA 2EC9H 1A0LA 3D62A 2PKSC 3RXQA 1GJ5H 3LGIA 3RLYH 4FVDA 1EJNA 1L0ZA 4BNRA 2B0FA 4A5TS 1KTTB 2OC0A 3RMOH 5HYOA 1FY8E 3OAAD 4NA7A 4NG9H 4AFUA 1FDPA 3FO8D 1A2CH 1CA0C 2BLOA 2G4UA 1C2DA 3C1KA 1JIMA 3ESTA 1PPEE 1AE5A 2LIZA 1QGFA 1DLKB 1NRQH 1NRRH 2BTCE 7LPRA 2ZCKP 5TJXA 2BDBA 1QJ6B 1SGNE 2JETC 4WF8A 2R9PA 1CE5A 1NBME 3F3BA 3PV4A 2QCYA 3D65E 1H4WA 2FS8A 4TT3D 4NA8A 1GGDC 1UVSH 3U8OH 3SW2B 4JMYA 3LONA 2QC2A 4I8LA 4I32A 1DSUA 2A32A 2XRCA 6ESTA 2W7UA 1D6RA 1PPGE 2VWLA 1VGCB 1EJAA 5JPMH 3RM0H 1SBWA 2Y81A 4TSFD 2GCTC 2A4RA 3MH5A 4E7RG 1THRH 1BZXE 4FUIA 2ZDNA 2A2XH 3TJUA 1JBUH 2GCHG 1OWIA 1RIWB 2AHME 4B1TA 1ELVA 4YO9A 1KXCA 4BAMB 3T28A 1QTFA 2A7JA 3SGAE 2Y82A 1T8NA 3VXEH 3DUXH 3SNAA 4ZXYH 1GBLA 1VCWA 6GCHG 1YLDA 1TYNA 2TGPZ 5K0HA 5IDKA 4HI3A 5CE1A 1C2GA 2SGAA 1YKTA 2G51A 3W1EA 4AFSA 2GV6A 2RCEA 4P02A 1J14A 2UUFB 2VB0A 2QV1A 1K22H 2YMSC 2G00A 3HATH 1Q3XA 1DY9A 5F8XA 4CR9A 1V2ST 2FIRH 2G5NA 4ABHA 1K2I1 1C1TA 1T4VH 2ZTXA 3A89A 2Z9IA 2QF4A 2H9HA 3BIUH 3QO6A 3LKWA 4K8BA 1THPB 1O3IA 4O3UA 2ZFSA 1QA7A 3URDA 2ZU3A 3NK8A 2GDDA 4ZROA 4YESB 1D4PB 3UOPA 4ZHAA 1UTQA 2XWBI 3UQOA 2FDAA 1FI8A 1HPGA 3VXFH 1TGBA 1C4V2 3T29A 2XYAA 3VGCB 1OYTH 5J4SA 5FHTA 5GJ4B 1PJPA 1IHSH 2BVRH 3QGNB 1IQHA 1AVGH 1SQTA 5T6DA 2KR7A 2P94A 1EATA 1EPTC 2WYGA 3H7TA 1C5LH 3A8BA 1PPBH 2BDGA 1F2SE 4JZFH 2P95A 4IW4E 3M5MA 2C93B 2PSYA 3RXOA 1PYTC 5C2ZA 2FOBA 1MTSA 4NSYA 3NKKA 2PLXA 4U2WA 3ZVBA 1C5TA 1P2IA 1HUTH 1W10U 1QRWA 4X6MA 3O8BA 3SJIA 1P01A 2AGGX 4X2YA 2QXJA 2PTNA 1J8AA 1C1VH 5DG6A 4YLUA 5C1YA 2ZU2A 3RUOA 3ZVAA 8KME2 3LJJA 1GJAB 5ABWA 5C0TA 2FOHA 3A83A 2XBVA 3MTYA 2Q6FA 1MH0A 1Y3XA 4FXGH 1MKWK 1MQ5A 1O32A 2F3CE 5FAHA 2A5AA 1KXEA 4ACBA 1W12U 2BDHA 1Y8TA 2Y80A 1DOJA 1OWHA 3A88A 3OY5U 2J38A 1EASA 5DP6A 1HDTH 1PFXC 5FX5A 1B7XB 2ZPRA 3N7EA 4OS7A 3B23B 4WXVA 2GZ8A 1DFPA 1LKBA 2A1DB 1ZSLA 3LGUA 4MVNA 4CRBA 2FX6A 2R3UA 2OC1A 3QUMP 3KQ5A 2YOLA 2TRMA 1BCUH 1BTXA 4WMEA 1T31A 1IHTH 1ZOMA 2J34A 1P3EA 4GUXA 5JB9S 1TBRH 2FLBH 3EGKH 2ZEBA 1SR5C 1GWAA 2I6SA 1ELAA 1PPHE 1O31A 1ZMLA 2ZKSA 3CNRA 2UWOA 4Y71A 2VIWA 2WZQA 2XNIA 1ZHRA 5DP4A 1V2JT 2PFEA 2NWNA 2J97A 4YM9A 4X8VH 1YPMH 2V3HH 3ATWA 4JCNA 2VIVA 1SOZA 3SU3A 1CA8B 1O5EH 1V2NT 1O36A 1B0FA 1ARCA 3NCLA 2F83A 1NM6A 2ODYB 1B5GH 1S6HA 3GY2A 1P11E 1AUJA 3PWCA 1AO5A 1SB1H 1TONA 3P8GA 3TH2H 1W2KH 2WPJS 2HRVA 3QN7A 2AMDA 3UFAA 4RSPA 1O2QA 2CK3D 3IG6B 1O2WA 4CBOA 2FXRA 4LZ4B 4B71A 3WW7A 4Y10E 2P59A 1Z8IB 2K1QA 3PROA 2GX4A 5LPFA 5F03A 2HLCA 3RU4E 5HMAA 1V2PT 1WQSA 2ZFPH 1G3BA 3SJOA 1KXBA 1GMDG 2ZQ1A 4A1XA 2VIDA 4B74A 1C5RA 3SU5A 4ZKNU 1ETRH 1VCQA 5HM2A 4ZUHA 1N8OB 2VJ1A 4JK5A 5DJ7A 1P0SH 3A7TA 4MNXA 1JRSA 2ZPQA 2Q6DA 2F9UA 2VIPA 3L6PA 4M7GA 4IBLH 4UFGH 1Y5UT 2ZFTA 3U1JB 1BRBE 1EAUA 2OK5A 3PMHB 4LOYH 5DSFA 1L2EA 1TNIA 5F53A 2W6ID 1SHYA 1MAXA 1ANDA 1UTMA 2FEQH 3LIWA 3SO3A 3SZNA 5GXPA 1XM1A 2LELA 3OFND 2B9LA 1ARBA 5EODA 2ASUB 1VCPA 1BUIA 1O3DA 4XRNA 4MPUA 2CXVA 2ALVA 5ETXA 4GPGA 3ATIA 4ACAA 1EZQA 3MNBA 2Y5GA 5C5NA 1GI3A 3E91A 2J98B 1BITA 2ZDVH 2FI5E 3EA8A 1C2EA 2BZAA 3N7DA 1HAOH 1AU8A 2BDAA 3UTUH 2J4IA 1O3MA 3A85A 4WWYA 1GBAA 4A1TA 2SGQE 3NWUA 4BAHB 2ILNA 1G2LA 1TNLA 2CF9H 2Z7FE 3A7XA 1K21H 5DKMA 1HLTH 3KQCA 1MBQA 3RXTA 2XCFA 1QY6A 4H42U 1A46H 2PHBA 1SLXB 2LPRA 4YOJA 1BRAA 3ZVDA 1ZTJA 4Q7XA 1EQ9A 5JYIA 1V2QT 1BOQA 1T8MA 2XOKD 4AZ2B 3V0XA 2Y7XA 3LGWA 1NROH 4ASUD 2BHGA 5HIZA 4H6TA 3AASA 1ZGIA 1L4ZA 5AHGH 1YPGH 1GJBB 5DP7A 1LVOA 8ESTE 4IS5A 5EXNA 2FESH 3RXIA 1GGDB 3P8NA 2XW9A 2JJ2D 3ZYDA 4WMFA 1NRNH 4X1PU 5DGJA 2BY6X 5ESBA 9LPRA 1C1NA 1F5LA 4I31A 1GBFA 1GCTC 5L2ZH 1YYY1 1ZSKA 3RXAA 3ODDA 3C27B 4NIVA 3V7TA 2OCVB 1YBWA 4D8NA 2C90B 2OLGA 1C9TA 5I46H 1G2MA 1LQDB 1SPJA 1TABE 1UVOA 3CP7A 1FV9A 3LDXH 5C20A 3P6ZB 1CGIE 4RT1A 1BT7A 3SN8A 1O2VA 1LHEH 3PB1E 1RIWC 1QJ7B 3OX7U 1GJ9B 1GDQA 1GHAG 3TITA 3BV9B 1OP2A 5FBIA 2QXIA 1GBIA 1UTJA 3BTHE 3E1XB 3RXDA 2HALA 1SGQE 1NS3A 4INHA 2CN0H 4AGKA 1TGNA 4ABAA 5DP9A 3Q3YA 4XD7D 2VVVA 5KEDA 4CHAC 1GBEA 2EI7A 4D7FA 3A87A 4Q4LA 1GBMA 2G5VA 1GHBF 2ZDKA 2ZGBH 3LC5A 3TJVA 2NU1E 1SKYE 4J1YA 1ZPCA 1SLWB 1T8LA 1V2VT 3O8DA 3MU8A 5B6OA 4TYDA 4ZHMU 1FQ3A 2KFWA 1T32A 3ENSB 1BTUA 3S9CA 7ESTE 3SHCH 1XMNB 1HNEE 5C1UA 3SOSA 1GVLA 1GI1A 2XWAA 3MH6A 1CT2E 2FX4A 1Z8RA 2BOHB 1NFUA 1GHWH 2TGDA 3AK5A 1TA2A 4AOQA 4BOHA 4CRAA 3D23A 2Y5FA 3RXCA 5A8ZA 3MNSA 2FOAA 3IITA 5EQQA 1A5IA 1Q2WA 3QTVH 1C1UH 3BIVH 2A7HA 1EB2A 1O5GH 4I8GA 4KKDA 3OE7D 1WQVH 2HLDD 2BY8X 1AI8H 2V35A 4A1VA 3AAVA 1S82A 3L33A 3OY6U 3RM2H 1GHAF 3A7YA 3SV8A 1F0RA 1KDQB 2OINA 3MNCA 5CDFE 2SGEE 4BAQB 1GBKA 1LHGH 2ZDLA 4ZAEA 2A31A 2ZZUH 5EIYA 1BRCE 2BLVA 4TY7A 4IMZA 3GCTG 1SLUB 3UY9A 1O2YA 3ZVFA 3MI4A 3PWBA 1E35B 2AH4X 3GCHC 2ZHEH 5CHAB 4OS2A 4JYVH 2CGAA 2JDID 2I6QA 1JMOH 1AUTC 4RI0A 3LGTA 2WYJA 2VH0A 3FVFB 2UUYA 3TPIZ 4FUGA 5HKKD 1MTUA 2WPDD 3HGPA 2W26A 1D3TB 1HFDA 3ZYEA 4KGAA 5EPNA 5EJLA 3SI4H 2WINI 3ZZCA 3M5NA 4MTBA 1AFQC 2WV4A 2JJ1D 1H8IH 1ZSJA 2RA0A 3VEQB 4Y8YA 1QQUA 3H7OA 3A81A 3MU5A 2V7QD 3BTQE 4WY3A 1DITH 3MU4A 3GYLB 1DM4B 1V2KT 1VITG 1L4DA 3SGBE 1O2NA 4JZIA 2Y7ZA 1QB6A 2VIOA 1O5CB 1WSSH 1GMHF 5B6LA 4K1TA 1JIRA 3S69A 1NY22 1TLDA 1CT0E 1VZQH 4B73A 3EYDA 4ABIA 1BTHH 4XFQA 1OOKB 3AW0A 1TNKA 2V3MA 1GHVH 1W0ZU 1F0SA 1QL8A 3OEED 3K6ZA 2HWLB 2D2DA 1K1OA 1O5AB 2AFQB 2KCOA 4UFEH 1P02A 1AWFH 1ANCA 1M9UA 3SU1A 1P2MA 2ALPA 4ABJA 2WPLS 3EQ0H 3WY8A 3TJOA 1OP8A 3SNEA 1HAVB 1MCTA 2O8MA 2CV3A 2XTTB 3AAUA 1YP9A 1YLCA 3FKSD 2ZF0H 1O3FA 1CO7E 3GY3A 2P3TB 1OPHB 1TBQH 2QY0B 4Q80A 1SGFG 2YMSB 1K1JA 2BX4A 3IWMA 2BD5A 3Q77A 4A92A 3TGJE 2BDCA 3PO1C 1RXPA 1TNJA 4NIXA 4YOGA 3ZVGA 1MTWA 1SGPE 3CS0A 1J15A 3FAOA 2L74A 1FONA 3GY4A 1GBTA 1S83A 3SV6A 3EE7A 3SUFA 3M61U 1PQ5A 3SU4A 1N6YA 1G3DA 1P2JA 4GAWA 1Q31A 5T1VA 3A8AA 3DD2H 2KAIA 3VB4A 2K0QA 2W7SA 3PLKA 1DSTA 5KECA 3TU7H 2Z9GA 3RU4D 1TX8A 2ZHDA 1CGHA 4X0WU 3WWBA 4AFZA 2RG3A 3BEUA 1Z1JA 1C5UA 1E37B 1LO6A 1SQOA 1ZYOA 1QIXB 1LPKB 5GPIB 3T26A 2ZU1A 1O3LA 4OGXA 1VKYA 4AGJA 2D8WA 4X6OA 2UWLA 1ANBA 3RXKA 2XBWA 1EPTA 1S0RA 3M5LA 2O8LA 1TGSZ 1YPLH 4YLQH 2YMSD 2BY5X 4B6FA 4D9RA 5E8EH 2UUKB 2JH5D 2GVFA 1C1QA 4YXWD 1BIOA 1DANH 1EXFA 1O0DH 5A0CA 1TMTH 5EJ1A 1MKXH 2VU8E 3UPEA 5A8YA 3NXPA 4MNWA 1UHBB 1EAXA 2IN2A 1C2HA 1F7ZA 1TA6A 1J16A 4WH6A 1O3BA 3RXMA 1G32B 1H8HD 3KYFA 1BHXF 3PMBB 4AX9H 1LHCH 3PV2A 1FY1A 5L30H 2C8ZB 1HAXB 2LNCA 3S7HB 1BA8B 3SZEA 3UOUA 2F4LA 2NU4E 3A8DA 4QT8C 4MNVA 1P2KA 5ESTE 5I25A 2BY7X 3RMLH 1YGCH 3VB6A 3MMGA 1HJ9A 1ELBA 1ESBA 1C5WB 3GCNA 1GI2A 3PTNA 3RC5A 1RFNA 4MLFB 5BRRE 1FJSA 1GG6B 2C8XB 2FP7B 1YWUA 1UJ1A 4JYUH 4K1SA 1Z7KA 4GVUA 1SGRE 2ZQ2A 2ZU5A 3WWFA 3M7TA 4LZ1H 1LHFH 2ZFRH 1XX9A 2DUCA 2H1UA 4DG4A 2ZGXH 3KEEA 3I78A 3U8TH 2IJD1 1D9IA 4MQAA 2Z94A 1CA0B 1FN6A 4BTUB 1WU1A 1W14U 1CBWB 1V2LT 1UW7A 7KMEH 4NWLA 3FP7E 5C5OA 3PYHA 1KLJH 1PPZA 2W3IA 3F9EA 1LVMA 2J5UA 2JIZD 4ZKRU 2KZ4A 4K1EA 4D7GA 4AYVB 4HGCA 4OGYA 1GHXH 1NTPA 1EKBB 1IQKA 1AHTH 1KLIH 1DUAA 2V3OH 2QYIA 1ZHMA 4BANB 1GI8B 2YNBA 1QBOA 3GY5A 3VG8A 1W7GH 2M2AA 3GDVA 1ABIH 2ZGCA 2GZ9A 2BD3A 3DSPA 1TX6A 2ZC9H 5HM9A 1S6FA 2JKHA 4IC6A 2OD3B 5EOKA 2LP6A 3BTEE 1O34A 1SC8U 1W0YH 3RP2A 1NFXA 3ATKA 3F0PA 4R8TB 1Y3WA 2GMTC 2ZGJA 1O2GH 3TJNA 4CBNA 1BMLA 3E0PB 4UONA 2WHXA 2WPMS 1QA0A 2GP9B 1DWEH 2XNDD 5EGMA 4AB8A 2PKSB 3FZDA 3SUEA 3STIA 4DOQA 1GMCG 1Y59T 4FOUC 4O3TA 1S81A 1HIAB 3RXGA 1IQEA 1EFRD 4HZHA 5T6GA 4DIIH 4WXIA 1AKSA 1J9CH 2A4OA 1KMHB 1O2ZA 1UMAH 2WPHS 1P9SA 1UTKA 3GY7A 4FUEA 1NPMA 4K69A 1WDIA 2HNTC 3QTOH 4XSKU 1X7AC 4ABEA 1GG6C 1OX1A 4I8HA 1V2RT 1MTNC 3ZZ9A 1HJ8A 1BBRK 2HNTE 1OHHD 3E8LA 4Q63A 2C3SA 4X1QU 4BAKB 3E6PH 1MUEB 1EJMA 1SSXA 3QDZB 5EQSA 1FY4A 4D9QA 1TIOA 4F4OC 3RXUA 4JZEH 4TPYA 4Z0KA 1P2NA 4HFPB 2AIQA 1AGJA 1HBTH 1DICA 1E1QD 1O2IA 3PMJA 4KTSA 1YC0A 1QBVH 3S9AA 5E0HA 4IC5A 5EU8A 4INLA 4NA9H 3ATLA 3SU2A 1JWTA 4ABBA 2QXGA 1MABB 3S7KB 1VJAU 3VB3A 4XE4A 1FNIA 1K9OE 2F43B 2GT8A 1ELFA 4Y11E 3QK1A 5C17A 2FOEA 4OM9A 5DP5A 2A0QB 4NFEA 2PUQH 3Q3XA 4Q2KA 5GWZA 4AC9A 1K1IA 2ZIQH 2Z3DA 4K2YA 1LVBA 2KCYA 3GCTF 2A4GA 4Y8ZA 5CHAC 8GCHG 5JDUB 3OSYA 3MH4A 1SMFE 3E0NB 4OS6A 4DVAU 4GHQA 1QHRB 5DO4H 3UREA 1MTVA 1GL1A 3QZRA 3UR6A 2XC0A 1C5VA 2V6NA 3TH4H 2P8OC 1IQNA 2IPHA 3BTDE 3HPTB 1TALA 1ZJDA 4UFDH 2A4QA 4AORA 1AVXA 1AB9B 1C2FA 5F8TA 3RXPA 3S9BA 4DCDA 1W0JD 2B8OH 2HOBA 1E1RD 1OP0A 2Z6BD 2W6JD 4KTUA 3I77A 2FYQA 4ZXXH 3ZZ8A 4IMQA 1UK2A 1P04A 1GCTB 1OKXA 1GJ4H 3KQDA 2Z9JA 1O2MA 2K7XA 2Z3EA 1K1LA 1MD7A 1QCPA 1GVKB 1EPTB 1O3CA 3ZIAD 2XCNA 1Z6EA 3GCOA 2OQUA 1S85A 3RXSA 3TK5A 4E06H 1O3PB 2OBQA 3RXHA 1W13U 4X8TH 1WXRA 4ISLA 3KN2A 1TOMH 1HAPH 1IQGA 3SGQE 2F9PA 1NC6A 1YCPH 1AE8H 4KTCA 4I8JA 3F68H 1PYTD 1KDQA 5JBBS 1O35A 2HVXA 2TIOA 1GDUA 1AZ8A 4MPWA 3MFJA 4AYYB 1V2TT 5F8ZA 4Q7YA 1DS2E 4B2BA 4DW2U 3GICB 2CHAC 1P8VC 5HIYA 3ZZDA 1H9HE 4ASHA 1DT2A 3P17H 1TFXA 3P8FA 2EA3A 1IQJA 4FU9A 1BJVA 4CH8B 4K60A 1L1GA 1DX5M 1KTSB 3M7UA 6LPRA 1K1NA 2F9VA 6CHAB 4J2YB 4JZ1A 2H2ZA 3A84A 3NRLA 4LXBH 4K3JA 1JOUB 1VITF 4TY6A 1RRKA 1OWEA 2VGCB 1XVMA 3MYWA 3KGPA 1O2JA 4MPXA 1MKWH 1FLEE 1HAYB 1MU8B 1CBWC 3OU0A 4U30A 3K65B 2KCPA 1A3BH 1O3HA 4O03A 3UB0A 1FIWA 2QF3A 3O8RA 2FS9A 1B0EA 1K0HA 1TPAE 1BBRH 4MNYA 1A0HB 3TIUA 2QAAA 4Y7AA 2VVUA 1N8OC 1D3DB 1ZRKA 1VITH 3GISB 1C5XB 2H6MA 4AN7A 1GI6A 2SGFE 1A1RA 4FVBA 3ZZ4A 3V3MA 1YY3A 2QIQA 1ORFA 1UCYK 1MZAA 2TBSA 2O8TA 3SI3H 5DK1A 2GZ7A 3UQVA 3DFJA 4DGJA 6CHAC 1O2OA 4FUBA 1AVWA 8LPRA 1RD3B 4BTTB 1ZJKA 2FOGA 1SGIB 2FOCA 1COWD 1YPEH 2GT7A 1FX0B 1GBBA 1FZZA 1EP5A 1PQ7A 3LJOA 1GBHA 2BMGB 1TWXB 2AGEX 1TNHA 3M35A 1A3EH 2HPQH 2EY4C 2ZCHP 4PROA 3TVJB 5IK2D 2QXHA 1G30B 1KLTA 4INKA 2FM2A 1WBGB 4FUHA 1SHHB 1TGTA 1C1OA 5J4QA 1V3XA 3HKIB 2AMQA 5C0UA 1OWKA 5SGAE 3ZZAA 3MO9A 5DP3A 1MTNB 5T3HA 1D6WA 3SU6A 3BTFE 1ZPZA 3U8RH 3RLWH 2AEIH 1N6XA 1Y3YA 3LH1A 3ZV9A 3SJ8A 4FU8A 2DE9A 5GIBA 1ESAA 1VGCC 3P8OA 5E0JA 1TPSA 4ISOA 4OS5A 3SORA 2ZHFH 2KM0A 4Q7ZA 2PUXB 1GPZA 2BYAX 1DWBH 1C5ZB 1DLEA 1ZR0A 2R0LA 1AY6H 1WOFA 1O33A 2BD7A 4NZQA 1CQQA 1INCA 2SGPE 1QB9A 2QE7D 2BXTH 3T2NA 1W7XH 2ANMH 3U1IB 2PW8H 2GV7A 3UUZA 2FPZA 1DE7H 1O39A 2EEKA 1OYQA 4ABFA 2GCHF 4X1NU 5GNDA 1UTLM 2Q1JA 5L6NH 1C4U2 1SGDE 1T4UH 3BTKE 2R0KA 4ZHLU 1H8ED 3RXRA 3Q3KA 4R0IA 4UD9H 2FOMB 1P05A 3F2HA 2WPIS 1E38B 1C4Y2 1H1BA 1BTYA 1SL3A 4CRDA 1BRUP 1UVUH 3DCLA 1QB1A 1C9PA 2ZDMA 4X2VA 1LDTT 1O2UA 4XOJA 3JZ2B 1FY3A 1DWDH 3T62A 1CT4E 2VWNA 1F0UA 5HGGA 3SUDA 3PTBA 1FY5A 1BDAA 3MQKC 2VGCC 3SJ9A 2JH6D 1NRPH 2V0BA 1O3EA 3KF2A 9ESTA 5GCHG 4Y76A 1HAVA 3K9XB 2ZTZA 1NU7B 1O38A 3PLPA 2SGDE 1GHBG 2W3KA 1FPHH 1C5OH 3P95A 1A5GH 4FUJA 2D1JA 1FAKH 4B75A 1O3JA 1HXFH 1BHXB 4LK4A 1EOJA 1SGYE 1MMJN 1SQRA 1XXFA 2GCTB 4X2XA 4Y0YE 1AQ7A 3RXLA 3PO1B 2D26C 1W8BH 2BM2A 1LCYA 2QF0A 4CR5A 1DPOA 4XBDA 1P57B 1JXPA 5A0AE 4MDSA 3ZVEA 1W3CA 3VB5A 2FYRA 1UTNA 5JBCS 3FOAA 4CRFA 1WAYB 1FXYA 1GDNA 3ZZBA 3KCGH 3B9FH 5A8XA 2C8YB 2AIPA 5FXLA 1SVPA 3SV7A 1L1NA 1Y5AT 2AERH 1O2PA 1E0FD 3HK6B 3K2UA 1C2JA 3DHKH 1Z8JB 3GCHB 1O30A 3UWJH 3KQBA 3EAJA 1C5MD 1EZUC 1LTOA 4IN2A 1ZLRA 4Y8XA 1BBRE 1ELCA 1BMMH 2F9OA 3ITIA 5DPAA 1QZ8A 2JETB 3M3SA 3P70B 3NZIA 1QL7A 1DDJA 2ODPA 4Y7BA 2P16A 5GCHF 1U6QA 4CRGA 1F92A 3U98H 2PGBB 1QURH 5DN6D 1GI0A 3OEHD 1ZGVA 1AFQB 4Y0ZE 5AFZH 3AVZA 3ODFA 1ZMJA 1QL9A 2FLRH 1H9LB 1E79D 4CREA 4AB9A 2P8OB 4FU7A 1XUHA 3F1SB 3FP6E 3N99A 2VIQA 4WMDA 1O2XA 1QBNA 2FO9A 1G37A 1QRXA 1SG8B 1TNGA 1O2TA 2FTMA 1QJ1B 3EA9A 1DUEA 4ZMAH 1J17T 4I33A 4ABGA 3GDSA 5G4BA 1FN8A 2B5TB 4XDEA 1V2UT 1PQAA 2VVCA 4NIWA 1ELTA 2ZU4A 1GBDA 3BN9A 2VH6A 3SQEE 2G4TA 1NO9H 3GS9A 2NU3E 3D49H 1IQIA 5PTPA 3H09A 3SNCA 3KQEA 4NWKA 3OYPA 1FUJA 3VGCC 3MU0A 4THNH 1QQ4A 2AYWA 4OS4A 2OBOA 2Z9KA 5AVDA 3ZV8A 2F9NA 4X8SH 2BLWA 1AWHB 2VBCA 3BTGE 1NU9A 4GCHF 4GCHG 5DP8A 4I8KA 1C1RA 1Z8GA 3SNDA 3EBNA 1SOTA 1GCDA 1HGTH 1XUIA 1GHZA 1HXEH 3QLPH 4K8YA 2J9NA 2BQ6B 4M9FA 1A7SA 2PKAB 3BEFB 4SGAE 1IQLA 2OTVA 3OTPA 1AD8H 3TK9A 2H9TH 1RGQA 1XKBC 2THFB 5TCAA 3FANA 3ZZ6A 1CU1A 1DXPA 3OTJE 1O5DH 1ACBE 1F5KU 4UFFH 4D76A 1D3QB 4CHAB 3RXJA 3M5OA 1NN6A 1AB9C 1XUJA 2GGVB 1TQ7B 1TMBH 5CMXH 1TE0A 4Y79A 4SGBE 1O2HA 2IOTA 1BQYA 3UWIA 1BB0B 2EI6A 4NZLA 1F5RA 1GL0E 1C2MA 5FBEA 3BTWE 4BTIB 2PSXA 2HVYB 1HJAB 1CHGA 1GHYH 2O8UA 3RC4A 1YCPM 1PQ8A 1ZMNA 1EAWA 2VWMA 1QRZA 4BXSA 1C2IA 2ZFFH 1RJXB 1OS8A 3UAIC 4F55A 2R2MB 1THSH 2BZ6H 1Z1IA 2ZFQH 2VNTA 3QX5H 1YPKH 2G52A 2SNVA 1K1MA 2BQWB 2CF8H 3R0FA 2A7CA 4KP0A 2EI8A 3RMMH 4CRCA 5EJZA 3SUGA 2ODQA 2RDEA 5JB8S 3DA9B 1YPHE 2PWXA 1DVAH 1EAIA 2PP6A 3LOXA 1UCYE 1YPHC 1V6DA 5EXLA 1EP6A 1EUFA 1GMHG 2BVSH 4X6NA 4DT4A 2HGTH 3TGKE 1GJCB 1OXGA 1QFKH 1TAWA 4NSVA 3BG4B 1HAHH 1TPOA 2Y5HA 1TMUH 4TWYA 2DE8A 2GMTB 5LPRA 1VR1H 4FETA 2PGQB 1NFWA 1P9UA 1SGTA 2BB4A 2TGTA 3BF6H 1LMWB 4A6LA 2ANKH 4H6SB 1UTOA 2OQ5A 3SJKA 1GMDF 1WV7H 2A5KA 2SFAA 1UK4A 3DSOA 4FUDA 4YTAA 2UUJB 3BG4C 2CJIA 2HPPH 4DIHH 4WVPE 4DT7B 5EXMA 2JH0D 1L1JA 1KXFA 4DJZB 4F48B 4YOIA 3RC6A 1MCVA 1NZQH 1C5PA 1WCZA 1CHOF 1IAUA 3SHAH 2ZP0H 4TPIZ 4JZDH 1C1SA 3UIRA 1KYNA 1AN1E 1RTKA 2K8IA 2ZNKH 1YM0A 3TH3H 2IJOB 5GDSH 2BD9A 2BXUH 2HNTF 5EQRA 5A0BA 3SNBA 2BD2A 5E0GA 5JBTA 5EPYA 1P12E 2AS9A 3F9GA 4MG3A 5C67A 5EW1H 3TNTA 2GTBA 3HGNA 3W95A 2OXSA 2PTCE 1IOEA 1HJAC 2ZDAH 3UNQA 1P2OA 1O2SA 1C2KA 2B7DH 1HRTH 1SI5H 3M7QA 1ZRBA 1ZTLA 1CSOE 2XBYA 3CS7A 1XUGA 2R3YA 2XC4A 1CGJE 2ZTYA 4IGDA 2QGRA 2C4FH 3KIDU 3W94A 2ZA5A 3QZQA 1FMGA 3ZVCA 4TWWA 1C1PA 1ESTA 1F0TA 1HAGE 2CHAB 1HCGA 5A2MH 5AF9H 3M37A 3LH3A 2YNAA 2ZHWH 1BJUA 5EG4A 5CHBA 1QR3E 2STBE 3O8CA 4RN6A 1KXAA 3SQHE 3ZZ3A 4XBBA 1BTPA 5A09A 1O2LA 1NRSH 2FI4E 2KAIB 4ISNA 1OSSA 1W0KD 3URCA 3MNXA 5HXFA 1TRYA 2F91A 1PPFE 5L2YH 1P03A 3A80A 2OP9A 3MO3A 2ZI2H 1IQFA 1TB6H 3N7OA 1Y5BT 2STAE 2G81E 1NBMD 1S6LA 1ABJH 1O37A 3MU1A 3A82A 7GCHF 2OC8A 3BSQA 1SFQB 1S0QA 3B8JA 4JYTA 1GBCA 2ZPSA 3MH7A 3EE0B 3M3VA 5AFYH 3T5FH 1TRNA 1W11U 1S5SA 2ANWA 2ZWLH 1O5FH 3CENA 1KSNA 2C8WB 1EB1H 1SQAA 2VWOA 4X6PA 5FX6A 1KY9A 2BD8A 4GHTA 1O3KA 1FIZA 1KXDA 4NFFA 5FPTA 1UVPA 4HG6A 4NGAH 2W5EA 3F0OA 2KCAA 3EDXB 5K7RA 3M36A 3A86A 1EZSC 2TGAA 1GBJA 1D3PB 2QN5T 1AZZA 1RTFB 2J2UA 3KHVA 3K6YA 3I29A 2FZZA 4AG1A 3MOCA 2RA3A 1UHBA 2WV5A 3SV9A 1MKXK 3NUMA 1DY8A 1DWCH 1O3NA 5LPEA 1C5QA 1LPZB 1N1LA 4NCYA 3V12A 2WV9A 4UE7H 3SU0A 2IPQX 1LVYA 2ZCLP 3TK6A 2ZHQH 1NT1A 3M3TA 3PV5A 4ZKSU 4AFQA 1HAIH 1HV7A 3DT0H 3A7ZA 3VFEA 1YLNA 3MHWU 3QGJA 3Q76A 5T6FA 5TCCA 2EQNA 1Y3VA 3PRBA 2GDEH 3P92A 4FUFA 4GLYA 3F9HA 3A7VA 1TX7A 1TBZH 5LH8A 2L6OA 4O9VA 2H9EH 2R2WU 1Y3UA 4BAOB 1WTGH 1WTHD 4ISHH 3V13A 1XUFA 2BD4A 1MZDA 5EW2H 2FMJA 2BDIA 4B76A 2VINA 3PLBA 1QNJA 2Y6TA 3ATMA 4KELA 4O97A 3BTTE 3LGYA 3NPSA 4YZUA 1MAYA 2BQ7B 4F49A 4OS1A 1ZZZA 1RS0A 3LPRA 4X1RU 1P10A 4I7YH 2FOFA 2G8TA 2H5CA 1YCPK 2ESTE 1GJ7B 1SGEE 3KNXA 1Z6JH 2WUCA 4K5ZA 3E90B 3BG8A 4UEHH 3F2FA 2RFKC 1HIAA 5H4IB 1K1PA 1EX3A 1GJ8B 4UDWH 2Z3CA 3PM3A 6GCHF 3FN8A 1BMAA 1C1MA 2J94A 1V2MT 4B6EA 3MWIU 4E05H 1ZPBA 2CMYA 3U69H 4CH2B 2WPKS 2O8WA 1BTZA 1XUKA 4NIYA 5FPYA 1G9IE 5KGOA 1SGFA 2XXLA 1EOLA 1C5YB 3SYJA 1YF4A 1JRTA 3BTME 4RKOB 3S0NA 1KIGH 1MBMA 1AFEH 2BY9X 3MO6A 4B2AA 2OUAA 2QF5A 1XVOA 3TGIE 4BXWA 1ELGA 3LGVA 3T27A 1GJ6A 2UWPA 2BX3A 1E34B 3UNSA 5C94A 1C5NH 1ELEE 3BEIB 7GCHG 1H8DH 2F9BH 3KL6A 1C1WH 1SLVB 1HAZB 1AIXH 1RTLA 1UVTH 4IN1A 2PR3A 4ISIH 2GD4B 4ZCNA 1GI5A 1ZTKA 2NU2E 3JZ1B 1S84A 2FWWA 3UNRA 3AW1A 3STJA 2FTLE 3RXVA 3QWCH 1AMHA 1NESE 3T25A 4Y6DA 1K28D 3F6UH 2ANYA 1GI4A 2ULLA 2Z9LA 3LC3A 3GY8A 2BOKA 4XBCA 2GJGA 3A8CA 3EA7A 4H4FA 4ESTE 1BMFD 3VB7A 1NFYA 1HYLA 3RU4T 3G01A 1UO6A 3UR9A 1OWDA 3TNSA 3RXBA 2BVXH 2XBXA 4JK6A 1TPPA 1C2LA 2FI3E 5E2PA 1T7CA 1ID5H 4E7NA 4DY7B 1O3AA 5BPEA 1BMNH 1GI9B 3DFLA 2J95A 2J92A 3SBKA 5C3NA 1FAXA 2ZGHA 3LT3A 2Q6GA 2P3UB 3R3GB 1SFIA 2BLQA 1GMCF 3TLOA 1O2RA 4YT6H 1G3CA
chains in the Genus database with same CATH topology
1V2WT 2GKVE 4GSOA 1TGCA 5F6MA 3LU9B 1A5HA 5FCKA 1P09A 5FCRA 1WYKA 4U01A 1PPCE 3Q00A 4B2CA 2ZG0H 2AMPA 3GDUA 2PKAA 1LKAA 5JBAS 1MQ6A 1E36B 4WH8A 4YT7H 3SV2H 2M5TA 1H9IE 1BTWA 4A7IB 3RXFA 4FUCA 3ZZ7A 4HTCH 1UTPA 1YPJH 2RDLA 1WUNH 3E3TA 4VGCC 1T8OA 2AGIX 1C5SA 1XXDA 4ABDA 1UK3A 1TOCB 3RMNH 1P2QA 1GJDB 1A4WH 1VJ9U 5E2OA 2ZO3H 1ZHPA 2G55A 1LQEA 5LGOA 1Z71A 2P93A 1O2KA 4X2WA 3RXEA 3ZZ5A 1TRMA 1V2OT 5IYTA 1P06A 1P3CA 4U32A 3RDZA 4DURA 3VPKA 3H5CB 2OC7A 2O9QA 2H5DA 3L3TA 2BDYA 3E16B 2SNWA 1AKSB 1LPGB 3F9FA 1O3OA 4WJG2 2A45B 3A7WA 1CHOG 3U9AH 4AG2A 1IQMA 1ETTH 3GOVB 1EZXC 1SGCA 1A61H 1ETSH 3ELAH 3GYMA 3FZZA 1LHDH 2A2QH 1OWJA 1G36A 1MU6B 2WUBA 4Z6AH 2ZECA 4ZH8A 1ELDE 2TPIZ 1GI7B 4X1SU 2NU0E 2QA9E 8GCHF 1CVWH 2XC5A 1UCYH 1MD8A 4VGCB 1XKAC 3HK3B 1A0JA 1DXWA 1TQ0B 4X8UH 3GY6A 2A5IA 1O5BB 5C1XA 2FODA 4ZKOU 1HB0B 2PV9B 1G3EA 1FPCH 2P3FH 1O3GA 4RKJB 3FFGA 3HKJB 4MPVA 1GVZA 5FPSA 3FP8E 3PMAB 1ANEA 2EC9H 1A0LA 3D62A 2PKSC 3RXQA 1GJ5H 3LGIA 3RLYH 4FVDA 1EJNA 1L0ZA 4BNRA 2B0FA 4A5TS 1KTTB 2OC0A 3RMOH 5HYOA 1FY8E 4NA7A 4NG9H 4AFUA 1FDPA 1A2CH 1CA0C 2BLOA 2G4UA 1C2DA 3C1KA 1JIMA 3ESTA 1PPEE 1AE5A 2LIZA 1QGFA 1DLKB 1NRQH 1NRRH 2BTCE 7LPRA 2ZCKP 5TJXA 2BDBA 1QJ6B 1SGNE 2JETC 4WF8A 2R9PA 1CE5A 3PV4A 2QCYA 3D65E 1H4WA 2FS8A 4NA8A 1GGDC 1UVSH 3U8OH 3SW2B 4JMYA 3LONA 2QC2A 4I8LA 4I32A 1DSUA 2A32A 2XRCA 6ESTA 2W7UA 1D6RA 1PPGE 2VWLA 1VGCB 1EJAA 5JPMH 3RM0H 1SBWA 2Y81A 2GCTC 2A4RA 3MH5A 4E7RG 1THRH 1BZXE 4FUIA 2ZDNA 2A2XH 3TJUA 1JBUH 2GCHG 1OWIA 1RIWB 4B1TA 1ELVA 4YO9A 1KXCA 4BAMB 3T28A 1QTFA 2A7JA 3SGAE 2Y82A 1T8NA 3VXEH 3DUXH 3SNAA 4ZXYH 1GBLA 1VCWA 6GCHG 1YLDA 1TYNA 2TGPZ 5K0HA 5IDKA 4HI3A 5CE1A 1C2GA 2SGAA 1YKTA 2G51A 4AFSA 2GV6A 2RCEA 1J14A 2UUFB 2VB0A 2QV1A 1K22H 2G00A 3HATH 1Q3XA 1DY9A 5F8XA 4CR9A 1V2ST 2FIRH 2G5NA 4ABHA 1K2I1 1C1TA 1T4VH 2ZTXA 3A89A 2Z9IA 2H9HA 3BIUH 3QO6A 3LKWA 4K8BA 1THPB 1O3IA 4O3UA 2ZFSA 1QA7A 3URDA 2ZU3A 3NK8A 2GDDA 4ZROA 4YESB 1D4PB 3UOPA 4ZHAA 1UTQA 2XWBI 3UQOA 2FDAA 1FI8A 1HPGA 3VXFH 1TGBA 1C4V2 3T29A 2XYAA 3VGCB 1OYTH 5J4SA 5FHTA 5GJ4B 1PJPA 1IHSH 2BVRH 3QGNB 1IQHA 1AVGH 1SQTA 5T6DA 2P94A 1EATA 1EPTC 2WYGA 3H7TA 1C5LH 3A8BA 1PPBH 2BDGA 1F2SE 4JZFH 2P95A 4IW4E 3M5MA 2C93B 2PSYA 3RXOA 1PYTC 5C2ZA 2FOBA 1MTSA 4NSYA 3NKKA 2PLXA 4U2WA 3ZVBA 1C5TA 1P2IA 1HUTH 1W10U 1QRWA 4X6MA 3O8BA 3SJIA 1P01A 2AGGX 4X2YA 2QXJA 2PTNA 1J8AA 1C1VH 5DG6A 4YLUA 5C1YA 2ZU2A 3RUOA 3ZVAA 8KME2 3LJJA 1GJAB 5ABWA 2FOHA 3A83A 2XBVA 3MTYA 2Q6FA 1MH0A 1Y3XA 4FXGH 1MKWK 1MQ5A 1O32A 2F3CE 5FAHA 2A5AA 1KXEA 1W12U 2BDHA 1Y8TA 2Y80A 1DOJA 1OWHA 3A88A 3OY5U 2J38A 1EASA 5DP6A 1HDTH 1PFXC 5FX5A 1B7XB 2ZPRA 4OS7A 3B23B 4WXVA 2GZ8A 1DFPA 1LKBA 2A1DB 1ZSLA 3LGUA 4MVNA 4CRBA 2FX6A 2R3UA 2OC1A 3QUMP 2YOLA 2TRMA 1BCUH 1BTXA 4WMEA 1T31A 1IHTH 1ZOMA 2J34A 1P3EA 4GUXA 5JB9S 1TBRH 2FLBH 3EGKH 2ZEBA 1SR5C 1GWAA 2I6SA 1ELAA 1PPHE 1O31A 1ZMLA 2ZKSA 2UWOA 4Y71A 2VIWA 2XNIA 1ZHRA 5DP4A 1V2JT 2PFEA 2NWNA 4YM9A 4X8VH 1YPMH 2V3HH 3ATWA 4JCNA 2VIVA 1SOZA 3SU3A 1CA8B 1O5EH 1V2NT 1O36A 1B0FA 1ARCA 3NCLA 2F83A 1NM6A 2ODYB 1B5GH 1S6HA 3GY2A 1P11E 1AUJA 3PWCA 1AO5A 1SB1H 1TONA 3P8GA 3TH2H 1W2KH 2WPJS 2HRVA 3QN7A 2AMDA 3UFAA 4RSPA 1O2QA 3IG6B 4CBOA 1O2WA 2FXRA 4LZ4B 4B71A 4Y10E 2P59A 1Z8IB 2K1QA 3PROA 2GX4A 5LPFA 5F03A 2HLCA 3RU4E 5HMAA 1V2PT 1WQSA 2ZFPH 1G3BA 3SJOA 1KXBA 1GMDG 2ZQ1A 4A1XA 2VIDA 4B74A 1C5RA 3SU5A 4ZKNU 1ETRH 1VCQA 5HM2A 4ZUHA 1N8OB 2VJ1A 4JK5A 5DJ7A 1P0SH 3A7TA 4MNXA 1JRSA 2ZPQA 2Q6DA 2F9UA 2VIPA 3L6PA 4M7GA 4IBLH 4UFGH 1Y5UT 2ZFTA 3U1JB 1BRBE 1EAUA 3PMHB 4LOYH 1L2EA 1TNIA 1SHYA 1MAXA 1ANDA 1UTMA 2FEQH 3LIWA 3SO3A 3SZNA 5GXPA 1XM1A 2B9LA 1ARBA 5EODA 2ASUB 1VCPA 1BUIA 1O3DA 4MPUA 2CXVA 2ALVA 5ETXA 4GPGA 3ATIA 1EZQA 3MNBA 2Y5GA 5C5NA 1GI3A 3E91A 1BITA 2ZDVH 2FI5E 3EA8A 1C2EA 2BZAA 1HAOH 1AU8A 2BDAA 3UTUH 2J4IA 1O3MA 3A85A 4WWYA 1GBAA 4A1TA 2SGQE 3NWUA 4BAHB 2ILNA 1G2LA 1TNLA 2CF9H 2Z7FE 3A7XA 1K21H 5DKMA 1HLTH 3KQCA 1MBQA 3RXTA 2XCFA 1QY6A 4H42U 1A46H 2PHBA 1SLXB 2LPRA 4YOJA 1BRAA 3ZVDA 1ZTJA 4Q7XA 1EQ9A 5JYIA 1V2QT 1BOQA 1T8MA 4AZ2B 3V0XA 2Y7XA 3LGWA 1NROH 2BHGA 4H6TA 3AASA 1ZGIA 1L4ZA 5AHGH 1YPGH 1GJBB 5DP7A 1LVOA 8ESTE 4IS5A 5EXNA 2FESH 3RXIA 1GGDB 3P8NA 2XW9A 3ZYDA 4WMFA 1NRNH 4X1PU 5DGJA 2BY6X 5ESBA 9LPRA 1C1NA 1F5LA 4I31A 1GBFA 1GCTC 5L2ZH 1YYY1 1ZSKA 3RXAA 3ODDA 3C27B 4NIVA 3V7TA 2OCVB 1YBWA 4D8NA 2C90B 2OLGA 1C9TA 5I46H 1G2MA 1LQDB 1SPJA 1TABE 1UVOA 3CP7A 1FV9A 3LDXH 5C20A 3P6ZB 1CGIE 1BT7A 3SN8A 1O2VA 1LHEH 3PB1E 1RIWC 1QJ7B 3OX7U 1GJ9B 1GDQA 1GHAG 3TITA 3BV9B 1OP2A 5FBIA 2QXIA 1GBIA 1UTJA 3BTHE 3E1XB 3RXDA 2HALA 1SGQE 1NS3A 4INHA 2CN0H 4AGKA 1TGNA 4ABAA 5DP9A 3Q3YA 2VVVA 4CHAC 1GBEA 2EI7A 4D7FA 3A87A 1GBMA 2G5VA 1GHBF 2ZDKA 2ZGBH 3LC5A 3TJVA 2NU1E 4J1YA 1ZPCA 1SLWB 1T8LA 1V2VT 3O8DA 3MU8A 5B6OA 4TYDA 4ZHMU 1FQ3A 1T32A 3ENSB 1BTUA 3S9CA 7ESTE 3SHCH 1XMNB 1HNEE 5C1UA 3SOSA 1GVLA 1GI1A 2XWAA 3MH6A 1CT2E 2FX4A 1Z8RA 2BOHB 1NFUA 1GHWH 2TGDA 1TA2A 4AOQA 4BOHA 4CRAA 3D23A 2Y5FA 3RXCA 5A8ZA 3MNSA 2FOAA 3IITA 5EQQA 1A5IA 1Q2WA 3QTVH 1C1UH 3BIVH 2A7HA 1EB2A 1O5GH 4I8GA 4KKDA 1WQVH 2BY8X 1AI8H 2V35A 4A1VA 3AAVA 1S82A 3L33A 3OY6U 3RM2H 1GHAF 3A7YA 3SV8A 1F0RA 1KDQB 2OINA 3MNCA 2SGEE 4BAQB 1GBKA 1LHGH 2ZDLA 4ZAEA 2A31A 2ZZUH 1BRCE 2BLVA 4TY7A 4IMZA 3GCTG 1SLUB 3UY9A 1O2YA 3ZVFA 3MI4A 3PWBA 1E35B 2AH4X 3GCHC 2ZHEH 5CHAB 4OS2A 4JYVH 2CGAA 2I6QA 1JMOH 1AUTC 3LGTA 2WYJA 2VH0A 3FVFB 2UUYA 3TPIZ 4FUGA 1MTUA 3HGPA 2W26A 1D3TB 1HFDA 3ZYEA 4KGAA 5EPNA 3SI4H 2WINI 3ZZCA 3M5NA 4MTBA 1AFQC 2WV4A 1H8IH 1ZSJA 2RA0A 3VEQB 4Y8YA 1QQUA 3H7OA 3A81A 3MU5A 3BTQE 4WY3A 1DITH 3MU4A 3GYLB 1DM4B 1V2KT 1VITG 1L4DA 3SGBE 1O2NA 4JZIA 2Y7ZA 1QB6A 2VIOA 1O5CB 1WSSH 1GMHF 4K1TA 1JIRA 3S69A 1NY22 1TLDA 1CT0E 1VZQH 4B73A 3EYDA 4ABIA 1BTHH 4XFQA 1OOKB 3AW0A 1TNKA 1GHVH 1W0ZU 1F0SA 1QL8A 3K6ZA 2HWLB 2D2DA 1K1OA 1O5AB 2AFQB 4UFEH 1P02A 1AWFH 1ANCA 1M9UA 3SU1A 1P2MA 2ALPA 4ABJA 2WPLS 3EQ0H 3WY8A 3TJOA 1OP8A 3SNEA 1HAVB 1MCTA 2O8MA 2CV3A 2XTTB 3AAUA 1YP9A 1YLCA 2ZF0H 1O3FA 1CO7E 3GY3A 2P3TB 1OPHB 1TBQH 2QY0B 4Q80A 1SGFG 1K1JA 2BX4A 3IWMA 2BD5A 3Q77A 4A92A 3TGJE 2BDCA 3PO1C 1RXPA 1TNJA 4NIXA 4YOGA 3ZVGA 1MTWA 1SGPE 3CS0A 1J15A 3FAOA 1FONA 3GY4A 1GBTA 1S83A 3SV6A 3SUFA 3M61U 1PQ5A 3SU4A 1N6YA 1G3DA 1P2JA 4GAWA 1Q31A 3A8AA 3DD2H 2KAIA 3VB4A 2W7SA 3PLKA 1DSTA 3TU7H 2Z9GA 3RU4D 1TX8A 2ZHDA 1CGHA 4X0WU 4AFZA 2RG3A 3BEUA 1Z1JA 1C5UA 1E37B 1LO6A 1SQOA 1ZYOA 1QIXB 1LPKB 5GPIB 3T26A 2ZU1A 1O3LA 4OGXA 4AGJA 2D8WA 4X6OA 2UWLA 1ANBA 3RXKA 2XBWA 1EPTA 1S0RA 3M5LA 2O8LA 1TGSZ 1YPLH 4YLQH 2BY5X 4D9RA 5E8EH 2UUKB 2JH5D 2GVFA 1C1QA 1BIOA 1DANH 1EXFA 1O0DH 5A0CA 1TMTH 1MKXH 2VU8E 3UPEA 5A8YA 3NXPA 4MNWA 1UHBB 1EAXA 2IN2A 1C2HA 1F7ZA 1TA6A 1J16A 4WH6A 1O3BA 3RXMA 1G32B 1BHXF 3PMBB 4AX9H 1LHCH 1FY1A 5L30H 2C8ZB 1HAXB 2LNCA 3S7HB 1BA8B 3UOUA 2NU4E 3A8DA 4QT8C 4MNVA 1P2KA 5ESTE 5I25A 2BY7X 3RMLH 1YGCH 3VB6A 3MMGA 1HJ9A 1ELBA 1ESBA 1C5WB 3GCNA 1GI2A 3PTNA 3RC5A 1RFNA 4MLFB 5BRRE 1FJSA 1GG6B 2C8XB 2FP7B 1UJ1A 4JYUH 4K1SA 1Z7KA 4GVUA 1SGRE 2ZQ2A 2ZU5A 3M7TA 4LZ1H 1LHFH 2ZFRH 1XX9A 2DUCA 2H1UA 4DG4A 2ZGXH 3KEEA 3I78A 3U8TH 1D9IA 4MQAA 2Z94A 1CA0B 1FN6A 4BTUB 1WU1A 1W14U 1CBWB 1V2LT 7KMEH 4NWLA 3FP7E 5C5OA 3PYHA 1KLJH 1PPZA 2W3IA 3F9EA 1LVMA 4ZKRU 4K1EA 4D7GA 4AYVB 4HGCA 4OGYA 1GHXH 1NTPA 1EKBB 1IQKA 1AHTH 1KLIH 1DUAA 2V3OH 2QYIA 1ZHMA 4BANB 1GI8B 2YNBA 1QBOA 3GY5A 1W7GH 3GDVA 1ABIH 2ZGCA 2GZ9A 2BD3A 1TX6A 2ZC9H 5HM9A 1S6FA 2JKHA 4IC6A 2OD3B 5EOKA 3BTEE 1O34A 1SC8U 1W0YH 3RP2A 1NFXA 3ATKA 4R8TB 1Y3WA 2GMTC 2ZGJA 1O2GH 3TJNA 4CBNA 1BMLA 3E0PB 4UONA 2WPMS 1QA0A 2GP9B 1DWEH 5EGMA 4AB8A 2PKSB 3FZDA 3SUEA 3STIA 4DOQA 1GMCG 1Y59T 4O3TA 1S81A 1HIAB 3RXGA 1IQEA 4HZHA 5T6GA 4DIIH 4WXIA 1AKSA 1J9CH 2A4OA 1O2ZA 1UMAH 2WPHS 1P9SA 1UTKA 3GY7A 4FUEA 1NPMA 4K69A 2HNTC 3QTOH 4XSKU 1X7AC 4ABEA 1GG6C 1OX1A 4I8HA 1V2RT 1MTNC 3ZZ9A 1HJ8A 1BBRK 2HNTE