2BX3A

Crystal structure of sars coronavirus main proteinase (p43212)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
molecule keywords MAIN PROTEINASE
molecule tags Hydrolase
source organism Sars coronavirus sin2774
total genus 89
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A02
1P0SH 4Y8XA 3A88A 1O3JA 4X1QU 3U98H 2ZPRA 2TRMA 3RXQA 1V3XA 2K7XA 1C1TA 3GOVB 3RXDA 3MI4A 3QZRA 1FAXA 3EBNA 1EX3A 2Y6TA 1TE0A 1SFIA 4ABHA 5DG6A 1ID5H 2GCTC 3UR9A 3V13A 3ATMA 2O9QA 1P06A 4TY6A 4KTSA 4JZFH 3FP7E 2PV9B 5L6NH 1BJUA 1Y3WA 4MPWA 2FDAA 4JYUH 3ZZ7A 1A0HB 1MBQA 2XWAA 1QJ7B 3H7OA 4LK4A 4XBCA 1GHBG 1EJAA 1BA8B 1ETRH 4X8VH 4BANB 4X6OA 3Q3KA 5EPYA 2PUXB 2FOMB 3DFLA 1ZHPA 1EB2A 4GUXA 4ZXYH 1IHTH 3FP6E 2B8OH 4TY7A 1BTZA 4BAKB 1YYY1 1XM1A 2F3CE 4AOQA 1J16A 3U9AH 4D7FA 2P3UB 1TRMA 4SGAE 2XBXA 1BRAA 4OS1A 3SNDA 5EU8A 3DA9B 1QRXA 1UVSH 1P9SA 2BQ7B 3A7ZA 1IQMA 3TGKE 1FPCH 1GDUA 1WAYB 4U32A 4AFSA 1XUGA 1YF4A 1K21H 1GMHG 1KXEA 1TWXB 3F9FA 4KKDA 1PYTC 1WYKA 4O3UA 3VB7A 3LGVA 4H4FA 1YPGH 4B1TA 5A0AE 1LHDH 5AFZH 1GBCA 4UEHH 4IS5A 4ZKSU 2Z9IA 5CHAC 1DICA 1XKAC 3ZVBA 2C90B 3GDSA 2Z9JA 2F83A 3M5MA 5C5NA 4YTAA 1DLKB 1UMAH 5AVDA 1EATA 5GDSH 2A4OA 1KTSB 1E35B 3T26A 4K1TA 1CT4E 2FEQH 4UFEH 1TRYA 4THNH 2BDHA 2CHAC 4BTIB 4OS6A 5C67A 2FOBA 2JH0D 2BD4A 1LCYA 5L2YH 2HWLB 3AAUA 2UWPA 1HB0B 3BIUH 3BTGE 1IHSH 1E34B 3SU4A 2EC9H 2ZFRH 1OWJA 1TONA 4ISNA 4NIWA 2GV7A 3RC6A 4CR9A 1SGIB 1XUKA 4SGBE 1VGCB 1GI6A 1D4PB 3GISB 2HRVA 4B76A 4D76A 3GY2A 1EQ9A 1EZSC 4OGYA 3EAJA 2DE9A 1RTFB 1KLTA 3ITIA 5JPMH 1P3CA 1KYNA 1THRH 1LPGB 1O39A 3TJUA 2ZC9H 1SR5C 1GWAA 1MTNC 1MD7A 1H8DH 1Q3XA 3L33A 2H9TH 1ZOMA 1FN8A 2H9EH 3KHVA 4HTCH 2RA0A 3K6YA 2QA9E 3A8DA 1Z8GA 4ISHH 3RXLA 3A80A 2VIVA 4DCDA 4GCHG 1AVGH 3VGCC 5SGAE 2DE8A 1SGTA 2BY6X 2GTBA 1GMDG 1A3BH 3O8BA 2Y81A 2QXIA 2FOCA 2NU0E 1TX7A 1TNJA 1J9CH 4ZKNU 1MZDA 1C5PA 3RMOH 5I25A 2AGGX 3UUZA 3KL6A 4DY7B 1V2VT 1UTPA 2VIDA 1L4DA 3RU4T 2A5AA 1JXPA 5A0CA 4U30A 1LVMA 1SFQB 3ODFA 1TAWA 3BTTE 1KXFA 4A5TS 1A61H 1GHVH 1NRPH 4FUDA 4H6SB 3RP2A 1T32A 3TH4H 1P2MA 3ATLA 4XBDA 4Q7YA 3T25A 2ZG0H 2BY8X 1RTKA 4BOHA 1QFKH 1ZSLA 2XC4A 2BVRH 3LH1A 1BB0B 2NU1E 1W3CA 1XXDA 3ZYDA 3ZZ8A 1TGNA 1T4UH 3ZZ3A 1GI8B 3U69H 2DUCA 2CF9H 3SHAH 4A92A 4Y76A 4X8UH 1XXFA 1Q31A 2BB4A 4Y8YA 1H9IE 4GHTA 3BV9B 2TIOA 1WQSA 1RRKA 3E0PB 2JETC 1SGDE 1OP2A 1TX8A 4CH8B 3SJKA 1AGJA 3TNSA 1EAUA 4OGXA 1RS0A 1OSSA 1F7ZA 4IBLH 1DWEH 1XX9A 1ZSKA 3T62A 3VXFH 3SU2A 4AYVB 2J4IA 2F9UA 1SPJA 3GCTF 6CHAB 1Q2WA 1O5GH 1C2IA 4LZ4B 3LPRA 4AFUA 2BD5A 1EPTC 1JWTA 1GI1A 1YBWA 1V2UT 9ESTA 1O2IA 4HFPB 3M36A 1NRRH 2BXUH 1N8OB 3SNCA 2HVXA 2G51A 2A2QH 4PROA 3SUDA 1NS3A 5GJ4B 3H5CB 4ASHA 1UVPA 4CRBA 2CMYA 1F0TA 1CA0B 4E7RG 3I29A 1C1OA 3UWIA 3BTEE 4CRAA 1V2ST 1FIZA 4WMDA 3QUMP 3V7TA 1P03A 1IQHA 2EI8A 4ISIH 1NFUA 2H9HA 2ZGBH 2J92A 2VGCB 4CR5A 1UVUH 4Z6AH 5GXPA 3ATKA 2FO9A 3W95A 3NUMA 4MVNA 3D62A 2P8OC 3T27A 4YO9A 4WVPE 2Z3DA 1TGTA 3ZZ9A 1C5QA 1HAZB 2WUCA 4NA8A 5C3NA 1GGDC 1A3EH 4A7IB 3O8CA 3A7TA 1GJCB 1FY5A 1BHXF 4DVAU 2M5TA 5A8XA 3E91A 2AGIX 1XUJA 3TK5A 1C4U2 1XUFA 2Y80A 2LIZA 4NSYA 3UTUH 1NC6A 3Q3XA 3EA9A 1DWCH 2GT8A 1DITH 3ZZ4A 4X2XA 4X2VA 2J9NA 1JRTA 1GJ7B 1HCGA 1OOKB 4B75A 4X6MA 1TBRH 3RUOA 5HM2A 3M37A 2ZDVH 3GY8A 1SL3A 1SOZA 1VITF 2AS9A 4FU8A 1P2JA 1EJNA 2ZEBA 2YNBA 3T28A 5DKMA 1HRTH 2BDIA 5A2MH 3SNEA 2FLBH 1AFEH 2ODPA 3M5NA 1W14U 3QZQA 3BTWE 3UNSA 3MU4A 3NZIA 4XSKU 1C9TA 1JRSA 3ATWA 2BDGA 3SU1A 1O3CA 1OWIA 1NN6A 1UTJA 3EE0B 3NXPA 1O2GH 3QO6A 5JDUB 4M7GA 4DJZB 1GJDB 3SNAA 3P8FA 5JBBS 2R0LA 5GIBA 3MH6A 1O5BB 1OWKA 2ZU3A 2AFQB 1BMAA 1LHEH 3T5FH 4B71A 1PPFE 4NZQA 1NFWA 3P8OA 4WWYA 1DY9A 1O2TA 1QL8A 1K1IA 1TPSA 3A7XA 2H2ZA 3Q77A 1PPGE 3E1XB 4DOQA 1EAIA 1KXAA 4XDEA 4I8GA 1TGCA 2ZDLA 2ULLA 3RXAA 2QAAA 4ZROA 2VVCA 3DT0H 1BTYA 1QHRB 2Z7FE 2QF0A 3SV6A 4NA7A 4BAQB 1QURH 1K1OA 2HPQH 1T8NA 1EZXC 3P8NA 2SGAA 3A83A 2V3HH 3CENA 4MLFB 1MCTA 5C5OA 2O8TA 4U01A 5E0JA 5LPRA 1K22H 1C2EA 2XCNA 5HM9A 3PTNA 2Q6GA 4CRDA 4AGJA 3SOSA 3KQCA 2ZDKA 3M3SA 1HJ8A 1YPKH 2JKHA 3KF2A 1O0DH 4X1PU 1CHGA 2XTTB 4GSOA 1AD8H 1NRQH 3LH3A 1G32B 1S83A 2ZQ1A 2F9OA 6GCHG 3MTYA 1HAPH 3HK6B 2PKSB 4JMYA 5DP5A 2B7DH 4F4OC 3DD2H 3K6ZA 5C1UA 2FI5E 4AFZA 1C1UH 3RC5A 1G2MA 1TNLA 2G4UA 2V3OH 3RM0H 1CHOG 3M7UA 2PKAA 2WPHS 2FX6A 2FMJA 1ZHMA 1DS2E 3Q3YA 4NWKA 5A09A 1ZJDA 3FZZA 2H5CA 2BOKA 2ANMH 1ETTH 2RG3A 3RXHA 5K0HA 1S0QA 5AFYH 1ZZZA 3PO1C 3UNQA 1TYNA 2PTNA 1BBRE 1XKBC 4WXIA 1O3AA 1BRCE 2VH0A 3NPSA 5DPAA 3KIDU 2ODYB 5GPIB 1Y3VA 2W26A 1O3OA 2C8WB 2GKVE 1YKTA 1P02A 3Q00A 4Y6DA 2XW9A 1TPPA 1YLDA 2C8YB 1VGCC 3F9EA 1C5NH 5LPEA 4VGCB 1C1VH 3O8DA 3GY3A 3A82A 3BTHE 2W7UA 1Y59T 4RKJB 4JK6A 3M3TA 3OY5U 1OWHA 1UO6A 2XBVA 5GCHF 4JYVH 2R0KA 1GPZA 3QGJA 2A5KA 1QGFA 4BXWA 1ELFA 3VB3A 1S82A 3B8JA 3TK6A 3TLOA 2A31A 2ZCKP 1V2NT 3KNXA 4Z0KA 3SI4H 2SGEE 2GP9B 1NPMA 1ESBA 1V2JT 1FI8A 4ZXXH 5A0BA 2W5EA 1J8AA 4NFFA 2TGDA 1LVOA 1C1NA 1GJ8B 5TJXA 3M35A 1O2NA 2ZCHP 4HI3A 1TOMH 1ESAA 4I8JA 1YPHC 1P8VC 3QN7A 2GV6A 3A81A 1DWBH 1G3EA 3FZDA 2PKAB 2PTCE 3UREA 4DURA 1P01A 3PROA 1ZPCA 2ZWLH 2ILNA 2Y7XA 4RN6A 1G9IE 2BQ6B 1MMJN 2IJOB 4XOJA 2P16A 3PWCA 3GY6A 1NRNH 2HALA 3SO3A 5FHTA 1DY8A 1FY4A 1GDQA 2ZHEH 3O8RA 1O2MA 8GCHG 3PMBB 1FDPA 1P3EA 2WPKS 3MNBA 1J17T 1ABJH 1GHAF 1TRNA 1HIAA 1GVKB 2QXHA 1S81A 1HNEE 2R2MB 2Q6DA 1ELDE 2ANYA 2BZAA 3VB6A 2OCVB 1U6QA 3F6UH 2B5TB 4AGKA 1GBBA 3MH7A 1SGQE 3KCGH 2YOLA 3RXFA 3VXEH 1Y3XA 4A1VA 1ZYOA 2OP9A 1SLXB 1C2LA 4OS5A 5FPTA 1OYTH 2BXTH 1CT0E 5ESBA 4ESTE 3VFEA 1PQ7A 1SGFA 1JOUB 3QGNB 1ZTJA 1IQIA 4AG1A 1RD3B 4UFGH 2ALPA 1GMCF 2STAE 4MG3A 1FPHH 1JBUH 1UK4A 6CHAC 5JB9S 1PJPA 3SQEE 1F0RA 3TH2H 1YLCA 2R3YA 3BTFE 1O36A 2FTMA 1HXFH 1HFDA 1N8OC 1S6HA 4TYDA 4X0WU 1AO5A 2OUAA 3A8CA 5B6OA 1PPZA 2ZKSA 2BLVA 1TPAE 1CA0C 5BPEA 3D23A 1QTFA 5ETXA 2UUJB 1C5SA 1X7AC 3SQHE 2Z3CA 4UFDH 1SGNE 5EXMA 4DW2U 4ZMAH 1LKAA 1TALA 4K8BA 1D3QB 2VGCC 1AMHA 4XFQA 1HIAB 3QTOH 4MDSA 1W7GH 1WOFA 1QR3E 2VWNA 2G81E 1T8LA 1FIWA 1TNHA 1VJ9U 3CS7A 2QC2A 1DE7H 1O3PB 7GCHF 3IITA 2EA3A 2PR3A 1AHTH 2ZHFH 2G52A 3RXJA 1EP6A 2P3FH 2ZDMA 3UOUA 2ZU2A 4TPIZ 2IN2A 1QCPA 4D8NA 6ESTA 8LPRA 1N6XA 1P11E 4NG9H 2FP7B 5A8ZA 2VU8E 1IOEA 1GI3A 1F0UA 1O3BA 1OP0A 1CSOE 3HGNA 5FBEA 1NTPA 1V2TT 1NT1A 4AZ2B 2ANKH 2FWWA 3OSYA 1GHZA 1A5GH 5HGGA 1F0SA 4D9RA 2ZA5A 2FS8A 3MH4A 4B2AA 4I32A 3LONA 3BG4B 1OX1A 1Z8JB 2FODA 1OWEA 1VJAU 1RXPA 1KLJH 3M5LA 2OD3B 2BY9X 3PMAB 1C2GA 4BAOB 1IQFA 1IQKA 2PGQB 2ZGCA 1WV7H 3EA7A 1AB9B 2FOHA 1O2KA 2GDDA 1A7SA 1Z8IB 2XNIA 1VITH 1GL0E 1QA0A 4CH2B 5F8XA 1C5WB 3ZV9A 2C4FH 4X8SH 3RXMA 2BLQA 1O5AB 1SOTA 1PPHE 3ATIA 1FZZA 2Y5GA 2Z94A 3MO9A 2FM2A 1TBQH 2B9LA 3MU8A 3LC3A 1DM4B 2SGQE 2ESTE 5DO4H 4Q7ZA 4WY3A 4FUCA 4FU7A 3F9HA 2H5DA 1BCUH 1A0LA 1GBAA 2FYRA 1IQEA 5EGMA 2ZCLP 4ZUHA 1BJVA 3RXTA 4B73A 3LC5A 2BY7X 3EQ0H 1HJAB 4BNRA 4K69A 1KTTB 5HYOA 1MKWK 1GBMA 1XVMA 3FFGA 2A4GA 3GYMA 2HNTC 3SV7A 4IW4E 2NWNA 4HZHA 1VCWA 1BBRH 2P93A 1EP5A 1P57B 5T3HA 5C1YA 1EOJA 4X1NU 3SJIA 1BT7A 1GHBF 3LJOA 4ABGA 1D6WA 5JB8S 4KTCA 4I33A 3A84A 2SGPE 2PKSC 5EXNA 3QTVH 2A32A 3HGPA 1W10U 3VB4A 3TK9A 1C5TA 1GVLA 3MO6A 4B74A 3DFJA 3E16B 1CGJE 5EQRA 1MUEB 1YPHE 3E0NB 3RXKA 5FCRA 2ZDAH 5DP3A 1ANBA 1O2HA 1UVOA 4LOYH 1C1PA 1MU8B 3SV8A 4DGJA 2BZ6H 2GDEH 2QV1A 2ZF0H 4IC6A 2NU3E 3V0XA 3URCA 4Q80A 2BVXH 1AFQB 2VIPA 1DUAA 4FUFA 1GMHF 4IMQA 3GCOA 4NCYA 3I77A 1LQDB 2G5NA 3JZ1B 2VVVA 5EXLA 2ZGHA 3SW2B 3KQBA 1GJ4H 2Y5HA 2ZTZA 4CRFA 1B0FA 2HPPH 2WYJA 3MU1A 4Y11E 2XBYA 1MQ6A 3RXEA 3RXPA 1O2RA 2ZFTA 3TU7H 3MFJA 3AW1A 3SU5A 3QK1A 5EOKA 5GWZA 2I6SA 1SGEE 5I46H 4RSPA 1FLEE 2WPLS 4Y8ZA 2FOFA 3RU4D 1OWDA 8ESTE 3OYPA 1NU9A 4ABIA 3LGUA 1D3DB 4NA9H 2ZU4A 1XMNB 1SMFE 5DP8A 1UCYK 4UFFH 1QL7A 1DXPA 5EQSA 3PMHB 4K60A 3RXIA 1PQ8A 3BN9A 1BDAA 3S9AA 3U1IB 2EEKA 4GHQA 4ISLA 1W0YH 1AY6H 1FY3A 3DHKH 1MCVA 1QY6A 3RU4E 3TGIE 4NFEA 1S6FA 1O32A 2GZ9A 2HOBA 3SU0A 1O2VA 2ZTYA 3V3MA 1CA8B 1AIXH 1BTWA 1ZPBA 4MNWA 2BHGA 1DWDH 2V35A 4AG2A 2UUKB 2CN0H 4CRGA 3D65E 2VB0A 1CE5A 1O3MA 2PSYA 2HLCA 3BTME 3B23B 2OTVA 2TGPZ 1QQUA 1OS8A 1C5OH 1V2QT 1AU8A 5L30H 3BTKE 4H42U 1GI9B 4GCHF 1ZGIA 2EI6A 3UQOA 1GHYH 2GVFA 2WV5A 2R3UA 3S0NA 3LU9B 3LGYA 5ABWA 1E37B 1BRUP 2F9NA 1GMDF 4Y71A 1RIWB 1PYTD 4YLUA 3TGJE 1F92A 1P2KA 4MPXA 1C1QA 5C20A 3BTDE 4Y0YE 4JYTA 1HAIH 3MNCA 2QXGA 1H1BA 3P6ZB 2FI4E 2SFAA 2AMDA 2AIQA 2P3TB 4ZHAA 1NFYA 2O8UA 3A86A 1C5MD 3JZ2B 3LDXH 1SC8U 1IQNA 1O3GA 1P09A 1Y8TA 1HV7A 4ABJA 1BMMH 2FIRH 1HYLA 1TGSZ 3A8AA 1MTSA 4KTUA 4K1SA 4ABEA 1EZQA 4O3TA 2PHBA 1SGYE 1AN1E 4FUBA 1SLWB 2BM2A 2ZNKH 1P12E 1H9HE 3R3GB 3SNBA 1Y3YA 1L0ZA 2ZPQA 3RMMH 1MKXH 4R0IA 2VWMA 2GZ7A 4FUEA 1YP9A 2BOHB 4X2WA 2Q1JA 2OINA 3LKWA 2GMTB 1G3DA 2F9PA 1O33A 3OU0A 3FP8E 4X6NA 4CRCA 1TLDA 3TJVA 1A5HA 4B2BA 1UK2A 1Z6EA 1JIMA 3HATH 3GY5A 2PLXA 1OPHB 2GCHG 4INKA 1O2PA 1MD8A 3U8TH 1HAGE 2XXLA 1C2FA 1CBWB 1YCPM 1FUJA 1B5GH 3AAVA 5IDKA 4YOJA 2ZO3H 5T6FA 5CE1A 1EAWA 1BHXB 2V6NA 3SJOA 1TPOA 1QIXB 3P17H 5EG4A 2PUQH 2VIWA 3VB5A 1D9IA 1VCPA 1LTOA 3C27B 5AHGH 1CO7E 4Y0ZE 1SGPE 5JBAS 1HXEH 1MQ5A 4YZUA 1AE5A 1W12U 2A0QB 2BLOA 2FPZA 5HMAA 1JIRA 4AB9A 1ZRKA 1BTPA 1OP8A 5DP6A 1QNJA 2Q6FA 3MWIU 1BQYA 4X1RU 2CF8H 2LNCA 1LHCH 4I8HA 1ZMNA 1O5EH 3BG4C 1THPB 2J34A 2ZECA 4YOGA 4K8YA 2QF3A 2WPMS 4Y10E 1C2JA 3VGCB 1F5KU 3L6PA 1KIGH 1AB9C 1TMUH 4NZLA 2ZTXA 3A7WA 3ZVAA 1HGTH 1ARCA 3QX5H 4CBNA 3GICB 1V2MT 4DIHH 1C2MA 3A7YA 1K1JA 3A87A 3BSQA 1D3PB 2THFB 1TX6A 1KLIH 4ISOA 3VEQB 1Y5BT 3GDUA 1GL1A 3SGQE 2D1JA 2C8XB 3S69A 1T4VH 1QBNA 1HBTH 1DANH 3U8RH 2BD3A 2UUYA 3KQEA 2Z6BD 4K3JA 2CXVA 3D49H 1ESTA 1GVZA 4O9VA 4I7YH 2AIPA 2BY5X 1OKXA 1K1PA 3TNTA 2ANWA 1ZRBA 1P2QA 1W11U 1WQVH 1UTQA 1ZMLA 3ZVEA 1P10A 2JH5D 1AWHB 1GBDA 4GAWA 1DT2A 2GT7A 2OC0A 1HJAC 1E36B 4KGAA 1ELAA 5FXLA 1EASA 3RMNH 4IN1A 5EODA 1TQ0B 3ZVFA 1SGFG 2ZI2H 1SB1H 5E8EH 3PTBA 1K28D 2D8WA 5IYTA 1Z1JA 4WJG2 3MNXA 2Y7ZA 5JYIA 1Y3UA 1GG6B 2ZU1A 1AZ8A 4ZAEA 2C3SA 4WMEA 2QIQA 3UIRA 4NGAH 1HAYB 1XUIA 2P94A 1T31A 4IGDA 4JZEH 3T29A 1GI4A 1ZGVA 4NIYA 1S5SA 2FI3E 3SJ9A 4YT6H 1A5IA 1O31A 1HAXB 1BRBE 1NRSH 2OQ5A 2CV3A 2AH4X 3WY8A 5DGJA 2Z3EA 1UHBA 1Y5AT 4JZIA 4Q7XA 2AYWA 1RJXB 4AX9H 2ZIQH 1TNKA 1LDTT 4OS4A 3SORA 5CMXH 1TQ7B 4JZ1A 1GI5A 1H4WA 2BD9A 2C93B 4KP0A 1YGCH 1O2XA 1AFQC 1GDNA 1D3TB 1A1RA 1BIOA 4TWYA 3N7OA 1BZXE 1NZQH 2KAIA 3AVZA 3F9GA 1O2OA 1PPEE 1ARBA 1WU1A 4ABAA 3GYLB 3ODDA 1ZSJA 2OC1A 1AUTC 2QXJA 3SGAE 1O3DA 3RC4A 2EI7A 6GCHF 3UQVA 2XRCA 1QBOA 4FXGH 3ZVDA 1L2EA 1V2LT 2OQUA 3TJNA 1GCDA 3G01A 3NKKA 1HJ9A 4GPGA 4INLA 1CHOF 2IOTA 1RFNA 2VVUA 3ZZBA 2VIQA 3S9CA 2G8TA 1O5DH 1NO9H 3SGBE 3S9BA 1BTHH 1UTLM 1AWFH 4TWWA 1TNGA 1V2OT 1HAVA 1THSH 3URDA 1QQ4A 3GCNA 2QYIA 2QGRA 2ALVA 1NY22 4ABBA 1V2PT 1Z1IA 1GJ5H 1EZUC 2OBQA 3TITA 1LO6A 3EDXB 1AE8H 4Y79A 1D6RA 1DSTA 1C1SA 4YLQH 1C1WH 4FUGA 3PMJA 1O2ZA 4A1XA 3MHWU 3BF6H 1BUIA 1B7XB 1F5LA 1WCZA 2Y5FA 3R0FA 2QCYA 4NIXA 1UHBB 4CHAB 6LPRA 1Z8RA 1EOLA 4OS2A 2FLRH 3A89A 4JK5A 4UDWH 2AEIH 2FXRA 1ANDA 5T6DA 1YPEH 1UTKA 4J2YB 2K1QA 4NWLA 1K9OE 2A7CA 2OLGA 3UFAA 4H6TA 5F8ZA 1ELBA 1LPZB 2PFEA 1AUJA 4KELA 5J4SA 1LKBA 1SG8B 2H1UA 5C1XA 1CT2E 1SQAA 3KN2A 1A46H 2KAIB 4X1SU 5E2PA 1K1NA 3E8LA 3STIA 4NIVA 4E05H 5DP7A 2BX4A 1MBMA 3S7HB 3RM2H 3FANA 1RIWC 2BTCE 1RTLA 4AFQA 2XYAA 1FONA 2A2XH 1CGHA 1ZLRA 1V6DA 1IQJA 4CREA 1RGQA 1QB6A 5EPNA 3A8BA 1O35A 4D7GA 2XWBI 3QLPH 1MKXK 1ORFA 1BITA 2VNTA 3LT3A 1DDJA 3VPKA 2J38A 1M9UA 4YESB 3UR6A 2O8LA 3PM3A 4BAMB 1K1MA 1HAVB 1LHGH 4LZ1H 1L4ZA 2CJIA 3GY4A 1SLVB 1C5YB 3KGPA 3BIVH 1MTWA 1INCA 2ZFQH 3NK8A 2BD2A 1O2UA 8GCHF 1C5UA 4A6LA 3ZZ5A 3IWMA 3TPIZ 1DUEA 3RXSA 1PFXC 3KQDA 3M7TA 3RMLH 1QB1A 1O38A 1ACBE 2PGBB 4D9QA 1FY1A 2RA3A 3A7VA 1L1GA 4ZHMU 1CQQA 2A5IA 4FVDA 2GMTC 4F49A 1VR1H 3RXOA 4AN7A 3W94A 1S0RA 2Z9GA 4BTTB 1BTXA 1W8BH 2R2WU 2FTLE 2ZFPH 1J15A 2XC5A 3RXVA 3RXUA 5FPSA 3A85A 3MMGA 1DOJA 3AW0A 1TOCB 2OXSA 5FBIA 2VWOA 1QRWA 1O2LA 3BEFB 1XUHA 2OC7A 2BDYA 2F9VA 1WTGH 3LGTA 1YPLH 3AASA 3QDZB 4FU9A 4TPYA 1CBWC 4I8LA 1K1LA 1ZJKA 3PO1B 4WH6A 2BLWA 3NWUA 3GCHB 1AI8H 3ZVGA 3BTQE 1KSNA 4ZHLU 1DVAH 5E0GA 2B0FA 2ZDNA 1P05A 3ZV8A 5H4IB 4BTUB 1UK3A 2QY0B 1UJ1A 1C1MA 1O3IA 1TNIA 2YNAA 3RXCA 1N6YA 1C4V2 1TIOA 2ZGJA 3GCTG 3MOCA 2NU2E 3ZZAA 2V0BA 3K2UA 2A4RA 4WMFA 5EQQA 1QJ6B 1SQOA 4DT7B 1MTVA 3BG8A 4IMZA 3OY6U 1ELTA 1O3HA 1C9PA 2FX4A 3SU6A 2ZHQH 2FZZA 5C2ZA 3C1KA 1PPCE 3ZYEA 1AVXA 1OXGA 1Y5UT 1O2SA 7ESTE 2AMQA 1NESE 3TH3H 1FJSA 5DP4A 5K7RA 2ZPSA 2UWOA 1TMTH 3Q76A 1SBWA 1F5RA 2D2DA 1LMWB 4YM9A 4YOIA 3FAOA 1C5LH 3ENSB 3SN8A 4BXSA 1HLTH 1C5XB 2ODQA 2WPIS 1AKSA 3DUXH 5EW1H 1C5VA 2R9PA 5G4BA 3M5OA 2G00A 1EKBB 1V2KT 1ABIH 4UD9H 2TPIZ 4DIIH 2XBWA 5HXFA 1PPBH 3RXGA 3QWCH 1TBZH 4FVBA 1PQ5A 4X8TH 1FXYA 2IPHA 2UWLA 1AVWA 5LPFA 3SHCH 1KDQA 5F03A 4AORA 4YT7H 5LGOA 2FESH 3SBKA 1YPJH 3MU5A 2STBE 1GJBB 3SUEA 3MNSA 2PWXA 3K65B 1EJMA 4VGCC 3P70B 2VWLA 2J2UA 1A0JA 2HGTH 5F8TA 1ZHRA 1FMGA 4A1TA 3M7QA 4Y7AA 1MZAA 2AMPA 1VITG 1GJ6A 2BD7A 4E06H 3HK3B 1EB1H 1TGBA 2D26C 1K2I1 1W0ZU 1J14A 4INHA 5J4QA 5JBCS 2ASUB 1FV9A 1A2CH 1TABE 3OX7U 3SUFA 1HUTH 1O2WA 3CP7A 7LPRA 1LVBA 2Z9LA 3PLPA 3SUGA 2VIOA 4LXBH 3MU0A 1GG6C 3SZNA 4FUIA 1UCYE 3PV4A 1L1JA 1TMBH 1GCTB 4GVUA 3TIUA 1HDTH 1G2LA 3TVJB 3S7KB 1AKSB 2FOAA 1NROH 3U8OH 2A4QA 3HKJB 1MH0A 3B9FH 4I8KA 1S85A 2GGVB 4DG4A 1GBIA 1A4WH 1Z7KA 2BYAX 2BD8A 1P2IA 3HPTB 2SGDE 1KXDA 1P9UA 2CGAA 2XC0A 3U1JB 2ZHWH 3STJA 1YCPH 3GY7A 2SNWA 8KME2 2ZU5A 1EUFA 1P2NA 3MH5A 2GCTB 1O3NA 1KDQB 3P92A 4WXVA 1O5FH 1GI0A 4NSVA 4O03A 2J94A 1SGRE 2XCFA 3I78A 5E2OA 3ZZDA 4O97A 1HAHH 1T8OA 1O2JA 1W13U 3ELAH 4BAHB 2BDAA 2G55A 1NFXA 1SSXA 3PWBA 1F2SE 2NU4E 1G36A 1GBJA 4ABFA 3BEUA 4FUJA 4AYYB 3PYHA 5FCKA 1O5CB 1QL9A 1C5ZB 3ESTA 1UVTH 4MTBA 1P04A 4B2CA 1YM0A 1BMLA 4K2YA 2BX3A 3UOPA 1LVYA 2W3IA 1HAOH 5TCAA 3EYDA 3LGWA 3F68H 2JH6D 1G3BA 1PQAA 1SVPA 1GBLA 4WH8A 1UTOA 7KMEH 3RXRA 1TFXA 1WSSH 3E6PH 5AF9H 1DSUA 1DLEA 4K5ZA 1FAKH 4CHAC 1G30B 1YC0A 3LIWA 2GX4A 1H9LB 5CHAB 1AZZA 2HNTF 3PLKA 4MPVA 4JZDH 1GCTC 1C2HA 3KEEA 1UTNA 1ZMJA 4ZKOU 2Z9KA 2A7JA 5GCHG 1MAYA 3SV9A 1DXWA 3M61U 2FOEA 3E3TA 4J1YA 1KXCA 4MNVA 1FN6A 2TBSA 4UE7H 3UY9A 5DP9A 3M3VA 2W3KA 4UONA 2BMGB 1QRZA 2RCEA 1BTUA 3LOXA 2CHAB 2OBOA 1E38B 4R8TB 1WUNH 1O3KA 2TGAA 4MNXA 1ZTKA 3RLWH 5EW2H 1QB9A 1LPKB 3MYWA 3SJ8A 1FNIA 3RLYH 2AGEX 2OC8A 5A8YA 1FQ3A 1O30A 1GI2A 5BRRE 1QA7A 1C4Y2 4U2WA 1MU6B 2F91A 3UPEA 3ZVCA 1GBKA 4Q2KA 1JMOH 4QT8C 1DFPA 1ETSH 4IN2A 2WYGA 3T2NA 2ZP0H 1ELEE 1O3LA 2WUBA 2HNTE 1C2KA 1WTHD 1CVWH 1Z71A 4I31A 2O8MA 1CU1A 4XBBA 3SU3A 1MTNB 2P95A 1FY8E 2FS9A 2VH6A 1P2OA 3PB1E 1T7CA 1XVOA 1B0EA 3MO3A 1W2KH 1C2DA 3ZZCA 1Z6JH 2BDBA 2RDLA 5DK1A 3F1SB 1W7XH 2ZHDA 3SV2H 2P59A 1GHAG 1HPGA 1O3EA 1VZQH 2SGFE 5LH8A 4ZH8A 1KY9A 1T8MA 2WPJS 9LPRA 2Y82A 1C1RA 4JCNA 1SGCA 2WINI 5FX5A 4ZKRU 5FX6A 3CS0A 1BBRK 2F9BH 1ANCA 1EPTA 2A1DB 1LHFH 3GDVA 1MKWH 2C8ZB 1MAXA 5FAHA 1OYQA 1KXBA 1SHYA 1O34A 2VJ1A 1IQGA 3GCHC 5DJ7A 2GZ8A 1NM6A 3SI3H 3OTJE 3BEIB 2SNVA 4RKOB 1MTUA 1GJAB 1SHHB 3LJJA 3TJOA 1IQLA 4FUHA 2H6MA 4Y7BA 1V2RT 1DPOA 1GMCG 3P8GA 2FYQA 2AERH 2QN5T 2A45B 4XE4A 3FVFB 1GBHA 1GJ9B 1ZTLA 1GHWH 2ZQ2A 4ABDA 1O2YA 3IG6B 1V2WT 3H7TA 4MNYA 3EA8A 1GHXH 1ZR0A 3UWJH 2TGTA 4HGCA 2G4TA 2PSXA 3RDZA 2GCHF 2WV4A 5PTPA 3UNRA 4GLYA 1GBEA 1C5RA 2JETB 4CBOA 2GD4B 1VCQA 1G3CA 1S84A 1QBVH 2G5VA 2UUFB 2A7HA 1CGIE 3L3TA 1GBTA 1WBGB 1UTMA 4WF8A 1BOQA 4MPUA 5ESTE 5JBTA 1SI5H 2J95A 3LGIA 1ELVA 2VINA 3ZZ6A 7GCHG 1ANEA 3NCLA 4AB8A 4K1EA 1IAUA 2ZFFH 3E90B 1L1NA 1G37A 1TA2A 1O2QA 1E0FD 2BDCA 2FOGA 2PW8H 2ZGXH 2O8WA 1EPTB 3P95A 1BMNH 2I6QA 1SLUB 2BQWB 3EGKH 1O3FA 1EAXA 2BVSH 1UCYH 5L2ZH 3HKIB 1LQEA 1O37A 2W7SA 1TB6H 5F6MA 1YPMH 4IC5A 5TCCA 3K9XB 4OS7A 5T6GA 5FPYA 1NU7B 1DX5M 1H8IH 1GI7B 4E7NA 5E0HA 1ZPZA 4MQAA 1AQ7A 1SQTA 2ZZUH 1N1LA 1QJ1B 1YCPK 2ZFSA 2LPRA 2P8OB 1EXFA 1GBFA 1ELGA 4X6PA 1TA6A 3PLBA 4X2YA 3V12A 1ELCA 1GGDB 3RXBA
chains in the Genus database with same CATH superfamily
1P0SH 4Y8XA 3A88A 1O3JA 4X1QU 3U98H 2ZPRA 2TRMA 3RXQA 1V3XA 2K7XA 2KZ4A 1C1TA 3GOVB 3RXDA 3MI4A 3QZRA 1FAXA 3EBNA 3AK5A 1EX3A 2J98A 2Y6TA 1TE0A 1SFIA 4ABHA 5DG6A 1ID5H 2GCTC 3CNRA 3UR9A 3V13A 3ZIAD 3ATMA 2O9QA 1P06A 4TY6A 4KTSA 4JZFH 3FP7E 2PV9B 5L6NH 1BJUA 1Y3WA 4MPWA 2FDAA 2PP6A 4JYUH 1A0HB 3ZZ7A 1WXRA 1MBQA 2W6ID 2XWAA 1QJ7B 3H7OA 4LK4A 4XBCA 1GHBG 1EJAA 1BA8B 1ETRH 4X8VH 4BANB 4X6OA 3Q3KA 5EPYA 2PUXB 3OFND 2FOMB 3DFLA 1ZHPA 1EB2A 4GUXA 4ZXYH 1IHTH 3FP6E 2B8OH 4TY7A 1BTZA 4BAKB 1YYY1 1XM1A 2F3CE 4AOQA 1J16A 3U9AH 4D7FA 2P3UB 1TRMA 4SGAE 2XBXA 1BRAA 4OS1A 4TT3D 3SNDA 5EU8A 3DA9B 1QRXA 1UVSH 1P9SA 2BQ7B 4Q4LA 3A7ZA 1IQMA 3TGKE 1FPCH 1GDUA 3MQKC 1WAYB 4U32A 4AFSA 1XUGA 1YF4A 1K21H 1GMHG 1KXEA 1TWXB 3F9FA 4KKDA 1PYTC 1WYKA 4O3UA 3VB7A 3LGVA 4H4FA 1YPGH 4B1TA 5A0AE 1LHDH 5AFZH 1GBCA 4UEHH 4IS5A 4ZKSU 2Z9IA 5CHAC 1DICA 1XKAC 3ZVBA 2C90B 3GDSA 2Z9JA 2F83A 3M5MA 2J98B 5C5NA 4YTAA 1DLKB 1UMAH 5AVDA 1EATA 2WV9A 5GDSH 2A4OA 1KTSB 1E35B 3T26A 4K1TA 1CT4E 2FEQH 3N99A 4UFEH 1TRYA 4THNH 2BDHA 2CHAC 3EE7A 4BTIB 4OS6A 5C67A 2FOBA 2JH0D 2BD4A 1LCYA 5L2YH 2HWLB 3AAUA 2UWPA 1HB0B 3BIUH 3BTGE 1IHSH 1E34B 3SU4A 2EC9H 2ZFRH 1OWJA 1TONA 4ISNA 4NIWA 2GV7A 3RC6A 4CR9A 1SGIB 1XUKA 4SGBE 1VGCB 1GI6A 1D4PB 3GISB 2HRVA 4B76A 4D76A 3GY2A 1EQ9A 1EZSC 4OGYA 3EAJA 2DE9A 1RTFB 1KLTA 4OM9A 3ITIA 5JPMH 1P3CA 1KYNA 1THRH 1LPGB 1O39A 3TJUA 2ZC9H 1SR5C 1GWAA 1MTNC 1MD7A 1H8DH 1Q3XA 3L33A 2H9TH 1ZOMA 1FN8A 2H9EH 3KHVA 4HTCH 2RA0A 3K6YA 4FETA 2QA9E 3A8DA 1Z8GA 4ISHH 3RXLA 3A80A 2VIVA 4DCDA 4GCHG 1AVGH 3VGCC 5SGAE 2DE8A 1SGTA 2BY6X 2RDEA 2GTBA 1GMDG 1A3BH 3O8BA 2Y81A 2QXIA 2FOCA 2NU0E 1TX7A 1TNJA 1J9CH 4ZKNU 5EJZA 1MZDA 1C5PA 3RMOH 5I25A 2AGGX 3UUZA 3KL6A 4DY7B 1V2VT 1UTPA 2VIDA 1L4DA 3RU4T 2A5AA 1JXPA 5A0CA 4U30A 1LVMA 1SFQB 3ODFA 1TAWA 3BTTE 1KXFA 4A5TS 1A61H 1GHVH 1NRPH 4FUDA 4H6SB 3RP2A 1T32A 3TH4H 1P2MA 3ATLA 4XBDA 4Q7YA 3T25A 2ZG0H 2BY8X 1RTKA 4BOHA 1QFKH 1ZSLA 2XC4A 2BVRH 3LH1A 1BB0B 2NU1E 1W3CA 1XXDA 3ZYDA 3ZZ8A 1TGNA 1T4UH 3ZZ3A 1GI8B 1YY3A 1H8ED 3U69H 2DUCA 2CF9H 1NBMD 3SHAH 4A92A 4Y76A 4X8UH 1XXFA 1Q31A 2BB4A 4Y8YA 1H9IE 4GHTA 3BV9B 2TIOA 1WQSA 1RRKA 3E0PB 2JETC 1SGDE 1OP2A 1TX8A 4CH8B 2IJD1 3SJKA 3DSPA 1AGJA 3TNSA 1EAUA 4OGXA 1RS0A 1OSSA 1F7ZA 4IBLH 1DWEH 1XX9A 1ZSKA 3T62A 3VXFH 3SU2A 4AYVB 2J4IA 2F9UA 1SPJA 3GCTF 6CHAB 1Q2WA 1O5GH 1C2IA 4LZ4B 3LPRA 4AFUA 2BD5A 1EPTC 1JWTA 1GI1A 1YBWA 1V2UT 9ESTA 1O2IA 4HFPB 3M36A 1NRRH 2BXUH 1N8OB 3SNCA 2HVXA 2M2AA 2G51A 2A2QH 4PROA 3SUDA 1NS3A 5GJ4B 3H5CB 4ASHA 3KYFA 1UVPA 4CRBA 2CMYA 1F0TA 1CA0B 4E7RG 3I29A 1C1OA 3UWIA 3BTEE 4CRAA 1V2ST 1FIZA 4WMDA 3QUMP 3V7TA 1P03A 1IQHA 2EI8A 4ISIH 1NFUA 2H9HA 2ZGBH 2J92A 3OE7D 4HG6A 2VGCB 4M9FA 4CR5A 1UVUH 4Z6AH 5GXPA 3ATKA 2FO9A 3W95A 3NUMA 4MVNA 3D62A 2P8OC 3T27A 5CHBA 4YO9A 4WVPE 2Z3DA 1TGTA 3ZZ9A 1C5QA 1HAZB 5EIYA 2WUCA 4NA8A 5C3NA 1GGDC 1A3EH 4A7IB 3O8CA 3A7TA 1GJCB 1FY5A 1BHXF 4DVAU 2M5TA 5A8XA 3E91A 2AGIX 1XUJA 3TK5A 1C4U2 1XUFA 2Y80A 2WSSD 2LIZA 5KGOA 4NSYA 3UTUH 1NC6A 3Q3XA 3EA9A 1DWCH 2GT8A 1DITH 3VG8A 3ZZ4A 4X2XA 2KCYA 4X2VA 2YMSD 2J9NA 1JRTA 1GJ7B 1HCGA 1OOKB 4B75A 4X6MA 1TBRH 3RUOA 5HM2A 3M37A 2ZDVH 3GY8A 1SL3A 1SOZA 1VITF 2AS9A 4FU8A 4AC9A 1P2JA 1EJNA 2ZEBA 2YNBA 3T28A 5DKMA 1HRTH 2BDIA 5A2MH 3SNEA 2FLBH 1AFEH 2ODPA 3M5NA 1W14U 3QZQA 3BTWE 3UNSA 3MU4A 3NZIA 4XSKU 1C9TA 1JRSA 3ATWA 2BDGA 3SU1A 1O3CA 1OWIA 1NN6A 1UTJA 3EE0B 3NXPA 1O2GH 3QO6A 5JDUB 4M7GA 3F0OA 4DJZB 1GJDB 3SNAA 3P8FA 5JBBS 2R0LA 5GIBA 3MH6A 3F2GA 1O5BB 1OWKA 2ZU3A 2YMSB 2AFQB 1BMAA 1LHEH 3T5FH 4B71A 1PPFE 4NZQA 1NFWA 3P8OA 4WWYA 1DY9A 1O2TA 1QL8A 1K1IA 1TPSA 3A7XA 2H2ZA 3Q77A 1PPGE 3E1XB 4DOQA 1EAIA 1KXAA 1YLNA 4XDEA 4I8GA 1TGCA 2ZDLA 2ULLA 3RXAA 2QAAA 4ZROA 2VVCA 3DT0H 1BTYA 1QHRB 2Z7FE 2QF0A 3SV6A 4NA7A 4BAQB 1QURH 1K1OA 2HPQH 2HVYB 1T8NA 1EZXC 3P8NA 2SGAA 3A83A 4F55A 2V3HH 3CENA 4MLFB 4YXWD 1MCTA 5C5OA 2O8TA 4U01A 5E0JA 5LPRA 1K22H 1C2EA 2XCNA 5HM9A 3PTNA 2Q6GA 4CRDA 4Z1MD 4AGJA 3SOSA 3KQCA 2ZDKA 3M3SA 1HJ8A 1YPKH 2JKHA 3KF2A 1O0DH 4X1PU 1CHGA 2XTTB 4GSOA 1AD8H 1NRQH 3LH3A 1G32B 1S83A 2ZQ1A 2F9OA 6GCHG 3MTYA 1HAPH 3HK6B 2PKSB 4JMYA 5DP5A 2B7DH 4F4OC 3DD2H 3K6ZA 5C1UA 2FI5E 4AFZA 1C1UH 3RC5A 1G2MA 1TNLA 2G4UA 2V3OH 3PV5A 3RM0H 1CHOG 3M7UA 2PKAA 2WPHS 2FX6A 2FMJA 1ZHMA 1DS2E 3Q3YA 4NWKA 5A09A 5CDFE 1ZJDA 3FZZA 2H5CA 2BOKA 2ANMH 1ETTH 2RG3A 3RXHA 5K0HA 1S0QA 5AFYH 1ZZZA 3PO1C 3UNQA 1TYNA 2PTNA 1BBRE 1XKBC 4WXIA 1O3AA 1BRCE 2VH0A 3NPSA 5DPAA 3KIDU 2ODYB 5GPIB 1Y3VA 2W26A 1O3OA 2C8WB 3SYJA 2GKVE 1YKTA 1P02A 3Q00A 4Y6DA 2XW9A 1TPPA 1YLDA 2C8YB 5T1VA 1VGCC 3F9EA 1C5NH 5LPEA 4VGCB 1C1VH 3O8DA 3GY3A 3A82A 3BTHE 2W7UA 1Y59T 4RKJB 4JK6A 3M3TA 3OY5U 1OWHA 1UO6A 2XBVA 5GCHF 4JYVH 2R0KA 1GPZA 2V3MA 3QGJA 2A5KA 1QGFA 4BXWA 1ELFA 3VB3A 1S82A 3B8JA 3TK6A 3TLOA 2A31A 2KCOA 1V2NT 2ZCKP 3KNXA 4Z0KA 3SI4H 2SGEE 2GP9B 1NPMA 2F4LA 1ESBA 1V2JT 1FI8A 4ZXXH 5A0BA 2W5EA 1J8AA 4NFFA 2TGDA 1LVOA 1C1NA 1GJ8B 5TJXA 3M35A 1O2NA 2ZCHP 4HI3A 1TOMH 1ESAA 4I8JA 1YPHC 1P8VC 3QN7A 2GV6A 3A81A 1DWBH 1G3EA 3FZDA 2PKAB 2PTCE 3UREA 4DURA 1P01A 3PROA 1ZPCA 2ZWLH 2ILNA 2Y7XA 4RN6A 1G9IE 2BQ6B 1MMJN 2IJOB 4XOJA 2P16A 3PWCA 3GY6A 1NRNH 2HALA 3SO3A 5FHTA 1DY8A 1FY4A 1GDQA 2ZHEH 3O8RA 1O2MA 8GCHG 3PMBB 1FDPA 1P3EA 2WPKS 3MNBA 1J17T 1ABJH 1GHAF 1TRNA 1HIAA 1GVKB 2QXHA 1S81A 1HNEE 2R2MB 2Q6DA 1ELDE 2ANYA 4P02A 2BZAA 3VB6A 2OCVB 1U6QA 3F6UH 2B5TB 4AGKA 1GBBA 1COWD 3MH7A 1SGQE 3KCGH 2YOLA 3RXFA 3VXEH 1Y3XA 3UAIC 4A1VA 1ZYOA 2OP9A 1SLXB 1C2LA 4OS5A 5FPTA 1OYTH 1W0KD 1CT0E 2BXTH 5ESBA 4ESTE 3VFEA 1PQ7A 1SGFA 1JOUB 3QGNB 1ZTJA 1IQIA 4AG1A 1RD3B 4UFGH 2ALPA 1GMCF 2STAE 4MG3A 1FPHH 1JBUH 1UK4A 6CHAC 5JB9S 1PJPA 3SQEE 1F0RA 3TH2H 1YLCA 2R3YA 3BTFE 1O36A 2FTMA 1HXFH 1HFDA 1N8OC 1S6HA 4TYDA 4X0WU 1AO5A 2OUAA 3A8CA 5B6OA 1PPZA 2ZKSA 2BLVA 1TPAE 1CA0C 5BPEA 3D23A 1QTFA 5ETXA 2UUJB 1C5SA 1X7AC 3SQHE 2Z3CA 5GNDA 4F48B 4UFDH 1SGNE 5EXMA 4DW2U 4ZMAH 1LKAA 1TALA 4K8BA 1D3QB 2VGCC 1AMHA 5FL7D 4XFQA 1HIAB 3QTOH 4MDSA 1W7GH 1WOFA 2L74A 1QR3E 2VWNA 1T8LA 2G81E 1FIWA 1TNHA 1VJ9U 3CS7A 2QC2A 1DE7H 1O3PB 7GCHF 2CK3D 3IITA 2EA3A 2PR3A 1AHTH 2ZHFH 2G52A 3RXJA 1EP6A 1MABB 2P3FH 2ZDMA 3UOUA 3NRLA 2ZU2A 4TPIZ 1WDIA 2IN2A 1QCPA 3KYGA 4D8NA 6ESTA 8LPRA 1N6XA 1P11E 4NG9H 2FP7B 5A8ZA 2VU8E 1IOEA 5B6LA 1GI3A 1F0UA 1O3BA 1OP0A 1CSOE 3HGNA 5FBEA 1NTPA 1V2TT 1NT1A 3WWBA 4AZ2B 2ANKH 2FWWA 3OSYA 1GHZA 1A5GH 5HGGA 1F0SA 4D9RA 2ZA5A 2FS8A 5KECA 3MH4A 4B2AA 4I32A 3LONA 3BG4B 1OX1A 3KQ5A 1Z8JB 2FODA 1OWEA 1VJAU 1RXPA 1KLJH 3M5LA 2OD3B 2BY9X 3PMAB 1C2GA 4BAOB 1IQFA 1IQKA 2PGQB 2ZGCA 1WV7H 3EA7A 1AB9B 2FOHA 2HLDD 1O2KA 2GDDA 1A7SA 1Z8IB 2XNIA 1VITH 1GL0E 1QA0A 4CH2B 5F8XA 3OAAD 1C5WB 3ZV9A 2C4FH 4X8SH 3RXMA 2BLQA 1O5AB 1SOTA 1PPHE 3ATIA 1FZZA 2Y5GA 2Z94A 2YMSC 3MO9A 2FM2A 1TBQH 2B9LA 3MU8A 3LC3A 1DM4B 1H8HD 2SGQE 2ESTE 5DO4H 4Q7ZA 4WY3A 4FUCA 4FU7A 3F9HA 2H5DA 1BCUH 1A0LA 1GBAA 3N7DA 2FYRA 1IQEA 5EGMA 2ZCLP 4ZUHA 1BJVA 3RXTA 4B73A 3LC5A 2BY7X 3EQ0H 1HJAB 4BNRA 4K69A 1KTTB 5HYOA 1MKWK 1GBMA 1XVMA 3FFGA 2A4GA 3DSGA 3GYMA 2HNTC 4TSFD 3SV7A 4IW4E 2NWNA 4HZHA 1VCWA 1BBRH 2P93A 1EP5A 1P57B 5T3HA 5C1YA 1EOJA 4X1NU 3SJIA 1BT7A 1GHBF 3F2FA 3LJOA 4ABGA 1D6WA 5JB8S 4KTCA 4I33A 3A84A 2SGPE 2PKSC 5EXNA 3QTVH 2KFWA 2A32A 3HGPA 1SKYE 1W10U 3VB4A 3TK9A 1C5TA 1GVLA 3MO6A 4B74A 5DSFA 1YWUA 3DFJA 3E16B 1CGJE 5EQRA 1MUEB 1YPHE 3E0NB 3RXKA 5FCRA 2ZDAH 1W0JD 5DP3A 1ANBA 1O2HA 1UVOA 4LOYH 1C1PA 1MU8B 3SV8A 4DGJA 2BZ6H 2GDEH 2AHME 2QV1A 2ZF0H 4IC6A 2NU3E 3V0XA 3URCA 4Q80A 2BVXH 1AFQB 2VIPA 1DUAA 4FUFA 1GMHF 4IMQA 3GCOA 4NCYA 3I77A 1LQDB 2G5NA 3JZ1B 3PRDA 2VVVA 5EXLA 4FOUC 2ZGHA 3SW2B 3KQBA 1GJ4H 2Y5HA 2ZTZA 4CRFA 1B0FA 2HPPH 2WYJA 3MU1A 4Y11E 2XBYA 1MQ6A 3RXEA 3RXPA 1O2RA 2ZFTA 3TU7H 3MFJA 3AW1A 3SU5A 3QK1A 1S6LA 5EOKA 5GWZA 2I6SA 1SGEE 5I46H 4RSPA 1FLEE 2WPLS 4Y8ZA 2FOFA 3RU4D 1OWDA 8ESTE 3OYPA 1NU9A 4ABIA 3LGUA 1D3DB 4NA9H 5C17A 2ZU4A 1XMNB 1SMFE 5DP8A 1UCYK 4UFFH 1QL7A 1DXPA 5EQSA 3PMHB 4K60A 1K0HA 3RXIA 1PQ8A 3FKSD 3BN9A 1BDAA 3S9AA 3U1IB 2EEKA 4GHQA 4ISLA 1W0YH 1AY6H 1FY3A 3DHKH 1MCVA 1QY6A 2LP6A 3RU4E 3TGIE 4NFEA 1S6FA 1O32A 2GZ9A 2HOBA 3SU0A 1O2VA 2ZTYA 3V3MA 1CA8B 1AIXH 1BTWA 1ZPBA 4MNWA 2BHGA 1DWDH 2V35A 4AG2A 2UUKB 2CN0H 4CRGA 3D65E 2VB0A 1CE5A 1O3MA 2PSYA 2HLCA 3BTME 3B23B 2OTVA 2TGPZ 1QQUA 1OS8A 2QE7D 1C5OH 1V2QT 1AU8A 5C0TA 5L30H 3BTKE 4H42U 1GI9B 4GCHF 1ZGIA 2EI6A 3FN8A 3UQOA 1GHYH 2GVFA 2WV5A 2R3UA 3S0NA 3LU9B 3LGYA 5ABWA 1E37B 1BRUP 2F9NA 1GMDF 4Y71A 2K8IA 1RIWB 1PYTD 4YLUA 3TGJE 1F92A 1P2KA 4MPXA 1C1QA 5C20A 2IPQX 3BTDE 4JYTA 1HAIH 4Y0YE 3MNCA 2QXGA 1H1BA 3P6ZB 2FI4E 2SFAA 2AMDA 2AIQA 2P3TB 4ZHAA 1NFYA 2O8UA 3A86A 1C5MD 5HIZA 3JZ2B 3LDXH 1SC8U 1IQNA 1O3GA 1P09A 1Y8TA 1HV7A 4ABJA 1BMMH 2FIRH 1HYLA 1TGSZ 3A8AA 1MTSA 4KTUA 4K1SA 4ABEA 1EZQA 4O3TA 2PHBA 1SGYE 1SQRA 1AN1E 4FUBA 1SLWB 2BM2A 2ZNKH 1P12E 1H9HE 3R3GB 4XD7D 3SNBA 1Y3YA 1L0ZA 2ZPQA 3RMMH 3DCLA 1MKXH 4R0IA 2VWMA 2GZ7A 4FUEA 4RI0A 1YP9A 2BOHB 4X2WA 2Q1JA 2OINA 3LKWA 2GMTB 1G3DA 2F9PA 1O33A 3OU0A 3FP8E 4X6NA 4CRCA 1TLDA 3TJVA 1A5HA 4B2BA 1UK2A 2JJ1D 1Z6EA 1JIMA 3HATH 3GY5A 2PLXA 1OPHB 2GCHG 4INKA 1O2PA 1MD8A 2JJ2D 3U8TH 1HAGE 2XXLA 1C2FA 1CBWB 1YCPM 1FUJA 1B5GH 3AAVA 5IDKA 4YOJA 2ZO3H 5T6FA 5CE1A 1EAWA 1BHXB 2V6NA 3SJOA 1TPOA 1QIXB 3P17H 5EG4A 2PUQH 2VIWA 3VB5A 1D9IA 1VCPA 1LTOA 3C27B 5AHGH 1CO7E 4Y0ZE 1SGPE 5JBAS 1HXEH 1E1RD 1MQ5A 4YZUA 1AE5A 1W12U 2A0QB 2BLOA 2FPZA 5HMAA 1JIRA 4AB9A 1ZRKA 1BTPA 1OP8A 5DP6A 1QNJA 2Q6FA 3MWIU 1BQYA 4X1RU 2CF8H 2LNCA 1LHCH 4I8HA 1ZMNA 1O5EH 3BG4C 1THPB 2J34A 2ZECA 4YOGA 4K8YA 2QF3A 2WPMS 4Y10E 1C2JA 3VGCB 1F5KU 3L6PA 1KIGH 1AB9C 1TMUH 4NZLA 2ZTXA 3A7WA 3ZVAA 1HGTH 1ARCA 3QX5H 4CBNA 3GICB 1V2MT 4DIHH 1C2MA 3A7YA 1K1JA 3A87A 3BSQA 4XRNA 1D3PB 2THFB 4I86A 1TX6A 1KLIH 2WPDD 4ISOA 3VEQB 1Y5BT 3GDUA 1GL1A 2QF4A 3SGQE 2D1JA 2C8XB 3S69A 1T4VH 1QBNA 1HBTH 1DANH 2J97A 3U8RH 2BD3A 2UUYA 3KQEA 2Z6BD 4K3JA 2CXVA 3D49H 1ESTA 1GVZA 4O9VA 4I7YH 4ACAA 2AIPA 2BY5X 1OKXA 1EFRD 3TNTA 1K1PA 2ANWA 1ZRBA 4ZCNA 1P2QA 1W11U 1WQVH 1UTQA 1ZMLA 3ZVEA 3WWFA 1P10A 2JH5D 1AWHB 1GBDA 4GAWA 1DT2A 2GT7A 2OC0A 1HJAC 3FOAA 1E36B 4KGAA 1ELAA 5FXLA 1EASA 3RMNH 4IN1A 3WW7A 5EODA 1TQ0B 3ZVFA 1SGFG 2ZI2H 1SB1H 5E8EH 3PTBA 1K28D 2D8WA 5IYTA 1Z1JA 1QZ8A 4WJG2 3MNXA 2Y7ZA 5JYIA 1Y3UA 1GG6B 2ZU1A 1AZ8A 4ZAEA 2C3SA 4WMEA 2QIQA 3UIRA 4NGAH 1HAYB 1XUIA 2P94A 1T31A 4IGDA 4JZEH 2JIZD 3T29A 1GI4A 1ZGVA 4NIYA 1S5SA 2FI3E 3SJ9A 4YT6H 1A5IA 1O31A 1HAXB 1BRBE 1NRSH 2OQ5A 2CV3A 2AH4X 3WY8A 5DGJA 2Z3EA 1UHBA 1Y5AT 4JZIA 4Q7XA 2AYWA 1RJXB 4AX9H 2ZIQH 1TNKA 4B6FA 1LDTT 4OS4A 3SORA 5CMXH 1TQ7B 4JZ1A 1GI5A 1H4WA 2BD9A 2C93B 4KP0A 1YGCH 1O2XA 1AFQC 1GDNA 1D3TB 1A1RA 1BIOA 4TWYA 3N7OA 1BZXE 1NZQH 2KAIA 3AVZA 3F9GA 1O2OA 1PPEE 1ARBA 1WU1A 4ABAA 3GYLB 3ODDA 1ZSJA 2OC1A 1AUTC 2QXJA 3SGAE 1O3DA 3RC4A 2EI7A 6GCHF 3UQVA 2XRCA 1QBOA 4FXGH 3ZVDA 1L2EA 1V2LT 2OQUA 3TJNA 1GCDA 3G01A 3NKKA 1HJ9A 4GPGA 4INLA 1CHOF 2IOTA 1RFNA 2VVUA 3ZZBA 2VIQA 3S9CA 2G8TA 1O5DH 1NO9H 3SGBE 4P00A 1BTHH 3S9BA 1UTLM 1AWFH 4TWWA 1TNGA 1V2OT 1HAVA 1THSH 3URDA 1QQ4A 3GCNA 2QYIA 2WHXA 2QGRA 2ALVA 1NY22 4ABBA 1V2PT 1Z1IA 1GJ5H 1EZUC 2OBQA 3TITA 1LO6A 3EDXB 1AE8H 4Y79A 1D6RA 1DSTA 1C1SA 4YLQH 1C1WH 4FUGA 3PMJA 5C94A 1O2ZA 1FX0B 4A1XA 3MHWU 1KMHB 3BF6H 1BUIA 1B7XB 1F5LA 1WCZA 2Y5FA 3R0FA 2QCYA 4NIXA 1UHBB 4CHAB 6LPRA 1Z8RA 1EOLA 4OS2A 2FLRH 3A89A 4JK5A 4UDWH 2AEIH 2FXRA 1ANDA 5T6DA 3OEHD 1YPEH 1UTKA 4J2YB 2K1QA 4NWLA 2RFKC 1K9OE 2A7CA 2OLGA 3UFAA 4H6TA 5F8ZA 1ELBA 1LPZB 2PFEA 1AUJA 4KELA 5J4SA 1LKBA 1SG8B 2H1UA 5C1XA 1CT2E 1SQAA 3KN2A 1A46H 2KAIB 4X1SU 5E2PA 1K1NA 3E8LA 3STIA 4NIVA 4E05H 5DP7A 2BX4A 1MBMA 3S7HB 3RM2H 3FANA 1RIWC 2BTCE 1RTLA 4AFQA 2XYAA 1FONA 2A2XH 1CGHA 1ZLRA 2LELA 1V6DA 1IQJA 4CREA 1RGQA 1QB6A 5EPNA 3A8BA 1O35A 4D7GA 2XWBI 3QLPH 1MKXK 1ORFA 1BITA 2VNTA 3LT3A 1DDJA 3VPKA 2J38A 1M9UA 3F0PA 5DN6D 4YESB 3UR6A 4RT0A 2JDID 2O8LA 3PM3A 4BAMB 1K1MA 3OTPA 1HAVB 1LHGH 4LZ1H 1L4ZA 2CJIA 3GY4A 1SLVB 1C5YB 3KGPA 3BIVH 1MTWA 1INCA 2ZFQH 3NK8A 2BD2A 1O2UA 8GCHF 1C5UA 4A6LA 3ZZ5A 3IWMA 3TPIZ 1DUEA 3RXSA 1PFXC 3KQDA 3M7TA 3RMLH 1QB1A 1O38A 1ACBE 1E1QD 2PGBB 4D9QA 1FY1A 2RA3A 3A7VA 1L1GA 4ZHMU 1CQQA 3PV2A 2A5IA 4FVDA 2GMTC 2KCPA 4F49A 1VR1H 3RXOA 4AN7A 3W94A 1S0RA 2Z9GA 4BTTB 1BTXA 1W8BH 2R2WU 2FTLE 2ZFPH 1J15A 2XC5A 3RXVA 3RXUA 5FPSA 3A85A 3MMGA 1DOJA 3AW0A 1TOCB 2OXSA 5FBIA 2VWOA 1QRWA 1O2LA 3BEFB 1XUHA 2OC7A 2BDYA 2F9VA 1WTGH 3LGTA 1YPLH 3AASA 3QDZB 4FU9A 4TPYA 1CBWC 4I8LA 1K1LA 1ZJKA 3PO1B 4WH6A 2BLWA 3NWUA 3GCHB 1AI8H 3ZVGA 3BTQE 1KSNA 4ZHLU 1DVAH 5E0GA 2B0FA 2ZDNA 1P05A 3ZV8A 5H4IB 4BTUB 1UK3A 2QY0B 1UJ1A 1C1MA 1O3IA 1TNIA 2KX4A 2YNAA 3RXCA 1N6YA 1C4V2 1TIOA 2ZGJA 3GCTG 3MOCA 2NU2E 3ZZAA 2V0BA 3K2UA 2A4RA 4WMFA 5EQQA 1QJ6B 1SQOA 4DT7B 1MTVA 3BG8A 4IMZA 3OY6U 1ELTA 1O3HA 1C9PA 2FX4A 3SU6A 2ZHQH 2FZZA 5C2ZA 3C1KA 1PPCE 3ZYEA 1AVXA 1OXGA 1Y5UT 1O2SA 4Q63A 2AMQA 7ESTE 1NESE 3TH3H 1FJSA 5DP4A 5K7RA 2ZPSA 2UWOA 1TMTH 3Q76A 1SBWA 1F5RA 2D2DA 1LMWB 4YM9A 4YOIA 3FAOA 1C5LH 3ENSB 3FO8D 3SN8A 4BXSA 1HLTH 1C5XB 2ODQA 2WPIS 1AKSA 4RT1A 3DUXH 5EW1H 1C5VA 2R9PA 5G4BA 3M5OA 3PRBA 2G00A 1EKBB 2EQNA 1V2KT 1ABIH 4UD9H 2TPIZ 4DIIH 2XBWA 5HXFA 1PPBH 2XOKD 3RXGA 3QWCH 1TBZH 4FVBA 1PQ5A 4X8TH 1FXYA 2IPHA 2UWLA 1AVWA 5LPFA 3SHCH 1KDQA 5F03A 4AORA 4YT7H 5LGOA 2FESH 3SBKA 1YPJH 3MU5A 2OK5A 2STBE 1GJBB 3SUEA 3MNSA 2PWXA 3K65B 2KCAA 1EJMA 4VGCC 3P70B 2VWLA 2J2UA 1A0JA 2HGTH 5F8TA 1OHHD 1ZHRA 1FMGA 4A1TA 3M7QA 4Y7AA 1MZAA 2AMPA 1VITG 1GJ6A 3DSOA 2BD7A 4E06H 3HK3B 1EB1H 1TGBA 2D26C 1K2I1 1W0ZU 1J14A 4INHA 5J4QA 5JBCS 2ASUB 1FV9A 1A2CH 1TABE 3OX7U 3SUFA 1HUTH 1O2WA 2WZQA 3CP7A 7LPRA 1LVBA 2Z9LA 3PLPA 3SUGA 2VIOA 4LXBH 3MU0A 1GG6C 3SZNA 4FUIA 1UCYE 3PV4A 1L1JA 1TMBH 1GCTB 4GVUA 2KR7A 3TIUA 1HDTH 1G2LA 3TVJB 3N7EA 3S7KB 1AKSB 2FOAA 1NROH 3U8OH 2A4QA 3HKJB 1MH0A 3B9FH 4I8KA 1S85A 2GGVB 4DG4A 1GBIA 1A4WH 1Z7KA 1NBME 2BYAX 2BD8A 1P2IA 3HPTB 2SGDE 1KXDA 1P9UA 2CGAA 2XC0A 3U1JB 2ZHWH 2KM0A 3STJA 1YCPH 3GY7A 2SNWA 8KME2 2ZU5A 1EUFA 1P2NA 3MH5A 2GCTB 1O3NA 1KDQB 3P92A 4WXVA 1O5FH 1GI0A 4NSVA 4O03A 2J94A 1SGRE 2XCFA 3U28C 1VKYA 3I78A 5E2OA 3ZZDA 4O97A 1HAHH 1T8OA 1O2JA 1W13U 3ELAH 4BAHB 2BDAA 2G55A 1NFXA 1SSXA 3PWBA 1F2SE 2NU4E 1G36A 1GBJA 4ABFA 3BEUA 4FUJA 4AYYB 3PYHA 5EJLA 5FCKA 1O5CB 1QL9A 1C5ZB 4ACBA 3ESTA 1UVTH 4MTBA 1P04A 4B2CA 1YM0A 1BMLA 4K2YA 4B6EA 2BX3A 3UOPA 1LVYA 2W3IA 1HAOH 5TCAA 5C0UA 3EYDA 3LGWA 3F68H 2JH6D 1G3BA 1PQAA 1SVPA 1GBLA 4WH8A 1UTOA 7KMEH 3RXRA 1TFXA 1WSSH 3E6PH 5AF9H 1DSUA 1DLEA 4K5ZA 1FAKH 4CHAC 1G30B 1YC0A 3LIWA 2GX4A 1H9LB 5CHAB 1AZZA 2HNTF 3PLKA 4MPVA 4JZDH 1BMFD 1GCTC 1C2HA 3KEEA 1UTNA 1ZMJA 4ZKOU 2Z9KA 2A7JA 5GCHG 1MAYA 3SV9A 1DXWA 3M61U 2FOEA 3E3TA 4J1YA 1KXCA 4MNVA 1FN6A 2TBSA 4UE7H 3UY9A 5DP9A 3M3VA 2W3KA 4UONA 2BMGB 1QRZA 2RCEA 1BTUA 2L6OA 2CHAB 2OBOA 3LOXA 1E38B 4R8TB 2W6JD 1WUNH 3UB0A 1O3KA 2TGAA 4MNXA 1ZTKA 3RLWH 5EW2H 1QB9A 1LPKB 3MYWA 3F3BA 3SJ8A 1FNIA 3RLYH 3GS9A 2AGEX 2OC8A 5A8YA 1FQ3A 1O30A 1GI2A 5BRRE 1QA7A 1C4Y2 4U2WA 1MU6B 2F91A 3UPEA 3ZVCA 1GBKA 5EJ1A 4Q2KA 1JMOH 4QT8C 1DFPA 1ETSH 4IN2A 2WYGA 3T2NA 2ZP0H 1ELEE 1O3LA 2WUBA 2HNTE 1C2KA 1WTHD 1CVWH 1Z71A 4I31A 2O8MA 1CU1A 4XBBA 3SU3A 1MTNB 2P95A 1FY8E 2FS9A 2VH6A 2V7QD 1P2OA 3PB1E 1T7CA 1XVOA 1B0EA 3MO3A 1W2KH 1C2DA 3ZZCA 1Z6JH 2BDBA 2RDLA 5DK1A 3F1SB 1W7XH 2ZHDA 3SV2H 2P59A 1GHAG 1HPGA 1O3EA 1VZQH 2SGFE 5LH8A 4ZH8A 1KY9A 1T8MA 2WPJS 1UW7A 9LPRA 2Y82A 1C1RA 4JCNA 1SGCA 1E79D 2WINI 5FX5A 4ZKRU 2F43B 5FX6A 3CS0A 1BBRK 2F9BH 1ANCA 1EPTA 2A1DB 2QF5A 4DT4A 1LHFH 3GDVA 1MKWH 2C8ZB 1MAXA 5FAHA 1OYQA 1KXBA 1SHYA 1O34A 2VJ1A 1IQGA 3GCHC 5DJ7A 5IK2D 2GZ8A 1NM6A 3SI3H 3OTJE 3BEIB 2SNVA 4RKOB 1MTUA 1GJAB 1SHHB 3LJJA 3TJOA 1IQLA 3W1EA 4FUHA 2H6MA 4Y7BA 2K0QA 1V2RT 1DPOA 1GMCG 5KEDA 5F53A 3P8GA 2FYQA 2AERH 2QN5T 2A45B 4XE4A 3FVFB 1GBHA 1GJ9B 1ZTLA 1GHWH 2ZQ2A 4ABDA 1O2YA 3IG6B 1V2WT 2J5UA 3H7TA 4MNYA 3EA8A 1GHXH 1ZR0A 2EY4C 3UWJH 2TGTA 4HGCA 2G4TA 2PSXA 4ASUD 3RDZA 2GCHF 2WV4A 5PTPA 3UNRA 4GLYA 1GBEA 1C5RA 2JETB 4CBOA 2GD4B 1VCQA 1G3CA 1S84A 1QBVH 2G5VA 2UUFB 2A7HA 1CGIE 3L3TA 3OEED 1GBTA 1WBGB 1UTMA 4WF8A 1BOQA 4MPUA 5ESTE 5JBTA 1SI5H 2J95A 3LGIA 3H09A 1ELVA 2VINA 3ZZ6A 7GCHG 1ANEA 3NCLA 4AB8A 4K1EA 5HKKD 1IAUA 2ZFFH 3E90B 1L1NA 1G37A 1TA2A 1O2QA 1E0FD 2BDCA 2FOGA 2PW8H 2ZGXH 2O8WA 1EPTB 3P95A 3F2HA 2XNDD 1BMNH 2I6QA 1SLUB 2BQWB 3EGKH 1O3FA 1EAXA 2BVSH 1UCYH 5L2ZH 3HKIB 1LQEA 1O37A 2W7SA 1TB6H 5F6MA 1YPMH 4IC5A 5TCCA 3K9XB 4OS7A 5T6GA 3SZEA 5FPYA 1NU7B 1DX5M 1H8IH 1GI7B 4E7NA 5E0HA 1ZPZA 4MQAA 1AQ7A 1SQTA 2ZZUH 1N1LA 1QJ1B 1YCPK 2ZFSA 2LPRA 2P8OB 1EXFA 1GBFA 2GJGA 1ELGA 4X6PA 1TA6A 3PLBA 4X2YA 3V12A 2VBCA 1ELCA 5HIYA 1GGDB 3RXBA
chains in the Genus database with same CATH topology
1P0SH 4Y8XA 3A88A 1O3JA 4X1QU 3U98H 2ZPRA 2TRMA 3RXQA 1V3XA 2K7XA 1C1TA 3GOVB 3RXDA 3MI4A 3QZRA 1FAXA 3EBNA 1EX3A 2Y6TA 1TE0A 1SFIA 4ABHA 5DG6A 1ID5H 2GCTC 3UR9A 3V13A 3ATMA 2O9QA 1P06A 4TY6A 4KTSA 4JZFH 3FP7E 2PV9B 5L6NH 1BJUA 1Y3WA 4MPWA 2FDAA 4JYUH 3ZZ7A 1A0HB 1MBQA 2XWAA 1QJ7B 3H7OA 4LK4A 4XBCA 1GHBG 1EJAA 1BA8B 1ETRH 4X8VH 4BANB 4X6OA 3Q3KA 5EPYA 2PUXB 2FOMB 3DFLA 1ZHPA 1EB2A 4GUXA 4ZXYH 1IHTH 3FP6E 2B8OH 4TY7A 1BTZA 4BAKB 1YYY1 1XM1A 2F3CE 4AOQA 1J16A 3U9AH 4D7FA 2P3UB 1TRMA 4SGAE 2XBXA 1BRAA 4OS1A 3SNDA 5EU8A 3DA9B 1QRXA 1UVSH 1P9SA 2BQ7B 3A7ZA 1IQMA 3TGKE 1FPCH 1GDUA 1WAYB 4U32A 4AFSA 1XUGA 1YF4A 1K21H 1GMHG 1KXEA 1TWXB 3F9FA 4KKDA 1PYTC 1WYKA 4O3UA 3VB7A 3LGVA 4H4FA 1YPGH 4B1TA 5A0AE 1LHDH 5AFZH 1GBCA 4UEHH 4IS5A 4ZKSU 2Z9IA 5CHAC 1DICA 1XKAC 3ZVBA 2C90B 3GDSA 2Z9JA 2F83A 3M5MA 5C5NA 4YTAA 1DLKB 1UMAH 5AVDA 1EATA 5GDSH 2A4OA 1KTSB 1E35B 3T26A 4K1TA 1CT4E 2FEQH 4UFEH 1TRYA 4THNH 2BDHA 2CHAC 4BTIB 4OS6A 5C67A 2FOBA 2JH0D 2BD4A 1LCYA 5L2YH 2HWLB 3AAUA 2UWPA 1HB0B 3BIUH 3BTGE 1IHSH 1E34B 3SU4A 2EC9H 2ZFRH 1OWJA 1TONA 4ISNA 4NIWA 2GV7A 3RC6A 4CR9A 1SGIB 1XUKA 4SGBE 1VGCB 1GI6A 1D4PB 3GISB 2HRVA 4B76A 4D76A 3GY2A 1EQ9A 1EZSC 4OGYA 3EAJA 2DE9A 1RTFB 1KLTA 3ITIA 5JPMH 1P3CA 1KYNA 1THRH 1LPGB 1O39A 3TJUA 2ZC9H 1SR5C 1GWAA 1MTNC 1MD7A 1H8DH 1Q3XA 3L33A 2H9TH 1ZOMA 1FN8A 2H9EH 3KHVA 4HTCH 2RA0A 3K6YA 2QA9E 3A8DA 1Z8GA 4ISHH 3RXLA 3A80A 2VIVA 4DCDA 4GCHG 1AVGH 3VGCC 5SGAE 2DE8A 1SGTA 2BY6X 2GTBA 1GMDG 1A3BH 3O8BA 2Y81A 2QXIA 2FOCA 2NU0E 1TX7A 1TNJA 1J9CH 4ZKNU 1MZDA 1C5PA 3RMOH 5I25A 2AGGX 3UUZA 3KL6A 4DY7B 1V2VT 1UTPA 2VIDA 1L4DA 3RU4T 2A5AA 1JXPA 5A0CA 4U30A 1LVMA 1SFQB 3ODFA 1TAWA 3BTTE 1KXFA 4A5TS 1A61H 1GHVH 1NRPH 4FUDA 4H6SB 3RP2A 1T32A 3TH4H 1P2MA 3ATLA 4XBDA 4Q7YA 3T25A 2ZG0H 2BY8X 1RTKA 4BOHA 1QFKH 1ZSLA 2XC4A 2BVRH 3LH1A 1BB0B 2NU1E 1W3CA 1XXDA 3ZYDA 3ZZ8A 1TGNA 1T4UH 3ZZ3A 1GI8B 3U69H 2DUCA 2CF9H 3SHAH 4A92A 4Y76A 4X8UH 1XXFA 1Q31A 2BB4A 4Y8YA 1H9IE 4GHTA 3BV9B 2TIOA 1WQSA 1RRKA 3E0PB 2JETC 1SGDE 1OP2A 1TX8A 4CH8B 3SJKA 1AGJA 3TNSA 1EAUA 4OGXA 1RS0A 1OSSA 1F7ZA 4IBLH 1DWEH 1XX9A 1ZSKA 3T62A 3VXFH 3SU2A 4AYVB 2J4IA 2F9UA 1SPJA 3GCTF 6CHAB 1Q2WA 1O5GH 1C2IA 4LZ4B 3LPRA 4AFUA 2BD5A 1EPTC 1JWTA 1GI1A 1YBWA 1V2UT 9ESTA 1O2IA 4HFPB 3M36A 1NRRH 2BXUH 1N8OB 3SNCA 2HVXA 2G51A 2A2QH 4PROA 3SUDA 1NS3A 5GJ4B 3H5CB 4ASHA 1UVPA 4CRBA 2CMYA 1F0TA 1CA0B 4E7RG 3I29A 1C1OA 3UWIA 3BTEE 4CRAA 1V2ST 1FIZA 4WMDA 3QUMP 3V7TA 1P03A 1IQHA 2EI8A 4ISIH 1NFUA 2H9HA 2ZGBH 2J92A 2VGCB 4CR5A 1UVUH 4Z6AH 5GXPA 3ATKA 2FO9A 3W95A 3NUMA 4MVNA 3D62A 2P8OC 3T27A 4YO9A 4WVPE 2Z3DA 1TGTA 3ZZ9A 1C5QA 1HAZB 2WUCA 4NA8A 5C3NA 1GGDC 1A3EH 4A7IB 3O8CA 3A7TA 1GJCB 1FY5A 1BHXF 4DVAU 2M5TA 5A8XA 3E91A 2AGIX 1XUJA 3TK5A 1C4U2 1XUFA 2Y80A 2LIZA 4NSYA 3UTUH 1NC6A 3Q3XA 3EA9A 1DWCH 2GT8A 1DITH 3ZZ4A 4X2XA 4X2VA 2J9NA 1JRTA 1GJ7B 1HCGA 1OOKB 4B75A 4X6MA 1TBRH 3RUOA 5HM2A 3M37A 2ZDVH 3GY8A 1SL3A 1SOZA 1VITF 2AS9A 4FU8A 1P2JA 1EJNA 2ZEBA 2YNBA 3T28A 5DKMA 1HRTH 2BDIA 5A2MH 3SNEA 2FLBH 1AFEH 2ODPA 3M5NA 1W14U 3QZQA 3BTWE 3UNSA 3MU4A 3NZIA 4XSKU 1C9TA 1JRSA 3ATWA 2BDGA 3SU1A 1O3CA 1OWIA 1NN6A 1UTJA 3EE0B 3NXPA 1O2GH 3QO6A 5JDUB 4M7GA 4DJZB 1GJDB 3SNAA 3P8FA 5JBBS 2R0LA 5GIBA 3MH6A 1O5BB 1OWKA 2ZU3A 2AFQB 1BMAA 1LHEH 3T5FH 4B71A 1PPFE 4NZQA 1NFWA 3P8OA 4WWYA 1DY9A 1O2TA 1QL8A 1K1IA 1TPSA 3A7XA 2H2ZA 3Q77A 1PPGE 3E1XB 4DOQA 1EAIA 1KXAA 4XDEA 4I8GA 1TGCA 2ZDLA 2ULLA 3RXAA 2QAAA 4ZROA 2VVCA 3DT0H 1BTYA 1QHRB 2Z7FE 2QF0A 3SV6A 4NA7A 4BAQB 1QURH 1K1OA 2HPQH 1T8NA 1EZXC 3P8NA 2SGAA 3A83A 2V3HH 3CENA 4MLFB 1MCTA 5C5OA 2O8TA 4U01A 5E0JA 5LPRA 1K22H 1C2EA 2XCNA 5HM9A 3PTNA 2Q6GA 4CRDA 4AGJA 3SOSA 3KQCA 2ZDKA 3M3SA 1HJ8A 1YPKH 2JKHA 3KF2A 1O0DH 4X1PU 1CHGA 2XTTB 4GSOA 1AD8H 1NRQH 3LH3A 1G32B 1S83A 2ZQ1A 2F9OA 6GCHG 3MTYA 1HAPH 3HK6B 2PKSB 4JMYA 5DP5A 2B7DH 4F4OC 3DD2H 3K6ZA 5C1UA 2FI5E 4AFZA 1C1UH 3RC5A 1G2MA 1TNLA 2G4UA 2V3OH 3RM0H 1CHOG 3M7UA 2PKAA 2WPHS 2FX6A 2FMJA 1ZHMA 1DS2E 3Q3YA 4NWKA 5A09A 1ZJDA 3FZZA 2H5CA 2BOKA 2ANMH 1ETTH 2RG3A 3RXHA 5K0HA 1S0QA 5AFYH 1ZZZA 3PO1C 3UNQA 1TYNA 2PTNA 1BBRE 1XKBC 4WXIA 1O3AA 1BRCE 2VH0A 3NPSA 5DPAA 3KIDU 2ODYB 5GPIB 1Y3VA 2W26A 1O3OA 2C8WB 2GKVE 1YKTA 1P02A 3Q00A 4Y6DA 2XW9A 1TPPA 1YLDA 2C8YB 1VGCC 3F9EA 1C5NH 5LPEA 4VGCB 1C1VH 3O8DA 3GY3A 3A82A 3BTHE 2W7UA 1Y59T 4RKJB 4JK6A 3M3TA 3OY5U 1OWHA 1UO6A 2XBVA 5GCHF 4JYVH 2R0KA 1GPZA 3QGJA 2A5KA 1QGFA 4BXWA 1ELFA 3VB3A 1S82A 3B8JA 3TK6A 3TLOA 2A31A 2ZCKP 1V2NT 3KNXA 4Z0KA 3SI4H 2SGEE 2GP9B 1NPMA 1ESBA 1V2JT 1FI8A 4ZXXH 5A0BA 2W5EA 1J8AA 4NFFA 2TGDA 1LVOA 1C1NA 1GJ8B 5TJXA 3M35A 1O2NA 2ZCHP 4HI3A 1TOMH 1ESAA 4I8JA 1YPHC 1P8VC 3QN7A 2GV6A 3A81A 1DWBH 1G3EA 3FZDA 2PKAB 2PTCE 3UREA 4DURA 1P01A 3PROA 1ZPCA 2ZWLH 2ILNA 2Y7XA 4RN6A 1G9IE 2BQ6B 1MMJN 2IJOB 4XOJA 2P16A 3PWCA 3GY6A 1NRNH 2HALA 3SO3A 5FHTA 1DY8A 1FY4A 1GDQA 2ZHEH 3O8RA 1O2MA 8GCHG 3PMBB 1FDPA 1P3EA 2WPKS 3MNBA 1J17T 1ABJH 1GHAF 1TRNA 1HIAA 1GVKB 2QXHA 1S81A 1HNEE 2R2MB 2Q6DA 1ELDE 2ANYA 2BZAA 3VB6A 2OCVB 1U6QA 3F6UH 2B5TB 4AGKA 1GBBA 3MH7A 1SGQE 3KCGH 2YOLA 3RXFA 3VXEH 1Y3XA 4A1VA 1ZYOA 2OP9A 1SLXB 1C2LA 4OS5A 5FPTA 1OYTH 2BXTH 1CT0E 5ESBA 4ESTE 3VFEA 1PQ7A 1SGFA 1JOUB 3QGNB 1ZTJA 1IQIA 4AG1A 1RD3B 4UFGH 2ALPA 1GMCF 2STAE 4MG3A 1FPHH 1JBUH 1UK4A 6CHAC 5JB9S 1PJPA 3SQEE 1F0RA 3TH2H 1YLCA 2R3YA 3BTFE 1O36A 2FTMA 1HXFH 1HFDA 1N8OC 1S6HA 4TYDA 4X0WU 1AO5A 2OUAA 3A8CA 5B6OA 1PPZA 2ZKSA 2BLVA 1TPAE 1CA0C 5BPEA 3D23A 1QTFA 5ETXA 2UUJB 1C5SA 1X7AC 3SQHE 2Z3CA 4UFDH 1SGNE 5EXMA 4DW2U 4ZMAH 1LKAA 1TALA 4K8BA 1D3QB 2VGCC 1AMHA 4XFQA 1HIAB 3QTOH 4MDSA 1W7GH 1WOFA 1QR3E 2VWNA 2G81E 1T8LA 1FIWA 1TNHA 1VJ9U 3CS7A 2QC2A 1DE7H 1O3PB 7GCHF 3IITA 2EA3A 2PR3A 1AHTH 2ZHFH 2G52A 3RXJA 1EP6A 2P3FH 2ZDMA 3UOUA 2ZU2A 4TPIZ 2IN2A 1QCPA 4D8NA 6ESTA 8LPRA 1N6XA 1P11E 4NG9H 2FP7B 5A8ZA 2VU8E 1IOEA 1GI3A 1F0UA 1O3BA 1OP0A 1CSOE 3HGNA 5FBEA 1NTPA 1V2TT 1NT1A 4AZ2B 2ANKH 2FWWA 3OSYA 1GHZA 1A5GH 5HGGA 1F0SA 4D9RA 2ZA5A 2FS8A 3MH4A 4B2AA 4I32A 3LONA 3BG4B 1OX1A 1Z8JB 2FODA 1OWEA 1VJAU 1RXPA 1KLJH 3M5LA 2OD3B 2BY9X 3PMAB 1C2GA 4BAOB 1IQFA 1IQKA 2PGQB 2ZGCA 1WV7H 3EA7A 1AB9B 2FOHA 1O2KA 2GDDA 1A7SA 1Z8IB 2XNIA 1VITH 1GL0E 1QA0A 4CH2B 5F8XA 1C5WB 3ZV9A 2C4FH 4X8SH 3RXMA 2BLQA 1O5AB 1SOTA 1PPHE 3ATIA 1FZZA 2Y5GA 2Z94A 3MO9A 2FM2A 1TBQH 2B9LA 3MU8A 3LC3A 1DM4B 2SGQE 2ESTE 5DO4H 4Q7ZA 4WY3A 4FUCA 4FU7A 3F9HA 2H5DA 1BCUH 1A0LA 1GBAA 2FYRA 1IQEA 5EGMA 2ZCLP 4ZUHA 1BJVA 3RXTA 4B73A 3LC5A 2BY7X 3EQ0H 1HJAB 4BNRA 4K69A 1KTTB 5HYOA 1MKWK 1GBMA 1XVMA 3FFGA 2A4GA 3GYMA 2HNTC 3SV7A 4IW4E 2NWNA 4HZHA 1VCWA 1BBRH 2P93A 1EP5A 1P57B 5T3HA 5C1YA 1EOJA 4X1NU 3SJIA 1BT7A 1GHBF 3LJOA 4ABGA 1D6WA 5JB8S 4KTCA 4I33A 3A84A 2SGPE 2PKSC 5EXNA 3QTVH 2A32A 3HGPA 1W10U 3VB4A 3TK9A 1C5TA 1GVLA 3MO6A 4B74A 3DFJA 3E16B 1CGJE 5EQRA 1MUEB 1YPHE 3E0NB 3RXKA 5FCRA 2ZDAH 5DP3A 1ANBA 1O2HA 1UVOA 4LOYH 1C1PA 1MU8B 3SV8A 4DGJA 2BZ6H 2GDEH 2QV1A 2ZF0H 4IC6A 2NU3E 3V0XA 3URCA 4Q80A 2BVXH 1AFQB 2VIPA 1DUAA 4FUFA 1GMHF 4IMQA 3GCOA 4NCYA 3I77A 1LQDB 2G5NA 3JZ1B 2VVVA 5EXLA 2ZGHA 3SW2B 3KQBA 1GJ4H 2Y5HA 2ZTZA 4CRFA 1B0FA 2HPPH 2WYJA 3MU1A 4Y11E 2XBYA 1MQ6A 3RXEA 3RXPA 1O2RA 2ZFTA 3TU7H 3MFJA 3AW1A 3SU5A 3QK1A 5EOKA 5GWZA 2I6SA 1SGEE 5I46H 4RSPA 1FLEE 2WPLS 4Y8ZA 2FOFA 3RU4D 1OWDA 8ESTE 3OYPA 1NU9A 4ABIA 3LGUA 1D3DB 4NA9H 2ZU4A 1XMNB 1SMFE 5DP8A 1UCYK 4UFFH 1QL7A 1DXPA 5EQSA 3PMHB 4K60A 3RXIA 1PQ8A 3BN9A 1BDAA 3S9AA 3U1IB 2EEKA 4GHQA 4ISLA 1W0YH 1AY6H 1FY3A 3DHKH 1MCVA 1QY6A 3RU4E 3TGIE 4NFEA 1S6FA 1O32A 2GZ9A 2HOBA 3SU0A 1O2VA 2ZTYA 3V3MA 1CA8B 1AIXH 1BTWA 1ZPBA 4MNWA 2BHGA 1DWDH 2V35A 4AG2A 2UUKB 2CN0H 4CRGA 3D65E 2VB0A 1CE5A 1O3MA 2PSYA 2HLCA 3BTME 3B23B 2OTVA 2TGPZ 1QQUA 1OS8A 1C5OH 1V2QT 1AU8A 5L30H 3BTKE 4H42U 1GI9B 4GCHF 1ZGIA 2EI6A 3UQOA 1GHYH 2GVFA 2WV5A 2R3UA 3S0NA 3LU9B 3LGYA 5ABWA 1E37B 1BRUP 2F9NA 1GMD