2BX3A

Crystal structure of sars coronavirus main proteinase (p43212)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAIN PROTEINASE
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
source organism Sars coronavirus sin2774
molecule tags Hydrolase
total genus 89
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A02
1TQ7B 4K1SA 1H8IH 4KGAA 3U98H 4BTTB 1ANEA 2BXTH 2D8WA 1O3BA 5FAHA 4GPGA 3Q00A 3M7UA 1N6YA 1NRRH 2R2WU 3UQOA 3RXGA 5ESTE 5FPYA 4E06H 5L6NH 1IQJA 3TVJB 1FDPA 1OWHA 1Z8RA 1G36A 4JZIA 5FCKA 5A8ZA 1P8VC 3KF2A 3NKKA 1GBHA 1YCPH 5C1YA 2C8XB 1G3DA 1MBMA 3U8RH 3SBKA 3STIA 3LGIA 2F9UA 1VITH 2ZTZA 3ZZ6A 2WUBA 3S7HB 4NWKA 1AZ8A 2ODPA 1MZAA 3MO9A 2GCTB 3ENSB 1LMWB 3S7KB 5AHGH 1KXDA 2ZFSA 3MU1A 3ATIA 3SV6A 2CV3A 2OBOA 1WOFA 4Z6AH 4UFDH 3RXFA 3S69A 3P8OA 2BDIA 8LPRA 1DXWA 3MU5A 4ABIA 3MH6A 1PYTC 1TB6H 1DOJA 4IMQA 4YOIA 4U32A 1J16A 2HNTF 1CGIE 4UONA 3E90B 1GJ8B 2BDGA 5A09A 1GBCA 4X6PA 3PLPA 4MLFB 2FEQH 2TIOA 4FUCA 3UR9A 1ZSJA 1K1MA 3QDZB 2AERH 4GCHF 3KQCA 1O5GH 1VZQH 4FUBA 2R3YA 2O8TA 3SJ9A 3FANA 1P2QA 4KTSA 1GCTB 1TA6A 1ESTA 3RP2A 1ELTA 1QBVH 3A7XA 1XKAC 2A7CA 2QV1A 4YOGA 3TGJE 1RIWB 2QXJA 4TY6A 1BRUP 1N8OB 2B8OH 4OGYA 1LKAA 1C9PA 2Z3DA 3EBNA 1H1BA 4DCDA 2FESH 4KTUA 3F9EA 1YPKH 1WCZA 1QNJA 1VGCC 3KQBA 1O3NA 2B7DH 3KEEA 4DGJA 1L2EA 3QWCH 3AAUA 1TGCA 1KSNA 2HALA 1ZHMA 1YPLH 2VNTA 1OXGA 3G01A 5LH8A 1ESBA 3VPKA 1MD8A 4O9VA 4WMDA 1SMFE 2Q6GA 1W13U 1ZSKA 1T8NA 5EG4A 3EYDA 2BZ6H 3A80A 3VGCB 1SGDE 1W2KH 3HGPA 5K7RA 2WPKS 1G32B 1XXDA 1NRSH 4NIXA 1SLWB 4INKA 2Z3CA 1S85A 1LQDB 1TBZH 3SJOA 3R3GB 1V2PT 4KTCA 4XBDA 5PTPA 3LGWA 1DSTA 2PGQB 3EE0B 1MMJN 1IQNA 2O8WA 2GCHF 1NROH 1TGBA 1GBKA 2BOHB 3UTUH 1UVTH 2C90B 2J38A 4ABJA 1G2MA 1Z71A 4FUHA 1Y5AT 7LPRA 4ZHLU 4A6LA 2Y7XA 3HGNA 2W3IA 1CT4E 4JYUH 1GGDB 4B75A 2CN0H 3BG8A 1OWIA 2TGAA 4XBBA 4J2YB 2BD5A 3OU0A 5AF9H 2I6QA 1NRNH 1O2JA 3GISB 4CR5A 1MTWA 1ANDA 3TLOA 3B8JA 2A1DB 2FLBH 1IOEA 1O39A 3LJJA 3CENA 2BVRH 1MU6B 3SNEA 4OS4A 4BTUB 1S5SA 4O3TA 1C2MA 1B0EA 2BQWB 1DX5M 2YOLA 2ZNKH 2DE8A 4AFZA 1EZUC 2ZTXA 3OTJE 2EEKA 4UDWH 1C1UH 2ZQ1A 5DPAA 1LVMA 1PPEE 2GGVB 1V2VT 2WYJA 4Q7YA 1YPMH 3PO1C 4MQAA 1CVWH 6CHAB 2FOHA 4IN1A 3HK6B 2P94A 3TJVA 4WVPE 4CHAB 2UUJB 2IOTA 2A7HA 1SOZA 1DSUA 1Y3UA 2P8OC 1JIRA 1LVBA 2BOKA 3MU4A 2JH6D 3QK1A 1A61H 1INCA 2FI4E 3MOCA 1ZYOA 2BHGA 2F91A 2FOCA 1THSH 1O2LA 1XKBC 1A0JA 1TPAE 1W8BH 1NT1A 1MKXK 2V3HH 1DWCH 5A8YA 1EAXA 2OC0A 1QFKH 1UVUH 4X1RU 2ZHFH 1KXAA 1KTTB 3GYMA 1XUGA 1RD3B 4FUFA 4UFFH 4XE4A 1GBLA 1KLTA 3GY6A 2JH5D 1DUEA 1UCYK 3FAOA 4NFEA 3EA9A 3SU6A 1DT2A 1T8LA 3OSYA 3E0PB 1TWXB 3W94A 4GVUA 1OSSA 2Z7FE 1BRCE 2IPHA 2AMDA 3LPRA 1RTFB 2ZDNA 4IBLH 5EXLA 2ZGCA 1PJPA 4CRFA 4LXBH 1ZR0A 2H6MA 2FDAA 2F9NA 3TNTA 1C5NH 1JXPA 1O31A 2ZDLA 1MBQA 1FIWA 3A88A 4YTAA 1AFQC 1NESE 4Z0KA 1HGTH 1V2RT 1TGNA 1A5GH 2P16A 1S83A 4LOYH 3M3TA 2VIQA 1O2KA 4YLQH 4UFGH 1LPKB 1L1JA 1DWBH 1BA8B 1EZQA 1OWKA 2BXUH 2ZDKA 2XRCA 3ZZ4A 3DA9B 2ALPA 1UK4A 2BDYA 1L1NA 2GMTB 2UUKB 4Q80A 1K1IA 2OC7A 1GMDF 3T25A 3EGKH 1HYLA 1SGIB 2ANYA 1HJ9A 2FX6A 1OWJA 1W3CA 3KCGH 1CO7E 1GI6A 1O33A 1GHBF 1OWEA 2VVVA 2JH0D 2XBXA 5HM2A 2R2MB 3TGIE 3SU0A 2D1JA 1F2SE 2CXVA 4BTIB 3S9BA 5JYIA 3Q3XA 3TU7H 2YNBA 1OX1A 1F7ZA 3RXHA 4JCNA 3RMMH 1C4V2 4K2YA 3A89A 3SNAA 2AGGX 1V2KT 1YLCA 2F9BH 1GHAF 3C1KA 1ZZZA 2ZFFH 3OY6U 5DP4A 3T62A 4AFSA 2QF0A 1GHBG 1CHOF 1FIZA 1GJ4H 2CMYA 1CA0B 1XXFA 3SJIA 1P57B 1XVOA 2GV7A 2ASUB 1RTLA 4Q2KA 1LHCH 2BLWA 1GMCF 1O3MA 3IITA 2WINI 3P6ZB 1SQAA 1SLXB 4X6MA 2FODA 4BANB 3L33A 1QCPA 1UCYE 1EZSC 1K1LA 1UTMA 3GY7A 1MTSA 1CHOG 1VGCB 1C1QA 3U69H 4X2VA 1QR3E 2SGFE 4K1TA 4DVAU 1FY4A 1UO6A 2PSXA 1GMCG 1TNJA 3M36A 2ZHQH 1C2HA 1QB1A 1G3EA 3OX7U 2F83A 1UK2A 1V2NT 1ZGIA 2ZCLP 1C2FA 1ZTJA 1AI8H 1XVMA 1CA8B 3SNDA 1T8OA 3Q77A 1VITF 3SUDA 2SNVA 4ZH8A 4NA9H 1CGHA 2BLVA 5AVDA 2PTCE 3ZZAA 4GSOA 5GPIB 3MU0A 4GAWA 4KKDA 4IN2A 1MKXH 2QAAA 2QYIA 1THRH 2CHAB 1WU1A 4ABFA 1L4ZA 1BIOA 2PUXB 2QGRA 3MNCA 2BVXH 5A0CA 4MVNA 3QTVH 1VITG 4I8LA 2H2ZA 1TQ0B 2VIWA 1DXPA 2FS8A 4X8VH 3RXCA 2VH0A 4INHA 2XWAA 4U01A 3ATLA 4CRDA 9ESTA 4FUIA 2EI8A 2SGEE 1E0FD 1IAUA 1DLKB 1NM6A 1UCYH 4MTBA 5BPEA 2XNIA 1MTNC 1SGRE 1Y3YA 2O8MA 3DT0H 3LOXA 3T26A 3A81A 1ZRKA 2B0FA 2BLQA 3AVZA 7GCHF 4R0IA 2Z6BD 3VFEA 5JBBS 1GBAA 3ODDA 3MI4A 3MYWA 3GY3A 4I31A 3T28A 2A31A 2J4IA 1FN8A 1O5DH 4FUEA 2B5TB 1BOQA 4D76A 5DP9A 3PO1B 4F49A 2VB0A 1ZPBA 5IDKA 4K3JA 4MPWA 1C2IA 2C8WB 4JZFH 4ABDA 2NU1E 3ZZ3A 3FP7E 7GCHG 4TWYA 2ZIQH 1UTKA 3K9XB 2GT7A 2ZKSA 3RXLA 4BXSA 2BDBA 1O38A 5T6FA 5C2ZA 1C5MD 4I32A 4I8HA 4Y0ZE 3GCOA 1ELEE 1O2IA 3A7WA 3MU8A 1Y3XA 2I6SA 1TOCB 3BTKE 4FVBA 3TH3H 4B2BA 1AFEH 3VB7A 4IW4E 2NU2E 4GHQA 4SGAE 1O3JA 2A7JA 3ZYEA 3N7OA 4K8YA 2ZFPH 1ZHPA 3VEQB 1GMHF 2K7XA 3RMOH 2R0KA 1V2WT 1K1NA 2XC4A 2BX4A 1MKWK 2UWPA 3TJOA 4ASHA 1FAKH 5LPEA 5EPNA 3W95A 2DUCA 4OS1A 3ZZDA 1QQ4A 1D4PB 1QY6A 4DT7B 5CHAC 1O3IA 1SFQB 1P2OA 3SV7A 1GBDA 3BEUA 3SOSA 3M61U 2AEIH 2VVUA 1ANCA 1HUTH 1G30B 1NFUA 2GV6A 5FPSA 1TNGA 1GJCB 1K1OA 1YPHE 2A45B 1O32A 1V2TT 1P04A 1C5VA 2QXHA 1NZQH 4JMYA 3UOUA 2ZU4A 1P3EA 5BRRE 2ZHEH 1D3QB 3BTQE 4JK5A 4FUGA 1K22H 1GWAA 4ABGA 1D3TB 1SI5H 3K2UA 1ZOMA 5FXLA 8GCHF 1Y59T 3K6ZA 3U8OH 4HZHA 1F0RA 4ABBA 1CE5A 2Z9IA 1QTFA 4X2YA 1LCYA 4KELA 2FOAA 2Q6FA 3RU4T 2LPRA 2OUAA 3VB4A 1AIXH 2TGTA 1LHEH 1P12E 1C1NA 1TYNA 2VWOA 4X1QU 1O3AA 2D2DA 4OGXA 4INLA 5TCAA 1C1OA 4OS6A 1C2KA 3DD2H 2H9TH 1Z1JA 1EB1H 2STAE 4VGCC 4QT8C 1LQEA 1TAWA 2Z9JA 2JETC 4CBNA 2PSYA 3A8AA 3QX5H 1KXFA 1BBRK 4HFPB 2FLRH 3GOVB 3BG4B 3RXUA 1G2LA 3QTOH 3SNBA 2NU0E 2GVFA 3NZIA 1NPMA 1VCWA 3TNSA 1C5ZB 1O3CA 2C4FH 3BIUH 1C5LH 2UUYA 5JB8S 3VB5A 2EA3A 2RDLA 1GI1A 1ID5H 2G81E 4HGCA 4I33A 1FY5A 4CH2B 2F9PA 4MPUA 5FX6A 6ESTA 1FZZA 2ZU5A 1ESAA 1ETRH 1L1GA 2K1QA 1UJ1A 1HAIH 1EUFA 1HXFH 4Y10E 8KME2 3MTYA 4TPYA 2Y5HA 4YT7H 3KNXA 1OP0A 1D9IA 3TK5A 1ELVA 1EPTC 3OYPA 4I8KA 3FZDA 4DY7B 1IQKA 2PKAA 1AB9C 1J14A 2SGPE 1T32A 4CRBA 3LH3A 1C1RA 4J1YA 1FV9A 2ANMH 5B6OA 1T7CA 3CS0A 2OP9A 3PWCA 3H5CB 1HAPH 1C5QA 3MMGA 5JPMH 1NFXA 2G51A 2ZU3A 1O2HA 2ZGHA 1K28D 3A8BA 1ZMNA 2GTBA 2DE9A 3SO3A 1DVAH 1UVOA 3SGBE 4D9QA 1T4VH 2Z9KA 3RMNH 1P05A 1EJNA 5HM9A 1SGCA 3P92A 2Q1JA 4DG4A 4K1EA 1RXPA 2FMJA 1A46H 1OYTH 1O2MA 1ZRBA 3T5FH 1ETTH 1MKWH 1W7XH 3RM2H 4XFQA 2Z94A 1BTHH 2PKAB 3FP8E 1ARBA 2FOMB 3BV9B 2BDAA 5FBEA 4ZXYH 5DGJA 1T4UH 4NGAH 1BBRE 2W3KA 3AASA 4X8UH 2AMQA 1CBWB 4ABEA 4CRAA 1H8DH 1C5XB 1ARCA 3SUFA 3DFJA 1VR1H 1VJ9U 2ODQA 4B2CA 2BQ6B 5C1UA 4OS2A 1TOMH 4R8TB 1RJXB 1O5BB 4B1TA 2R9PA 1SPJA 1ELFA 3TH4H 1VCQA 1ZMJA 4AFUA 2VVCA 3ZZBA 2FM2A 2J92A 4JZ1A 3RLWH 3ZZ9A 3GICB 3QZQA 1GJAB 3RMLH 2Y7ZA 4O97A 1MQ5A 4NFFA 2ANKH 4BAKB 4NSVA 2G8TA 1OWDA 1B7XB 3MO6A 2FOGA 1ZTLA 2ZCHP 3GYLB 1ZPCA 3F9FA 4AX9H 2WPJS 3TJUA 1T31A 2CGAA 1O3HA 1ZMLA 1FMGA 3M37A 4E7NA 1BBRH 1DFPA 2UWOA 1RFNA 3IG6B 1JBUH 2BDCA 5F8TA 3MH5A 3E16B 3D65E 5AFYH 4OS5A 1K1JA 1HDTH 2BQ7B 2OXSA 1NTPA 2ZPQA 5L30H 1BTXA 2AS9A 3FFGA 4FUDA 3GCHC 3TH2H 2RCEA 4YT6H 2BVSH 1NU9A 3MNXA 1XUHA 1A2CH 3S0NA 5FHTA 3PB1E 4D8NA 2XC0A 3RC4A 1V2JT 4X0WU 1C5SA 1EAWA 1SVPA 3P8FA 5T6DA 3UNQA 2P59A 3LU9B 5HXFA 2WV5A 3O8CA 1RS0A 1YP9A 4Q7ZA 2A4GA 2FI5E 4WMFA 1Z1IA 2FS9A 2ZC9H 4CR9A 2BD2A 3RXAA 1QB6A 4ISNA 2FOFA 5FPTA 4BXWA 1BTZA 4AB8A 3LONA 2PLXA 1SC8U 1W11U 1HAYB 4O3UA 4WH6A 9LPRA 2H1UA 4IMZA 1LHFH 1ZPZA 2FO9A 2ZFQH 3A7TA 1MU8B 1UTQA 2ZEBA 3NUMA 2ZGBH 1SGNE 1MH0A 2NU4E 1SGFG 1IQIA 1KXEA 1BJUA 2FYRA 1BMLA 3UUZA 1AVGH 2PFEA 2PTNA 3SGAE 1DUAA 1YM0A 2BY9X 2HNTE 1GG6C 1QQUA 1QL8A 4MDSA 1O2WA 2Y6TA 1GBFA 2ALVA 1O35A 1YPHC 1FY1A 4ZUHA 1O5FH 3PTBA 5JBAS 1OOKB 4XDEA 3SZNA 3URDA 4ZHAA 4TY7A 3KQEA 2ZO3H 3PYHA 1MUEB 7ESTE 2Z9LA 1LVOA 2D26C 1C5YB 5C3NA 3R0FA 2IN2A 2EI7A 2A5KA 1NFYA 1TIOA 2HPQH 2C8YB 6GCHF 5EOKA 4MNXA 3F6UH 1QRZA 1TNKA 1PFXC 1HAGE 2GP9B 1QA7A 4X8TH 1ANBA 3BTWE 2G52A 4JZDH 5F03A 4UE7H 2XCFA 3SQEE 2O9QA 4MNWA 3M35A 1WUNH 3DFLA 4Y6DA 5C1XA 2OQ5A 1KIGH 5I46H 2AYWA 5F8XA 4DIHH 4GUXA 6GCHG 2FPZA 4ISIH 1BTWA 1QRXA 1V3XA 1FN6A 5EQRA 3BSQA 1D6RA 1LHGH 4MPXA 1HPGA 2R3UA 3ELAH 3KIDU 4K8BA 1YKTA 4BAOB 3M7TA 2QIQA 1CHGA 2P3UB 1D3PB 1EX3A 3BF6H 2A2QH 1FONA 4ZKSU 2V35A 1LTOA 2BD8A 1Z8GA 1QJ6B 1TALA 1QURH 5DKMA 1KY9A 2Y5GA 4NG9H 4BAHB 1M9UA 3UQVA 4WWYA 2ANWA 1K9OE 1ABIH 3PMJA 2GZ9A 4TWWA 1YLDA 2ZP0H 3F9GA 1SG8B 4HTCH 3UREA 3AW0A 1UTJA 2GZ7A 1O37A 2TGPZ 3E6PH 3HK3B 5AFZH 1GDNA 3QGJA 1N1LA 1A0HB 3M3VA 3RXBA 1D3DB 3TK6A 4RSPA 4ZKOU 3PLKA 2PR3A 3O8BA 1N6XA 1OPHB 5A2MH 4ZXXH 2XXLA 1EOJA 3ODFA 4XSKU 1S0QA 1DE7H 2TPIZ 1ZGVA 7KMEH 1TNHA 2W7UA 1CT2E 1O2OA 3RXQA 3RM0H 4MG3A 5EU8A 1PPZA 1P2IA 1E37B 3KGPA 3M5LA 4Y0YE 3CS7A 5DP5A 3RXVA 4XOJA 3RXDA 3A7ZA 1A1RA 1GVKB 1LPGB 1NY22 3M5MA 3RU4D 5H4IB 1KLJH 2F3CE 1FJSA 4AFQA 1AZZA 1HJ8A 2GCTC 3SQHE 3A87A 2C93B 1E36B 3HPTB 1V2LT 2WYGA 1DY9A 3TJNA 5L2YH 1FPHH 3A82A 3EA8A 1QRWA 1P2JA 1IQFA 1OS8A 1O5EH 2ZPRA 4ISOA 1IHSH 1QGFA 3GY8A 4D7GA 4NZQA 1P9SA 2QA9E 1BHXF 1O3GA 2BB4A 4D7FA 1DICA 2H9HA 3O8RA 3SV2H 1O36A 3RXJA 1IQMA 3SI4H 4IC5A 1V2QT 4RKOB 3IWMA 1TPOA 2ILNA 4BAQB 4NCYA 3M3SA 2FOEA 5L2ZH 2OC1A 3V3MA 3RXMA 2HGTH 1MTUA 1O34A 2P93A 1GCTC 1F0SA 3BTFE 2A4OA 3ZZ8A 1DITH 4Q7XA 4Y8ZA 1ZSLA 3ITIA 1C1PA 4AGKA 4K60A 1QL9A 4YLUA 3I29A 4DIIH 1P11E 1N8OC 1C1WH 1DWEH 2HPPH 1GHVH 3UR6A 2ZU2A 1CU1A 5E2OA 1XX9A 5T3HA 2RA3A 1GJDB 4TPIZ 1ZLRA 2HOBA 1NC6A 4BOHA 5EODA 3BTDE 1ZTKA 2BYAX 1MD7A 4MPVA 2FTMA 2P8OB 1EKBB 3UNSA 2AMPA 4B76A 1DANH 1A5IA 1BMNH 3D23A 2ULLA 2O8LA 2B9LA 2QXGA 5ETXA 4UD9H 1YBWA 2ZWLH 3RU4E 4RKJB 1KTSB 1C2LA 2CJIA 1WQSA 1W14U 3BTHE 1U6QA 1BT7A 1GI8B 2ZA5A 3AW1A 1TRYA 1GJ5H 2BD9A 1T8MA 2O8UA 1YGCH 1AHTH 1GI0A 2BY6X 1AU8A 2WV4A 5DG6A 2WPHS 3F1SB 1S6FA 3D62A 2P95A 3SU1A 1QJ1B 3EQ0H 5TJXA 3D49H 3M5OA 3GY4A 3RC5A 4DW2U 1WTHD 1TRNA 2VIVA 1O2YA 1O2NA 1UMAH 4JYTA 1C5PA 1QBOA 4AGJA 2OINA 3LGUA 5DO4H 2WUCA 1GGDC 1J9CH 2FYQA 4CH8B 1YPJH 1Z7KA 4MNYA 2OQUA 2HVXA 3M5NA 3PM3A 2BZAA 3WY8A 3RUOA 1IQHA 4FXGH 2XBVA 1RRKA 2P3TB 1AFQB 1O3KA 1GI4A 3V13A 3NK8A 5DP6A 1MZDA 1B5GH 4NWLA 1D6WA 2AIQA 3ZZ5A 3EAJA 1O5AB 1OP2A 3S9CA 4H4FA 2BY8X 1BUIA 1UTLM 1IQEA 5GWZA 2J34A 1JIMA 4HI3A 4F4OC 1SQTA 3VB3A 4CHAC 1O5CB 4FVDA 3P8GA 4E05H 4CRCA 1O2ZA 1AE8H 2ESTE 4SGBE 1GBJA 3DUXH 4LK4A 3H7OA 1O2TA 1Q2WA 1XUIA 3UOPA 2PHBA 1P3CA 1TGTA 5C67A 2FXRA 2AH4X 2VJ1A 1C2DA 2VIDA 2HNTC 1A5HA 3URCA 2BD7A 1O3EA 1BHXB 2WPLS 3SUGA 3GCNA 5CMXH 2GDDA 2ZFRH 2FTLE 1EASA 3O8DA 1P02A 1Q31A 4FU7A 1Z6JH 3BN9A 1GPZA 3OY5U 1UTPA 5DP3A 1Y5BT 1V2ST 3FP6E 1A7SA 5SGAE 4A92A 2PGBB 1S6HA 2ZI2H 2VGCC 1GI3A 1GBEA 2VWMA 4JYVH 3QGNB 4AYVB 1FXYA 4AORA 4NZLA 1SGTA 3U1IB 2A4RA 3TIUA 1EB2A 1THPB 4GLYA 2C8ZB 3ATWA 3GDSA 1LDTT 3MHWU 5LPRA 2Q6DA 2W26A 2FIRH 3PLBA 3F9HA 1PPHE 2GD4B 1TNLA 2JKHA 2ZTYA 1UTNA 4Y79A 3ZZ7A 2GT8A 3ESTA 3RXPA 4A7IB 1GL1A 4KP0A 5ESBA 4X2XA 1Y3WA 1SSXA 2V6NA 4AZ2B 5E0GA 3MO3A 4AG2A 2EI6A 5EW2H 4FUJA 1BZXE 1HCGA 4X6OA 2TRMA 2BY7X 2H5DA 2GMTC 1O3DA 1BB0B 3SJKA 1O2GH 4LZ4B 1F92A 1TX6A 2GX4A 1V2OT 1WV7H 2OLGA 3CP7A 1C5WB 1GBBA 2UWLA 1IQGA 3SJ8A 3GCTF 2G00A 2RA0A 4H6SB 5EXNA 5HMAA 4Y11E 1S82A 1SGEE 2QC2A 1TX8A 3RXTA 2OC8A 1O3OA 3ZVGA 1AKSA 5A0BA 3RXOA 3LKWA 3A8CA 2HWLB 1H9LB 2RG3A 2SNWA 4H42U 4YOJA 5G4BA 2XBYA 1TMUH 3EA7A 2R0LA 1TX7A 4BAMB 4GHTA 3GCTG 1O2PA 1H9HE 3GY5A 1MTNB 3UIRA 1CA0C 3HKJB 1PPFE 1PQ8A 1HBTH 2NU3E 2OD3B 3K6YA 1GHZA 1C2JA 1F0TA 3UWIA 2CF9H 4TYDA 4DOQA 3PMHB 3ZV8A 1O2VA 1SGPE 1TA2A 1W10U 4IC6A 1GBMA 2GZ8A 1J17T 1GJBB 4AN7A 4B2AA 3BEIB 2V0BA 3AAVA 1SB1H 3SI3H 1EJAA 2GDEH 3GDVA 1SLVB 4MNVA 3B23B 1K1PA 1LHDH 1HLTH 5FCRA 4GCHG 1AKSB 1SGQE 1C5UA 3SHCH 1KXCA 2BMGB 2SGQE 1EJMA 2J94A 1HIAA 3KL6A 1K21H 1EZXC 1HAXB 1GBIA 2QN5T 3UY9A 1P06A 1GI7B 1W0YH 3ZVCA 1J15A 1TBRH 1MCVA 1C1MA 3GDUA 4I8GA 2TBSA 1O2RA 1O0DH 1GI2A 3GY2A 2G55A 1E38B 2THFB 4WY3A 2ZG0H 4ABHA 3C27B 1G3BA 4ISHH 4DJZB 3LC5A 1C5TA 1O3LA 3Q3YA 2WPIS 1FY3A 3L3TA 1TGSZ 3KN2A 2CHAC 2PKSC 4IGDA 3JZ1B 3LGYA 4I8JA 2A2XH 1C1TA 3TPIZ 2A0QB 2TGDA 3T2NA 2ZU1A 4YESB 1HJAC 2J2UA 1ZJKA 2W5EA 1HIAB 1P03A 1UVSH 5CHAB 2XCNA 1BRAA 1GHXH 1SL3A 1TPSA 4X8SH 4ZHMU 2GCHG 2XC5A 4Y71A 1NRPH 3MFJA 1LVYA 4DURA 1LPZB 1AUJA 1GVLA 1DM4B 1NFWA 2NWNA 2BM2A 1ELGA 1EATA 1XUFA 1ACBE 5DK1A 1F0UA 2PV9B 1TABE 5HYOA 4X1NU 1PQAA 1P09A 2AGIX 3K65B 5LPFA 1AY6H 2GKVE 2FWWA 3BTGE 4NIVA 1BDAA 1PPBH 2HRVA 4I7YH 5EQSA 4RN6A 1GDQA 1GJ6A 3V0XA 3A7VA 1QJ7B 4JK6A 2J95A 1BRBE 3ATKA 4B74A 3H7TA 3SORA 3LGTA 1GBTA 1V2MT 1AWHB 4NIYA 4WXIA 1ABJH 2A32A 1C5RA 1GI9B 4X6NA 3RC6A 3VB6A 5JB9S 5GDSH 4U30A 3A7YA 2G5NA 2ZZUH 2SGDE 1BCUH 4VGCB 1WSSH 4A5TS 3MH4A 1PYTD 4Y76A 1P10A 1QBNA 1Z8IB 3E0NB 2JETB 3QUMP 1EPTA 3ATMA 3DHKH 5JDUB 2VIOA 2BDHA 3U9AH 2LIZA 1XMNB 1QA0A 5JBTA 5C5NA 1TFXA 2BLOA 5E2PA 4X2WA 1MAYA 1UHBA 1L4DA 1SFIA 1X7AC 1FPCH 1P2NA 1DY8A 2VGCB 1OP8A 1UK3A 3E91A 1G3CA 2FI3E 3ZV9A 1QHRB 1FAXA 1FNIA 1BMAA 1HAHH 2EC9H 2QY0B 3RLYH 1UTOA 1TNIA 2VINA 5HGGA 2HLCA 2OBQA 3P17H 2OTVA 1Z8JB 1P01A 1ZHRA 2G4UA 1FQ3A 4K5ZA 1C2EA 3JZ2B 1SOTA 1DDJA 5IYTA 1S0RA 2M5TA 3TK9A 4JZEH 1AGJA 1K2I1 1SBWA 5E0JA 1BJVA 1AN1E 1GL0E 3UWJH 1C4Y2 4X1SU 1EAIA 1HRTH 1EPTB 1XUKA 2OCVB 3TGKE 1QIXB 1BMMH 3NPSA 3MNSA 3E8LA 1PPCE 4NA7A 3QZRA 1AB9B 2QF3A 3VXFH 3QLPH 1KYNA 3BIVH 1HFDA 2BD4A 1TE0A 3TITA 1UHBB 3P70B 2ZQ2A 2A4QA 4CREA 3PROA 2VWNA 1TMTH 3U1JB 1SGFA 1J8AA 1TRMA 3LT3A 2FP7B 3MWIU 4ZAEA 5E0HA 1SGYE 2FX4A 3LIWA 2ZECA 3E3TA 2XW9A 3T27A 2CF8H 2LNCA 4A1VA 1ELAA 1BITA 3ZVEA 4UFEH 3NCLA 3A86A 4H6TA 4CBOA 1TONA 2BTCE 1IQLA 1O3FA 2AIPA 2C3SA 5E8EH 3LH1A 2SFAA 4Y8XA 2XBWA 3SN8A 4PROA 1TMBH 3HKIB 1GHWH 3E1XB 3RXIA 4LZ1H 1GMDG 2QXIA 1V2UT 5GJ4B 1C5OH 1C4U2 1HAVA 3SV9A 2ZHWH 3BG4C 2AGEX 3LGVA 3KHVA 4NA8A 1HNEE 1BTUA 2XTTB 3ZVAA 1Y5UT 1G37A 1MAXA 1JOUB 3MH7A 3T29A 1PQ5A 3SU3A 5C20A 1FUJA 1XM1A 3U8TH 1AD8H 4E7RG 2Y80A 1L0ZA 2Y82A 3RXRA 1JRSA 1SQOA 1QB9A 2XWBI 2ZDAH 1CSOE 3SV8A 1Z6EA 1C9TA 1NO9H 1O30A 3NWUA 1F5RA 1GHAG 3RXKA 1YCPM 1GDUA 1GCDA 2H5CA 1HB0B 3NXPA 4ZMAH 5LGOA 3P95A 2Z9GA 3RXSA 3KQDA 4YM9A 2ZCKP 3SHAH 5ABWA 1BTYA 2ZDVH 2VIPA 4YZUA 1AMHA 1VJAU 1HAVB 1O2SA 1TPPA 3LDXH 3QO6A 4Y7AA 5F8ZA 4NSYA 1CQQA 1AWFH 5GCHF 1A0LA 3Q76A 1EQ9A 1YYY1 3F68H 2ZDMA 4OS7A 8ESTE 3V12A 5EGMA 3PV4A 1G9IE 1EOLA 1ORFA 2G4TA 3BTTE 1EAUA 3VXEH 3UFAA 1WTGH 1WAYB 2ZF0H 2P3FH 4AYYB 3BEFB 1W7GH 1KDQA 1KLIH 1A3BH 3RDZA 3SGQE 2PWXA 4ZROA 5C5OA 1A4WH 2PKSB 5GCHG 2W7SA 2FZZA 1B0FA 1EP6A 3V7TA 1ELCA 4Y7BA 5J4SA 1KXBA 1JMOH 1CGJE 1UVPA 1HJAB 1ZJDA 3PMAB 2YNAA 5TCCA 4B73A 1C1VH 1NU7B 1RIWC 3PMBB 1YPGH 1DWDH 4B71A 1MQ6A 3ZZCA 5GXPA 3BTEE 1LO6A 3Q3KA 1WBGB 3GCHB 1YCPK 1OYQA 3S9AA 2BY5X 5DP8A 1H9IE 1CBWC 2PUQH 3EDXB 2QCYA 3BTME 2H9EH 1FI8A 1AUTC 1GHYH 1F5KU 1EP5A 3UNRA 3A84A 1XUJA 1S81A 1SLUB 1Y8TA 3SW2B 1AQ7A 5J4QA 2ZGXH 1GJ9B 1KDQB 1H4WA 2PW8H 2IJOB 4X1PU 1BTPA 3A83A 5EW1H 1P9UA 3FZZA 1SHYA 3VGCC 1C1SA 2XYAA 3PTNA 4IS5A 4A1XA 3SU2A 5DP7A 2VU8E 1SHHB 1FLEE 3L6PA 4AG1A 4XBCA 4NIWA 1GJ7B 4WF8A 1LKBA 1A3EH 1TLDA 3B9FH 1NS3A 1YC0A 3M7QA 1O2XA 4U2WA 1MTVA 4A1TA 1Y3VA 2KAIA 2A5AA 1DS2E 1PQ7A 5FX5A 1W12U 4BNRA 3SUEA 2F9VA 5F6MA 4ABAA 1PPGE 1AVWA 4YO9A 1HAOH 1E35B 4WH8A 3ZVBA 3FVFB 3RXEA 2J9NA 2Z3EA 4WMEA 1AO5A 3A85A 1GG6B 2Y81A 5EQQA 2WPMS 4AB9A 1ETSH 5A8XA 2ZFTA 2STBE 4M7GA 2BD3A 4AOQA 1E34B 4K69A 3PWBA 2FOBA 1EXFA 3SU5A 4ISLA 3ZYDA 1P0SH 4THNH 2ZHDA 1QL7A 1ELBA 5T6GA 2VWLA 2AFQB 4Y8YA 1O2QA 5A0AE 1JWTA 4ZKRU 3STJA 2UUFB 3HATH 1GMHG 1O2UA 1JRTA 2KAIB 1NN6A 5JBCS 1OKXA 1NRQH 2SGAA 6CHAC 2Y5FA 1AE5A 1MCTA 2VH6A 1Q3XA 1FY8E 1P2MA 4WXVA 1VCPA 3I77A 1GI5A 1YF4A 5K0HA 3A8DA 4ESTE 5CE1A 1V6DA 2ZGJA 1HXEH 1AVXA 2BX3A 2V3OH 5EPYA 1DLEA 5EXMA 1O3PB 3I78A 4WJG2 1S84A 2A5IA 1WQVH 3QN7A 3UPEA 3ZVFA 4D9RA 3SU4A 1IHTH 3ZVDA 1C2GA 1W0ZU 1GVZA 3SNCA 1DPOA 1SR5C 1CT0E 5I25A 1HV7A 8GCHG 1RGQA 4O03A 3P8NA 2ZPSA 4UEHH 3LJOA 2G5VA 3LC3A 5DJ7A 1YPEH 4ZKNU 5GIBA 5FBIA 1RTKA 1P2KA 1BQYA 1F5LA 1HAZB 2ODYB 3MNBA 1ELDE 6LPRA 2F9OA 4FU8A 4FU9A 4CRGA 1WYKA 1TBQH
chains in the Genus database with same CATH superfamily
1TQ7B 4K1SA 1H8IH 4KGAA 3U98H 4BTTB 1ANEA 2BXTH 2D8WA 1O3BA 2PP6A 5FAHA 4GPGA 3Q00A 3M7UA 1N6YA 1NRRH 2R2WU 3UQOA 3RXGA 5ESTE 5FPYA 4E06H 5L6NH 1IQJA 3TVJB 1FDPA 1OWHA 1E79D 1G36A 1Z8RA 4JZIA 5FCKA 5A8ZA 1P8VC 3KF2A 3DSPA 3NKKA 1GBHA 1YCPH 5C1YA 2C8XB 1G3DA 1MBMA 3U8RH 3SBKA 3STIA 3LGIA 2F9UA 1VITH 2ZTZA 3ZZ6A 2WUBA 3S7HB 4NWKA 1AZ8A 2ODPA 1MZAA 3MO9A 2GCTB 3ENSB 1LMWB 3S7KB 5AHGH 1KXDA 2ZFSA 3MU1A 3ATIA 3SV6A 2CV3A 2OBOA 1WOFA 4Z6AH 3WWBA 4UFDH 3RXFA 3S69A 3P8OA 2BDIA 8LPRA 1DXWA 3MU5A 4ABIA 3MH6A 1PYTC 1TB6H 1DOJA 4IMQA 4YOIA 4U32A 1J16A 2HNTF 1CGIE 4UONA 3E90B 1GJ8B 2BDGA 5A09A 2YMSB 1GBCA 4X6PA 3PLPA 4MLFB 2FEQH 2TIOA 4FUCA 3UR9A 1ZSJA 4F48B 1K1MA 3QDZB 2AERH 4GCHF 3KQCA 1O5GH 1VZQH 4FUBA 2R3YA 2O8TA 3SJ9A 3FANA 1P2QA 4KTSA 1GCTB 1TA6A 1ESTA 3RP2A 1ELTA 1QBVH 3A7XA 1XKAC 2A7CA 2QV1A 4YOGA 3TGJE 1RIWB 2QXJA 4TY6A 1BRUP 1N8OB 2B8OH 4OGYA 1LKAA 1C9PA 2Z3DA 3EBNA 1H1BA 4XD7D 2FESH 4KTUA 4DCDA 3F9EA 1YPKH 1WCZA 1QNJA 1VGCC 5F53A 3KQBA 1O3NA 2B7DH 3KEEA 4DGJA 1L2EA 3QWCH 3AAUA 1TGCA 1KSNA 2HALA 1ZHMA 1YPLH 2VNTA 1OXGA 3G01A 5LH8A 1ESBA 3VPKA 1MD8A 4O9VA 4WMDA 1SMFE 2Q6GA 1W13U 1ZSKA 3EE7A 1T8NA 5EG4A 3EYDA 2BZ6H 3A80A 3VGCB 1SGDE 1W2KH 4TT3D 3HGPA 5K7RA 2WPKS 1G32B 1XXDA 2OK5A 1NRSH 4NIXA 1SLWB 4INKA 2Z3CA 1S85A 1LQDB 1TBZH 3SJOA 3R3GB 1V2PT 4KTCA 4XBDA 5PTPA 3LGWA 1DSTA 2PGQB 3EE0B 1MMJN 1IQNA 2O8WA 2GCHF 1NROH 1TGBA 1GBKA 2BOHB 3UTUH 1UVTH 2C90B 2J38A 4ABJA 1G2MA 1Z71A 4FUHA 1Y5AT 7LPRA 4ZHLU 2IJD1 4A6LA 2Y7XA 3HGNA 2W3IA 1CT4E 4JYUH 1GGDB 4B75A 1VKYA 2CN0H 3BG8A 1OWIA 4FETA 2TGAA 4XBBA 4J2YB 2BD5A 3OU0A 5AF9H 2I6QA 1NRNH 1O2JA 3GISB 4CR5A 1MTWA 1ANDA 3TLOA 3B8JA 2A1DB 2FLBH 3SYJA 1IOEA 1O39A 3LJJA 3CENA 2BVRH 1MU6B 3SNEA 4OS4A 4BTUB 1S5SA 4O3TA 1C2MA 1B0EA 2BQWB 1DX5M 2YOLA 2ZNKH 2DE8A 4AFZA 1EZUC 2ZTXA 3OTJE 2EEKA 4UDWH 1C1UH 2ZQ1A 5DPAA 2J97A 1LVMA 1PPEE 2GGVB 1V2VT 2WYJA 4Q7YA 1YPMH 3PO1C 4MQAA 1CVWH 6CHAB 2FOHA 4IN1A 3HK6B 2P94A 3TJVA 4WVPE 4CHAB 2UUJB 2IOTA 2A7HA 1SOZA 1DSUA 1Y3UA 2P8OC 1JIRA 1LVBA 2BOKA 3MU4A 2JH6D 3QK1A 4I86A 1A61H 1INCA 2FI4E 3MOCA 1ZYOA 2BHGA 2F91A 2FOCA 1THSH 1O2LA 1XKBC 1A0JA 1TPAE 1W8BH 1NT1A 1MKXK 2V3HH 1DWCH 5A8YA 1EAXA 2OC0A 1MABB 1QFKH 1UVUH 4X1RU 3OEHD 2ZHFH 1KXAA 1KTTB 3FKSD 3GYMA 4AC9A 2WV9A 1XUGA 1RD3B 4FUFA 4UFFH 3PRDA 4XE4A 1GBLA 1KLTA 3GY6A 2JH5D 1YLNA 1DUEA 1UCYK 3FAOA 4NFEA 3EA9A 3SU6A 1DT2A 1T8LA 2J98B 3OSYA 3E0PB 1TWXB 3W94A 4GVUA 1OSSA 2Z7FE 2F4LA 1BRCE 4P00A 2IPHA 2AMDA 3LPRA 1RTFB 3WW7A 2ZDNA 4IBLH 5EXLA 2ZGCA 1PJPA 4CRFA 2XNDD 4LXBH 1ZR0A 2H6MA 2FDAA 2F9NA 3TNTA 1C5NH 1JXPA 1O31A 2ZDLA 1MBQA 1FIWA 3A88A 2J5UA 4YTAA 1AFQC 1NESE 4Z0KA 1HGTH 1SQRA 1V2RT 1TGNA 1A5GH 2P16A 1S83A 4LOYH 3M3TA 3OAAD 2VIQA 1O2KA 4YLQH 4UFGH 1LPKB 1L1JA 1DWBH 1BA8B 1EZQA 1OWKA 2BXUH 2ZDKA 2XRCA 3ZZ4A 3DA9B 4XRNA 2ALPA 3W1EA 1UK4A 2BDYA 1L1NA 2GMTB 2UUKB 4Q80A 1K1IA 2OC7A 1GMDF 3T25A 2W6JD 3EGKH 1HYLA 1SGIB 2ANYA 1HJ9A 2FX6A 1OWJA 1W3CA 3KCGH 1CO7E 1GI6A 1O33A 1GHBF 1OWEA 2VVVA 2JH0D 2XBXA 5HM2A 2R2MB 3TGIE 3SU0A 2D1JA 3ZIAD 1F2SE 2CXVA 4BTIB 3S9BA 5JYIA 3Q3XA 3TU7H 2YNBA 1OX1A 1F7ZA 3RXHA 4JCNA 3RMMH 1C4V2 4K2YA 3A89A 3SNAA 2AGGX 1V2KT 1YLCA 2F9BH 1GHAF 3C1KA 1ZZZA 2ZFFH 3OY6U 5DP4A 3T62A 4AFSA 2QF0A 1GHBG 1CHOF 1FIZA 1GJ4H 2CMYA 1CA0B 5C94A 1XXFA 3SJIA 1P57B 1XVOA 2ASUB 1RTLA 2GV7A 4Q2KA 1LHCH 2BLWA 1GMCF 1O3MA 3IITA 2WINI 3P6ZB 1SQAA 1SLXB 5IK2D 4X6MA 2FODA 4BANB 3L33A 1QCPA 1UCYE 1EZSC 5C17A 1K1LA 1UTMA 3GY7A 1MTSA 1CHOG 1VGCB 1C1QA 3U69H 4X2VA 1QR3E 2SGFE 4K1TA 4DVAU 1FY4A 1UO6A 2PSXA 1GMCG 1TNJA 3M36A 2ZHQH 1C2HA 1QB1A 1G3EA 3OX7U 2F83A 1UK2A 1V2NT 1ZGIA 2ZCLP 1C2FA 1ZTJA 1AI8H 1XVMA 1CA8B 3SNDA 1T8OA 3Q77A 1VITF 3DSGA 3SUDA 5FL7D 2SNVA 4ZH8A 4NA9H 1CGHA 2BLVA 5AVDA 2PTCE 3ZZAA 4GSOA 5GPIB 3MU0A 3N7DA 4GAWA 4KKDA 4IN2A 1MKXH 2QAAA 2QYIA 1THRH 2CHAB 1WU1A 4ABFA 1L4ZA 1BIOA 2PUXB 2QGRA 3MNCA 2BVXH 5A0CA 4MVNA 3QTVH 5HIZA 1VITG 4I8LA 2H2ZA 1TQ0B 2VIWA 1DXPA 2JJ1D 2FS8A 4X8VH 3RXCA 2VH0A 4INHA 2XWAA 4U01A 3ATLA 4CRDA 9ESTA 4FUIA 2EI8A 2SGEE 1E0FD 1IAUA 1DLKB 2M2AA 1NM6A 1UCYH 4MTBA 3MQKC 5BPEA 2XNIA 1MTNC 1SGRE 1Y3YA 2O8MA 3DT0H 3LOXA 3T26A 3A81A 1ZRKA 2B0FA 2BLQA 3AVZA 7GCHF 4R0IA 2Z6BD 3VFEA 4YXWD 5B6LA 5JBBS 1GBAA 3ODDA 3MI4A 3MYWA 3GY3A 4I31A 3T28A 2A31A 2J4IA 1FN8A 1O5DH 4FUEA 2B5TB 1BOQA 4D76A 5DP9A 3PO1B 4F49A 2VB0A 1ZPBA 5IDKA 4K3JA 4MPWA 1C2IA 2C8WB 4JZFH 4ABDA 2NU1E 3ZZ3A 3FP7E 7GCHG 4TWYA 2ZIQH 1UTKA 3K9XB 2GT7A 2ZKSA 3RXLA 4BXSA 2BDBA 1O38A 5T6FA 5C2ZA 1C5MD 4I32A 4I8HA 4Y0ZE 3GCOA 1ELEE 1O2IA 3A7WA 3MU8A 1Y3XA 1H8ED 2I6SA 1TOCB 3BTKE 4FVBA 3TH3H 4B2BA 1AFEH 3VB7A 4IW4E 2NU2E 4GHQA 4SGAE 1O3JA 2A7JA 3ZYEA 3N7OA 4K8YA 2ZFPH 1ZHPA 3VEQB 1GMHF 2K7XA 3RMOH 2R0KA 1V2WT 1K1NA 2XC4A 2BX4A 1MKWK 2UWPA 3TJOA 4ASHA 1FAKH 5LPEA 5EPNA 3W95A 2DUCA 4OS1A 1YY3A 3ZZDA 1QQ4A 4ASUD 1D4PB 2F43B 1QY6A 4DT7B 5CHAC 1O3IA 1SFQB 1P2OA 1BMFD 3SV7A 1GBDA 3BEUA 3SOSA 3M61U 2AEIH 2VVUA 1ANCA 1HUTH 1G30B 1NFUA 2GV6A 5FPSA 1TNGA 1GJCB 1K1OA 1YPHE 2A45B 1O32A 1V2TT 1P04A 1C5VA 2QXHA 1NZQH 4JMYA 3UOUA 2ZU4A 1P3EA 5BRRE 2ZHEH 1D3QB 3BTQE 3OFND 5CDFE 4JK5A 4FUGA 1K22H 1GWAA 4ABGA 1D3TB 1SI5H 3K2UA 1ZOMA 5FXLA 8GCHF 1Y59T 3K6ZA 3U8OH 4HZHA 1F0RA 4ABBA 1CE5A 2Z9IA 1QTFA 4X2YA 1LCYA 5EJ1A 4KELA 1COWD 2FOAA 2Q6FA 3RU4T 2LPRA 2OUAA 3VB4A 1AIXH 4TSFD 2TGTA 1LHEH 1P12E 1C1NA 1TYNA 2VWOA 4X1QU 1O3AA 2D2DA 4OGXA 4INLA 5TCAA 1C1OA 4OS6A 1C2KA 3DD2H 2H9TH 1Z1JA 1EB1H 2KCYA 2STAE 4VGCC 4QT8C 1LQEA 1TAWA 2Z9JA 2JETC 4CBNA 2PSYA 3A8AA 3QX5H 1KXFA 1BBRK 4HFPB 5GNDA 2FLRH 3GOVB 3BG4B 3RXUA 1G2LA 3QTOH 3SNBA 2NU0E 2GVFA 3NZIA 1KMHB 1NPMA 1VCWA 3TNSA 1C5ZB 1O3CA 2C4FH 3BIUH 1C5LH 2UUYA 5JB8S 3VB5A 2EA3A 2RDLA 1GI1A 1W0JD 1ID5H 2G81E 4HGCA 4I33A 3PV2A 1FY5A 3F0PA 4CH2B 2F9PA 4MPUA 5FX6A 6ESTA 1FZZA 2ZU5A 1ESAA 1ETRH 1L1GA 2K1QA 1UJ1A 1HAIH 1EUFA 1HXFH 4Y10E 8KME2 3MTYA 4TPYA 2Y5HA 4YT7H 3KNXA 1OP0A 1D9IA 3TK5A 1ELVA 1EPTC 3OYPA 4I8KA 3FZDA 3SZEA 4DY7B 1IQKA 2PKAA 3F3BA 1AB9C 1J14A 2SGPE 1T32A 4CRBA 3LH3A 1C1RA 4J1YA 1FV9A 2ANMH 5B6OA 1T7CA 3CS0A 2OP9A 3PWCA 3H5CB 3PRBA 1HAPH 1C5QA 3MMGA 5JPMH 1NFXA 2G51A 2ZU3A 1O2HA 2ZGHA 1K28D 3A8BA 1ZMNA 2GTBA 2DE9A 3SO3A 1DVAH 1UVOA 3SGBE 1QZ8A 4D9QA 1T4VH 2Z9KA 1UW7A 3RMNH 1P05A 2K0QA 1EJNA 5HM9A 1SGCA 3P92A 2Q1JA 4DG4A 4K1EA 1RXPA 3F0OA 2FMJA 1A46H 1OYTH 1O2MA 1ZRBA 3T5FH 1ETTH 1MKWH 1W7XH 3RM2H 4XFQA 2Z94A 1BTHH 2PKAB 3FP8E 1ARBA 2FOMB 3BV9B 2BDAA 5FBEA 4ZXYH 5DGJA 1T4UH 4NGAH 1BBRE 2W3KA 3AASA 4X8UH 2AMQA 1CBWB 4ABEA 4CRAA 1H8DH 1C5XB 1ARCA 3SUFA 5HIYA 3DFJA 1VR1H 1VJ9U 2ODQA 4B2CA 2BQ6B 2K8IA 5C1UA 4OS2A 1TOMH 4R8TB 1RJXB 1O5BB 4B1TA 1W0KD 2KCOA 1SPJA 2R9PA 1ELFA 3TH4H 1VCQA 1ZMJA 4AFUA 2VVCA 3ZZBA 2FM2A 2XOKD 2J92A 4JZ1A 3RLWH 3ZZ9A 3GICB 3QZQA 1GJAB 3RMLH 2Y7ZA 4O97A 1MQ5A 4NFFA 2ANKH 4BAKB 4NSVA 2G8TA 1OWDA 1B7XB 3MO6A 2FOGA 1ZTLA 2ZCHP 3GYLB 1ZPCA 3F9FA 4AX9H 2WPJS 3TJUA 1T31A 2CGAA 1O3HA 1ZMLA 1FMGA 3M37A 4E7NA 1BBRH 1DFPA 2UWOA 1RFNA 3IG6B 1JBUH 4ACAA 2BDCA 5F8TA 3MH5A 3E16B 3D65E 5AFYH 4OS5A 1K1JA 1HDTH 2BQ7B 2OXSA 3KQ5A 1NTPA 2ZPQA 5L30H 1BTXA 2AS9A 3FFGA 4FUDA 3GCHC 3TH2H 2RCEA 4YT6H 2BVSH 1NU9A 3MNXA 1XUHA 1A2CH 3S0NA 5FHTA 2J98A 3PB1E 4D8NA 2XC0A 3RC4A 1V2JT 4X0WU 1C5SA 1EAWA 1SVPA 2V3MA 3P8FA 5T6DA 3UNQA 2P59A 3LU9B 5HXFA 2WV5A 3O8CA 1RS0A 1YP9A 4Q7ZA 2A4GA 2FI5E 2WZQA 4WMFA 1Z1IA 2FS9A 2ZC9H 2HLDD 4CR9A 2BD2A 3RXAA 1QB6A 4ISNA 2FOFA 5FPTA 4BXWA 1BTZA 4AB8A 3LONA 2PLXA 1SC8U 1W11U 1HAYB 4O3UA 4WH6A 9LPRA 2H1UA 4IMZA 1LHFH 1ZPZA 2FO9A 2ZFQH 3A7TA 1MU8B 1UTQA 3KYFA 2ZEBA 3NUMA 2ZGBH 1SGNE 1MH0A 2NU4E 1SGFG 1IQIA 1KXEA 1BJUA 2FYRA 1BMLA 3UUZA 1AVGH 2PFEA 2PTNA 3SGAE 1DUAA 1YM0A 2BY9X 2HNTE 5CHBA 1GG6C 1QQUA 1QL8A 4MDSA 1O2WA 2Y6TA 1GBFA 2ALVA 1O35A 1YPHC 3AK5A 1FY1A 4ZUHA 1O5FH 3PTBA 5JBAS 1OOKB 4XDEA 3SZNA 3URDA 4ZHAA 4TY7A 3KQEA 2ZO3H 3PYHA 1MUEB 7ESTE 2Z9LA 1LVOA 2D26C 1C5YB 5C3NA 3R0FA 2IN2A 2EI7A 2A5KA 1NFYA 1TIOA 2HPQH 2C8YB 6GCHF 5EOKA 4MNXA 3F6UH 1QRZA 1TNKA 1PFXC 1HAGE 2GP9B 1QA7A 4Q4LA 4X8TH 1ANBA 4B6EA 3BTWE 2G52A 4JZDH 5F03A 4UE7H 2XCFA 3SQEE 2O9QA 4MNWA 3M35A 1WUNH 3DFLA 4Y6DA 5C1XA 2OQ5A 1KIGH 5I46H 2AYWA 5F8XA 4DIHH 4GUXA 6GCHG 2FPZA 4ISIH 1BTWA 1QRXA 1S6LA 1V3XA 1FN6A 5EQRA 3BSQA 1D6RA 1LHGH 4MPXA 1HPGA 2R3UA 3ELAH 3KIDU 4K8BA 1YKTA 4BAOB 3M7TA 2HVYB 2KCPA 3PV5A 4ZCNA 2QIQA 1CHGA 2P3UB 5EJZA 1D3PB 1EX3A 3BF6H 2KFWA 2A2QH 1FONA 4ZKSU 2V35A 1LTOA 2BD8A 1Z8GA 1QJ6B 1TALA 2KX4A 1QURH 5DKMA 1KY9A 2Y5GA 4NG9H 4BAHB 1M9UA 3UQVA 4WWYA 2ANWA 1K9OE 1ABIH 3PMJA 2GZ9A 4TWWA 1YLDA 2ZP0H 3F9GA 1SG8B 2WPDD 4HTCH 3UREA 3AW0A 4F55A 1UTJA 2GZ7A 1O37A 2TGPZ 3E6PH 3HK3B 5AFZH 1GDNA 3QGJA 1N1LA 1A0HB 1WDIA 3M3VA 3RXBA 1D3DB 3TK6A 4RSPA 4ZKOU 3PLKA 2PR3A 3O8BA 1N6XA 1OPHB 5A2MH 4ZXXH 2XXLA 1EOJA 1FX0B 3ODFA 4XSKU 1S0QA 1DE7H 4Q63A 2TPIZ 1ZGVA 7KMEH 1TNHA 2W7UA 1CT2E 1O2OA 3RXQA 3RM0H 4MG3A 5EU8A 1PPZA 1P2IA 1E37B 3KGPA 3M5LA 4Y0YE 3CS7A 5DP5A 3RXVA 4XOJA 3RXDA 3A7ZA 1A1RA 1GVKB 1LPGB 1NY22 3M5MA 3RU4D 5H4IB 1KLJH 2F3CE 1FJSA 4AFQA 3OEED 1AZZA 1HJ8A 2GCTC 3VG8A 3SQHE 3A87A 2C93B 1E36B 2JJ2D 3HPTB 3F2HA 1V2LT 2WYGA 1DY9A 3TJNA 5L2YH 1FPHH 3A82A 3EA8A 1QRWA 1P2JA 2KR7A 1IQFA 1OS8A 1O5EH 2ZPRA 4ISOA 1IHSH 1QGFA 3GY8A 4D7GA 4NZQA 1P9SA 2QA9E 1BHXF 1O3GA 2BB4A 4D7FA 1DICA 2H9HA 2YMSC 3N7EA 4Z1MD 3O8RA 3SV2H 1O36A 4P02A 3RXJA 1IQMA 3SI4H 4IC5A 1V2QT 4RKOB 3IWMA 1TPOA 2ILNA 4BAQB 4NCYA 2QF5A 1NBMD 3M3SA 2FOEA 5L2ZH 2OC1A 3V3MA 3RXMA 2HGTH 1MTUA 1O34A 2P93A 1GCTC 3OTPA 1F0SA 3BTFE 2A4OA 3ZZ8A 1DITH 2LELA 4Q7XA 4Y8ZA 1ZSLA 3ITIA 1C1PA 2V7QD 4AGKA 4K60A 1QL9A 4YLUA 3I29A 4DIIH 1P11E 1N8OC 1C1WH 1DWEH 2HPPH 1GHVH 3UR6A 2ZU2A 1CU1A 5E2OA 1XX9A 5T3HA 2RA3A 1GJDB 1K0HA 4TPIZ 1ZLRA 2HOBA 1NC6A 4BOHA 5EODA 3BTDE 1ZTKA 2BYAX 1MD7A 4MPVA 2FTMA 2P8OB 1EKBB 3UNSA 2LP6A 2AMPA 4B76A 1DANH 1A5IA 1BMNH 3D23A 2ULLA 2O8LA 2B9LA 2QXGA 5ETXA 4UD9H 1YBWA 2ZWLH 3RU4E 4RKJB 1KTSB 1C2LA 2CJIA 1WQSA 1W14U 3BTHE 1U6QA 1BT7A 1GI8B 2ZA5A 3AW1A 1TRYA 1GJ5H 2BD9A 1T8MA 2O8UA 1YGCH 1AHTH 1GI0A 2BY6X 1AU8A 2WV4A 5DG6A 2WPHS 3F1SB 1S6FA 3D62A 2P95A 3SU1A 1QJ1B 3EQ0H 5TJXA 3D49H 3M5OA 3GY4A 3RC5A 4DW2U 1WTHD 1TRNA 2VIVA 1O2YA 3OE7D 1O2NA 1UMAH 4JYTA 1C5PA 1QBOA 4AGJA 2OINA 3LGUA 5DO4H 2WUCA 1GGDC 1J9CH 2FYQA 4CH8B 1YPJH 1Z7KA 4MNYA 2OQUA 2HVXA 3M5NA 3PM3A 2BZAA 2EQNA 3WY8A 2IPQX 2KM0A 3RUOA 1NBME 1IQHA 4FXGH 2XBVA 1RRKA 2P3TB 1AFQB 1O3KA 1GI4A 3V13A 3NK8A 5DP6A 1MZDA 1B5GH 4NWLA 1D6WA 2AIQA 3ZZ5A 3EAJA 1O5AB 1OP2A 3S9CA 4H4FA 2BY8X 1BUIA 1UTLM 1IQEA 5GWZA 2J34A 1JIMA 4HI3A 4F4OC 2L74A 1SQTA 3VB3A 4CHAC 1O5CB 4FVDA 3P8GA 4E05H 4CRCA 1O2ZA 1AE8H 2ESTE 4SGBE 1GBJA 1OHHD 3DUXH 4LK4A 3H7OA 1O2TA 1Q2WA 1XUIA 3UOPA 2PHBA 1P3CA 1TGTA 5C67A 2FXRA 2AH4X 2VJ1A 1C2DA 2VIDA 2HNTC 1A5HA 3URCA 2BD7A 1O3EA 1BHXB 2WPLS 3SUGA 3GCNA 5CMXH 2GDDA 2ZFRH 2FTLE 1EASA 3O8DA 1P02A 1Q31A 2YMSD 4FU7A 1Z6JH 3BN9A 1GPZA 3OY5U 1UTPA 5DP3A 5HKKD 1EFRD 1Y5BT 1V2ST 4FOUC 3FP6E 1A7SA 5SGAE 4A92A 2PGBB 1S6HA 2ZI2H 2VGCC 1GI3A 3FO8D 1GBEA 2VWMA 4JYVH 3QGNB 4AYVB 1FXYA 4AORA 4NZLA 1SGTA 3U1IB 2A4RA 3TIUA 1EB2A 1THPB 4GLYA 2C8ZB 3ATWA 3GDSA 1LDTT 3MHWU 5LPRA 2Q6DA 1YWUA 2W26A 3WWFA 2FIRH 3PLBA 3F9HA 1PPHE 2GD4B 1TNLA 2JKHA 2ZTYA 1UTNA 4Y79A 3ZZ7A 2GT8A 3ESTA 3F2FA 3RXPA 4A7IB 5DSFA 1GL1A 4KP0A 5EJLA 5ESBA 4X2XA 1Y3WA 1SSXA 2V6NA 4AZ2B 5E0GA 3MO3A 4AG2A 2EI6A 5EW2H 4FUJA 1BZXE 1HCGA 4X6OA 2TRMA 2BY7X 2H5DA 2GMTC 1O3DA 1BB0B 3SJKA 1O2GH 4LZ4B 1F92A 1TX6A 2GX4A 1V2OT 1WV7H 1H8HD 2OLGA 3CP7A 4B6FA 1C5WB 1GBBA 2UWLA 1IQGA 3SJ8A 3GCTF 2G00A 2RA0A 4H6SB 5EXNA 5HMAA 4Y11E 3UB0A 1S82A 1SGEE 2QC2A 1TX8A 3RXTA 2OC8A 1O3OA 3ZVGA 1AKSA 5A0BA 3RXOA 3LKWA 3A8CA 2HWLB 1H9LB 2RG3A 2SNWA 4H42U 4YOJA 5G4BA 2XBYA 1TMUH 3EA7A 2R0LA 1TX7A 4BAMB 4GHTA 3GCTG 3KYGA 1O2PA 1H9HE 3GY5A 1MTNB 3UIRA 1CA0C 3HKJB 1PPFE 1PQ8A 3NRLA 1HBTH 2NU3E 2OD3B 3K6YA 4RI0A 1GHZA 1C2JA 1F0TA 3DCLA 2CF9H 4TYDA 3UWIA 3PMHB 3ZV8A 1O2VA 4DOQA 1SGPE 1TA2A 1W10U 4IC6A 3H09A 1GBMA 2GZ8A 1J17T 1GJBB 4AN7A 4B2AA 3BEIB 2V0BA 3AAVA 1SB1H 3SI3H 1EJAA 2GDEH 3GDVA 1SLVB 4RT1A 3UAIC 4MNVA 3B23B 1K1PA 1LHDH 1HLTH 5FCRA 4GCHG 1AKSB 1SGQE 1C5UA 3SHCH 1KXCA 2JIZD 1WXRA 2BMGB 2SGQE 1EJMA 5C0TA 2J94A 1HIAA 3KL6A 1K21H 1EZXC 2RDEA 1HAXB 1GBIA 2QN5T 4HG6A 3UY9A 1P06A 1GI7B 1W0YH 3ZVCA 1J15A 1TBRH 1MCVA 1C1MA 3GDUA 4I8GA 2TBSA 1O2RA 1O0DH 1GI2A 3GY2A 2G55A 1E38B 2THFB 4WY3A 2ZG0H 4ABHA 3C27B 1G3BA 4ISHH 4DJZB 3LC5A 1C5TA 1O3LA 3Q3YA 2WPIS 1FY3A 3L3TA 1TGSZ 3KN2A 2CHAC 2PKSC 4IGDA 3JZ1B 3LGYA 4I8JA 2A2XH 1C1TA 3TPIZ 2A0QB 2TGDA 3T2NA 2ZU1A 4YESB 2VBCA 1HJAC 2J2UA 1ZJKA 2W5EA 1HIAB 1P03A 1UVSH 5CHAB 2XCNA 1BRAA 1GHXH 1SL3A 1TPSA 4X8SH 4ZHMU 2GCHG 2XC5A 4Y71A 1NRPH 3MFJA 1LVYA 4DURA 1LPZB 1AUJA 1GVLA 1DM4B 1NFWA 2NWNA 2BM2A 1ELGA 1EATA 1XUFA 4M9FA 1E1QD 1ACBE 5DK1A 1F0UA 2PV9B 1TABE 5HYOA 4X1NU 1PQAA 1P09A 2AGIX 3K65B 5LPFA 1AY6H 2GKVE 2FWWA 3BTGE 4NIVA 1BDAA 1PPBH 2HRVA 4I7YH 5EQSA 4RN6A 1GDQA 1GJ6A 3V0XA 3A7VA 1QJ7B 4JK6A 2J95A 1BRBE 3ATKA 4B74A 3H7TA 3FN8A 3SORA 3LGTA 1GBTA 1V2MT 1AWHB 4NIYA 4WXIA 1ABJH 2A32A 1C5RA 1GI9B 4X6NA 3RC6A 3VB6A 1SKYE 5JB9S 5GDSH 4U30A 3A7YA 2G5NA 2ZZUH 2SGDE 1BCUH 4VGCB 1WSSH 4A5TS 3MH4A 2KZ4A 2AHME 1PYTD 4Y76A 1P10A 1QBNA 1Z8IB 3E0NB 2JETB 3QUMP 1EPTA 2QE7D 3ATMA 3DHKH 5JDUB 2VIOA 2BDHA 3U9AH 2LIZA 1XMNB 1QA0A 5JBTA 5C5NA 1TFXA 2BLOA 5E2PA 4X2WA 1MAYA 1UHBA 1L4DA 1SFIA 1X7AC 1FPCH 1P2NA 1DY8A 2VGCB 1OP8A 1UK3A 5C0UA 3E91A 1G3CA 2FI3E 2KCAA 3ZV9A 1QHRB 1FAXA 1FNIA 1BMAA 1HAHH 2EC9H 2QY0B 3RLYH 1UTOA 2JDID 1TNIA 2VINA 5HGGA 2HLCA 2OBQA 3P17H 2OTVA 1Z8JB 1P01A 1ZHRA 2G4UA 2EY4C 1FQ3A 4K5ZA 1C2EA 3JZ2B 1SOTA 1DDJA 5IYTA 4DT4A 1S0RA 2M5TA 3TK9A 3U28C 5T1VA 4JZEH 1AGJA 1K2I1 5KECA 1SBWA 5E0JA 1BJVA 1AN1E 1GL0E 3UWJH 1C4Y2 4X1SU 1EAIA 1HRTH 1EPTB 1XUKA 2OCVB 3TGKE 1QIXB 1BMMH 3NPSA 3MNSA 3E8LA 1PPCE 4NA7A 3QZRA 1AB9B 2QF3A 3VXFH 3QLPH 1KYNA 3BIVH 1HFDA 2BD4A 1TE0A 3TITA 1UHBB 3P70B 2ZQ2A 2A4QA 4CREA 3PROA 2VWNA 2W6ID 1TMTH 3N99A 3U1JB 1SGFA 1J8AA 1TRMA 3LT3A 2FP7B 3MWIU 4ZAEA 5E0HA 2L6OA 1SGYE 2FX4A 3LIWA 2ZECA 3E3TA 2XW9A 3T27A 2CF8H 2LNCA 4A1VA 1ELAA 1BITA 3ZVEA 4UFEH 3NCLA 3A86A 4H6TA 4CBOA 1TONA 2BTCE 1IQLA 1O3FA 2AIPA 2C3SA 5E8EH 3LH1A 2SFAA 4Y8XA 2XBWA 3SN8A 4PROA 1TMBH 3DSOA 3HKIB 1GHWH 3E1XB 3RXIA 4LZ1H 1GMDG 2QXIA 1V2UT 5GJ4B 1C5OH 1C4U2 1HAVA 3SV9A 2ZHWH 3BG4C 2AGEX 3LGVA 3KHVA 4NA8A 1HNEE 1BTUA 2XTTB 3ZVAA 1Y5UT 1G37A 1MAXA 1JOUB 3MH7A 5EIYA 3T29A 1PQ5A 3SU3A 5C20A 1FUJA 1XM1A 3U8TH 1AD8H 4E7RG 2Y80A 1L0ZA 2Y82A 3RXRA 1JRSA 1SQOA 1QB9A 2XWBI 2ZDAH 1CSOE 3SV8A 1Z6EA 1C9TA 1NO9H 1O30A 3NWUA 1F5RA 1GHAG 3RXKA 1YCPM 1GDUA 1GCDA 2H5CA 1HB0B 3NXPA 4ZMAH 5LGOA 3P95A 2Z9GA 3RXSA 3KQDA 4YM9A 2ZCKP 3SHAH 5ABWA 1BTYA 2ZDVH 5KEDA 2VIPA 4YZUA 1AMHA 1VJAU 1HAVB 1O2SA 1TPPA 3LDXH 3QO6A 4Y7AA 5F8ZA 4NSYA 1CQQA 1AWFH 5GCHF 1A0LA 3Q76A 1EQ9A 1YYY1 3F68H 2ZDMA 4OS7A 8ESTE 3V12A 5EGMA 3PV4A 1G9IE 1EOLA 1ORFA 2G4TA 3BTTE 1EAUA 3VXEH 3UFAA 1WTGH 1WAYB 2ZF0H 2P3FH 4AYYB 3BEFB 1W7GH 1KDQA 1KLIH 1A3BH 2QF4A 2CK3D 2PWXA 3RDZA 3SGQE 4ZROA 5C5OA 1A4WH 2PKSB 5GCHG 2W7SA 2FZZA 1B0FA 2WHXA 1EP6A 3V7TA 1ELCA 4Y7BA 5J4SA 1KXBA 1JMOH 1CGJE 1UVPA 1HJAB 1ZJDA 3PMAB 2YNAA 4RT0A 5TCCA 4B73A 1C1VH 1NU7B 1RIWC 5KGOA 3PMBB 1YPGH 1DWDH 4B71A 1MQ6A 3ZZCA 5GXPA 3BTEE 1LO6A 3Q3KA 1WBGB 3GCHB 1YCPK 1OYQA 3S9AA 2BY5X 5DP8A 1H9IE 1CBWC 2PUQH 3EDXB 2QCYA 3BTME 2H9EH 1FI8A 1AUTC 1GHYH 1F5KU 1EP5A 3UNRA 3A84A 1XUJA 1S81A 1SLUB 1Y8TA 3SW2B 1AQ7A 5J4QA 2ZGXH 1GJ9B 1KDQB 1H4WA 2PW8H 2IJOB 4X1PU 1BTPA 3A83A 5EW1H 1P9UA 3FZZA 1SHYA 3VGCC 1C1SA 2XYAA 3PTNA 4IS5A 4A1XA 2GJGA 2RFKC 3SU2A 5DP7A 2VU8E 1SHHB 1FLEE 3L6PA 4OM9A 4AG1A 4XBCA 4NIWA 1GJ7B 4WF8A 1LKBA 1A3EH 1TLDA 3B9FH 1NS3A 1YC0A 3M7QA 1O2XA 4U2WA 1E1RD 1MTVA 4A1TA 1Y3VA 2KAIA 2A5AA 1DS2E 1PQ7A 5FX5A 1W12U 4BNRA 3SUEA 2F9VA 5F6MA 4ABAA 1PPGE 1AVWA 4YO9A 1HAOH 1E35B 4WH8A 3FOAA 3ZVBA 3FVFB 3RXEA 2J9NA 2Z3EA 4WMEA 1AO5A 3A85A 1GG6B 2Y81A 5EQQA 2WPMS 4AB9A 1ETSH 5A8XA 4ACBA 2ZFTA 2STBE 4M7GA 2BD3A 4AOQA 1E34B 3CNRA 4K69A 3PWBA 2FOBA 1EXFA 3SU5A 4ISLA 3ZYDA 1P0SH 4THNH 2ZHDA 1QL7A 2WSSD 1ELBA 5T6GA 2VWLA 2AFQB 4Y8YA 1O2QA 5A0AE 1JWTA 4ZKRU 3STJA 2UUFB 3HATH 1GMHG 1O2UA 1JRTA 2KAIB 1NN6A 5JBCS 1OKXA 1NRQH 2SGAA 6CHAC 2Y5FA 1AE5A 1MCTA 2VH6A 1Q3XA 1FY8E 1P2MA 4WXVA 1VCPA 3I77A 1GI5A 1YF4A 5K0HA 3A8DA 4ESTE 5CE1A 1V6DA 2ZGJA 1HXEH 1AVXA 2BX3A 5DN6D 2V3OH 5EPYA 1DLEA 5EXMA 3F2GA 1O3PB 3I78A 4WJG2 1S84A 2A5IA 1WQVH 3QN7A 3UPEA 3ZVFA 4D9RA 3SU4A 1IHTH 3ZVDA 1C2GA 1W0ZU 1GVZA 3SNCA 1DPOA 1SR5C 1CT0E 5I25A 1HV7A 8GCHG 1RGQA 4O03A 3P8NA 2ZPSA 4UEHH 3LJOA 2G5VA 3LC3A 5DJ7A 1YPEH 4ZKNU 5GIBA 5FBIA 1RTKA 1P2KA 1BQYA 1F5LA 1HAZB 3GS9A 2ODYB 3MNBA 1ELDE 6LPRA 2F9OA 4FU8A 4FU9A 4CRGA 1WYKA 1TBQH
chains in the Genus database with same CATH topology
1TQ7B 4K1SA 1H8IH 4KGAA 3U98H 4BTTB 1ANEA 2BXTH 2D8WA 1O3BA 5FAHA 4GPGA 3Q00A 3M7UA 1N6YA 1NRRH 2R2WU 3UQOA 3RXGA 5ESTE 5FPYA 4E06H 5L6NH 1IQJA 3TVJB 1FDPA 1OWHA 1Z8RA 1G36A 4JZIA 5FCKA 5A8ZA 1P8VC 3KF2A 3NKKA 1GBHA 1YCPH 5C1YA 2C8XB 1G3DA 1MBMA 3U8RH 3SBKA 3STIA 3LGIA 2F9UA 1VITH 2ZTZA 3ZZ6A 2WUBA 3S7HB 4NWKA 1AZ8A 2ODPA 1MZAA 3MO9A 2GCTB 3ENSB 1LMWB 3S7KB 5AHGH 1KXDA 2ZFSA 3MU1A 3ATIA 3SV6A 2CV3A 2OBOA 1WOFA 4Z6AH 4UFDH 3RXFA 3S69A 3P8OA 2BDIA 8LPRA 1DXWA 3MU5A 4ABIA 3MH6A 1PYTC 1TB6H 1DOJA 4IMQA 4YOIA 4U32A 1J16A 2HNTF 1CGIE 4UONA 3E90B 1GJ8B 2BDGA 5A09A 1GBCA 4X6PA 3PLPA 4MLFB 2FEQH 2TIOA 4FUCA 3UR9A 1ZSJA 1K1MA 3QDZB 2AERH 4GCHF 3KQCA 1O5GH 1VZQH 4FUBA 2R3YA 2O8TA 3SJ9A 3FANA 1P2QA 4KTSA 1GCTB 1TA6A 1ESTA 3RP2A 1ELTA 1QBVH 3A7XA 1XKAC 2A7CA 2QV1A 4YOGA 3TGJE 1RIWB 2QXJA 4TY6A 1BRUP 1N8OB 2B8OH 4OGYA 1LKAA 1C9PA 2Z3DA 3EBNA 1H1BA 4DCDA 2FESH 4KTUA 3F9EA 1YPKH 1WCZA 1QNJA 1VGCC 3KQBA 1O3NA 2B7DH 3KEEA 4DGJA 1L2EA 3QWCH 3AAUA 1TGCA 1KSNA 2HALA 1ZHMA 1YPLH 2VNTA 1OXGA 3G01A 5LH8A 1ESBA 3VPKA 1MD8A 4O9VA 4WMDA 1SMFE 2Q6GA 1W13U 1ZSKA 1T8NA 5EG4A 3EYDA 2BZ6H 3A80A 3VGCB 1SGDE 1W2KH 3HGPA 5K7RA 2WPKS 1G32B 1XXDA 1NRSH 4NIXA 1SLWB 4INKA 2Z3CA 1S85A 1LQDB 1TBZH 3SJOA 3R3GB 1V2PT 4KTCA 4XBDA 5PTPA 3LGWA 1DSTA 2PGQB 3EE0B 1MMJN 1IQNA 2O8WA 2GCHF 1NROH 1TGBA 1GBKA 2BOHB 3UTUH 1UVTH 2C90B 2J38A 4ABJA 1G2MA 1Z71A 4FUHA 1Y5AT 7LPRA 4ZHLU 4A6LA 2Y7XA 3HGNA 2W3IA 1CT4E 4JYUH 1GGDB 4B75A 2CN0H 3BG8A 1OWIA 2TGAA 4XBBA 4J2YB 2BD5A 3OU0A 5AF9H 2I6QA 1NRNH 1O2JA 3GISB 4CR5A 1MTWA 1ANDA 3TLOA 3B8JA 2A1DB 2FLBH 1IOEA 1O39A 3LJJA 3CENA 2BVRH 1MU6B 3SNEA 4OS4A 4BTUB 1S5SA 4O3TA 1C2MA 1B0EA 2BQWB 1DX5M 2YOLA 2ZNKH 2DE8A 4AFZA 1EZUC 2ZTXA 3OTJE 2EEKA 4UDWH 1C1UH 2ZQ1A 5DPAA 1LVMA 1PPEE 2GGVB 1V2VT 2WYJA 4Q7YA 1YPMH 3PO1C 4MQAA 1CVWH 6CHAB 2FOHA 4IN1A 3HK6B 2P94A 3TJVA 4WVPE 4CHAB 2UUJB 2IOTA 2A7HA 1SOZA 1DSUA 1Y3UA 2P8OC 1JIRA 1LVBA 2BOKA 3MU4A 2JH6D 3QK1A 1A61H 1INCA 2FI4E 3MOCA 1ZYOA 2BHGA 2F91A 2FOCA 1THSH 1O2LA 1XKBC 1A0JA 1TPAE 1W8BH 1NT1A 1MKXK 2V3HH 1DWCH 5A8YA 1EAXA 2OC0A 1QFKH 1UVUH 4X1RU 2ZHFH 1KXAA 1KTTB 3GYMA 1XUGA 1RD3B 4FUFA 4UFFH 4XE4A 1GBLA 1KLTA 3GY6A 2JH5D 1DUEA 1UCYK 3FAOA 4NFEA 3EA9A 3SU6A 1DT2A 1T8LA 3OSYA 3E0PB 1TWXB 3W94A 4GVUA 1OSSA 2Z7FE 1BRCE 2IPHA 2AMDA 3LPRA 1RTFB 2ZDNA 4IBLH 5EXLA 2ZGCA 1PJPA 4CRFA 4LXBH 1ZR0A 2H6MA 2FDAA 2F9NA 3TNTA 1C5NH 1JXPA 1O31A 2ZDLA 1MBQA 1FIWA 3A88A 4YTAA 1AFQC 1NESE 4Z0KA 1HGTH 1V2RT 1TGNA 1A5GH 2P16A 1S83A 4LOYH 3M3TA 2VIQA 1O2KA 4YLQH 4UFGH 1LPKB 1L1JA 1DWBH 1BA8B 1EZQA 1OWKA 2BXUH 2ZDKA 2XRCA 3ZZ4A 3DA9B 2ALPA 1UK4A 2BDYA 1L1NA 2GMTB 2UUKB 4Q80A 1K1IA 2OC7A 1GMDF 3T25A 3EGKH 1HYLA 1SGIB 2ANYA 1HJ9A 2FX6A 1OWJA 1W3CA 3KCGH 1CO7E 1GI6A 1O33A 1GHBF 1OWEA 2VVVA 2JH0D 2XBXA 5HM2A 2R2MB 3TGIE 3SU0A 2D1JA 1F2SE 2CXVA 4BTIB 3S9BA 5JYIA 3Q3XA 3TU7H 2YNBA 1OX1A 1F7ZA 3RXHA 4JCNA 3RMMH 1C4V2 4K2YA 3A89A 3SNAA 2AGGX 1V2KT 1YLCA 2F9BH 1GHAF 3C1KA 1ZZZA 2ZFFH 3OY6U 5DP4A 3T62A 4AFSA 2QF0A 1GHBG 1CHOF 1FIZA 1GJ4H 2CMYA 1CA0B 1XXFA 3SJIA 1P57B 1XVOA 2GV7A 2ASUB 1RTLA 4Q2KA 1LHCH 2BLWA 1GMCF 1O3MA 3IITA 2WINI 3P6ZB 1SQAA 1SLXB 4X6MA 2FODA 4BANB 3L33A 1QCPA 1UCYE 1EZSC 1K1LA 1UTMA 3GY7A 1MTSA 1CHOG 1VGCB 1C1QA 3U69H 4X2VA 1QR3E 2SGFE 4K1TA 4DVAU 1FY4A 1UO6A 2PSXA 1GMCG 1TNJA 3M36A 2ZHQH 1C2HA 1QB1A 1G3EA 3OX7U 2F83A 1UK2A 1V2NT 1ZGIA 2ZCLP 1C2FA 1ZTJA 1AI8H 1XVMA 1CA8B 3SNDA 1T8OA 3Q77A 1VITF 3SUDA 2SNVA 4ZH8A 4NA9H 1CGHA 2BLVA 5AVDA 2PTCE 3ZZAA 4GSOA 5GPIB 3MU0A 4GAWA 4KKDA 4IN2A 1MKXH 2QAAA 2QYIA 1THRH 2CHAB 1WU1A 4ABFA 1L4ZA 1BIOA 2PUXB 2QGRA 3MNCA 2BVXH 5A0CA 4MVNA 3QTVH 1VITG 4I8LA 2H2ZA 1TQ0B 2VIWA 1DXPA 2FS8A 4X8VH 3RXCA 2VH0A 4INHA 2XWAA 4U01A 3ATLA 4CRDA 9ESTA 4FUIA 2EI8A 2SGEE 1E0FD 1IAUA 1DLKB 1NM6A 1UCYH 4MTBA 5BPEA 2XNIA 1MTNC 1SGRE 1Y3YA 2O8MA 3DT0H 3LOXA 3T26A 3A81A 1ZRKA 2B0FA 2BLQA 3AVZA 7GCHF 4R0IA 2Z6BD 3VFEA 5JBBS 1GBAA 3ODDA 3MI4A 3MYWA 3GY3A 4I31A 3T28A 2A31A 2J4IA 1FN8A 1O5DH 4FUEA 2B5TB 1BOQA 4D76A 5DP9A 3PO1B 4F49A 2VB0A 1ZPBA 5IDKA 4K3JA 4MPWA 1C2IA 2C8WB 4JZFH 4ABDA 2NU1E 3ZZ3A 3FP7E 7GCHG 4TWYA 2ZIQH 1UTKA 3K9XB 2GT7A 2ZKSA 3RXLA 4BXSA 2BDBA 1O38A 5T6FA 5C2ZA 1C5MD 4I32A 4I8HA 4Y0ZE 3GCOA 1ELEE 1O2IA 3A7WA 3MU8A 1Y3XA 2I6SA 1TOCB 3BTKE 4FVBA 3TH3H 4B2BA 1AFEH 3VB7A 4IW4E 2NU2E 4GHQA 4SGAE 1O3JA 2A7JA 3ZYEA 3N7OA 4K8YA 2ZFPH 1ZHPA 3VEQB 1GMHF 2K7XA 3RMOH 2R0KA 1V2WT 1K1NA 2XC4A 2BX4A 1MKWK 2UWPA 3TJOA 4ASHA 1FAKH 5LPEA 5EPNA 3W95A 2DUCA 4OS1A 3ZZDA 1QQ4A 1D4PB 1QY6A 4DT7B 5CHAC 1O3IA 1SFQB 1P2OA 3SV7A 1GBDA 3BEUA 3SOSA 3M61U 2AEIH 2VVUA 1ANCA 1HUTH 1G30B 1NFUA 2GV6A 5FPSA 1TNGA 1GJCB 1K1OA 1YPHE 2A45B 1O32A 1V2TT 1P04A 1C5VA 2QXHA 1NZQH 4JMYA 3UOUA 2ZU4A 1P3EA 5BRRE 2ZHEH 1D3QB 3BTQE 4JK5A 4FUGA 1K22H 1GWAA 4ABGA 1D3TB 1SI5H 3K2UA 1ZOMA 5FXLA 8GCHF 1Y59T 3K6ZA 3U8OH 4HZHA 1F0RA 4ABBA 1CE5A 2Z9IA 1QTFA 4X2YA 1LCYA 4KELA 2FOAA 2Q6FA 3RU4T 2LPRA 2OUAA 3VB4A 1AIXH 2TGTA 1LHEH 1P12E 1C1NA 1TYNA 2VWOA 4X1QU 1O3AA 2D2DA 4OGXA 4INLA 5TCAA 1C1OA 4OS6A 1C2KA 3DD2H 2H9TH 1Z1JA 1EB1H 2STAE 4VGCC 4QT8C 1LQEA 1TAWA 2Z9JA 2JETC 4CBNA 2PSYA 3A8AA 3QX5H 1KXFA 1BBRK 4HFPB 2FLRH 3GOVB 3BG4B 3RXUA 1G2LA 3QTOH 3SNBA 2NU0E 2GVFA 3NZIA 1NPMA 1VCWA 3TNSA 1C5ZB 1O3CA 2C4FH 3BIUH 1C5LH 2UUYA 5JB8S 3VB5A 2EA3A 2RDLA 1GI1A 1ID5H 2G81E 4HGCA 4I33A 1FY5A 4CH2B 2F9PA 4MPUA 5FX6A 6ESTA 1FZZA 2ZU5A 1ESAA 1ETRH 1L1GA 2K1QA 1UJ1A 1HAIH 1EUFA 1HXFH 4Y10E 8KME2 3MTYA 4TPYA 2Y5HA 4YT7H 3KNXA 1OP0A 1D9IA 3TK5A 1ELVA 1EPTC 3OYPA 4I8KA 3FZDA 4DY7B 1IQKA 2PKAA 1AB9C 1J14A 2SGPE 1T32A 4CRBA 3LH3A 1C1RA 4J1YA 1FV9A 2ANMH 5B6OA 1T7CA 3CS0A 2OP9A 3PWCA 3H5CB 1HAPH 1C5QA 3MMGA 5JPMH 1NFXA 2G51A 2ZU3A 1O2HA 2ZGHA 1K28D 3A8BA 1ZMNA 2GTBA 2DE9A 3SO3A 1DVAH 1UVOA 3SGBE 4D9QA 1T4VH 2Z9KA 3RMNH 1P05A 1EJNA 5HM9A 1SGCA 3P92A 2Q1JA 4DG4A 4K1EA 1RXPA 2FMJA 1A46H 1OYTH 1O2MA 1ZRBA 3T5FH 1ETTH 1MKWH 1W7XH 3RM2H 4XFQA 2Z94A 1BTHH 2PKAB 3FP8E 1ARBA 2FOMB 3BV9B 2BDAA 5FBEA 4ZXYH 5DGJA 1T4UH 4NGAH 1BBRE 2W3KA 3AASA 4X8UH 2AMQA 1CBWB 4ABEA 4CRAA 1H8DH 1C5XB 1ARCA 3SUFA 3DFJA 1VR1H 1VJ9U 2ODQA 4B2CA 2BQ6B 5C1UA 4OS2A 1TOMH 4R8TB 1RJXB 1O5BB 4B1TA 2R9PA 1SPJA 1ELFA 3TH4H 1VCQA 1ZMJA 4AFUA 2VVCA 3ZZBA 2FM2A 2J92A 4JZ1A 3RLWH 3ZZ9A 3GICB 3QZQA 1GJAB 3RMLH 2Y7ZA 4O97A 1MQ5A 4NFFA 2ANKH 4BAKB 4NSVA 2G8TA 1OWDA 1B7XB 3MO6A 2FOGA 1ZTLA 2ZCHP 3GYLB 1ZPCA 3F9FA 4AX9H 2WPJS 3TJUA 1T31A 2CGAA 1O3HA 1ZMLA 1FMGA 3M37A 4E7NA 1BBRH 1DFPA 2UWOA 1RFNA 3IG6B 1JBUH 2BDCA 5F8TA 3MH5A 3E16B 3D65E 5AFYH 4OS5A 1K1JA 1HDTH 2BQ7B 2OXSA 1NTPA 2ZPQA 5L30H 1BTXA 2AS9A 3FFGA 4FUDA 3GCHC 3TH2H 2RCEA 4YT6H 2BVSH 1NU9A 3MNXA 1XUHA 1A2CH 3S0NA 5FHTA 3PB1E 4D8NA 2XC0A 3RC4A 1V2JT 4X0WU 1C5SA 1EAWA 1SVPA 3P8FA 5T6DA 3UNQA 2P59A 3LU9B 5HXFA 2WV5A 3O8CA 1RS0A 1YP9A 4Q7ZA 2A4GA 2FI5E 4WMFA 1Z1IA 2FS9A 2ZC9H 4CR9A 2BD2A 3RXAA 1QB6A 4ISNA 2FOFA 5FPTA 4BXWA 1BTZA 4AB8A 3LONA 2PLXA 1SC8U 1W11U 1HAYB 4O3UA 4WH6A 9LPRA 2H1UA 4IMZA 1LHFH 1ZPZA 2FO9A 2ZFQH 3A7TA 1MU8B 1UTQA 2ZEBA 3NUMA 2ZGBH 1SGNE 1MH0A 2NU4E 1SGFG 1IQIA 1KXEA 1BJUA 2FYRA 1BMLA 3UUZA 1AVGH 2PFEA 2PTNA 3SGAE 1DUAA 1YM0A 2BY9X 2HNTE 1GG6C 1QQUA 1QL8A 4MDSA 1O2WA 2Y6TA 1GBFA 2ALVA 1O35A 1YPHC 1FY1A 4ZUHA 1O5FH 3PTBA 5JBAS 1OOKB 4XDEA 3SZNA 3URDA 4ZHAA 4TY7A 3KQEA 2ZO3H 3PYHA 1MUEB 7ESTE 2Z9LA 1LVOA 2D26C 1C5YB 5C3NA 3R0FA 2IN2A 2EI7A 2A5KA 1NFYA 1TIOA 2HPQH 2C8YB 6GCHF 5EOKA 4MNXA 3F6UH 1QRZA 1TNKA 1PFXC 1HAGE 2GP9B 1QA7A 4X8TH 1ANBA 3BTWE 2G52A 4JZDH 5F03A 4UE7H 2XCFA 3SQEE 2O9QA 4MNWA 3M35A 1WUNH 3DFLA 4Y6DA 5C1XA 2OQ5A 1KIGH 5I46H 2AYWA 5F8XA 4DIHH 4GUXA 6GCHG 2FPZA 4ISIH 1BTWA 1QRXA 1V3XA 1FN6A 5EQRA 3BSQA 1D6RA 1LHGH 4MPXA 1HPGA 2R3UA 3ELAH 3KIDU 4K8BA 1YKTA 4BAOB 3M7TA 2QIQA 1CHGA 2P3UB 1D3PB 1EX3A 3BF6H 2A2QH 1FONA 4ZKSU 2V35A 1LTOA 2BD8A 1Z8GA 1QJ6B 1TALA 1QURH 5DKMA 1KY9A 2Y5GA 4NG9H 4BAHB 1M9UA 3UQVA 4WWYA