2BX3A

Crystal structure of sars coronavirus main proteinase (p43212)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
b'GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAIN PROTEINASE
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
source organism Sars coronavirus sin2774
molecule tags Hydrolase
total genus 89
structure length 300
sequence length 300
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx3A02
3QZRA 1CGIE 1MTSA 2FI4E 1SLXB 3RMMH 1CVWH 5EPYA 3F9GA 1GMHG 1FPCH 3OU0A 1BMNH 1GVZA 2WINI 1PQ7A 3QZQA 2FOEA 2CXVA 1CHGA 2BXUH 4ZXYH 2VJ1A 3AW0A 2Y5GA 1UTPA 2QY0B 1NROH 1S5SA 3STJA 1FMGA 2AFQB 4ABDA 3TGKE 1LKAA 3PB1E 2BYAX 3UNRA 3MO3A 1J15A 5A8ZA 2C3SA 1CQQA 1N8OB 1DLKB 1ELBA 2BDCA 2GMTB 1C5VA 3M5OA 4OGYA 1LPKB 1GL0E 2BD7A 2HGTH 4ABGA 3VGCC 4UONA 1ZGVA 4TYDA 4AX9H 1EP6A 3RXIA 4BTTB 3U9AH 1C1NA 1AZ8A 1P3EA 4HI3A 3U8OH 3U8RH 1O2TA 4LXBH 1K2I1 1WCZA 1F0SA 3ODDA 1VCQA 2G8TA 3BEFB 1E34B 1C1VH 2OBOA 4R0IA 3LONA 4YOIA 3PYHA 2J2UA 3RXSA 5LPRA 1DXWA 4K8BA 3K2UA 4Z0KA 5I25A 4X0WU 3PMAB 2OXSA 3SNCA 1BMAA 2XCFA 3F9EA 1OYTH 3P17H 3ZZ5A 1FNIA 1BOQA 2XBXA 2RG3A 4WH6A 1V2LT 2H1UA 4GHQA 2WPKS 3EA9A 2QC2A 1VCPA 2GCHG 3QGNB 4KP0A 5ESBA 3A8BA 2UUFB 1KXAA 3SJIA 1F7ZA 4B73A 1AFEH 2PSYA 3SV7A 3W95A 5IYTA 3LPRA 3KGPA 3F9FA 1DSUA 2HPPH 2ZO3H 1V6DA 3AW1A 1KXCA 1O5EH 4KKDA 3RMNH 1GHBG 2QXGA 3TLOA 5DGJA 3U1JB 5EW2H 1O3AA 2WV4A 3M5MA 5EXLA 1G3BA 4A1XA 1H9IE 1KXEA 2QXHA 1K1OA 2YNAA 4MPWA 4DY7B 5DO4H 1LHFH 1TNLA 1LPZB 1QURH 3IG6B 1D3DB 2OP9A 3RXBA 2G55A 1O3GA 1O2UA 2VIDA 2Y5FA 1P2QA 4LZ4B 1KIGH 1QQ4A 1V2QT 4RN6A 4Y8ZA 5A0BA 2AYWA 3UY9A 2ZI2H 3VXFH 3PMBB 1QNJA 2QA9E 5DP5A 3RXDA 3BEUA 3QN7A 5T3HA 3SOSA 1HAOH 4J1YA 5JB9S 4BAOB 2ZU4A 1SSXA 1Z7KA 2R9PA 5HXFA 2HRVA 3ZVBA 1TBQH 1LTOA 1O5BB 1WTGH 5EG4A 1AWHB 4NA7A 2ZDKA 4IBLH 5CHAB 4CREA 1YBWA 1A2CH 1OOKB 2B5TB 2PFEA 2A4QA 3RXAA 3SJKA 1C4Y2 1FDPA 2FI3E 4GUXA 5FHTA 2P3UB 3P8OA 3T26A 3MU4A 4X1NU 5C3NA 1P2OA 3VXEH 8GCHG 3SU4A 2Q6DA 3SUEA 1OWHA 5FBEA 5EQSA 1HJ9A 3RC5A 1C1TA 5C1YA 4WVPE 3SW2B 2A1DB 2PUQH 1DANH 1P01A 1BITA 3ATIA 3UWJH 1BT7A 1Q2WA 4ABJA 3EAJA 1TGNA 8ESTE 1H8IH 1RTKA 3BG4C 5FCKA 3RM0H 4B74A 1TQ0B 4ZAEA 1FAKH 4MNYA 4GVUA 1O31A 2VVVA 1GJ8B 1G30B 2ODPA 2BY5X 3LGTA 5BPEA 1O2OA 4BAMB 3A80A 2R3UA 3A8CA 1GI3A 2VVUA 1O3NA 1KLIH 3BTKE 1S0RA 3FP8E 4HZHA 1JMOH 1G32B 1HAVA 3A87A 2PW8H 3CP7A 2ZPSA 4CRDA 1TONA 1C5UA 1O5DH 2GD4B 1XKBC 1EJNA 3SGAE 2ZCHP 1GHZA 5DK1A 1GCDA 1OPHB 2CMYA 1TNJA 6GCHF 3E91A 1ZLRA 1AB9C 2CHAB 2XBWA 2UWOA 2Q6GA 3ITIA 3H7TA 1IQKA 2OC8A 2ODQA 4NIYA 3QTVH 1MU8B 1AUTC 2H6MA 3M35A 1BTWA 4ZROA 1EAUA 4CRGA 1AI8H 4RKOB 2BY6X 3RMOH 1A3EH 5GPIB 1SMFE 1VJ9U 5JDUB 2UWLA 1UVOA 5EU8A 3EE0B 5HM9A 2BHGA 2WPLS 4K1EA 2EEKA 4LK4A 2W3IA 3ZZCA 1RS0A 1UK4A 5GWZA 2UUJB 1JXPA 1Q3XA 1UCYE 3WY8A 1SGNE 1ELCA 2Y7XA 1CBWC 5CE1A 1GHXH 3FZZA 2LIZA 2C8XB 2UUYA 2OLGA 2ZGJA 3T25A 2OINA 4K69A 5T6GA 1FQ3A 1YPJH 2GCTC 2VIQA 1GCTB 1O5AB 4XOJA 4JZEH 1AFQC 1J8AA 1GBFA 4BXWA 2NU4E 1HAHH 1MKXK 2PKAA 4IC6A 3D62A 1YCPK 1O35A 1F0TA 3LH3A 3MFJA 2P8OC 1TPSA 4D8NA 1EPTA 4ASHA 1TE0A 1ESAA 1G37A 1KLJH 2ZC9H 4NZLA 5JBCS 1MU6B 1CO7E 4KTCA 4ABEA 2A7HA 2BVSH 4O3TA 1PYTC 4ZHLU 1AZZA 1YPGH 1O2VA 4X2VA 4AFUA 1BA8B 1HCGA 5HYOA 1O2QA 2BD9A 1C2FA 1ELFA 1NRQH 2NWNA 1WOFA 3SZNA 2HPQH 1YKTA 1CGJE 4ABIA 3OY5U 2QXJA 4BAKB 1SGEE 2WUCA 1ORFA 2O8LA 1O2MA 1DY9A 8KME2 3PWCA 4I32A 1NU9A 1WYKA 2R2WU 1YC0A 1P9UA 4IN2A 1C5YB 1GHVH 1YGCH 3T5FH 4Y0YE 4Y8YA 2Z9KA 3TPIZ 4FUJA 4WMFA 1HXEH 1VCWA 1MAXA 3ATLA 1S6HA 3RXOA 3SJ8A 3M61U 2J34A 1DWCH 4FUCA 4NWLA 3SJOA 2ZHDA 1NRRH 3TU7H 3A7WA 3MNXA 3A85A 3BTWE 1ZHPA 1ESBA 4AGKA 1OX1A 2FXRA 1FI8A 1FJSA 1ABJH 2FYQA 1C5RA 1VITH 2BLWA 3S9BA 4XFQA 1AY6H 3SN8A 2A7JA 2BDBA 4UDWH 3T28A 2PLXA 4X6NA 2ZP0H 3P8FA 1L4DA 5AF9H 2A7CA 4CBOA 1VITF 2QIQA 2UWPA 5PTPA 5JPMH 1TBZH 4BTUB 1OKXA 3H5CB 3SI3H 3MNSA 5EOKA 3A8AA 1PJPA 2V3HH 4MLFB 1QBVH 3TK6A 4JZFH 1N6XA 3URDA 2PR3A 3LT3A 2TGDA 4IS5A 1HYLA 1QJ1B 3HATH 3FP6E 4B76A 2UUKB 1LHCH 3SNAA 5F8ZA 3OSYA 4B75A 1O3IA 1AVXA 1O3CA 3R0FA 1F5RA 1GDNA 2SGDE 1IAUA 3NCLA 1MBMA 3B8JA 4CH8B 1TPPA 3E0PB 1QFKH 3F68H 1S0QA 1HNEE 1YLCA 1ANBA 4NGAH 3ZYDA 3GY5A 4Y71A 4B2BA 1C2KA 2M5TA 5DP7A 3A7XA 3SORA 1C4U2 1G3DA 1XX9A 1ZTJA 1TLDA 2C8ZB 3PO1C 2B0FA 1G3EA 5HMAA 3MMGA 1NU7B 1BBRK 2ESTE 2HLCA 2RCEA 3MH7A 1KXBA 1ZTLA 4PROA 5FPYA 1O37A 5HM2A 5DKMA 1UTJA 1C2HA 3ZZ4A 3ZZ7A 1CA0B 2O8WA 2XWAA 2ZCKP 4DW2U 3S9CA 3RU4T 4YZUA 4YLQH 3RXPA 1LPGB 1HAIH 2QN5T 4X2YA 2SGEE 2HNTE 1W3CA 2Z6BD 4K1TA 1ZYOA 1P12E 3DFLA 2CV3A 3P70B 2H2ZA 4AN7A 4Q2KA 4X6PA 1C5SA 1DY8A 1BHXB 2F9UA 1P2MA 3K9XB 3RUOA 1P2NA 1E37B 4X2WA 2A32A 4D9RA 1QRXA 3BF6H 1GHWH 5CHAC 1QGFA 2CJIA 1RTFB 2JETB 3KF2A 5T6FA 1GBLA 1BJUA 3MI4A 3A88A 1AE5A 1D4PB 3NUMA 3OX7U 1DXPA 1O2JA 5B6OA 5FX5A 2G4UA 4JK5A 2BY9X 2H9TH 1AQ7A 4KELA 1LO6A 1JIRA 4E05H 1O2GH 4ISLA 2BLOA 3TK9A 4O3UA 1MBQA 4UEHH 4NSVA 5IDKA 1IQNA 1JIMA 4WXIA 2J9NA 3PMHB 2IN2A 4AB9A 1O3EA 2Z7FE 3ZVAA 1RGQA 3C1KA 3BTFE 3U8TH 1J16A 1FXYA 1GI7B 2TGTA 1TNKA 3RXTA 3A83A 2ZTYA 2P3FH 3RP2A 3DD2H 1G2MA 1UTNA 3I29A 3E6PH 5ETXA 4X1SU 4IMQA 2CGAA 1B7XB 2A2QH 1UTLM 4O97A 3KNXA 1C1QA 5DP6A 3K6YA 6GCHG 4OS7A 1A7SA 1NFWA 1O3OA 1UTOA 1EZXC 2ZZUH 4CH2B 1O32A 3PROA 4ZKRU 2VH6A 2ZFSA 1GJDB 1YPEH 2ZDVH 1ACBE 5C20A 1ZOMA 2A5AA 1O5GH 2XC4A 1DWDH 1TWXB 1BTHH 1TOMH 1C9PA 5T6DA 3RXEA 1MCVA 2O8MA 3IWMA 4XDEA 2V35A 2GT8A 2QGRA 1PPCE 1QRZA 3CS7A 1Y3WA 4K8YA 3K6ZA 2G4TA 2ZG0H 4UFGH 1CT2E 3GISB 2GV7A 1LVMA 3K65B 1MZAA 1SQOA 3UOPA 1ZSJA 1YCPH 1K1NA 3LC3A 1P11E 4CRAA 1BQYA 1ZSKA 4ZKOU 1A4WH 3RXGA 1TRNA 2GZ9A 4UE7H 3S7HB 4MQAA 4TPIZ 3TVJB 4Z6AH 1KXFA 4FUBA 4X6MA 3RXJA 2RDLA 2Z9IA 4FVBA 2ZIQH 3LJOA 1P05A 1A0LA 1A5GH 1IQEA 3ENSB 3BIVH 1RJXB 1DITH 1P2IA 1XKAC 1Y5BT 3I77A 1SOTA 1V2TT 1GBKA 1HJAC 2GTBA 4CR5A 1H1BA 2QV1A 4FU8A 3SQHE 2BD5A 1NRPH 4E7RG 2R3YA 2GZ8A 4X8UH 4AGJA 1O39A 3P8GA 3ZZ3A 2G51A 4AFZA 3JZ2B 1C2EA 1N6YA 5K7RA 2QXIA 2ZQ2A 2R0KA 3MH6A 4R8TB 5E2PA 1VR1H 1MTNC 2BDGA 5SGAE 1SQTA 1IQMA 1SR5C 1ETTH 1EPTC 1ZMJA 1EX3A 4MG3A 4Y0ZE 1QHRB 5AFZH 5ESTE 2J92A 4THNH 2ZFRH 1AWFH 1D9IA 3UR6A 3SU0A 1P8VC 3QDZB 1GVKB 1LHEH 4LZ1H 1WSSH 1A46H 1P2KA 2ANMH 1BUIA 1BDAA 2VGCB 1L2EA 1NFYA 1QB6A 1O3PB 2A4OA 1CT0E 1ZJKA 2P94A 3VB5A 2BY7X 1UK3A 1TMBH 2FX4A 1O2RA 2AS9A 1MKWH 2THFB 3TJUA 3CS0A 5GXPA 1BTXA 2BD2A 3RU4D 1GHYH 3TGIE 1D3PB 2HNTC 4BNRA 1SGCA 1FIWA 1TGBA 4ISHH 4JYUH 3A81A 3GICB 2HNTF 4FUHA 4IN1A 3IITA 1BTZA 4VGCB 1OWIA 1MH0A 3S7KB 3GCHB 3L33A 1PPBH 3KCGH 2H5DA 3PLPA 3E3TA 4ZH8A 5F6MA 3A7TA 2FTMA 1H4WA 4MTBA 5GDSH 4YOGA 1OWDA 2WYJA 4Q7XA 1GI5A 4DJZB 3GY7A 1GMCF 1UO6A 3V3MA 1XXDA 2FS9A 1RD3B 5FAHA 1CSOE 2DE8A 4FUGA 1WQSA 4U01A 1QCPA 4D76A 2XBVA 2YNBA 3GCTG 5C5OA 1SB1H 1V2MT 2A2XH 2TGPZ 5EGMA 1JRSA 2ILNA 5JBBS 3VB4A 1UJ1A 3VB7A 1QB1A 2Z9JA 2ZDLA 1T8MA 3EYDA 2BB4A 3A82A 1VITG 1GI8B 5G4BA 1O33A 4WMDA 1CT4E 1PQ8A 3RXVA 2Y81A 2QF3A 2AGIX 2ZU3A 1O34A 1W14U 1GI9B 3BEIB 2VWNA 4I8GA 4U2WA 5DP9A 2TGAA 5GCHF 1H9LB 2PTNA 2FO9A 1MTUA 3BG8A 5A0AE 4TWWA 1J9CH 2AEIH 1GBEA 1GBAA 2W3KA 3BSQA 6CHAB 1BBRH 3ZV9A 1P10A 3DHKH 1E0FD 2Y82A 2IJOB 4KTUA 1HAYB 4YO9A 2A31A 2J94A 5F03A 5A8YA 3SV6A 5F8XA 2OC1A 3LIWA 1K28D 2IPHA 2DE9A 3A7YA 4DT7B 3SHCH 2WV5A 4B2AA 1ANEA 3E90B 1YF4A 1OXGA 1SOZA 3LGWA 4MNVA 2FS8A 2ZTXA 2FM2A 3LU9B 1ZMLA 3M7QA 1IQLA 1A3BH 1LQDB 1GL1A 4H42U 1YYY1 1NRSH 2ZU1A 1HIAB 1FY8E 1K1JA 5FXLA 5EQQA 4CHAC 1SLUB 1TB6H 3TJOA 1AKSB 3STIA 4ABFA 1WV7H 3DFJA 1GJAB 3FZDA 3CENA 1IOEA 1EASA 3S69A 3MHWU 4CRCA 1GPZA 1QBNA 1WU1A 4A6LA 4U32A 1PPZA 3NPSA 2V3OH 1TOCB 1UCYK 3ZZAA 1ID5H 2ZQ1A 1GBJA 5K0HA 3O8RA 1G3CA 4I33A 2BDIA 1ABIH 1TPOA 2JH0D 4ISIH 3UNQA 4DOQA 3UUZA 3Q00A 1HAVB 3MOCA 1MTWA 1QR3E 2ZEBA 1QL7A 1VZQH 1GG6C 1O2YA 3BTDE 4Q80A 1O3LA 3UTUH 4X8SH 2C4FH 2BY8X 1Z8GA 3RC4A 1NT1A 2CF8H 1MMJN 1QRWA 4GHTA 1XUJA 1BHXF 1GWAA 1UVPA 3E16B 2AERH 1S85A 4GLYA 1IQFA 4Q7ZA 1C5LH 1O2KA 9ESTA 3MH4A 3G01A 3HK3B 4NIXA 2AMPA 1GDUA 1ZGIA 4GCHF 4X1RU 4CR9A 3M7TA 4XBCA 1SPJA 3RXLA 2SGAA 1QB9A 4MDSA 2ZFQH 2WUBA 4JCNA 3ZZBA 3MU1A 3RXRA 2GVFA 3C27B 3SJ9A 4YM9A 1GBIA 2ZDNA 3AAVA 3KHVA 2EI8A 3KQEA 1BB0B 1ZJDA 5A8XA 3LDXH 1EOLA 1TA2A 1TRYA 2G81E 4MPUA 1EAIA 4X1QU 1GBMA 4JYTA 1KTTB 2W7SA 1NN6A 1IQIA 1SI5H 2XRCA 3Q77A 2A45B 1YPKH 3BV9B 4A7IB 1GGDC 2H5CA 1W11U 1O3JA 2ANWA 2PSXA 4I8JA 1MZDA 3NKKA 1O2NA 1TIOA 1F5KU 1SQAA 1XUGA 1H8DH 1EP5A 2GV6A 4ISOA 1BRCE 4YOJA 3GOVB 4YT7H 2ZFFH 1NM6A 3P6ZB 4HGCA 1SFQB 1GI0A 3MTYA 4SGBE 3TH4H 2FLRH 2VWOA 1MTVA 4K5ZA 3UREA 3LOXA 4Y79A 2F9BH 1TGCA 1PQAA 5I46H 1ZZZA 1KTSB 2ASUB 1W10U 1GBBA 1AHTH 2FOAA 1E35B 4Q7YA 2OUAA 3F9HA 3ATKA 7LPRA 3UIRA 4ABHA 2C90B 1QJ6B 4WXVA 1TQ7B 1WTHD 2SNWA 1FPHH 1BZXE 3T29A 5DP4A 3KIDU 3V0XA 1A61H 3F1SB 1V2NT 4ZMAH 1GMDF 5EXNA 2KAIB 3TIUA 2BD8A 1SGRE 3EGKH 1VJAU 3MNCA 2XNIA 2Y80A 2P59A 2FI5E 2LPRA 1BMMH 1NFUA 1SLVB 1OSSA 2TBSA 3URCA 3MO6A 2ALVA 1F2SE 2AGGX 1MD8A 2SGPE 3M5LA 1DVAH 2QF0A 1M9UA 3UFAA 1HJ8A 1DLEA 2ZA5A 2FP7B 2XBYA 1W8BH 2WPHS 3BTGE 4YESB 2BZ6H 3TGJE 1AVGH 3SUDA 3PV4A 1TX7A 1GI6A 5BRRE 3M37A 4X1PU 3D65E 4UD9H 1N8OC 3AVZA 2GMTC 4DIIH 1L1JA 4FUDA 1P2JA 1WAYB 4ISNA 3MO9A 2VU8E 4WY3A 3UQOA 5JYIA 1B0EA 5L30H 7ESTE 1P9SA 3A89A 2H9EH 3GCTF 1PPHE 2O9QA 1HAZB 2G5VA 2EA3A 4CBNA 2WPIS 5C2ZA 4OS1A 3ELAH 5GJ4B 4K1SA 2VINA 2BDAA 1GBTA 2F9OA 3L3TA 2FX6A 2BVRH 3E0NB 3SUFA 1EJMA 1P06A 1KDQB 1PQ5A 3SU5A 4UFEH 2O8UA 3TH2H 1T32A 1G2LA 4Y8XA 2HWLB 3GY8A 2FTLE 1Z1IA 3QLPH 1GMCG 1Z8RA 1TA6A 4D7FA 1LQEA 1C2MA 3TK5A 4NIWA 3OYPA 4VGCC 1KYNA 1FIZA 1AE8H 1UTKA 1SVPA 1UHBA 4H6TA 1AN1E 1DM4B 4A5TS 3RM2H 2OQ5A 1LHGH 1SC8U 1XVOA 3RXFA 4MPXA 1SGIB 5GCHG 3SQEE 1ELGA 4BANB 1V2RT 1UK2A 2FODA 1C2LA 3LGVA 2FOHA 5J4SA 1NZQH 1V2VT 2FESH 4JZIA 5TCCA 1VGCB 4H6SB 3P8NA 1EB1H 1O2LA 1HGTH 2H9HA 3MYWA 5J4QA 4HTCH 1NTPA 3A7VA 1QL9A 3N7OA 1A5HA 3RXMA 2GDDA 3ATMA 1A1RA 1Q31A 4WWYA 2ZNKH 3PMJA 1LHDH 4U30A 1HRTH 3RMLH 4I8LA 4F49A 3RU4E 3BTHE 1MQ6A 3KN2A 1W0YH 1ZPCA 1DSTA 2PKSB 3M3TA 1Y5UT 4GPGA 1B5GH 1EZUC 1NPMA 1QQUA 1Z6EA 3A8DA 1F0RA 5FPSA 3UR9A 4IGDA 2J4IA 4NIVA 1Y3XA 2GGVB 3Q76A 2ZHQH 1XUHA 3E8LA 1P0SH 2OD3B 1BTYA 1TABE 1C5ZB 5C67A 1DICA 5JB8S 1TPAE 2VH0A 3UOUA 1K1MA 3ZZ8A 4IC5A 1CA8B 5DP8A 4O03A 3M5NA 4WH8A 4MNWA 4WJG2 1OWEA 1C5MD 1EQ9A 2TRMA 2ZGXH 4GAWA 1RTLA 2WPJS 2K7XA 1O5CB 3GYLB 1C2JA 2STBE 1BJVA 1F0UA 5GIBA 1O3KA 3BTQE 2F9PA 4BAHB 1FN6A 2A0QB 1ANCA 1U6QA 4DG4A 2JH6D 1T8LA 1HAGE 2ODYB 1J14A 2R0LA 1C1UH 1O2SA 3BTEE 1EJAA 1SGFA 1IQHA 3PLKA 2P95A 1S83A 3PM3A 4OS2A 1FLEE 1S6FA 1ZMNA 4OS6A 4YLUA 2G00A 1CBWB 2OBQA 4M7GA 2W5EA 1JOUB 1QIXB 3HGNA 4MVNA 1CU1A 1TAWA 1C2DA 5CMXH 2GCTB 2FEQH 1T8NA 2BX4A 1AFQB 2NU2E 1HB0B 1XM1A 1Z8JB 2BLVA 2J38A 4GCHG 4OS4A 2P8OB 1MKXH 4E7NA 2Z3EA 1Y3YA 2ZHWH 2CHAC 5AFYH 2Z9LA 4AFQA 1Z6JH 2I6QA 1P3CA 1C2IA 2VIOA 4K3JA 4BTIB 5FBIA 1XUIA 3EA8A 1RFNA 3TITA 1P04A 1FY1A 3SGQE 1LKBA 3HKJB 3D23A 2QYIA 2PUXB 5JBTA 1SGFG 1YM0A 1MD7A 1LCYA 1TNGA 3RXUA 1F5LA 5E0JA 2ZU5A 1NRNH 3ZYEA 4JZDH 3SNEA 1WUNH 4UFFH 1G9IE 3GYMA 1MAYA 3VPKA 1SGTA 4H4FA 5E0HA 3RC6A 2XCNA 2A4RA 2Z3CA 2EI6A 2Y5HA 1DT2A 1HAXB 1PFXC 4NCYA 4BXSA 1GI1A 3SHAH 2BDYA 2ZTZA 3ZVFA 4Y6DA 1O2PA 3GDSA 3V13A 3NZIA 1GCTC 4WMEA 1DS2E 1ZPZA 1GBCA 3GCNA 1DUEA 3NWUA 1DOJA 1P57B 3MH5A 4TPYA 3O8DA 4NG9H 1UVUH 1ELEE 2D2DA 1ZR0A 1ARCA 1GHAF 2ZFPH 4ZXXH 3KQBA 1BTPA 1L1GA 2K1QA 3SI4H 2AMQA 1GJ6A 2F9NA 3SUGA 1O3HA 1FY4A 2QAAA 1C5WB 1GMDG 1W7XH 4Y10E 1YPHE 2O8TA 2GX4A 2D1JA 4JZ1A 2FOBA 1CHOF 2ZPRA 4X8VH 2CN0H 1DFPA 1DUAA 4NFEA 5C5NA 2PHBA 1O36A 3FAOA 2VWMA 1C5OH 2BVXH 1KLTA 1TFXA 2I6SA 4AYYB 2WYGA 1XMNB 4UFDH 2FOCA 1NFXA 3SBKA 1EKBB 3PTBA 3TNSA 2FYRA 1OP2A 1O2HA 3DA9B 1INCA 1BCUH 1RRKA 2FMJA 2W7UA 2WPMS 5DPAA 2EC9H 3LJJA 1UMAH 5TCAA 3RLYH 1CGHA 3VB3A 3RDZA 1TRMA 4B71A 1TX8A 1W0ZU 1SGDE 4NSYA 3VFEA 5C1XA 1UVTH 2ALPA 6LPRA 5EODA 1NS3A 3GDVA 3RXCA 1HAPH 4XBDA 3U69H 3T27A 5E0GA 1O2ZA 3VB6A 3RXHA 1GJ5H 1BIOA 4AFSA 1XUKA 3MU0A 1HPGA 4TY6A 2B8OH 2A5IA 1AO5A 4DGJA 1NY22 1DE7H 3PO1B 1ANDA 1J17T 1UVSH 1W7GH 2FLBH 2P93A 2RA0A 1C5NH 5A0CA 1UTQA 2DUCA 1O38A 4F4OC 5L2ZH 1BRAA 3LGYA 1ELDE 3SU1A 1RIWB 1C5TA 3EDXB 2FOMB 3ZZDA 3GY2A 1HFDA 2BXTH 2ZHFH 2TPIZ 4GSOA 1QL8A 2OC0A 1L1NA 1FN8A 1YPLH 2VWLA 1LVOA 2SNVA 1DX5M 3A7ZA 2GKVE 3UQVA 5HGGA 1Y59T 1T8OA 3V7TA 1LDTT 3I78A 1EATA 2ZCLP 4BOHA 2BOKA 2ZDMA 2ZECA 1AUJA 2IOTA 1SFIA 2STAE 3QX5H 2F91A 1IHTH 4DURA 4Y7BA 1V2UT 3H7OA 3KEEA 8LPRA 5LGOA 1K1PA 1NESE 1D6RA 2Q1JA 2SGFE 1OP8A 1GI4A 1EAXA 3GY6A 1V3XA 1GDQA 1O3BA 2PV9B 3UWIA 4FUFA 1HBTH 1BRBE 1A5IA 5DG6A 1HIAA 2OTVA 3JZ1B 1V2KT 3KQDA 4YT6H 2F9VA 3W94A 1LVBA 3HKIB 1C1PA 2SGQE 1AU8A 1AKSA 1L4ZA 1GJ9B 1HLTH 1JBUH 1MUEB 1O3DA 4D9QA 2PWXA 1VGCC 2ZGHA 2BQWB 1LMWB 4A1TA 4INLA 3ODFA 1CA0C 1SGQE 1O3FA 4DVAU 2NU0E 2ULLA 4LOYH 3LH1A 2C8YB 3VEQB 4Y11E 2ZDAH 5FPTA 7GCHF 2PKSC 3BN9A 1F92A 1B0FA 2B7DH 1O2XA 1TMUH 2FIRH 2R2MB 1S81A 1C5PA 3ATWA 1KXDA 2JKHA 1W2KH 1HXFH 1HUTH 3GCOA 5AVDA 3EA7A 2D26C 3Q3KA 2AGEX 1GBDA 3NK8A 2JETC 3MU5A 4NWKA 2C8WB 3QTOH 4XSKU 2ANKH 1G36A 2VIVA 3ZVEA 2ZPQA 4AORA 1ZHRA 3U98H 1YPHC 2BDHA 1FZZA 2ZGBH 4CRBA 4AB8A 1UTMA 1KSNA 2FZZA 1E38B 2FDAA 2V6NA 1V2OT 2B9LA 1YCPM 3U1IB 2AIQA 4IW4E 4ZKSU 1O30A 1HV7A 3KQCA 1X7AC 1O0DH 1HJAB 4X2XA 1NC6A 3GDUA 1GVLA 2GDEH 3TJVA 2CF9H 3Q3YA 3SNDA 4SGAE 2BTCE 4X8TH 1ZSLA 1TGSZ 1GJCB 5DP3A 3QGJA 1GMHF 4JMYA 2PKAB 3V12A 1TYNA 1GJ4H 1MTNB 3ESTA 5E8EH 1FONA 3VGCB 5LPEA 1EPTB 1FV9A 2HALA 1EXFA 1Y5AT 3SV2H 3T62A 2G5NA 4AOQA 1TALA 4I8HA 4NA9H 3HPTB 1THSH 2BQ6B 2BD3A 2D8WA 1D6WA 3B23B 3SO3A 3ZZ6A 1K1LA 1PYTD 3O8CA 4QT8C 2OQUA 3MU8A 4WF8A 4YTAA 1WBGB 1GJ7B 1T4UH 1D3TB 2J95A 5A09A 1ELVA 2BM2A 2Z94A 1TMTH 1QJ7B 1AIXH 2G52A 1P02A 3RXQA 3PTNA 2VB0A 1C9TA 4ABAA 2NU1E 2KAIA 4ZHMU 1SGPE 3B9FH 1MCTA 5FX6A 1K9OE 2BX3A 4JK6A 5EPNA 2HOBA 5TJXA 2GZ7A 1YP9A 1ZRBA 4A1VA 1EOJA 1EB2A 4XE4A 1GHAG 3P92A 4BAQB 3SU6A 7KMEH 1O2WA 2V0BA 1QA0A 4A92A 2AH4X 1ETRH 1GBHA 1MQ5A 1C1MA 1D3QB 2ANYA 2GCHF 2ZWLH 1V2WT 1Y8TA 2ZF0H 5F8TA 3DUXH 1CHOG 1TX6A 4FUEA 1IHSH 5LPFA 1E36B 1LVYA 1K1IA 1EZSC 1O2IA 2GP9B 4HFPB 4CRFA 1ESTA 3FVFB 3QUMP 1ARBA 1SG8B 1ZRKA 3M3SA 1O5FH 1PPFE 2VGCC 5C1UA 1GHBF 2EI7A 3S9AA 1V2PT 3UPEA 1MKWK 2VVCA 1S84A 2ZKSA 3SV9A 2BD4A 4AG2A 3QWCH 3HGPA 2P3TB 4OS5A 3P95A 3OY6U 4FVDA 2HVXA 2OCVB 3AASA 1H9HE 1OYQA 2SFAA 1KDQA 1Z71A 4KGAA 1EAWA 4DCDA 4RSPA 2VNTA 1WQVH 2NU3E 3GCHC 3ZVGA 4Y76A 5JBAS 1T31A 1YLDA 4I7YH 1TNIA 1UHBB 1Y3UA 1P03A 1FUJA 3QO6A 3LC5A 2YOLA 3L6PA 1ELAA 1TNHA 2GT7A 3D49H 3M7UA 3FP7E 1P09A 1ZHMA 3KL6A 4I8KA 4NA8A 4K2YA 2PTCE 3EQ0H 1O3MA 1QA7A 1XVMA 3PLBA 4FU9A 4CHAB 1OWJA 5EW1H 1W12U 5H4IB 2OC7A 5DJ7A 2VIWA 1A0HB 3FANA 2RA3A 3BG4B 3SGBE 1EUFA 1T7CA 4AG1A 3Q3XA 2Y7ZA 1BTUA 1Y3VA 4FU7A 8GCHF 1AMHA 4D7GA 3RXKA 1RXPA 1S82A 2TIOA 3LGUA 1JRTA 1N1LA 4XBBA 5ABWA 1C5QA 1DPOA 3GY4A 3M36A 1Z1JA 1ELTA 5LH8A 1TGTA 3E1XB 2A5KA 1YPMH 3BTTE 6ESTA 6CHAC 4B1TA 1RIWC 4Y7AA 4ABBA 4NZQA 1EZQA 1UCYH 2F3CE 1THRH 3ZVCA 2P16A 2BZAA 1PPGE 2QCYA 1AVWA 4INHA 4AZ2B 1GI2A 2JH5D 2Q6FA 2ZFTA 1DWEH 3QK1A 1XUFA 4J2YB 1PPEE 4DIHH 1C4V2 1SHHB 2F83A 1C2GA 2ZU2A 4TWYA 1GG6B 1SGYE 5L2YH 1AB9B 1QTFA 1T4VH 3RLWH 3MNBA 1SBWA 1ZPBA 4FXGH 4RKJB 3LKWA 2BLQA 3SV8A 3AAUA 3LGIA 3HK6B 1OWKA 1W13U 1C1WH 4KTSA 4MPVA 1IQJA 5EQRA 2AMDA 4AYVB 4ZUHA 3ZV8A 1NO9H 1K22H 3NXPA 3R3GB 3F6UH 3DT0H 1C1RA 2XXLA 1FY5A 3MWIU 3SNBA 1A0JA 3A86A 3TJNA 2FOGA 1SHYA 2A4GA 1V2ST 3S0NA 1AGJA 3GY3A 2ZHEH 2W26A 4ZHAA 2PGQB 2BMGB 3O8BA 1BBRE 2FWWA 1BMLA 3TH3H 4JYVH 2VIPA 5E2OA 2FOFA 1TBRH 5FCRA 4INKA 5L6NH 3BTME 1C1SA 7GCHG 4IMZA 1K21H 4ZKNU 3A84A 1OP0A 1AD8H 2XC0A 1DDJA 3T2NA 3FFGA 4X6OA 1QY6A 1C5XB 1IQGA 4ESTE 1CE5A 3SU3A 4I31A 4OGXA 4E06H 1KY9A 1GGDB 1HDTH 2FPZA 2XWBI 5EXMA 4B2CA 1ZTKA 4TY7A 5A2MH 2Z9GA 1SL3A 3PWBA 1ETSH 2XTTB 2C93B 3EBNA 1FAXA 2AIPA 3BIUH 2XC5A 1GJBB 2PGBB 9LPRA 2BQ7B 4MNXA 1THPB 2Y6TA 3TNTA 2XW9A 1Z8IB 3ZVDA 5AHGH 1DWBH 1FY3A 3M3VA 1V2JT 4O9VA 4NFFA 4K60A 1BRUP 3OTJE 2XYAA 1SLWB 1QBOA 2Z3DA 1L0ZA 1XXFA 2LNCA 3ZZ9A 2ZGCA 1OS8A 3SU2A 2BOHB 1JWTA 1C1OA 4FUIA 3UNSA
chains in the Genus database with same CATH superfamily
3QZRA 1CGIE 1MTSA 2FI4E 5FL7D 2VBCA 1SLXB 3RMMH 1CVWH 5EPYA 3F9GA 1GMHG 1FPCH 3OU0A 1BMNH 1GVZA 2WINI 1PQ7A 3QZQA 2FOEA 2CXVA 1CHGA 2BXUH 4ZXYH 2VJ1A 3AW0A 2Y5GA 1UTPA 2QY0B 1NROH 1S5SA 2EY4C 3STJA 1H8HD 1FMGA 2AFQB 4ABDA 3TGKE 1LKAA 3PB1E 2BYAX 3UNRA 3MO3A 1J15A 5A8ZA 2C3SA 1CQQA 1N8OB 1DLKB 1ELBA 2BDCA 2GMTB 1C5VA 3M5OA 4OGYA 1LPKB 1GL0E 2BD7A 2HGTH 3AK5A 2JDID 4ABGA 3VGCC 4UONA 1ZGVA 4TYDA 4AX9H 1EP6A 3RXIA 4BTTB 3U9AH 1C1NA 1AZ8A 1P3EA 4HI3A 3U8OH 3U8RH 1O2TA 4LXBH 1K2I1 1WCZA 1F0SA 3ODDA 1VCQA 2G8TA 3BEFB 1E34B 1C1VH 2OBOA 4R0IA 3LONA 4YOIA 2WV9A 2J2UA 3PYHA 3RXSA 5LPRA 1DXWA 4K8BA 3K2UA 4Z0KA 5I25A 4X0WU 3PMAB 2OXSA 3SNCA 2HLDD 1BMAA 2XCFA 3F9EA 1OYTH 3P17H 3ZZ5A 1FNIA 1BOQA 2XBXA 2RG3A 4WH6A 1V2LT 2H1UA 4GHQA 2WPKS 3EA9A 2QC2A 1VCPA 2GCHG 3QGNB 4KP0A 5ESBA 3A8BA 2UUFB 1KXAA 3SJIA 1F7ZA 4B73A 1AFEH 2PSYA 3SV7A 3W95A 5IYTA 3LPRA 3KGPA 3F9FA 1DSUA 2HPPH 2ZO3H 1V6DA 3AW1A 1KXCA 1O5EH 4KKDA 3RMNH 1GHBG 2QXGA 3TLOA 5DGJA 3U1JB 5EW2H 1O3AA 2WV4A 4RI0A 3M5MA 5EXLA 1G3BA 4A1XA 3N7EA 1H9IE 1KXEA 2QXHA 1K1OA 2YNAA 4MPWA 2XNDD 4DY7B 5DO4H 1LHFH 1TNLA 1LPZB 1QURH 3IG6B 1D3DB 2OP9A 3RXBA 2G55A 1O3GA 1O2UA 2VIDA 2Y5FA 1P2QA 4LZ4B 1KIGH 1QQ4A 1V2QT 4RN6A 4Y8ZA 5A0BA 2AYWA 3UY9A 2ZI2H 3VXFH 3PMBB 1QNJA 2QA9E 5DP5A 3RXDA 3BEUA 3QN7A 5T3HA 3SOSA 1HAOH 4J1YA 5JB9S 5HIZA 4BAOB 2ZU4A 1SSXA 1Z7KA 2R9PA 5HXFA 2HRVA 3ZVBA 1TBQH 1LTOA 1O5BB 1WTGH 5EG4A 1AWHB 4NA7A 2ZDKA 4IBLH 5CHAB 1VKYA 4CREA 1YBWA 1A2CH 1OOKB 2B5TB 2PFEA 2A4QA 3RXAA 3SJKA 1C4Y2 1FDPA 2FI3E 4GUXA 5FHTA 2P3UB 3P8OA 2V7QD 3WWBA 3T26A 3MU4A 4X1NU 5C3NA 1P2OA 3VXEH 8GCHG 3SU4A 2Q6DA 5EJZA 3SUEA 1OWHA 5FBEA 5EQSA 5HIYA 1HJ9A 3RC5A 1C1TA 5C1YA 4WVPE 3SW2B 2A1DB 2PUQH 1DANH 1P01A 1BITA 3ATIA 3UWJH 1BT7A 1Q2WA 4ABJA 3EAJA 1TGNA 8ESTE 1H8IH 1RTKA 3BG4C 5FCKA 3RM0H 3U28C 4B74A 1TQ0B 4ZAEA 1FAKH 4MNYA 4GVUA 1O31A 2VVVA 1GJ8B 1G30B 1NBME 2ODPA 2BY5X 3LGTA 5BPEA 1O2OA 4BAMB 3A80A 2R3UA 3A8CA 1GI3A 2VVUA 1O3NA 1KLIH 3BTKE 1S0RA 3FP8E 4HZHA 1JMOH 1G32B 1HAVA 3A87A 2PW8H 3CP7A 2ZPSA 4CRDA 1TONA 1C5UA 1O5DH 2GD4B 1XKBC 1EJNA 3SGAE 2ZCHP 1GHZA 5DK1A 1GCDA 1OPHB 2CMYA 1TNJA 3KYGA 6GCHF 3E91A 1ZLRA 1AB9C 2CHAB 2XBWA 2UWOA 2Q6GA 2WPDD 3W1EA 3ITIA 3H7TA 1IQKA 2OC8A 2ODQA 4NIYA 3QTVH 1MU8B 1AUTC 2H6MA 3M35A 1BTWA 4ZROA 1EAUA 4CRGA 1AI8H 4RKOB 2BY6X 3RMOH 1A3EH 5GPIB 1SMFE 1VJ9U 4I86A 5JDUB 2UWLA 1UVOA 5EU8A 3EE0B 5HM9A 2BHGA 2WPLS 4K1EA 3DSGA 2EEKA 4LK4A 2W3IA 3ZZCA 1RS0A 1UK4A 5GWZA 3FOAA 2UUJB 1JXPA 3OFND 1Q3XA 1UCYE 3WY8A 1SGNE 1ELCA 2Y7XA 1CBWC 5CE1A 1GHXH 3FZZA 2LIZA 2C8XB 2UUYA 2OLGA 2ZGJA 3T25A 2OINA 4K69A 5T6GA 1FQ3A 1YPJH 2GCTC 2VIQA 1GCTB 1O5AB 4XOJA 4JZEH 1AFQC 1J8AA 1GBFA 4BXWA 2NU4E 1HAHH 1MKXK 2PKAA 4IC6A 3D62A 1YCPK 1O35A 1F0TA 3LH3A 3MFJA 2P8OC 1TPSA 4D8NA 1EPTA 4ASHA 1TE0A 1ESAA 1G37A 1KLJH 2ZC9H 3KQ5A 4NZLA 5JBCS 1MU6B 1CO7E 4ZCNA 4KTCA 4ABEA 2A7HA 2BVSH 4O3TA 1PYTC 4ZHLU 1AZZA 1YPGH 1O2VA 4X2VA 4AFUA 1BA8B 1HCGA 5HYOA 1O2QA 2BD9A 1C2FA 1ELFA 1NRQH 2NWNA 5DSFA 1WOFA 3SZNA 2HPQH 1YKTA 1CGJE 1E1RD 4ABIA 3OY5U 2QXJA 1W0JD 4BAKB 1SGEE 2WUCA 1ORFA 2O8LA 1O2MA 1DY9A 8KME2 3PWCA 4I32A 1NU9A 1WYKA 2R2WU 1YC0A 1P9UA 4IN2A 1C5YB 1GHVH 1YGCH 3T5FH 4Y0YE 4Y8YA 2Z9KA 3TPIZ 4FUJA 4WMFA 1HXEH 3MQKC 1VCWA 1MAXA 3ATLA 1S6HA 3RXOA 3SJ8A 2KFWA 3M61U 2J34A 1DWCH 4FUCA 4NWLA 3SJOA 2ZHDA 1NRRH 3TU7H 3A7WA 3MNXA 3A85A 3BTWE 1ZHPA 1ESBA 4AGKA 1OX1A 2FXRA 1FI8A 1FJSA 1ABJH 2FYQA 3PRDA 1C5RA 1VITH 2BLWA 2KR7A 3S9BA 4XFQA 1AY6H 3SN8A 2A7JA 2BDBA 4UDWH 3T28A 2PLXA 4X6NA 2ZP0H 3FN8A 3P8FA 1L4DA 5AF9H 2A7CA 4CBOA 1VITF 2QIQA 2UWPA 2QF5A 5PTPA 5JPMH 1TBZH 3SZEA 1OKXA 4BTUB 3H5CB 3SI3H 3MNSA 5EOKA 3A8AA 1PJPA 2V3HH 4MLFB 1QBVH 3TK6A 4JZFH 1N6XA 3URDA 2PR3A 3LT3A 2TGDA 4IS5A 1HYLA 1QJ1B 3HATH 3FP6E 2YMSB 4B76A 2UUKB 4AC9A 1LHCH 3SNAA 5F8ZA 3OSYA 4B75A 1O3IA 1AVXA 1O3CA 3R0FA 1F5RA 1GDNA 2SGDE 1IAUA 3NCLA 1MBMA 3B8JA 2F4LA 4CH8B 1TPPA 2L6OA 3E0PB 1QFKH 3F68H 1S0QA 1HNEE 1YLCA 1ANBA 4NGAH 3ZYDA 3GY5A 4Y71A 3N7DA 4B2BA 1C2KA 2M5TA 5DP7A 3A7XA 3SORA 1C4U2 1G3DA 2QE7D 5C0TA 1XX9A 1ZTJA 1TLDA 2C8ZB 3PO1C 2B0FA 1G3EA 5HMAA 3MMGA 1NU7B 2KCAA 1BBRK 2ESTE 2HLCA 2RCEA 3MH7A 1KXBA 1ZTLA 4PROA 5FPYA 1O37A 5HM2A 5DKMA 1UTJA 1C2HA 3ZZ4A 3ZZ7A 1CA0B 2O8WA 2XWAA 2ZCKP 4DW2U 3S9CA 3RU4T 4YZUA 4YLQH 3RXPA 1LPGB 1HAIH 2QN5T 4X2YA 2SGEE 2HNTE 1W3CA 2Z6BD 4K1TA 5CHBA 1ZYOA 1P12E 3DFLA 3F2FA 2CV3A 3P70B 2H2ZA 4AN7A 4Q2KA 4X6PA 1C5SA 1DY8A 1BHXB 2F9UA 1P2MA 3K9XB 3RUOA 1P2NA 1E37B 2JIZD 4X2WA 2A32A 4D9RA 1QRXA 3BF6H 1GHWH 5CHAC 1QGFA 2CJIA 1RTFB 2JETB 3KF2A 5T6FA 1GBLA 1BJUA 3MI4A 3A88A 1AE5A 1D4PB 3NUMA 3OX7U 2KZ4A 1DXPA 1O2JA 5B6OA 5FX5A 2G4UA 4JK5A 2BY9X 2H9TH 1AQ7A 4KELA 1LO6A 1JIRA 4E05H 1QZ8A 1O2GH 4ISLA 2BLOA 3TK9A 4O3UA 1MBQA 4UEHH 4NSVA 5IDKA 1IQNA 1JIMA 4WXIA 2J9NA 3PMHB 2IN2A 4AB9A 1O3EA 2Z7FE 3ZVAA 1RGQA 3C1KA 3BTFE 3U8TH 1J16A 1FXYA 1GI7B 2TGTA 1TNKA 4XD7D 3A83A 3RXTA 2ZTYA 4DT4A 2P3FH 3RP2A 3DD2H 1G2MA 1UTNA 3I29A 3E6PH 2RFKC 5ETXA 4X1SU 4IMQA 2CGAA 1B7XB 2A2QH 1UTLM 4O97A 3KNXA 1C1QA 5DP6A 3K6YA 1S6LA 6GCHG 4OS7A 1A7SA 1NFWA 1O3OA 1UTOA 1EZXC 2ZZUH 4CH2B 1O32A 3PROA 4ZKRU 2VH6A 2ZFSA 1GJDB 1YPEH 2ZDVH 1ACBE 5C20A 1ZOMA 2A5AA 1O5GH 2XC4A 1DWDH 1TWXB 1BTHH 1TOMH 1C9PA 5T6DA 3RXEA 1MCVA 2O8MA 3IWMA 4XDEA 2V35A 2GT8A 2QGRA 1PPCE 1QRZA 3CS7A 1Y3WA 4K8YA 3K6ZA 2G4TA 2ZG0H 4UFGH 1CT2E 3GISB 2GV7A 2JJ1D 1LVMA 2CK3D 3K65B 1MZAA 1SQOA 3UOPA 1ZSJA 1YCPH 1K1NA 3LC3A 2LP6A 1P11E 4CRAA 5EJ1A 1BQYA 1ZSKA 4ZKOU 1A4WH 3RXGA 1TRNA 2GZ9A 1H8ED 4UE7H 3S7HB 4MQAA 4TPIZ 3TVJB 4Z6AH 1KXFA 4FUBA 4X6MA 3RXJA 2RDLA 2Z9IA 4FVBA 2ZIQH 3LJOA 1P05A 1A0LA 1A5GH 1IQEA 3ENSB 3BIVH 1RJXB 1DITH 1P2IA 1XKAC 1Y5BT 3I77A 1SOTA 1V2TT 1GBKA 1HJAC 2GTBA 4CR5A 1H1BA 2QV1A 4FU8A 3SQHE 2BD5A 1NRPH 4E7RG 2R3YA 2GZ8A 4X8UH 4AGJA 1O39A 3P8GA 3ZZ3A 2G51A 4AFZA 3JZ2B 1C2EA 1N6YA 5K7RA 2QXIA 2ZQ2A 2R0KA 3MH6A 4R8TB 5E2PA 1VR1H 1MTNC 2BDGA 5SGAE 1SQTA 1IQMA 1SR5C 1ETTH 1EPTC 1ZMJA 1EX3A 4MG3A 4Y0ZE 1QHRB 5AFZH 5ESTE 2J92A 4THNH 2ZFRH 1AWFH 1D9IA 3UR6A 3SU0A 1P8VC 3QDZB 1GVKB 1LHEH 4LZ1H 1WSSH 1A46H 1P2KA 2ANMH 1BUIA 1BDAA 2VGCB 1L2EA 1NFYA 1QB6A 1O3PB 2A4OA 1CT0E 1WDIA 1ZJKA 2P94A 3VB5A 2BY7X 1UK3A 1TMBH 2FX4A 5B6LA 1O2RA 2AS9A 1MKWH 2THFB 3TJUA 3CS0A 5GXPA 2BD2A 1BTXA 3RU4D 3VG8A 1GHYH 3TGIE 1D3PB 2HNTC 4BNRA 1SGCA 1FIWA 1TGBA 4ISHH 4JYUH 3A81A 3GICB 2HNTF 4FUHA 4IN1A 3IITA 1BTZA 4VGCB 1OWIA 1MH0A 3S7KB 3GCHB 3L33A 1PPBH 3KCGH 2H5DA 3PLPA 5C0UA 3E3TA 4ZH8A 5F6MA 3A7TA 2FTMA 1H4WA 4MTBA 5GDSH 4YOGA 1OWDA 2WYJA 3CNRA 4Q7XA 1GI5A 4DJZB 3GY7A 1GMCF 1UO6A 3V3MA 1XXDA 2FS9A 1RD3B 5FAHA 1CSOE 2DE8A 4FUGA 1WQSA 4U01A 1QCPA 4D76A 2XBVA 2YNBA 3GCTG 5C5OA 1SB1H 1V2MT 2A2XH 2TGPZ 5EGMA 1JRSA 2ILNA 5JBBS 3VB4A 1UJ1A 3VB7A 1QB1A 2Z9JA 2ZDLA 1T8MA 3EYDA 2BB4A 3A82A 4M9FA 1VITG 1GI8B 5G4BA 1O33A 3DSPA 4WMDA 1CT4E 1PQ8A 2PP6A 3RXVA 2Y81A 2QF3A 2AGIX 2ZU3A 1O34A 1W14U 1GI9B 3BEIB 2VWNA 4I8GA 4U2WA 5DP9A 2TGAA 5GCHF 1H9LB 2PTNA 2FO9A 1MTUA 3BG8A 5A0AE 4TWWA 1J9CH 2AEIH 1GBEA 1GBAA 2W3KA 3BSQA 4RT1A 6CHAB 1BBRH 3ZV9A 1P10A 3DHKH 1E0FD 2Y82A 2IJOB 4KTUA 1HAYB 4YO9A 2A31A 2J94A 5F03A 5A8YA 2YMSD 3SV6A 1W0KD 5F8XA 2OC1A 3LIWA 1K28D 2IPHA 2DE9A 3A7YA 3OEHD 4DT7B 3SHCH 2WV5A 4Q4LA 4B2AA 1ANEA 3E90B 1YF4A 2WHXA 1OXGA 1SOZA 3LGWA 4MNVA 1YY3A 3PV5A 2FS8A 2ZTXA 2FM2A 3LU9B 1ZMLA 3M7QA 1IQLA 1A3BH 1LQDB 1GL1A 4H42U 1YYY1 1NRSH 2ZU1A 4B6EA 1HIAB 1FY8E 1K1JA 5FXLA 5EQQA 4CHAC 1SLUB 1TB6H 3TJOA 1AKSB 3STIA 4ABFA 1WV7H 3DFJA 1GJAB 3FZDA 3CENA 1IOEA 1EASA 3S69A 3MHWU 4CRCA 1GPZA 1QBNA 1WU1A 4A6LA 4U32A 1PPZA 3NPSA 2V3OH 1TOCB 1UCYK 3ZZAA 1ID5H 2ZQ1A 1GBJA 5K0HA 3O8RA 1G3CA 4I33A 2BDIA 1ABIH 1TPOA 2JH0D 4ISIH 3UNQA 4DOQA 3UUZA 2J98B 3Q00A 1HAVB 3MOCA 1MTWA 3DSOA 1QR3E 2ZEBA 1QL7A 1VZQH 1GG6C 1O2YA 5CDFE 3BTDE 4Q80A 1O3LA 3UTUH 4X8SH 2C4FH 2BY8X 1Z8GA 3RC4A 1NT1A 2CF8H 1MMJN 1QRWA 4GHTA 1XUJA 1BHXF 1GWAA 1UVPA 3E16B 2AERH 1S85A 4GLYA 1IQFA 4Q7ZA 1C5LH 1O2KA 1YLNA 9ESTA 3MH4A 3G01A 3HK3B 4NIXA 2AMPA 1GDUA 1ZGIA 4GCHF 4X1RU 4CR9A 3M7TA 4XBCA 1SPJA 5C94A 3RXLA 2SGAA 1QB9A 4MDSA 2ZFQH 2WUBA 4JCNA 3ZZBA 3MU1A 3RXRA 2GVFA 3C27B 3SJ9A 4YM9A 1GBIA 2ZDNA 3AAVA 3KHVA 2EI8A 3KQEA 1BB0B 1ZJDA 3NRLA 5A8XA 3LDXH 1EOLA 2IPQX 1TA2A 1TRYA 2G81E 4MPUA 1EAIA 4X1QU 1GBMA 4JYTA 1KTTB 2W7SA 1NN6A 1IQIA 1SI5H 2XRCA 3Q77A 2A45B 1YPKH 3BV9B 4A7IB 1GGDC 2H5CA 1W11U 1O3JA 2ANWA 2PSXA 4I8JA 1MZDA 3NKKA 5F53A 1O2NA 1TIOA 1F5KU 1SQAA 1XUGA 1H8DH 5EJLA 1EP5A 2GV6A 4ISOA 1BRCE 4YOJA 3GOVB 4YT7H 2ZFFH 1NM6A 3P6ZB 4HGCA 1SFQB 1GI0A 3MTYA 4SGBE 2KCOA 3TH4H 3F2GA 2FLRH 2VWOA 1MTVA 4K5ZA 3UREA 3LOXA 4Y79A 2F9BH 1TGCA 1PQAA 5I46H 1ZZZA 1KTSB 2ASUB 1W10U 1GBBA 1AHTH 2FOAA 1E35B 4Q7YA 2OUAA 3F9HA 3ATKA 7LPRA 3UIRA 4ABHA 2C90B 1QJ6B 4WXVA 1TQ7B 1WTHD 2SNWA 1FPHH 1BZXE 3T29A 5DP4A 3KIDU 3V0XA 1A61H 3F1SB 5C17A 1V2NT 4ZMAH 1GMDF 5EXNA 2KAIB 3TIUA 2BD8A 1MABB 1SGRE 3EGKH 1VJAU 3MNCA 2XNIA 2Y80A 2P59A 2FI5E 2LPRA 1BMMH 1NFUA 1SLVB 1OSSA 2TBSA 3URCA 3MO6A 2ALVA 1F2SE 2AGGX 2EQNA 1MD8A 2SGPE 3M5LA 1DVAH 2QF0A 1M9UA 3KYFA 3UFAA 1HJ8A 1DLEA 2ZA5A 2FP7B 2XBYA 1W8BH 2WPHS 3BTGE 4YESB 2BZ6H 3TGJE 1AVGH 3SUDA 3PV4A 1TX7A 1GI6A 5BRRE 3M37A 4X1PU 3D65E 4UD9H 3GS9A 1N8OC 3AVZA 2GMTC 4DIIH 1L1JA 4FUDA 1P2JA 1WAYB 4ISNA 3MO9A 2VU8E 4WY3A 4ACAA 3UQOA 5JYIA 1B0EA 5L30H 7ESTE 1P9SA 3A89A 2H9EH 3GCTF 1PPHE 2O9QA 1HAZB 2G5VA 3UB0A 2EA3A 4CBNA 2WPIS 2HVYB 1OHHD 5C2ZA 4OS1A 3ELAH 3F0PA 5GJ4B 4K1SA 2VINA 2BDAA 4ACBA 1GBTA 2F9OA 3L3TA 2FX6A 2BVRH 3E0NB 3SUFA 1EJMA 1P06A 1KDQB 1PQ5A 3SU5A 4UFEH 2O8UA 3TH2H 4Q63A 1T32A 1G2LA 4Y8XA 2HWLB 3GY8A 2FTLE 1Z1IA 3QLPH 1GMCG 1Z8RA 1TA6A 4YXWD 4D7FA 1LQEA 4F48B 1C2MA 3TK5A 3F3BA 4NIWA 3OYPA 4VGCC 1KYNA 1FIZA 1AE8H 1UTKA 1SVPA 1UHBA 4H6TA 1AN1E 1DM4B 4A5TS 1KMHB 3RM2H 2OQ5A 1LHGH 1SC8U 1XVOA 3OTPA 3RXFA 4MPXA 1SGIB 5GCHG 3SQEE 1ELGA 4BANB 1V2RT 1UK2A 2FODA 1C2LA 3LGVA 2FOHA 5J4SA 1NZQH 1V2VT 2FESH 4JZIA 5TCCA 1VGCB 4H6SB 3P8NA 1EB1H 1O2LA 3OEED 1HGTH 2H9HA 3MYWA 5J4QA 2W6ID 4HTCH 1NTPA 3A7VA 1QL9A 3N7OA 1A5HA 3RXMA 2GDDA 3ATMA 1A1RA 1Q31A 4WWYA 2ZNKH 3PMJA 1LHDH 4U30A 1HRTH 3RMLH 4I8LA 4F49A 3RU4E 3BTHE 1MQ6A 3KN2A 1W0YH 1ZPCA 1DSTA 2PKSB 3M3TA 1Y5UT 4GPGA 1B5GH 1EZUC 1NPMA 1QQUA 1Z6EA 3A8DA 1F0RA 5FPSA 2AHME 4IGDA 3UR9A 2J4IA 4NIVA 1Y3XA 2GGVB 3Q76A 2ZHQH 1XUHA 3E8LA 1P0SH 2OD3B 1BTYA 1TABE 1C5ZB 5C67A 2WZQA 1DICA 2F43B 5JB8S 1TPAE 2VH0A 3UOUA 1K1MA 3ZZ8A 4IC5A 1CA8B 5DP8A 4O03A 3M5NA 4WH8A 4MNWA 4WJG2 1OWEA 1C5MD 1EQ9A 2TRMA 2ZGXH 4GAWA 1RTLA 2WPJS 2K7XA 1O5CB 3GYLB 1C2JA 2STBE 1BJVA 1F0UA 5GIBA 1O3KA 1COWD 3BTQE 2F9PA 4BAHB 1FN6A 2KCPA 2A0QB 2LELA 1ANCA 1U6QA 4DG4A 2JH6D 1T8LA 1HAGE 2ODYB 1J14A 2R0LA 1C1UH 1O2SA 3BTEE 1EJAA 1SGFA 1IQHA 3PLKA 2P95A 1S83A 2QF4A 3PM3A 4OS2A 1FLEE 1S6FA 1ZMNA 2J5UA 4OS6A 4YLUA 2G00A 1CBWB 2OBQA 4M7GA 2W5EA 1JOUB 1QIXB 3HGNA 4MVNA 1CU1A 1TAWA 1C2DA 5CMXH 1FX0B 2GCTB 2GJGA 2FEQH 1T8NA 2BX4A 1AFQB 2NU2E 1HB0B 3WW7A 1XM1A 1Z8JB 2BLVA 2J38A 3ZIAD 4GCHG 4OS4A 2P8OB 1MKXH 4E7NA 2Z3EA 1Y3YA 2ZHWH 2CHAC 5AFYH 2Z9LA 4AFQA 1Z6JH 2I6QA 1P3CA 1C2IA 2VIOA 4K3JA 4BTIB 5FBIA 1XUIA 3EA8A 1RFNA 4OM9A 3TITA 1P04A 1FY1A 3SGQE 1LKBA 3HKJB 3D23A 2QYIA 2PUXB 5JBTA 1SGFG 1YM0A 1MD7A 1LCYA 1TNGA 3RXUA 1F5LA 5E0JA 2ZU5A 1NRNH 3ZYEA 4JZDH 3SNEA 1WUNH 4UFFH 1G9IE 3GYMA 1MAYA 3VPKA 1SGTA 4H4FA 5E0HA 3RC6A 2XCNA 2A4RA 1SQRA 2Z3CA 2EI6A 2Y5HA 1DT2A 1HAXB 1PFXC 4NCYA 5IK2D 4BXSA 1GI1A 3SHAH 2BDYA 2ZTZA 3ZVFA 4Y6DA 1O2PA 3GDSA 3V13A 3NZIA 1GCTC 4WMEA 1DS2E 1ZPZA 1K0HA 1GBCA 3GCNA 1DUEA 3NWUA 1DOJA 1P57B 3MH5A 4TPYA 3O8DA 4NG9H 1UVUH 1ELEE 2D2DA 1ZR0A 1ARCA 1GHAF 2ZFPH 4ZXXH 3KQBA 1BTPA 1L1GA 2K1QA 3SI4H 2AMQA 1GJ6A 2F9NA 3SUGA 1O3HA 1FY4A 2QAAA 1C5WB 1GMDG 1W7XH 4Y10E 1YPHE 2O8TA 2GX4A 2D1JA 4JZ1A 2FOBA 1CHOF 2ZPRA 4X8VH 2CN0H 1DFPA 1DUAA 4NFEA 2K8IA 5C5NA 2PHBA 1O36A 3FAOA 2VWMA 1C5OH 2BVXH 1KLTA 1TFXA 2I6SA 4AYYB 2WYGA 1XMNB 4UFDH 2FOCA 1NFXA 3SBKA 1EKBB 3PTBA 3TNSA 2FYRA 1OP2A 1O2HA 1E79D 3DA9B 1INCA 1BCUH 1RRKA 2FMJA 2W7UA 2WPMS 5DPAA 2EC9H 3LJJA 1UMAH 5TCAA 3RLYH 1CGHA 3VB3A 3RDZA 2J97A 1TRMA 4B71A 1TX8A 1W0ZU 1SGDE 4NSYA 3VFEA 5C1XA 5EIYA 1UVTH 2ALPA 6LPRA 5EODA 1NS3A 2K0QA 3GDVA 3RXCA 1HAPH 4XBDA 3U69H 3T27A 4ASUD 5E0GA 1O2ZA 3VB6A 3RXHA 1GJ5H 1BIOA 4AFSA 1XUKA 3MU0A 1HPGA 4TY6A 2B8OH 2A5IA 2IJD1 1AO5A 4DGJA 1NY22 4RT0A 1DE7H 3PO1B 1ANDA 1J17T 1UVSH 1W7GH 2FLBH 2P93A 2RA0A 1C5NH 5A0CA 1UTQA 2DUCA 1O38A 4F4OC 5L2ZH 1BRAA 3LGYA 1ELDE 3SU1A 5KEDA 1RIWB 1C5TA 3EDXB 2FOMB 3ZZDA 3GY2A 1HFDA 2BXTH 2ZHFH 2TPIZ 4GSOA 1QL8A 2OC0A 3F0OA 1L1NA 1FN8A 1YPLH 2VWLA 1LVOA 2SNVA 1DX5M 3A7ZA 2GKVE 3UQVA 5HGGA 1Y59T 1T8OA 3V7TA 1LDTT 3I78A 1EATA 2ZCLP 4BOHA 2YMSC 2BOKA 2ZDMA 2ZECA 1AUJA 2IOTA 1SFIA 2STAE 3QX5H 2F91A 1IHTH 4DURA 4Y7BA 2OK5A 1V2UT 3H7OA 3KEEA 8LPRA 2KCYA 4TSFD 5LGOA 1K1PA 1NESE 1D6RA 2Q1JA 2SGFE 1OP8A 1GI4A 1EAXA 3GY6A 1V3XA 1GDQA 1O3BA 2PV9B 3UWIA 4FUFA 1HBTH 1BRBE 1A5IA 5DG6A 1HIAA 2OTVA 3JZ1B 1V2KT 3KQDA 4YT6H 2F9VA 3W94A 1LVBA 3HKIB 1C1PA 2SGQE 1AU8A 1AKSA 1L4ZA 1GJ9B 1HLTH 1JBUH 1MUEB 1O3DA 4D9QA 2PWXA 1VGCC 2ZGHA 2BQWB 1LMWB 4A1TA 4INLA 3ODFA 1CA0C 1SGQE 1O3FA 3F2HA 4DVAU 2NU0E 2ULLA 4LOYH 3LH1A 2C8YB 3VEQB 4Y11E 2W6JD 2ZDAH 5FPTA 7GCHF 2PKSC 3BN9A 4P00A 1F92A 1B0FA 2B7DH 1O2XA 1TMUH 2FIRH 2R2MB 1S81A 1C5PA 3ATWA 1KXDA 2JKHA 3DCLA 1W2KH 2J98A 1HXFH 1HUTH 3GCOA 5AVDA 3EA7A 2D26C 3Q3KA 2AGEX 1GBDA 3NK8A 2JETC 3MU5A 4NWKA 2C8WB 3QTOH 4XSKU 2ANKH 1G36A 1BMFD 2VIVA 3ZVEA 2ZPQA 4AORA 1ZHRA 3U98H 2V3MA 1YPHC 2BDHA 2KX4A 1FZZA 2ZGBH 4CRBA 4AB8A 1UTMA 1KSNA 2FZZA 1E38B 2FDAA 2V6NA 1V2OT 2B9LA 1YCPM 3U1IB 2AIQA 4IW4E 4ZKSU 1O30A 1HV7A 3KQCA 1X7AC 1O0DH 3OE7D 1HJAB 4X2XA 1NC6A 3GDUA 1GVLA 2GDEH 3TJVA 2CF9H 3Q3YA 3SNDA 4SGAE 2BTCE 4X8TH 1ZSLA 1TGSZ 1GJCB 3N99A 5DP3A 3QGJA 1GMHF 4JMYA 2PKAB 3V12A 1TYNA 5DN6D 1GJ4H 1MTNB 5KGOA 3ESTA 5E8EH 1FONA 3VGCB 5LPEA 1EPTB 1FV9A 3PV2A 2HALA 3PRBA 1EXFA 1Y5AT 3SV2H 3T62A 2G5NA 4AOQA 1TALA 4I8HA 4NA9H 3HPTB 1THSH 2BQ6B 2BD3A 2D8WA 1D6WA 3B23B 3SO3A 3ZZ6A 1K1LA 1PYTD 3O8CA 4QT8C 2OQUA 3MU8A 4WF8A 4YTAA 1WBGB 1GJ7B 1T4UH 1D3TB 2J95A 5A09A 1ELVA 2BM2A 2Z94A 1TMTH 1QJ7B 5KECA 1AIXH 2G52A 1P02A 3RXQA 3PTNA 2VB0A 1C9TA 4ABAA 4FETA 2NU1E 2KAIA 4ZHMU 1SGPE 3B9FH 1MCTA 5FX6A 1K9OE 2BX3A 4JK6A 5EPNA 2HOBA 2XOKD 5TJXA 2GZ7A 1YP9A 1ZRBA 4A1VA 1EOJA 1EB2A 4XE4A 1GHAG 3P92A 4TT3D 4BAQB 3SU6A 4Z1MD 1O2WA 2V0BA 7KMEH 1QA0A 4A92A 2AH4X 1ETRH 1GBHA 1MQ5A 1C1MA 1D3QB 2ANYA 2GCHF 2ZWLH 1V2WT 1Y8TA 2ZF0H 5F8TA 3DUXH 1CHOG 1TX6A 4FUEA 1IHSH 5LPFA 1E36B 1LVYA 1K1IA 1EZSC 1O2IA 2GP9B 4HFPB 4CRFA 1ESTA 3FVFB 3QUMP 1ARBA 1SG8B 1ZRKA 3M3SA 1O5FH 1PPFE 2VGCC 5C1UA 1GHBF 2EI7A 3S9AA 1V2PT 3UPEA 1WXRA 1MKWK 2VVCA 1S84A 2ZKSA 2RDEA 2JJ2D 1NBMD 3SV9A 2BD4A 4AG2A 3QWCH 3HGPA 2P3TB 4OS5A 3P95A 3OY6U 4FVDA 2HVXA 2OCVB 5GNDA 5T1VA 3AASA 1H9HE 1OYQA 2SFAA 1KDQA 1Z71A 4KGAA 1EAWA 4DCDA 4RSPA 2VNTA 1WQVH 2NU3E 3GCHC 3ZVGA 4Y76A 5JBAS 1T31A 1YLDA 4I7YH 1TNIA 1UHBB 1Y3UA 1P03A 1FUJA 3QO6A 3LC5A 2YOLA 3L6PA 1ELAA 1TNHA 2GT7A 3D49H 3M7UA 3FP7E 1P09A 2WSSD 1ZHMA 3KL6A 4I8KA 4NA8A 4K2YA 3FKSD 2PTCE 3EQ0H 1O3MA 1QA7A 1XVMA 3PLBA 4FU9A 4CHAB 1OWJA 5EW1H 1W12U 4B6FA 5H4IB 1E1QD 2OC7A 5DJ7A 2VIWA 1A0HB 3OAAD 3FANA 2RA3A 3BG4B 3SGBE 4P02A 1EUFA 1T7CA 1UW7A 4AG1A 1YWUA 3Q3XA 2Y7ZA 1BTUA 1Y3VA 4FU7A 4HG6A 8GCHF 1AMHA 4D7GA 3RXKA 1RXPA 1S82A 2TIOA 3LGUA 1JRTA 1N1LA 4XBBA 3UAIC 5ABWA 1C5QA 1DPOA 3GY4A 3M36A 1Z1JA 1ELTA 5LH8A 1TGTA 3E1XB 2A5KA 1YPMH 3BTTE 6ESTA 6CHAC 3FO8D 4B1TA 1RIWC 3H09A 4Y7AA 4NZQA 1EZQA 4ABBA 1UCYH 2F3CE 1THRH 4FOUC 1SKYE 3ZVCA 2P16A 2BZAA 1PPGE 2QCYA 1AVWA 4INHA 4AZ2B 1GI2A 2JH5D 2Q6FA 2ZFTA 1DWEH 3QK1A 1XUFA 4J2YB 1PPEE 3WWFA 4DIHH 1C4V2 1SHHB 2F83A 1C2GA 2ZU2A 4TWYA 1GG6B 1SGYE 5L2YH 1AB9B 3EE7A 1QTFA 1T4VH 3RLWH 3MNBA 1SBWA 1ZPBA 4FXGH 4RKJB 3LKWA 2BLQA 4F55A 3SV8A 3AAUA 3LGIA 3HK6B 1OWKA 1W13U 1C1WH 4KTSA 4MPVA 1IQJA 5EQRA 2AMDA 4AYVB 4ZUHA 3ZV8A 1NO9H 1K22H 3NXPA 3R3GB 3F6UH 3DT0H 1C1RA 2XXLA 1FY5A 3MWIU 3SNBA 1A0JA 3A86A 3TJNA 2FOGA 1SHYA 2A4GA 1V2ST 3S0NA 1AGJA 3GY3A 2M2AA 2ZHEH 2W26A 4ZHAA 2PGQB 2BMGB 3O8BA 1BBRE 2FWWA 1BMLA 3TH3H 3SYJA 4JYVH 2VIPA 5E2OA 2FOFA 1TBRH 5FCRA 4INKA 5L6NH 3BTME 1C1SA 7GCHG 5HKKD 4IMZA 1K21H 4ZKNU 3A84A 1OP0A 1AD8H 2XC0A 1DDJA 3T2NA 3FFGA 4X6OA 1EFRD 1QY6A 1C5XB 1IQGA 4ESTE 1CE5A 3SU3A 4I31A 4OGXA 4E06H 1KY9A 1GGDB 1HDTH 2FPZA 2XWBI 5EXMA 4B2CA 1ZTKA 4TY7A 5A2MH 2Z9GA 4XRNA 1SL3A 3PWBA 1ETSH 2XTTB 2C93B 3EBNA 1FAXA 2AIPA 3BIUH 2XC5A 1GJBB 2PGBB 9LPRA 2BQ7B 4MNXA 1THPB 2Y6TA 3TNTA 2XW9A 1Z8IB 3ZVDA 5AHGH 1DWBH 1FY3A 3M3VA 1V2JT 4O9VA 4NFFA 4K60A 1BRUP 3OTJE 2XYAA 1SLWB 1QBOA 2Z3DA 1L0ZA 1XXFA 2LNCA 3ZZ9A 2ZGCA 1OS8A 2L74A 3SU2A 2BOHB 1JWTA 1C1OA 4FUIA 3UNSA 2KM0A
chains in the Genus database with same CATH topology
3QZRA 1CGIE 1MTSA 2FI4E 1SLXB 3RMMH 1CVWH 5EPYA 3F9GA 1GMHG 1FPCH 3OU0A 1BMNH 1GVZA 2WINI 1PQ7A 3QZQA 2FOEA 2CXVA 1CHGA 2BXUH 4ZXYH 2VJ1A 3AW0A 2Y5GA 1UTPA 2QY0B 1NROH 1S5SA 3STJA 1FMGA 2AFQB 4ABDA 3TGKE 1LKAA 3PB1E 2BYAX 3UNRA 3MO3A 1J15A 5A8ZA 2C3SA 1CQQA 1N8OB 1DLKB 1ELBA 2BDCA 2GMTB 1C5VA 3M5OA 4OGYA 1LPKB 1GL0E 2BD7A 2HGTH 4ABGA 3VGCC 4UONA 1ZGVA 4TYDA 4AX9H 1EP6A 3RXIA 4BTTB 3U9AH 1C1NA 1AZ8A 1P3EA 4HI3A 3U8OH 3U8RH 1O2TA 4LXBH 1K2I1 1WCZA 1F0SA 3ODDA 1VCQA 2G8TA 3BEFB 1E34B 1C1VH 2OBOA 4R0IA 3LONA 4YOIA 3PYHA 2J2UA 3RXSA 5LPRA 1DXWA 4K8BA 3K2UA 4Z0KA 5I25A 4X0WU 3PMAB 2OXSA 3SNCA 1BMAA 2XCFA 3F9EA 1OYTH 3P17H 3ZZ5A 1FNIA 1BOQA 2XBXA 2RG3A 4WH6A 1V2LT 2H1UA 4GHQA 2WPKS 3EA9A 2QC2A 1VCPA 2GCHG 3QGNB 4KP0A 5ESBA 3A8BA 2UUFB 1KXAA 3SJIA 1F7ZA 4B73A 1AFEH 2PSYA 3SV7A 3W95A 5IYTA 3LPRA 3KGPA 3F9FA 1DSUA 2HPPH 2ZO3H 1V6DA 3AW1A 1KXCA 1O5EH 4KKDA 3RMNH 1GHBG 2QXGA 3TLOA 5DGJA 3U1JB 5EW2H 1O3AA 2WV4A 3M5MA 5EXLA 1G3BA 4A1XA 1H9IE 1KXEA 2QXHA 1K1OA 2YNAA 4MPWA 4DY7B 5DO4H 1LHFH 1TNLA 1LPZB 1QURH 3IG6B 1D3DB 2OP9A 3RXBA 2G55A 1O3GA 1O2UA 2VIDA 2Y5FA 1P2QA 4LZ4B 1KIGH 1QQ4A 1V2QT 4RN6A 4Y8ZA 5A0BA 2AYWA 3UY9A 2ZI2H 3VXFH 3PMBB 1QNJA 2QA9E 5DP5A 3RXDA 3BEUA 3QN7A 5T3HA 3SOSA 1HAOH 4J1YA 5JB9S 4BAOB 2ZU4A 1SSXA 1Z7KA 2R9PA 5HXFA 2HRVA 3ZVBA 1TBQH 1LTOA 1O5BB 1WTGH 5EG4A 1AWHB 4NA7A 2ZDKA 4IBLH 5CHAB 4CREA 1YBWA 1A2CH 1OOKB 2B5TB 2PFEA 2A4QA 3RXAA 3SJKA 1C4Y2 1FDPA 2FI3E 4GUXA 5FHTA 2P3UB 3P8OA 3T26A 3MU4A 4X1NU 5C3NA 1P2OA 3VXEH 8GCHG 3SU4A 2Q6DA 3SUEA 1OWHA 5FBEA 5EQSA 1HJ9A 3RC5A 1C1TA 5C1YA 4WVPE 3SW2B 2A1DB 2PUQH 1DANH 1P01A 1BITA 3ATIA 3UWJH 1BT7A 1Q2WA 4ABJA 3EAJA 1TGNA 8ESTE 1H8IH 1RTKA 3BG4C 5FCKA 3RM0H 4B74A 1TQ0B 4ZAEA 1FAKH 4MNYA 4GVUA 1O31A 2VVVA 1GJ8B 1G30B 2ODPA 2BY5X 3LGTA 5BPEA 1O2OA 4BAMB 3A80A 2R3UA 3A8CA 1GI3A 2VVUA 1O3NA 1KLIH 3BTKE 1S0RA 3FP8E 4HZHA 1JMOH 1G32B 1HAVA 3A87A 2PW8H 3CP7A 2ZPSA 4CRDA 1TONA 1C5UA 1O5DH 2GD4B 1XKBC 1EJNA 3SGAE 2ZCHP 1GHZA 5DK1A 1GCDA 1OPHB 2CMYA 1TNJA 6GCHF 3E91A 1ZLRA 1AB9C 2CHAB 2XBWA 2UWOA 2Q6GA 3ITIA 3H7TA 1IQKA 2OC8A 2ODQA 4NIYA 3QTVH 1MU8B 1AUTC 2H6MA 3M35A 1BTWA 4ZROA 1EAUA 4CRGA 1AI8H 4RKOB 2BY6X 3RMOH 1A3EH 5GPIB 1SMFE 1VJ9U 5JDUB 2UWLA 1UVOA 5EU8A 3EE0B 5HM9A 2BHGA 2WPLS 4K1EA 2EEKA 4LK4A 2W3IA 3ZZCA 1RS0A 1UK4A 5GWZA 2UUJB 1JXPA 1Q3XA 1UCYE 3WY8A 1SGNE 1ELCA 2Y7XA 1CBWC 5CE1A 1GHXH 3FZZA 2LIZA 2C8XB 2UUYA 2OLGA 2ZGJA 3T25A 2OINA 4K69A 5T6GA 1FQ3A 1YPJH 2GCTC 2VIQA 1GCTB 1O5AB 4XOJA 4JZEH 1AFQC 1J8AA 1GBFA 4BXWA 2NU4E 1HAHH 1MKXK 2PKAA 4IC6A 3D62A 1YCPK 1O35A 1F0TA 3LH3A 3MFJA 2P8OC 1TPSA 4D8NA 1EPTA 4ASHA 1TE0A 1ESAA 1G37A 1KLJH 2ZC9H 4NZLA 5JBCS 1MU6B 1CO7E 4KTCA 4ABEA 2A7HA 2BVSH 4O3TA 1PYTC 4ZHLU 1AZZA 1YPGH 1O2VA 4X2VA 4AFUA 1BA8B 1HCGA 5HYOA 1O2QA 2BD9A 1C2FA 1ELFA 1NRQH 2NWNA 1WOFA 3SZNA 2HPQH 1YKTA 1CGJE 4ABIA 3OY5U 2QXJA 4BAKB 1SGEE 2WUCA 1ORFA 2O8LA 1O2MA 1DY9A 8KME2 3PWCA 4I32A 1NU9A 1WYKA 2R2WU 1YC0A 1P9UA 4IN2A 1C5YB 1GHVH 1YGCH 3T5FH 4Y0YE 4Y8YA 2Z9KA 3TPIZ 4FUJA 4WMFA 1HXEH 1VCWA 1MAXA 3ATLA 1S6HA 3RXOA 3SJ8A 3M61U 2J34A 1DWCH 4FUCA 4NWLA 3SJOA 2ZHDA 1NRRH 3TU7H 3A7WA 3MNXA 3A85A 3BTWE 1ZHPA 1ESBA 4AGKA 1OX1A 2FXRA 1FI8A 1FJSA 1ABJH 2FYQA 1C5RA 1VITH 2BLWA 3S9BA 4XFQA 1AY6H 3SN8A 2A7JA 2BDBA 4UDWH 3T28A 2PLXA 4X6NA 2ZP0H 3P8FA 1L4DA 5AF9H 2A7CA 4CBOA 1VITF 2QIQA 2UWPA 5PTPA 5JPMH 1TBZH 4BTUB 1OKXA 3H5CB 3SI3H 3MNSA 5EOKA 3A8AA 1PJPA 2V3HH 4MLFB 1QBVH 3TK6A 4JZFH 1N6XA 3URDA 2PR3A 3LT3A 2TGDA 4IS5A 1HYLA 1QJ1B 3HATH 3FP6E 4B76A 2UUKB 1LHCH 3SNAA 5F8ZA 3OSYA 4B75A 1O3IA 1AVXA 1O3CA 3R0FA 1F5RA 1GDNA 2SGDE 1IAUA 3NCLA 1MBMA 3B8JA 4CH8B 1TPPA 3E0PB 1QFKH 3F68H 1S0QA 1HNEE 1YLCA 1ANBA 4NGAH 3ZYDA 3GY5A 4Y71A 4B2BA 1C2KA 2M5TA 5DP7A 3A7XA 3SORA 1C4U2 1G3DA 1XX9A 1ZTJA 1TLDA 2C8ZB 3PO1C 2B0FA 1G3EA 5HMAA 3MMGA 1NU7B 1BBRK 2ESTE 2HLCA 2RCEA 3MH7A 1KXBA 1ZTLA 4PROA 5FPYA 1O37A 5HM2A 5DKMA 1UTJA 1C2HA 3ZZ4A 3ZZ7A 1CA0B 2O8WA 2XWAA 2ZCKP 4DW2U 3S9CA 3RU4T 4YZUA 4YLQH 3RXPA 1LPGB 1HAIH 2QN5T 4X2YA 2SGEE 2HNTE 1W3CA 2Z6BD 4K1TA 1ZYOA 1P12E 3DFLA 2CV3A 3P70B 2H2ZA 4AN7A 4Q2KA 4X6PA 1C5SA 1DY8A 1BHXB 2F9UA 1P2MA 3K9XB 3RUOA 1P2NA 1E37B 4X2WA 2A32A 4D9RA 1QRXA 3BF6H 1GHWH 5CHAC 1QGFA 2CJIA 1RTFB 2JETB 3KF2A 5T6FA 1GBLA 1BJUA 3MI4A 3A88A 1AE5A 1D4PB 3NUMA 3OX7U 1DXPA 1O2JA 5B6OA 5FX5A 2G4UA 4JK5A 2BY9X 2H9TH 1AQ7A 4KELA 1LO6A 1JIRA 4E05H 1O2GH 4ISLA 2BLOA 3TK9A 4O3UA 1MBQA 4UEHH 4NSVA 5IDKA 1IQNA 1JIMA 4WXIA 2J9NA 3PMHB 2IN2A 4AB9A 1O3EA 2Z7FE 3ZVAA 1RGQA 3C1KA 3BTFE 3U8TH 1J16A 1FXYA 1GI7B 2TGTA 1TNKA 3RXTA 3A83A 2ZTYA 2P3FH 3RP2A 3DD2H 1G2MA 1UTNA 3I29A 3E6PH 5ETXA 4X1SU 4IMQA 2CGAA 1B7XB 2A2QH 1UTLM 4O97A 3KNXA 1C1QA 5DP6A 3K6YA 6GCHG 4OS7A 1A7SA 1NFWA 1O3OA 1UTOA 1EZXC 2ZZUH 4CH2B 1O32A 3PROA 4ZKRU 2VH6A 2ZFSA 1GJDB 1YPEH 2ZDVH 1ACBE 5C20A 1ZOMA 2A5AA 1O5GH 2XC4A 1DWDH 1TWXB 1BTHH 1TOMH 1C9PA 5T6DA 3RXEA 1MCVA 2O8MA 3IWMA 4XDEA 2V35A 2GT8A 2QGRA 1PPCE 1QRZA 3CS7A 1Y3WA 4K8YA 3K6ZA 2G4TA 2ZG0H 4UFGH 1CT2E 3GISB 2GV7A 1LVMA 3K65B 1MZAA 1SQOA 3UOPA 1ZSJA 1YCPH 1K1NA 3LC3A 1P11E 4CRAA 1BQYA 1ZSKA 4ZKOU 1A4WH 3RXGA 1TRNA 2GZ9A 4UE7H 3S7HB 4MQAA 4TPIZ 3TVJB 4Z6AH 1KXFA 4FUBA 4X6MA 3RXJA 2RDLA 2Z9IA 4FVBA 2ZIQH 3LJOA 1P05A 1A0LA 1A5GH 1IQEA 3ENSB 3BIVH 1RJXB 1DITH 1P2IA 1XKAC 1Y5BT 3I77A 1SOTA 1V2TT 1GBKA 1HJAC 2GTBA 4CR5A 1H1BA 2QV1A 4FU8A 3SQHE 2BD5A 1NRPH 4E7RG 2R3YA 2GZ8A 4X8UH 4AGJA 1O39A 3P8GA 3ZZ3A 2G51A 4AFZA 3JZ2B 1C2EA 1N6YA 5K7RA 2QXIA 2ZQ2A 2R0KA 3MH6A 4R8TB 5E2PA 1VR1H 1MTNC 2BDGA 5SGAE 1SQTA 1IQMA 1SR5C 1ETTH 1EPTC 1ZMJA 1EX3A 4MG3A 4Y0ZE 1QHRB 5AFZH 5ESTE 2J92A 4THNH 2ZFRH 1AWFH 1D9IA 3UR6A 3SU0A 1P8VC 3QDZB 1GVKB 1LHEH 4LZ1H 1WSSH 1A46H 1P2KA 2ANMH 1BUIA 1BDAA 2VGCB 1L2EA 1NFYA 1QB6A 1O3PB 2A4OA 1CT0E 1ZJKA 2P94A 3VB5A 2BY7X 1UK3A 1TMBH 2FX4A 1O2RA 2AS9A 1MKWH 2THFB 3TJUA 3CS0A 5GXPA 1BTXA 2BD2A 3RU4D 1GHYH 3TGIE 1D3PB 2HNTC 4BNRA 1SGCA 1FIWA 1TGBA 4ISHH 4JYUH 3A81A 3GICB 2HNTF 4FUHA 4IN1A 3IITA 1BTZA 4VGCB 1OWIA 1MH0A 3S7KB 3GCHB 3L33A 1PPBH 3KCGH 2H5DA 3PLPA 3E3TA 4ZH8A 5F6MA 3A7TA 2FTMA 1H4WA 4MTBA 5GDSH 4YOGA 1OWDA 2WYJA 4Q7XA 1GI5A 4DJZB 3GY7A 1GMCF 1UO6A 3V3MA 1XXDA 2FS9A 1RD3B 5FAHA 1CSOE 2DE8A 4FUGA 1WQSA 4U01A 1QCPA 4D76A 2XBVA 2YNBA 3GCTG 5C5OA 1SB1H 1V2MT 2A2XH 2TGPZ 5EGMA 1JRSA 2ILNA 5JBBS 3VB4A 1UJ1A 3VB7A 1QB1A 2Z9JA 2ZDLA 1T8MA 3EYDA 2BB4A 3A82A 1VITG 1GI8B 5G4BA 1O33A 4WMDA 1CT4E 1PQ8A 3RXVA 2Y81A 2QF3A 2AGIX 2ZU3A 1O34A 1W14U 1GI9B 3BEIB 2VWNA 4I8GA 4U2WA 5DP9A 2TGAA 5GCHF 1H9LB 2PTNA 2FO9A 1MTUA 3BG8A 5A0AE 4TWWA 1J9CH 2AEIH 1GBEA 1GBAA 2W3KA 3BSQA 6CHAB 1BBRH 3ZV9A 1P10A 3DHKH 1E0FD 2Y82A 2IJOB 4KTUA 1HAYB 4YO9A 2A31A 2J94A 5F03A 5A8YA 3SV6A 5F8XA 2OC1A 3LIWA 1K28D 2IPHA 2DE9A 3A7YA 4DT7B 3SHCH 2WV5A 4B2AA 1ANEA 3E90B 1YF4A 1OXGA 1SOZA 3LGWA 4MNVA 2FS8A 2ZTXA 2FM2A 3LU9B 1ZMLA 3M7QA 1IQLA 1A3BH 1LQDB 1GL1A 4H42U 1YYY1 1NRSH 2ZU1A 1HIAB 1FY8E 1K1JA 5FXLA 5EQQA 4CHAC 1SLUB 1TB6H 3TJOA 1AKSB 3STIA 4ABFA 1WV7H 3DFJA 1GJAB 3FZDA 3CENA 1IOEA 1EASA 3S69A 3MHWU 4CRCA 1GPZA 1QBNA 1WU1A 4A6LA 4U32A 1PPZA 3NPSA 2V3OH 1TOCB 1UCYK 3ZZAA 1ID5H 2ZQ1A 1GBJA 5K0HA 3O8RA 1G3CA 4I33A 2BDIA 1ABIH 1TPOA 2JH0D 4ISIH 3UNQA 4DOQA 3UUZA 3Q00A 1HAVB 3MOCA 1MTWA 1QR3E 2ZEBA 1QL7A 1VZQH 1GG6C 1O2YA 3BTDE 4Q80A 1O3LA 3UTUH 4X8SH 2C4FH 2BY8X 1Z8GA 3RC4A 1NT1A 2CF8H 1MMJN 1QRWA 4GHTA 1XUJA 1BHXF 1GWAA 1UVPA 3E16B 2AERH 1S85A 4GLYA 1IQFA 4Q7ZA 1C5LH 1O2KA 9ESTA 3MH4A 3G01A 3HK3B 4NIXA 2AMPA 1GDUA 1ZGIA 4GCHF 4X1RU 4CR9A 3M7TA 4XBCA 1SPJA 3RXLA 2SGAA 1QB9A 4MDSA 2ZFQH 2WUBA 4JCNA 3ZZBA 3MU1A 3RXRA 2GVFA 3C27B 3SJ9A 4YM9A 1GBIA 2ZDNA 3AAVA 3KHVA 2EI8A 3KQEA 1BB0B 1ZJDA 5A8XA 3LDXH 1EOLA 1TA2A 1TRYA 2G81E 4MPUA 1EAIA 4X1QU 1GBMA 4JYTA 1KTTB 2W7SA 1NN6A 1IQIA 1SI5H 2XRCA 3Q77A 2A45B 1YPKH 3BV9B 4A7IB 1GGDC 2H5CA 1W11U 1O3JA 2ANWA 2PSXA 4I8JA 1MZDA 3NKKA 1O2NA 1TIOA 1F5KU