2BX7A

Crystal structure of l. lactis dihydroorotate dehydrogense a in complex with 3,5-dihydroxybenzoate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of Benzoate Pyrimidine Analogues with Class 1A Dihydroorotate Dehydrogenase from Lactococcus Lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE
total genus 116
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2bx7A02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2bx7A01
1EEPA 1TPB1 1YTEA 2DZTA 2XN2A 4FF7A 5HWJA 1L9WA 4WXZA 3THAA 3NEVA 2X1RA 4X22A 1VH7A 1W37A 3D0CA 1OX6A 2TSYA 5I3HA 1LRTA 2E5DA 2FJKA 3HJZA 1M7OA 1XBVA 1PHQA 2B4GA 5AC7A 2VELA 1DQXA 2NV2A 2B7NA 3UZJA 4GC4A 5G4EA 3GB6A 2ZA3A 3HQ1A 3G1YA 2WNZA 2Y7DA 5K7JA 2ZZ7A 1UCWA 4I7WA 1KM0A 4UTLA 5LZLA 3W7KA 1TPDA 3DHDA 1ME8A 4MVAA 1YXYA 2X16A 3LHUA 3MMTA 4MLRA 3DGRA 5FEWA 5AN7A 3UNDA 2DP3A 2ABAA 1QAPA 4PL2A 3TW6A 1BWLA 4OHQA 4POCA 3LCIA 3TJLA 7TIMA 3T7VA 1FDJA 3WJYA 4HPJA 3TW7A 4WY0F 1WBHA 3BPWA 1TQJA 3KFTA 3BG3A 4E2BA 3RK8A 3AJXA 3GXTA 4ZQOA 2G5WA 1KTBA 1PVNA 1K8XA 5FEXA 1VPXA 3M5VA 3FJLA 2ZRZA 3C2RA 2RDTA 4BFAA 1RQHA 1WBJA 1OX5A 2QJHA 3MP3A 3W6YA 1I2QA 4GUIA 1VCGA 1IGSA 1ZENA 3QFEA 4O18A 4UTIA 4HSOA 4M5PA 2CZ5A 4O1DA 3WJWA 2ISVA 1YXDA 3W1PA 3JR2A 4I7UA 1ZCOA 2X1TA 1XCFA 3P7YA 4CLMA 2DZVA 2OMAA 3TH6A 1LRQA 3NXFA 3LCFA 1TIMA 4UMBA 3CIXA 4MLJA 1YDVA 4WY0A 1OVDA 1N8FA 3W7RA 1LOLA 2UV8G 3W74A 2XN1A 2EHHA 4MZYA 3FYOA 5DCDA 4HT3A 2ZZ4A 1ZNNA 1SZEA 2AGKA 4HHPA 3TFCA 3CEUA 3TK7A 2WKJA 3NOEA 4O14A 3IVUA 1FDZA 2CLOA 1PS9A 3TR2A 1W3TA 4NXKA 3PSWA 2VFIA 3GXPA 1JR1A 4LUIA 1RQEA 4YCPA 1HFBA 2FPYA 4X3ZA 2ZYFA 2A2IA 1JCYA 2D73A 4XTDA 3VE9A 3B0UX 2GUUA 4DF0A 3CC1A 3C61A 2NWRA 1B4EA 4LU0A 2C3ZA 3PWAA 1OYBA 5AOUA 3MWAA 4QNWA 4PTNA 2E77A 4PODA 3TQVA 5CZTA 3MI2A 2NUXA 4RZ4A 4FNRA 4GUFA 3TIMA 1VQTA 5K9DA 3P8IA 1OABA 1P0NA 4RV8A 1EPXA 1KFBA 3G1XA 4UNLA 1TQXA 2NX1A 1JUBA 5CZJA 5AYXA 3GXNA 3L65A 3DZ1A 2AQWA 4OWGA 4JTIA 2C16A 4H3DA 3W7GA 8TIMA 5AC6A 3WK2A 1NAL1 1W8SA 1G6CA 1XDMA 3LRKA 4JTSA 1XUUA 5LNVA 2A1YA 3LDVA 4O15A 2VFEA 4UMAA 1OX4A 4KFPA 2QCEA 2QR6A 3PSVA 3E96A 4QQ3A 1H7RA 3NQGA 1I4NA 3QW4B 3R89A 3LXCA 5SWUA 2V30A 5HUPA 1K02A 1K7EA 1BTMA 3L66A 4UTKA 4OGZA 2BXVA 5DXYA 2DZSA 1W0MA 2E09A 2TYSA 2GVLA 3W1NA 4ZQCA 1FCQA 4FNQA 2W79A 3UWZA 3KRUA 3HG4A 3NYZA 4OQVA 5AB3A 2A5HA 3Q58A 5HUOA 4UTUA 4LW7A 4DO6A 3QM3A 5F2IA 1EUAA 1DOSA 3NR0A 3KX6A 3NL2A 1BEUA 3LV6A 1H7PA 2DJXA 1WV2A 3W7NA 3ZR4A 6TIMA 5D2YA 1JVNA 5DBUA 1WAUA 5HR7A 2Y63A 2Y70A 3PUDA 1ZAIA 2Y89A 4MFDA 3W1MA 2Z2UA 1WXJA 2Q3RA 4LVAA 3EXSA 1L6SA 3L0GA 2J9ZA 1SUXA 1TPC1 1RR2A 1KA9F 4M19A 4GUHA 2Y7FA 4MPQA 4HNTA 2ZCGA 3PBWA 3B04A 3P82A 2FPTA 3W1TA 2EGZA 2Q8LA 3BGGA 3W2KA 3CIWA 3TXVA 5FI8A 1F2JA 1QCWA 3W7CA 1W5MA 3LTPA 3W71A 1LZOA 1XI3A 3E49A 3FKKA 5F2LA 3TDFA 1I2NA 4YLWA 4PH6A 4O10A 1X7FA 3G3MA 3I7SA 3KVMA 3SECA 4L4LA 4ZQRA 1T8XA 5DY3A 5D37A 1LM1A 4NZFA 4WQ6A 1ZY9A 3DKLA 1H51A 4P61A 4DBEA 2ZRXA 4LVDA 4Z1AA 4DXVA 2P10A 1U5JA 3G0XA 4KFOA 1PCKA 4CCEA 4JTGA 2OT1A 3W7MA 3RMJA 2NX9A 1DL3A 4IJBA 2Y88A 4K37A 5I3KA 3OEXA 1IXQA 4Y8FA 2QAFA 4LVBA 4LVFA 3FS2A 2QCLA 1SFJA 1OFPA 3PBUA 2ZTKA 1TRDA 3BV4A 3L5MA 4AH7A 2PRLA 1EB3A 1HUVA 5BOOA 3TNOA 4EIVA 2BX7A 1YLVA 1NF7A 3OVQA 3CPRA 1G4PA 4TMCA 3S1XA 1ZAHA 3A24A 4A22A 3TROA 2E5BA 1RZMA 4CQAA 3KRSA 3LX9A 4AAJA 1FWNA 5HQEA 4IPJA 1EA0A 3NQAA 5F4XA 2TMDA 2R94A 4JY8A 3GDKA 3O07A 4DO5A 1DKWA 5HWNA 5H2ZA 3TQ0A 1FCVA 3NNTA 2ZA1A 1G4SA 4IMDA 1M7PA 4M6QA 1EIXA 2NXHA 2JKPA 1AW5A 3QPYA 2RHGA 5H91A 1XM3A 3A21A 3GDTA 2ATMA 2A6LA 2DZPA 2E5CA 4O1BA 3NL6A 1IXOA 1KM5A 4AHOA 5DELA 3Q2DA 1TB3A 3INPA 1VHNA 1HG3A 4ZL1A 4UMCA 3A22A 5K9CA 4JTFA 1A53A 1VR6A 1DORA 4WY0B 3EWZA 3MO7A 4DEFA 1GG0A 4WOZA 1T0OA 3WK1A 1LTDA 4I9AA 5D2TA 3BARA 3BVJA 4N6FA 3G0SA 3DHFA 4MFEA 4BF9A 1H50A 1O95A 1XBZA 4LOCA 1E51A 2VFDA 3EXRA 4HSNA 4DPQA 3N2XA 2XFWA 3I7QA 3MI6A 1XUZA 4M7TA 4J9JA 1LBFA 2Z6IA 2B7PA 4IQLA 1GWJA 2H3DA 3LHZA 3NG3A 5LNWA 3O8AA 2ZRVA 4AWTA 3KRZA 1SSDA 1H7NA 3FIGA 3MW7A 5CZ0A 2CLKA 4HIBA 3W1QA 4Z0JA 3W1RA 3IIOA 1ZJIA 3F1QA 1TMHA 3P84A 1HO1A 3PC0A 3V1PA 3W7HA 5D38A 3JS3A 4LY8A 3NPXA 4K38A 1V7YA 4JXCA 1QR7A 3YPIA 4RXGA 4IX2A 3NM3A 2EAWA 3TKFA 1ICPA 5HR6A 3A23A 3ZWSA 2H6RA 1RV8A 2E1DA 1TV5A 3LLDA 3C2OA 1F73A 1FXQA 3FLUA 2O7SA 2JBMA 4O1AA 1I8JA 1EWEA 5CG7A 1YXCA 3W76A 5HINA 3E0IA 4BI5A 4JTHA 1DHPA 2DZWA 3W7OA 1TO3A 4ORIA 4JGDA 3F03K 3I7RA 1TPH1 3P5ZA 4GUGA 3C6CA 4NUWA 3STEA 3LCHA 4QNEA 4Z1CA 2QEZA 3N9RA 4JNMA 5CPMA 3M0ZA 3TAKA 4JIPA 4NJJA 1R2SA 2ZZ5A 4JEQA 3W9ZA 2R91A 5T26A 1LROA 4NU7A 1FBAA 3GDRA 4EWND 1ZHAA 4MOZA 4LC8A 2YZRA 3S5ZA 2CZFA 4PA8A 1XDLA 3HGOA 2E6DA 1SZNA 5AC8A 3NQ8A 3NQ6A 2Q3OA 3NPVA 3QC3A 1XXXA 3HMJG 1W31A 4MKNA 3NQDA 3KAOA 1TJRA 2V2HA 4BK9A 3O15A 1W5OA 4A21A 3TCEA 1TTPA 4FHAA 5LNRA 3NZ1A 2YX0A 5K2ZA 1A5AA 3MJYA 2GPTA 1X1ZA 1AG1O 1Z42A 2J6XA 2JGQA 2FTPA 2GVJA 3IIZA 4Z1BA 1QDSA 3G1AA 3OVPA 1A5CA 5D02A 5CZSA 1J5TA 5HNRA 1GPWA 4GXMA 4N4QA 5BMWA 4FX6M 5F2MA 3TQKA 3QSTA 2GJNA 3N9SA 3W88A 3O6YX 4O50A 1ME9A 1RVGA 3IRDA 1GYLA 4O0ZA 2BLEA 3EXTA 5CGQA 1P5BA 4A2SA 1QWGA 2YSWA 2QCCA 3N2MA 3THQA 5FF7A 1C29A 2WQPA 3M16A 3M5XA 2GVGA 3VE7A 4AWUA 3BW4A 5GVJA 4MJZA 3IVSA 1KV8A 2CW6A 4HNUA 1KM3A 5AHMA 4Q32A 3EWXA 1JCNA 4JTLA 5BMXA 5C55A 3PUOA 3KXQA 4UXDA 1YDNA 4YL2A 3G8EA 1TV8A 1EP1A 2WSRA 4RJEA 3LM7A 1Q45A 4BI7A 1VCFA 2ZQ0A 1P0KA 1OYCA 1QO2A 1WQ5A 3PS7A 2PRHA 2BSLA 4AXKA 4OT7A 5F4WA 3GAYA 5I3JA 1K3UA 5IBXC 3N19B 5CKSA 4X9SA 3T44A 4WJEA 2VEPA 3ABQA 3LERA 4IXHA 1FUYA 1FY6A 4N9DA 3HIJA 4XBSA 5BRBA 3TC6A 3FOKA 5G5IA 1YTDA 2DZXA 3G3DA 3F4NA 4O8RA 3CB8A 1LP6A 4N02A 1ME7A 3S6DA 1IF2A 3BGJA 4TU1A 3FEMA 2FFCA 1A5BA 2YXGA 3L21A 3PB2A 4RZ5A 5AHNA 2VC6A 1DBTA 2VFGA 4JX5A 1O5KA 4IPIA 1VYSX 3UYCA 3W1XA 4XTIA 3E02A 5LHEA 3W2MA 4Y90A 1VYRA 5FEPA 2C13A 4FX8A 4UCGA 2YW4A 3W1UA 1IXNA 1OF6A 1PIIA 1KBIA 4GWEA 1QOQA 5F1VA 3W84A 4TX9A 1W54A 1VZWA 1Z44A 1OX4B 1QPOA 1H7XA 4PEKA 3P61A 1LLZA 1OJXA 3UPWA 1MEWA 3L0NA 4UTTA 3W2LA 1R2TA 4LVGA 3M9YA 4MUZA 2P0OA 5DCEA 2CLIA 3E12A 3OHIA 3PB0A 3S1UA 2E68A 4JR5A 3S5YA 3LI0A 3W83A 4N9BA 5K3VA 1W5NA 2FLIA 3VI2A 2C6QA 1YPIA 1NVMA 3LRMA 5CPOA 2TRSA 1D3GA 1C8VA 2OZ0A 4U28A 3IIVA 3NVTA 2YGYA 4DQWA 3CWOX 3B4UA 3C4UA 4BWLC 5D2VA 1GTHA 4LS0A 4EOUA 2DJLA 3RLUA 5MHBA 3NQVA 1TREA 4JIQA 4LV4A 3HOJA 3UWUA 4DF2A 1SZGA 4OBTA 4GJ1A 2A6NA 3QH2A 5HULA 4BWLA 3G24A 4NQ1A 4CQ8A 3CQ0A 1S5WA 2AAMA 3LLFA 3HG3A 3G8RA 4UNKA 5C5YA 5DCBA 1GVOA 2YR1A 3CU2A 1Q6LA 4M7SA 3L67A 1OHLA 3NPUA 3MHFA 1KBJA 3N14A 2TPSA 3OVRA 2J24A 2YYTA 3W7DA 1JCLA 2WPBA 4Y96A 3W07A 2Q8ZA 2VENA 3GLCA 1QO5A 4JX4A 1QNVA 2DZUA 5C2XA 1TPEA 3LRLA 4FXSA 2JKEA 2VXNA 1VGAA 1K7FA 3B05A 4UTWA 3U6WA 3N34A 5ABTA 3Q94A 2ZFAA 5CPLA 4HPXA 3W72A 3STGA 1VYPX 1O94A 3WJZA 1AW1A 1J4EA 3GYEA 1KFCA 4GFSA 4KWWA 3ZFHA 3DENA 4IUOA 2WO5A 3PUEA 1S5TA 4YWIA 2A7RA 2KZHA 2G95A 4YXGA 1XKYA 5K4XA 1Z41A 1FXPA 4GNJA 2QCMA 3UWQA 3S9YA 4UFLA 4JTTA 4UTJA 3RNDA 3MHUA 1DJQA 3E9AA 2C18A 1QMLA 3P81A 4AWSA 3DKJA 3IGUA 3FJ6A 4RZ6A 1LCOA 3MI3A 4NX5A 1L6WA 3MYPA 4MY9A 3LGEA 3W1LA 3TAOA 4A29A 3EWBX 4QISA 4B5NA 3LOTA 3MBDA 1UUMA 3UY8A 2CLMA 5KZDA 1KM1A 4IMFA 1ADOA 3A9IA 3P74A 5IM51 3NL3A 4D2JA 2I9EA 2RH9A 3GDLA 3TU9A 5DLCA 1R2RA 2B7OA 2VEMA 3KVLA 4MZ1A 2Y7EA 1P1XA 4UFIA 3S5OA 4M6PA 1A5SA 5E0KA 1Q6QA 4QAIA 4ICNA 4UR8A 1XC4A 1I2OA 2OJPA 3NQFA 1M6JA 1G4EA 1RPXA 5D30A 1D3HA 2ZBTA 3C2EA 1GVSA 4Y6GA 4Q4KA 3O16A 5KZMA 3TFXA 2ZA2A 4K39A 1F05A 2WSQA 3H53A 3GZ3A 1F7BA 3M41A 3SGZA 4RXFA 1X8FA 2FB3A 1AW2A 5EA9A 2V81A 5CPNA 1R30A 1KTCA 4IMEA 3S5NA 3W2NA 5K4ZA 2QUUA 4CNNA 2YFNA 4K36A 1SW7A 5L6UA 1KFKA 1KTNA 4AB4A 2A4AA 2QCGA 3LHYA 1F76A 3CEPA 4BR1A 3GNDA 2I1OA 3UY7A 3LXAA 3GK0A 3B8DA 4U4MA 3VFLA 1FWWA 3SJ3A 5LGXA 1WYIA 1SSGA 1LLWA 4QSHA 4RKAA 4UFKA 2C1HA 4FX7A 4ALDA 3N3MA 3QMRA 1OK4A 3JRKA 1KFJA 1GG1A 1KV5A 1SR9A 1SQ7A 1PL9A 3LB0A 3C3NA 3G1FA 3IIPA 3HG5A 1G69A 1JUKA 2P1FA 3O06A 1R46A 3EWWA 1L2UA 2JGYA 3KHJA 2ZRYA 3DFNA 2BWGA 1K8ZA 1WOAA 1OFDA 2H3BA 2H90A 1S3HA 3LCXA 5D32A 3USBA 2NWSA 2HSAA 2A0NA 1IIHA 1C9DA 1FX6A 2CLFA 4OE7A 4UFHA 1WA3A 3C2VA 2X2GA 4LC6A 1OF8A 2GQAA 2JKAA 3BLIA 3RF9A 3M1ZA 2FDSA 3C56A 3O6DA 3EX2A 4WX2A 4JTEA 3NO5A 3WJXA 4DPPA 5E93A 3R13A 4NNBA 1LBMA 3ELFA 2WV8A 1H61A 5EYWA 1F5ZA 4K8HA 3W22A 1ML1A 2QF7A 3GKFA 5U4NA 4MZ8A 2DORA 1AL7A 4AF0A 2C14A 1TPFA 2ZZ2A 4E0CA 4YCOA 5EBUA 4YMZA 2V2CA 3GIYA 4RR4A 4RK8A 2RDWA 5G1YA 3M47A 3W7EA 5AHEA 5HWMA 5EL1A 2FPVA 4ORMA 4PCFA 4PL1A 4LNYA 3VKJA 1TV7A 2J9YA 3DI1A 3H55A 1GVQA 1PHWA 4O12A 4MY1A 3AO0A 2ZZ3A 1CX9A 4JDBA 3SR7A 1MEHA 3NL5A 4HKPA 1SO4A 4GUJA 3C52A 3BG5A 3UPBA 1W5QA 5TQLA 5KITA 4UTHA 3QYQA 4NJGA 2EPHA 4CCCA 3BLFA 1A50A 1IIGA 3G1HA 4XZ9A 5EKYA 2NUWA 4FIQA 1T96A 4JYEA 4MY8A 5EY5A 4O13A 3STFA 4XUGA 3NA8A 4FO4A 5FESA 1NSJA 4DO4A 3DXIA 1GOXA 1FWTA 1UJPA 4JYDA 1FWRA 2Y7GA 5EMUA 2ZRUA 4A3UA 1EUNA 4WUIA 4NJIA 1OFRA 3PF3A 3P60A 5KMYA 3WK0A 3RFAA 3G1SA 3O63A 4FNUA 4RLIA 4JS3A 5F4SA 1KLYA 4IGHA 5KZEA 1JCMP 1KFEA 3HG2A 1F6KA 5G4WA 2PC4A 3I65A 3IV3A 4S1FA 4C1LA 3A5FA 4PFMA 1Y0EA 1G4TA 3CWNA 3WFAA 4O0KA 1BWKA 2OX1A 1XBYA 4HNVA 1K7XA 1LBLA 4XKYA 4X2RA 5LKYA 4K8EA 1UBSA 4JTUA 1I45A 1WDWA 4NJHA 4NNAA 4WD0A 3S8HA 1QPRA 2Y6ZA 1GZGA 4NXSA 4K7YA 2NLIA 1YPFA 3FA5A 4O28A 3QQ1A 1K8YA 2I14A 4DBDA 4ADSA 3EX4A 1OFBA 3T55A 1OFQA 3SIZA 2A85A 3HBLA 1GTEA 1SZFA 4EF9A 3W2UA 1DV7A 4AHQA 4GRSA 3TA6A 2QCDA 1LOSA 1H5YA 3UWVA 2F7FA 1GVFA 3W86A 2Z6JA 4QJ1A 5D05A 3U8GA 2FQIA 3QF0A 3B0VC 5AYZA 2OCZA 1H1YA 3EWYA 3ATZA 3GDMA 1QPQA 3NQMA 4ZQPA 3G1VA 5A8GA 1YADA 3F4WA 2RDUA 3MUXA 1KLZA 3GNNA 4ZMGA 3B0PA 3W87A 2WOQA 1SFLA 4FEZA 3R12A 2YW3A 3EX1A 4FB7A 4QITA 3FYPA 3S1WA 1O4UA 5HJLA 2QCNA 2R8WA 5KINA 2EF9A 4XWUA 2QCDB 4JTKA 1OFAA 2ABBA 4R53A 2Y62A 3L9CA 1DQWA 3LCLA 3S42A 3STCA 3NQCA 2W0UA 1Q6OA 4LS1A 3TSMA 1L6YA 3QJAA 4LRTA 3TSDA 3DFSA 3VNDA 3C8FA 1G7VA 1NFBA 2QJIA 4O16A 3TJXA 1G7UA 3NQ7A 1VLIA 3UXDA 3WJSA 3NPWA 1IXPA 3EKZA 2Y85A 1AL8A 1W5PA 5C54A 3UD6A 4UIOA 1LRNA 3ABRA 2YDAA 3DFTA 2RFGA 3G22A 1SW3A 4DELA 2VEIA 4KFNA 3GR8A 2YCEA 2F84A 2CU0A 4LS2A 3TE9A 4JDYA 3DH7A 1TRIA 3LHVA 1H60A 2VFFA 3LTSA 3HO8A 4JX6A 3W70A 2PCQA 2WSYA 1Q6RA 3O1NA 3MP4A 3ANYA 2O7QA 3T40A 3C2FA 1W3NA 4ZQMA 5J5DA 4R7JA 4Q33A 1KM4A 1PCWA 1GYNA 1Q3NA 4WZHA 3IIXA 2FIQA 1S5VA 4IXXA 4DF1A 3O6CA 4O17A 3P5YA 2CLHA 1N55A 3HPSA 3DFPA 3ZS4A 5LNUA 1GT8A 3OA3A 1EX5A 3I68A 3BLEA 3TXZA 1LORA 4RCXA 4JTJA 4R34A 4XKYB 1P4CA 2E6YA 5CSRA 5TIMA 3MBFA 2VKZG 4R33A 2QUTA 5AFDA 5LHFA 3L0KA 5FEZA 4Y9AA 2JK2A 4EVZA 3GX9A 5FF2A 3M43A 3SI9A 3EB2A 5F1UA 4LV9A 1D9EA 4G1KA 1HL2A 3GAKA 2QDHA 1JCXA 1XBXA 5FF0A 4CNPA 5KSWA 1AK5A 3W85A 3MP5A 1X1OA 3QPZA 1CW2A 5U7SA 5CSSA 1THFD 3PG9A 1MSSA 3KVJA 2ZZ6A 1B3OA 4HN4A 1GEQA 1G67A 4QM1A 1I2PA 3PBYA 2H8ZA 4UFJA 4UR7A 3T4CA 4O53A 2J27A 5J5RA 3M6YA 1SU5A 3V75A 1TYGA 3MYOA 2FB2A 2YPIA 5D09A 3QZEA 4IMGA 3LCGA 4LRSA 3W75A 3KOFA 3MHGA 3SW6A 3ZWTA 1HTIA 1I2RA 4JYFA 3DU0A 4E2DA 1TSIA 1W1ZA 4RX0A 5I3GA 1HO4A 1SO3A 1KM2A 5AHIA 3I6RA 4UTWC 3IGSA 2QKFA 3B06A 3PULA 3QRHA 4NX0A 2NX3A 2C15A 4TR9A 2X1SA 1UASA 3PY2A 3BW3A 2A7PA 3DBPA 1KFLA 3IVTA 1TPVA 5LSMA 1EP3A 3QEZA 5I3IA 2X30A 5FF3A 4A2RA 2Z1BA 1RD5A 3LBCA 1F74A 3QW3A 4N9CA 2WNNA 3W7IA 5EPDA 1SW0A 1U83A 3SGUA 4NJKA 3BO9A 3OIXA 4JY9A 2GJLA 2V9DA 3L5LA 5G2WA 4ADTA 2IQTA 4MIMA 2ZTJA 4S2CA 4ZZ9A 1QFEA 5DBTA 1M5WA 4UFMA 2V5LA 3W7PA 4M6VA 3PBVA 4ML9A 2VFHA 1AMKA 2ZZ1A 3L2IA 4MJMA 2J88A 3LV5A 2CFFA 3ATYA 2NZLA 4JD4A 4FIRA 3GVGA 3TMLA 5AHLA 1H7WA 4O4WA 3Q37A 1LYXA 1QPNA 1JUEA 3OG3A 2QUVA 3NDOA 4O57A 4OV9A 1W56A 3W2JA 1N7KA 3L5AA 3N73A 4LT9A 4W9TA 3LCWA 5D03A 5LGZA 3P80A 1QOPA 2Z0IA 4UTTC 4N6EA 1ZALA 4GBUA 2QCHA 3RLVA 3IGXA 3PR2A 5L9FA 1V5XA 1TCDA 1ZFJA 3M7WA 2BZNA 4S2BA 2V2DA 2ZRWA 2XN0A 4K6AA 3EEGA 5BNKA 2VEKA 4JICA 4UTMA 3ABOA 4N9EA 5A5WA 1VHCA 3QSRA 1TPUA 3GKAA 3R2GA 1RQBA 1FCUA 4MYXA 3GR7A 2CLEA 3M44A 1NF0A 1MZHA 3L68A 3PG8A 3DFOA 5D2WA 5E1QA 3W7JA 4UC5A 1MO0A 4HNNA 1O5XA 3G1DA 1B9BA 4Z0SA 1GVRA 3PAJA 2B7QA 4FNPA 3P62A 2YYUA 4XBKA 2E6FA 3UWYA 3H54A 2C19A 3TUUA 3LI1A 2G97A 5AYYA 3HF3A 3HGJA 3LTYA 1Z48A 1T99A 2PE4A 3EX3A 4OV4A 1JQVA 1TTJA 2Y61A 1K03A 4O54A 4FNTA 3SFKA 3HPZA 3S1VA 2HTMA 4BI6A 1R47A 1ICQA 2B0MA 1PV8A 1FDYA 3QQ0A 4I7VA 2HS6A 1TTQA 3W7QA 2V82A 1OK6A 4LUJA 1TPWA 1JJKA 6ALDA 2ATSA 3NQEA 2WNQA 2HMCA 5DN1A 3NM1A 3R5EA 3FFSA 4JN6A 2EKCA 3NAVA 3UZ5A 4CNOA 1H62A 3DAQA 2CWNA 4L4MA 1JRBA 1FQ0A 1TTIA 1VS1A 4N2YA 2V0TA 1SPQA 4NNCA 4C1KA 3O05A 4LTSA 3FKRA 3G0UA 1GJPA 4K7VA 5D2XA 3W7LA 2NXIA 5D33A 1FCBA 3SY5A 5FF4A 4IX0A 2VOMA 1OFOA 2HS8A 5LNSA 4E38A 2J9XA 3CLMA 2OT0A 2RKXA 4IWWA 2PURA 2NV1A 4P2VA 3TC7A 3IEBA 1EP2A 4AMAA 3P8JA 1KM6A 2DU2A 4Z08A 1VCVA 4NT0A 4AHPA 3NZRA 5G1TA 4AEOA 3SSJA 3M5ZA 1MEIA 2E6AA 3W3OA 4AVFA 3OBKA 2NUYA 4IOTA 4O4VA 3CHVA 4WOQA 2ALDA 4ZVJA 3PVFA 1VC4A 4AF0B 3U2OA 2C0AA 1NEYA 3QMSA 4ADUA 3HB9A 1DVJA 3C0JA 4NVTA 4O19A 4N4PA 2NXGA 2ISWA 2BTMA 3WK3A 2CLLA 5KTLA 3DI0A 3PM6A 3KVKA 1LDCA 2W6RA 3TV8A 3NGJA 4NZJA 1OG0A 1H63A 1BKSA 2PRMA 1LOQA 4TMBA 1UB3A 3HGSA 4PC8A 2A21A 1F6PA 1SO6A 3TX9A 4IMCA 1ONRA 3RU6A 3QMTA 1FWSA 1J2WA 3S0CA 5AHFA 1YTKA 3NQ2A 4TO8A 1JULA 4KWVA 4WXYA 3LHTA 3LXBA 4OU1A 1JQXA 2LLEA 2QDGA 5IBXA 1H7OA 1KW1A 1OFEA 5BW6A 1YDOA 4ONVA 3W23A 4Z1DA 3VCRA 1MXSA 3A5VA 4O52A 2V5BA 3UQNA 3BW2A 3R8RA 4H4IA 3W73A 4GE8A 2CZDA 2ZDRA 1B57A 3TMQA 2QJGA 5DXXA 4FXRA 2GQ9A 4MYAA 5G2HA 3EX6A 2CZEA 5C6MA 5HMSA 1YYAA 1XFBA 1SO5A 1ZAJA 1DJNA 4XQ6A 3K30A 1O60A 1W3IA 5K9XA 1JCJA 3HPXA 3DFQA 1B4KA 1X6UA 3P67A 4TIMA 3ABSA 1TJPA 1H1ZA 5D04C 3W1AA 2QCFA 1ICSA 1ALDA 1WX0A 4ZQNA 1VLWA 2QAPA 3G18A 1XL9A 2X1UA 3BK0A 1OYAA 4LWWA 4UUIA 4CCDA 3SZ8A 2ISSA 3UWWA 2H8XA 5I3FA 1UUOA 2A7NA 4KKXA 3EWUA 2R14A 4QIUA 1GQNA 3T78A 4FNSA 2G96A 3UXAA 2GQ8A 1WOBA 1PE1A 3EKLA 3M5YA 1VRDA 3CM4A 1JRCA 3CT7A 3LHWA 2WJZA 3B03A 3HGRA 2YFOA 5G2IA 5F2GA 4O1CA 4EF8A 1VJIA 1EWDA 2V8ZA 3BG9A 2GOUA 4O11A 4H6KA 3TSBA 5DY2A 4CQ9A 1CI1A 3LBMA 3CTLA 5TBOA
chains in the Genus database with same CATH superfamily
4U33A 1NU5A 4LUTB 2DZTA 1E1FA 3VMPA 1P6WA 4X22A 1EHNA 2Z2BA 1ODUA 1W37A 3QHNA 1ZBVA 2D24A 5AECA 2FJKA 1OQFA 3MSGA 1UA7A 2XGIA 4QE5A 2FYMA 4NSBA 1TELA 2NV2A 3KS5A 2B7NA 1A47A 5G4EA 3GB6A 4Q4QA 4AEEA 4XIMA 3G1YA 5K7JA 4GOAA 3N6JA 1UCWA 1BGAA 3VZZA 2R1KA 3WH5A 1QJWA 1AQHA 4MVAA 4AISA 2DZBA 1E9YB 2O55A 4PULA 4AIUA 2X16A 3RG6A 1A5MC 3JZUA 3QBUA 3G77A 3UGRA 2DP3A 4L64A 1QAPA 3TTOA 3TW6A 3CZKA 4OHQA 3LCIA 5DF0A 7TIMA 2TAAA 1WO2A 3A9BA 4GZJA 3CHDA 1RHCA 3HQNA 1VJZA 2XIOA 4F66A 1HJWA 1TQJA 3GE7A 3BG3A 3RK8A 2FZMA 4P5UA 1R9YA 3B8SA 4BFAA 4AD3A 1RQHA 1MQQA 1BHGA 2QJHA 3WQGA 1JAKA 1KO0A 4HQVA 4F2BA 2Z4GA 4O18A 1E9LA 3OPSA 4KH2A 1JI2A 1GKPA 2ISVA 3C0LA 4E2OA 4P8XA 4QS5A 4XZNX 4I7UA 1ZCOA 1JCTA 1WDSA 3P7YA 1VFTA 4CLMA 5H8PA 1M7XA 2OMAA 3NXFA 2DVUA 3QOKA 1YDVA 4C6LA 2EHHA 5DCDA 4HT3A 3GD6A 3KBJA 5I02A 3VIHA 2WKJA 3GUGA 1QNRA 3IVUA 1H2JA 3VUPA 2WJEA 1XDJA 1XPGA 4I9TA 1PS9A 1Q6DA 3TR2A 1TA3A 3UCDA 3AOFA 2WJDA 1YQ2A 3ARTA 5CCZA 4Z2IA 2PMQA 1JR1A 3JZEA 1RQEA 2FZ8A 4KWUA 3PJWA 4LJ3A 2FPYA 3EPMA 3H2NA 2A2IA 2D73A 2C91A 4XTDA 4LB3A 3CC1A 4J3XA 1B4EA 1TUFA 3BUVA 3PWAA 2W5FA 1VBHA 2XVPA 4IIBA 3C2YA 3TZNA 4PTMA 4RW3A 3LN3A 2NUXA 4FNRA 5FA5A 4RV8A 1JD7A 3UNTA 3TA9A 3WLNA 5CZJA 1HKMA 4GNKB 2YXOA 3AHZA 3VUSA 3CHEA 1YNPA 3DHUA 1MI3A 2GSEA 4W5ZA 5MKGB 4KF1A 3FXYA 3QGAC 5AC6A 1NAL1 2WVVB 3LMZA 3IARA 4DYJA 3KBNA 1OT2A 3FAWA 4B2DA 3MANA 5I06A 4IZGA 1E15A 3NQGA 1H1NA 3WQPA 3CBWA 4P7QA 4TVUA 1JGIA 2OB3A 1CXIA 1UG6A 1JIBA 2BXVA 1KR1A 2DZSA 1UZ4A 2E09A 1J96A 3M0LA 2QV4A 2YIHA 3CT2A 3HG4A 2VQUA 5JBFA 4HOWA 5I5RA 1W1YA 6REQB 3Q58A 4UTUA 1XLFA 2CC0A 2EO7A 1O5QA 3G6LA 3WBEA 1EUAA 1DOSA 4CD5A 4KEVA 4TOQA 1H7PA 5FJRA 2DJXA 1WV2A 1E4IA 2D2JA 3RILA 3F4CA 5DBUA 1SJCA 3ITLA 5HR7A 2G3NA 2Y63A 2Y70A 4MFDA 1NARA 1V6TA 2Z2UA 2E9MA 1WXJA 4UOZA 2YJQA 3WFZA 3L0GA 2J9ZA 1SUXA 1XGDA 2WCAA 1TPC1 1RR2A 4ZTYA 1KGUA 4GUHA 1J18A 4WRHA 2EGZA 2FHCA 4C6IA 1V0KA 3W2KA 3WL1A 2QW5A 2QDDA 1GCYA 4LAMA 1V79A 1W5MA 4XAYA 1LJYA 1LZOA 2J7HA 3RCYA 1XI3A 3FKKA 3TDFA 1Q6GA 4OOUA 2POTA 1RK6A 1C93A 4FLOA 1X7FA 3G3MA 1UD6A 1GOWA 4L4LA 4CD7A 3GH4A 2Z2AA 4AG0A 1LG2A 3DKLA 1H51A 4HA1A 1RJPA 4RNIA 2P10A 1U5JA 3E5BA 3G0XA 1EJSC 4P8UA 3IJ7A 1HKWA 2J66A 5EMKA 3W7MA 4LX4A 2Y88A 4ZSUA 4REQA 1QU4A 4E8CA 4C91A 4LVBA 1M7JA 3ZLFA 3FS2A 1HF6A 3WD4A 1RP8A 2GK1B 2JF6A 3TJIA 1XLMA 2E4TA 2CETA 1EB3A 1HUVA 4IFRA 2JEQA 4XD5A 1J79A 2BX7A 4TMCA 4PRTA 3S1XA 2OSWA 4W87A 5AYBA 3TROA 1ONXA 1NELA 3AS0A 3KRSA 2IKHA 3AQUA 1BG9A 4IPJA 1EA0A 4PN2A 4Q8QA 1R7OA 1WKYA 4M29A 2R94A 4BQ4A 3OLDA 1N8WA 1FCVA 4W85A 3TNBA 3EKGA 3N4FA 1LL4A 1OSEA 4J28A 3N17A 2NXHA 1UA3A 2RHGA 3AXKA 4IIDA 5A6SA 1XM3A 4HN8A 1CXEA 2DZPA 2OEMA 4O1BA 1KM5A 4AYSA 1TB3A 4NAEB 3OZOA 5BU6A 5TF0A 1VR6A 2WZTA 4WY0B 3MO7A 3E1F1 1GG0A 1YKWA 4WOZA 3WK1A 1BG4A 4EPBC 1E55A 4H8UA 5D2TA 4S3KA 2J7EA 2PWUA 4HHMA 3CL7A 2VFDA 5E09A 4AZ7A 4ES4A 4ZO9A 2PDHA 4HZ7A 2XFWA 4F79A 4QQUA 1LLOA 3KWSA 1TFVA 4J9JA 2O4QA 4UQBA 2B7PA 3FGCB 3ZLHA 1KWGA 3VKDA 2H3DA 3LHZA 1I1XA 3O8AA 3CXOA 4AWTA 3RIKA 2MUCA 1WKDA 4XSLA 4S3CA 3TYCA 3R79A 3W1QA 4D8AA 3N04A 4PB5A 3IIOA 3PC0A 1WPCA 3FDKA 3W7HA 4LY8A 4JIRA 3IJ8A 4G7EB 1R7AA 1QR7A 4GABA 1SJBA 4MUPA 5HR6A 1VFFA 4Q8VA 1UD4A 3P6LA 2E1DA 3VGDA 4F0MA 2ZUUA 2HVOA 3WBXA 3LLDA 1MYRA 1FXQA 1JZ8A 2A3EA 4C6JA 1MVYA 3B40A 4GIRA 3T4WA 4O1AA 1HKIA 1EWEA 5HINA 3SUVA 4B92A 3AIEA 2YZ5A 4RDVA 3I7RA 1TPH1 3P5ZA 3R0KA 3BAKA 2QT3A 3PZ9A 2GSHA 3SGGA 1R3VA 2ZXDA 2QEZA 4OZOA 1EJUC 3CAQA 3ALGA 5CPSA 1S5MA 1CXLA 1JXKA 3W9ZA 1KFWA 2DVXA 3GDRA 1GOKA 5FL1A 4EWND 2YKKA 4DI9A 3T81A 3S5ZA 1XLLA 4H9TA 2CZFA 4E4UA 1FP9A 4JOMA 1UWUA 3VM5A 2E6DA 2XISA 1XISA 5AC8A 4MAZA 2OLHA 3NPVA 3VNLA 3QC3A 3HMJG 4IM4A 2P0IA 1XLEA 3AZRA 4Q8MA 1TJRA 1JPIA 4A21A 4IIGA 1AD1A 2C0HA 1TTPA 3SCTA 1FVPA 3VD5A 1AG1O 2Y5JA 3B9EA 3EWDA 1CEOA 1W3JA 2J6XA 2GVJA 3BCDA 2ZIDA 3BQ5A 3GTFA 4J2PA 3E2RA 1QDSA 5D02A 4F8XA 2WSKA 5BMWA 4Z2KA 5LIKX 2WJFA 3W37A 3AAMA 1RVGA 2PWGA 2VGGA 4S3AA 1UR2A 3SDOA 4A2SA 2YSWA 1JZ6A 3N2MA 3EMCA 2WQPA 3M5XA 4ZENA 3RAOA 3VE7A 3BW4A 5GVJA 3ES7A 3RO8A 5JMUA 4M3PA 1JCNA 4WJ8A 3KE0A 3T0CA 4NZCA 3M0XA 2WSRA 1X39A 2PGWA 3LM7A 1Q45A 3UERA 4BI7A 2FVMA 2BSLA 2PPGA 2XTKA 5DMLA 1K3UA 3N19B 1MW3A 3VM7A 4WJEA 3WF3A 2XM2A 3RO6A 4CNSA 4X61A 3LERA 5A6TC 3CS2A 3HIJA 2XVGA 3HV9A 1YBQA 4W8LA 2DZXA 2XDFA 3I4EA 4HTBA 1JFHA 4HZ6A 2UBPC 4N02A 1ME7A 2J25A 1CGTA 4F0SA 3VCCA 3FSTA 1DJHA 4YS1A 3BGJA 3FW6A 3FJ4A 3BOFA 2Y1HA 4GQRA 1A5BA 4C5YA 3BLLA 1DBTA 3TN4A 4JX5A 3WD0A 4AD5A 4IPIA 1ZLPA 3UYCA 3E02A 3GS6A 3DHPA 4BQ5A 4WEVX 3W1UA 1KBIA 3CYJA 4Q4MA 4H8HA 3W84A 4XAFA 1ZJBA 3IK4A 3RU8X 4LF2A 4B4HA 1VZWA 1VFOA 1Z44A 1OX4B 4GX9A 1I1WA 3P61A 1OJXA 3CV2A 4GACA 4UTTA 1J11A 4HZMA 1TE6A 2KAUC 1UIOA 4MUZA 2P0OA 3WZ0E 2OSYA 3S5YA 2DVTA 4Q8UA 3VI2A 1NVMA 2TRSA 3MVTA 3PNUA 4EANA 3B4UA 5GJNA 1KR0A 1CLKA 4IIFA 4LV4A 3HOJA 4C6KA 4LUSA 4YHEA 4DF2A 1V6YA 1F9CA 5CLWA 2A6NA 3BZGA 3V0SA 2VVNA 3ZJ6A 3EPNA 3G24A 4NQ1A 5C7VA 4CQ8A 5A8MA 3E3HA 4L80A 5C9UA 3G8RA 4F0RA 2BNJA 1GVOA 2WVUA 5T91A 2ZX9A 1M01A 1U5HA 2PDKA 2O56A 3W07A 2O9RA 4JIHA 1XIJA 2V69A 2VXNA 3RUBL 1XYAA 1TMLA 2ZFAA 3AC0A 4HPXA 5FAJA 1D2KA 1J4EA 3KTSA 2Y0FA 1VFHA 1REQA 4GGHA 3SUSA 1B9ZA 3ITXA 3SADA 3DENA 4IUOA 2WO5A 4B3ZA 3PUEA 1S5TA 1Q2RA 2A7RA 2OTDA 3WDQA 2J7BA 1FXPA 4GNJA 3S9YA 3K1GA 2OYMA 3RNDA 4BCEA 2OOGA 3E9AA 1QMLA 4S3FA 4G1NA 3DKJA 3O0KA 3IK2A 4QG9A 3IGUA 3FJ6A 2WMIA 4W5UA 3TJ4A 1LCOA 2VNCA 1L6WA 5FSEC 4NZ4A 3TAOA 4A29A 3C3UA 2ZUMA 1UD5A 5BOFA 1PDYA 3MBDA 4JN7A 4Y7EA 2IQ0A 3BGAA 5KZDA 1KM1A 1CB2A 3MWCA 3P74A 4D6IA 4D2JA 2RH9A 2VVSA 1BPLB 1R2RA 3LU2A 4C1NB 3WUFA 2Y7EA 1Q6QA 4ICNA 4UR8A 1XC4A 3NOYA 2O9OA 3P3BA 3H7UA 2GGHA 4JNZA 1A5OC 3NQFA 3A3WA 2ZVRA 2GJRA 1D3HA 3RX4A 3B3DA 4RPQA 1EJVC 1E6SM 3LMYA 4YYCA 4LQ1A 1V4YA 1C7TA 2XVNA 4W4QA 2GGJA 3GZ3A 3OQEA 2PODA 1XH2A 2FB3A 4GI8A 2V81A 5CPNA 1MRQA 3TEVA 1R30A 1KTCA 4Q8PA 1DWIM 4CN1A 3L4TA 4NP7A 2BY0A 1XRVA 1MXGA 1SW7A 1X1NA 1V0NA 4WKHA 2FGBA 1F76A 1EJRC 3TTYA 4ROQA 4U4MA 2XGZA 3SJ3A 3CV1A 1WYIA 1TG7A 3WLLA 3WQWA 1JPHA 3LD5A 4RDZA 3WQ6A 1HJXA 1UD3A 3WELA 1OK4A 1KFJA 3WF4A 3QQWA 4DB7A 1K6WA 1OC7A 1SR9A 1SQ7A 1T5AA 1E0VA 5TAOA 4HVXA 3G1FA 3HG5A 2X7WA 4V1YA 3NFUA 3O06A 1XICA 5I09A 1QI0A 5LA1A 1VBUA 4C6EA 2BWGA 1WOAA 1W9UA 3UJEA 2Z24A 1W32A 1O68A 4OE7A 4UFHA 2Z28A 3C2VA 3WUBA 1Q2SA 3R4IA 4XIAA 1OF8A 1RCQA 2JKAA 4IGSA 4QGCA 2X05A 3R13A 4L4PA 3ELFA 4MWAD 3QTPA 4CU6A 4F3HA 2QF7A 3OYXA 2DW6A 1CBGA 2C14A 1JZ5A 1TPFA 1B5TA 4Y9NA 5EBUA 4DYEA 3ALFA 4YMZA 1T7LA 3BLPX 5G1YA 3IUIA 1UJQA 2PLKA 1JYWA 2ZICA 1F6YA 2J47A 4JCMA 4ORMA 4PL1A 3VKJA 1TV7A 1JXJA 4A35A 1GVQA 4QP0A 2ZZ3A 2F8QA 3ZT6A 3SR7A 3URAA 1MEHA 3NL5A 3VGEA 4GUJA 3BG5A 3SY1A 4X9YA 2QYGA 9RUBA 1KRMA 4PMVA 3QOMA 1US0A 1IIGA 5I77A 1HQTA 1GW1A 5HA7A 1T96A 5EY5A 4O13A 2QHAA 5FESA 4NKCA 1NSJA 4LANA 1UZHA 4DO4A 4TV5A 3F5KA 4JYDA 1UJPA 1FWRA 3SJNA 1DJYA 2Y7GA 5EMUA 3XIMA 1S2TA 2FMOA 1VPQA 1HIZA 3UZYA 1PTGA 3PF3A 3P60A 1I0BA 1S2VA 3WK0A 1Q85A 4QCEA 1P0BA 3O63A 4JS3A 4HMDA 1JCMP 1US3A 1KFEA 1F6KA 5G4WA 3VMOA 4S1FA 1IWAA 4PFMA 3WFAA 2WKGA 5MF5A 3K8KA 4XKYA 3WNMA 4X2RA 4K8EA 3TYBA 1I45A 2E1WA 4WD0A 2Y6ZA 3USZA 1UR3M 4NXSA 4K7YA 1YPFA 3WQOA 2I14A 1KKRA 5CC3A 3WF0A 4GZ7A 1GTEA 4DM1A 4ERIA 1BRLB 5CBJA 4AHQA 4GRSA 5GNXA 2OO6A 4A6GA 4NYUA 1IT0A 4CN4A 4D71A 3PTMA 4HCLA 1QW7A 4NL1A 3G1VA 5A8GA 2AQVA 1VPYA 2RDUA 3B0PA 1GGOA 3UVIA 3MZ2A 4GFIA 2YW3A 4FR1A 4QEHA 2ZDSA 3IAPA 2R8WA 3LGDA 3DYOA 1FWIC 4JTKA 2XFRA 3LQGA 3STCA 2PDUA 4H1ZA 1WKEA 4LS1A 3TSMA 4GY7A 1XLAA 1HX0A 3TSDA 1H4PA 1G7VA 4FI4A 1JNEA 3ITYA 1VLIA 2QS8A 4QJ3B 3WQDA 3WJSA 4GIYA 1AH3A 1IXPA 1TWDA 3AIWA 1AL8A 1PJ9A 2GWNA 5C54A 3UD6A 1OIMA 2DY3A 3G22A 1ELSA 1QWKA 2OWCA 1YBQB 3GR8A 2YCEA 1MUCA 3TTQA 3GM8A 3LHVA 4IGMA 2VX6A 3AJ7A 3S2LA 3ZJ8A 3O1NA 3ANYA 3T40A 1XX1A 4GA8A 3RDKA 1W3NA 1JZ7A 5J5DA 2VRQA 4Q33A 1L8PA 1KM4A 4F0KA 4TTGA 2FIQA 2VWSA 3HZ3A 3H6OA 3WLIA 3AZTA 4QR6A 1A4MA 3O6CA 3FNDA 4EPKA 2OLAA 2HBVA 3MJMA 1PTDA 3P5YA 4B16A 4TV6A 1B0IA 1E56A 1XRSA 1YIXA 4A8IA 2BXZA 5DMMA 4IICA 1GOMA 1UKSA 2GWGA 3CK5A 4LPCA 5LHFA 4N7QA 3L0KA 2HWGA 2OZTA 1VJSA 3OBAA 3WLMA 4EVZA 3GX9A 5FF2A 3SI9A 3EB2A 4GI6A 1JYNA 3N13A 1EH9A 2QGHA 1D9EA 3GAKA 1GEHA 3O3RA 2QDHA 4CNPA 1AK5A 3L7RA 1RJQA 3OODA 2CCRA 1HXJA 1N82A 2I9UA 1GEQA 1G67A 4DJEA 4QM1A 4JEJA 5KEZA 1XGZA 3ZOAA 2J27A 5J5RA 4CD8A 2FGLA 2BVTA 4F9JA 2DSWA 2CEQA 3LA4A 3CB3A 3S9ZA 4LRSA 1WZLA 2F6XA 3GG1A 1W1ZA 4RX0A 5I3GA 3STPA 1SO3A 1KM2A 5AHIA 3I6RA 3AU2A 1V02E 2QKFA 3IUHA 2NX3A 3CZEA 2ZVIA 2C15A 4TR9A 1UH3A 1UASA 2A7PA 3GTNA 5LSMA 3QEZA 5AZ0A 4GYKA 4K1WA 1BVNP 1F3WA 2WNNA 5EPDA 4PMNA 2G3IA 4G8TA 1MZRA 2V9DA 1L6FA 4JQ4A 4ADTA 4MIMA 4ZZ9A 2EEXA 4F0LA 1IHIA 2V5LA 4LBUA 3PBVA 4ML9A 2VFHA 1Q4WA 3L2IA 2OSXA 3LV5A 3QXBA 4D1IA 1M65A 3QZ6A 4FIRA 2OODA 5AHLA 1TZZA 2X7VA 1GORA 4ZOCA 4O4WA 3WMBA 1QPNA 3OG3A 1PZ1A 1NQ6A 2YCLB 2P88A 4F2TA 1W56A 3W2JA 3L5AA 3BAWA 3ZXWA 2Q8XA 1CPUA 4LT9A 4W9TA 3B8UA 3HQOA 3OG2A 3P80A 1QOPA 4N6EA 1ZALA 4GBUA 1JZ2A 3TWBA 5CAKA 4E8GA 1XYFA 3EA2A 4WK9A 1GHSA 2VL4A 3T2QA 5DMYA 3ZQ9A 2BGSA 1K70A 3OTRA 5A6KA 1Q65A 1BRLA 3QSRA 3GC2A 1TPUA 3D46A 4IQJA 2QMJA 4MYXA 2PBGA 1E1CB 1NF0A 3W7JA 1PKNA 4UTFA 4UC5A 5H8UA 3OZPA 3QR1A 4KCUA 1GVRA 3FJNA 4HA4A 4FZIA 4FNPA 1NM9A 2YYUA 4XBKA 1EIBA 4FOKA 1YX1A 3GWQA 2EPKX 3UWYA 3H54A 3TUUA 2YLLA 2GVYA 5HMEA 2G97A 4R9OA 4O0QA 1T99A 6XIMA 2PE4A 1JQVA 2I16A 3SY8A 2HTMA 1VRXA 2DSVA 3AMDA 1ICQA 5CAHA 7ODCA 1NDWA 4I7VA 1TTQA 3EEZA 3IJQA 1H5VA 2HMCA 3R8GA 3WDJA 1A5UA 4KCWA 2BG5A 4JN6A 2EKCA 1H62A 2PA6A 2X8RA 4X0VA 1FA2A 4AX6A 4C1KA 4N2YA 4LNCA 1OCBA 2ESCA 4K7VA 1FCBA 2WMKA 4IX0A 1UQZA 5LNSA 2WZHA 3LYEA 1OC6A 2PDFA 1VBJA 2A3LA 2J9XA 2ZUSA 2UY5A 3VIGA 3P8JA 1Q7MA 3GXIA 2DU2A 1VCVA 1GYMA 2CZVA 3SSJA 3BC9A 5C9XA 3OBKA 2D0FA 4WOQA 3U5YA 2ALDA 4ZVJA 1W2VA 3PPHA 4MNMA 3H23A 3RXZA 1XG4A 3U2OA 2C0AA 4ZFMA 3P14A 6CGTA 4HK5A 6ENLA 3C0JA 2NT0A 3UCCA 3R7MA 2ISWA 1MDLA 4N42A 1QOXA 3K4WA 2W6RA 3TV8A 7REQB 4LGXA 4Y8EA 3S2CA 4NAFB 4AC7C 2A3AA 3RCMA 1H63A 3V5CA 3BLOA 4C7DA 1UB3A 4PC8A 2WWCA 3BCJA 4Z1YA 1BLIA 3CHCA 3VOHA 3S0CA 1YTKA 3NQ2A 4OIFA 4IL2A 5C2GA 2LLEA 2YLAA 4QE4A 1KW1A 4GISA 3UJRA 3S2NA 2GGEA 4JBRA 3WNPA 3W23A 3M0MA 3VCRA 1MXSA 3JVAA 4O52A 3AS3A 2V5BA 4W7VA 3BW2A 4H4IA 2TODA 3H4GA 4FR6A 4IFKA 2QPSA 2CZDA 4MGGA 1D8WA 3B8IA 3DX5A 1B57A 2OPJA 3TMQA 2UY2A 4FXRA 2GQ9A 4NZ3A 1P0EA 4MWAE 3AIRA 4HK7A 2VGBA 3XINA 4DZIA 1O60A 2NQZA 4HJFA 5K9XA 4PMOA 3ABSA 2ZE3A 3UG3A 1Q63A 2QCFA 2Y8KA 5B80A 3W24A 1WX0A 4BHYA 3E5PA 1XL9A 2X1UA 3BK0A 2GOKA 2RJGA 4B2DD 1NOUA 4KKXA 2R14A 3T78A 2G96A 4IJRA 4J40A 2RGLA 3AHVA 1DIOA 1QNQA 2WJZA 1JDCA 3HGRA 1RA0A 1VAHA 3CMGA 1ZQ5A 2YFOA 4PUNA 4ZGYA 3T1GA 1EWDA 4C6FA 2GOUA 2CBJA 3ZYZA 3MT1A 1U30A 3VDCA 3ID7A 3D5HA 5A3HA 1EEPA 4FF7A 5HWJA 3VINA 1U1JA 4WXZA 2WMIB 2X1RA 3PK7A 2XINA 2R1PA 3MA8A 5I3HA 1LRTA 2E5DA 3HJZA 1M7OA 4MDOA 5EFFA 2B4GA 1OM0A 2VELA 3K1DA 4GIEA 1NP2A 1CGXA 2ZA3A 2REQA 2P8BA 3EOEA 1RVKA 1DE6A 2Y7DA 1V08A 3GVQA 4I7WA 1FHUA 4UTLA 2YCJA 5LZLA 1E4MM 2DQWA 1N2VA 3EDEA 3T8LA 1B54A 4NRSA 1UR4A 2GJXA 4Q7IA 3LHUA 3MMTA 4MLRA 3DGRA 4JFTA 4PSPA 5AN7A 1BSIA 1Q4NX 3UNDA 4PL2A 4IT1A 1XSKA 2ISDA 5H1WA 3TJLA 3HA1A 4MB1A 5CJMA 4OUIA 1FDJA 1NDYA 1C90A 4MPKA 2OQYA 3KFTA 4E2BA 1K8XA 5FEXA 3CMFA 3FGCA 3TOYA 3M5VA 3FA3A 2ZRZA 1OX5A 1P6CA 1XCWA 1I2QA 4GUIA 1PIGA 1ZENA 2IPGA 3NVDA 2ZX8A 4HD5A 4Q6JA 1E6NA 1QUMA 2PSNA 4O1DA 3WJWA 3LK6A 2NSXA 2V5CA 4PZVA 2R9RA 2X1TA 1O1ZA 1CGVA 4G9PA 2DZVA 4O1EA 3TH6A 1LRQA 3LCFA 3NZGA 4RE0A 8XIMA 3CIXA 2R82A 1DWJM 2GSJA 3FVMA 4MLJA 2D20A 2FVLA 1OVDA 1LOLA 3W74A 3EYPA 3NJ3A 3PNZA 4MZYA 1TMQA 2WC4A 4XKMA 1BSLA 5AVHA 4PBGA 2AGKA 3TK7A 4IHCA 3NOEA 4H6EA 3VC6A 5HNNA 2CLOA 3A4JA 1W3TA 4S3EA 2VEFA 3PSWA 2VFIA 3GXPA 3PAOA 4N0RA 5I7GA 3WL0A 3DN5A 1HFBA 2ZYFA 4K8GA 4GQGA 3VE9A 1JI1A 3SQSA 1E6ZA 2XH2A 2GUUA 4GXPA 4C7FA 2NWRA 3FHQA 3IJLA 3BAJA 3PTQA 5AOUA 1XQLA 4QNWA 3OIHA 2E77A 3QGKC 3TQVA 5CZTA 1AZ2A 1TV4A 1H41A 3A12A 3WIJA 3P8IA 1OABA 1JUBA 4PCNA 3TP4A 1ISXA 3L65A 3DZ1A 4F40A 4KBXA 4H83A 4MM1A 2AQWA 1SGJA 2G41A 3R10A 4OWGA 4H3DA 2FFIA 3BL3A 8TIMA 3T2OA 2PDNA 3MSDA 1VFUA 3LRKA 5LNVA 2A1YA 2QCEA 3MVIA 2YL6A 3ITVA 3ARXA 1E4LA 2QUMA 1EFZA 2XM1A 3R89A 4GG9A 3CUZA 2PTXA 5SWUA 5D9MA 2XJ7A 1UOZA 1V6WA 5HUPA 1K02A 1BTMA 1HT6A 2AKMA 3VU2A 1W0MA 5LIUX 1HKVA 4JHZA 2TYSA 3NGFA 3W1NA 3GZAA 5JH1A 4FNQA 1S39A 4X60A 2VTFA 2XUCA 3B0XA 4WDXA 5AB3A 4EAYA 3KL3A 2DUAA 1Z9AA 4LW7A 4V15A 5FKYA 4QSFA 5T8GA 3DERA 4AFYA 3KX6A 3NL2A 1BEUA 4DZAA 2NVAA 3W81A 1GUVA 1QPKA 3DG6A 2PDJA 3GIPA 2PFHA 3ZR4A 3OGRA 3GG8A 1ZAIA 2C71A 1UW9A 2Q3RA 4EX4A 2WKLA 3NZPA 4KPLA 4M19A 2Y7FA 3N4EA 1BGGA 2OG9A 4Y9PA 3ITOA 3OU8A 3K5XA 1OB0A 4QFUA 1TJ0A 3P0WA 1MDRA 3TXVA 1VENA 1TUXA 3NSNA 1DWFM 5D4YA 1CGYA 2XWEA 3RYSA 3E49A 2FH8A 3POCA 3L4WA 5FJUA 4I8YA 2HNHA 3M6DA 4M80A 3H7VA 1W17A 4YNGA 5D37A 4CCZA 4GH3A 4NZFA 4IPLA 1UWQA 4DBEA 2V3DA 3AYTA 3FN9A 1C8YA 1O66A 3UXLA 4KFOA 2C8NA 4CCEA 2IUZA 1E6XM 2OT1A 5BZAA 3WD2A 3RMJA 4H9ZA 1KXTA 1J0IA 5I3KA 1IXQA 2DGAA 2XVKA 5A6AA 1GOOA 4Y8FA 1Q13A 4LVFA 3PBUA 4IFKB 2ZTKA 3F2CA 3CO4A 3L5MA 3VKCA 1YLVA 1NF7A 4E5TA 1DIKA 3S2JA 4PB3A 1RZMA 4AAJA 1J0KA 4OECA 1IZJA 4P7OA 1MNZA 4RDYA 2MNRA 2BOEX 3W53A 5F4XA 2IQDA 3O07A 2GL5A 1IE7C 5H2ZA 3VMNA 1G4SA 4EXAA 1AW5A 3QPYA 3NDZA 3T8QA 5H91A 1TJ2A 4AZHA 2DH2A 3S1GA 3GDTA 2A6LA 1XYCA 5IHSA 1BD0A 4PFHA 5KZ6A 2E5CA 1SFTA 1R8LA 1VHNA 1S5NA 2J7DA 3M46A 1HG3A 5BRQA 3WDIA 2CITA 4UMCA 5K9CA 4JTFA 1A53A 1DORA 1OD0A 2JIWA 5BWAA 4M6UA 1NP0A 3AFBA 2VI0A 1XLGA 3BARA 4N6FA 3M0YA 1OINA 3G0SA 3DHFA 4MFEA 1H50A 1XBZA 4ZB2A 2J6VA 3VIJA 3I7QA 1BQGA 3S5SA 4NAEA 2R24A 2WBGA 1LBFA 2Z6IA 1JZ4A 4PR4A 4DJEC 1P6BA 3W26A 1G01A 4DUWA 5LNWA 1IT8A 2ZRVA 4MNKA 2HPMA 3KRZA 1SSDA 2DDXA 1UROA 2I5GA 3BWWA 3FIGA 1EC9A 4Z0JA 3V1PA 3ITTA 4XZHA 4WCJA 4AZCA 3LSBA 2BHYA 4JXCA 4DJDC 2EAWA 3TKFA 3W38A 1XINA 4LAZA 3FCPA 3ZWSA 3BAXA 1F73A 1T40A 2O7SA 1LL6A 1I8JA 5EMYA 1AUSL 4GC3A 4AIEA 5CG7A 5IDZA 3W76A 2BP1A 3PZIA 4H9YA 1R0MA 4JTHA 3L2MA 1HP4A 1X6LA 1KB3A 2DZWA 3W7OA 3VVGA 2Y5EA 2JE8A 4A3YA 4GJJA 3C6CA 4TQTA 4U3CA 4QNEA 2NVCA 4MG4A 4WSJA 3TAKA 1R2SA 4E6MA 2VZSA 2ZZ5A 4R27A 2R91A 1QI2A 1D8CA 3QLDA 1K9TA 4X2PA 1ZHAA 4MOZA 2E7FA 4LC8A 3WDHA 1R6WA 1W3LA 1XDLA 3V0TA 4D6FA 4DIAA 3QY7A 4MSSA 3NQ8A 1KXVA 4Y9OA 1VF8A 1W31A 3KTXA 3NQDA 4ASTA 1CLVA 4EPEC 3O15A 3N25A 3TCEA 3WUGA 3GH5A 5LNRA 2YX0A 1AZ1A 1A5AA 2X41A 3SCNA 1X1ZA 2NSOA 5CC6A 4PRRA 2FTPA 3TC3A 4DM2A 4C6QA 3IIZA 2BS9A 3IJ6A 4ZSTA 4R7OA 3OVPA 1NTHA 2J8TA 1W9XA 2EXOA 1FH9A 3A4XA 1CXKA 2BVDA 5HNRA 2P3EA 1FWGC 3TQKA 2GJNA 4I8DA 3U2CA 2OKTA 3N9SA 2UWFA 5HANA 3W88A 2ZE0A 3O6YX 4O50A 3H2AA 3MDUA 5M1TA 5CGQA 1P5BA 3L4ZA 1TVLA 4J3ZA 3THQA 4U2YA 3KOWA 3ISIX 3ABXA 4AWUA 4DBWA 3IVSA 2CW6A 1OG6A 4Q32A 4JTLA 3U4AA 5E0CA 1IYXA 3KXQA 1YDNA 3G8EA 1TV8A 1EP1A 3UR2A 3LENA 4RJEA 1RH9A 2D69A 1VCFA 3NYDA 2ZQ0A 1P0KA 4ERGA 2HZGA 2PRHA 5BCAA 4IPPA 4C1NA 5F4WA 3VTRA 2AOSA 1KQZA 5IBXC 3MO4A 3T44A 4XZLX 5EU9A 1ISYA 4US5A 4JPGA 4J5NA 4IXHA 1BVZA 3I6EA 4XBSA 5BRBA 3FOKA 5G5IA 1YTDA 3WNKA 3ORWA 3VKAA 4O8RA 1YHTA 1NY1A 5DQPA 3S6DA 1B2YA 1IF2A 3CQKA 3SAZA 4TU1A 3DGBA 2HE5A 3LG3A 3O0FA 3PB2A 1JF5A 5AHNA 2VC6A 3N2OA 4M56A 4ATDA 1UIPA 2FZNA 2O0TA 2EJ1A 2GGIA 4XTIA 4I5RA 5XINA 5D9OA 3N9KA 2VDIA 2YCLA 4Y90A 1VYRA 5FEPA 4FX8A 1XD1A 1I9CB 4RNJA 3UCQA 2WWDA 4GWEA 4ZCWA 5F1VA 1TA3B 2EG7A 3AXHA 1W54A 3OBEA 5I78A 3N6QA 4QBXA 2CXEA 3UPWA 3L0NA 4W84A 4DWSB 4FLQA 5CSUA 4LVGA 3OHIA 3S47A 3WYZA 1KCKA 3LI0A 3PZTA 3W83A 4N9BA 1TV2A 3PBMA 2C6QA 1W9PA 1U2YA 4H6RA 1UC4A 1D3GA 2OZ0A 5A2BA 4U28A 4DJED 1VFMA 4E8DA 4DQWA 3CWOX 3C4UA 4B9YA 4BWLC 1GTHA 4E4FA 4Z2JA 5REQA 1W9BM 1NOFA 1TREA 4S3BA 3A3XA 4J35A 2I7GA 1FTXA 1SZGA 4IQDA 4QG6A 5HULA 1VFSA 4BWLA 2PDQA 3PFMA 1NWSA 5C5YA 1HL9A 3UBPC 5DCBA 4J1OA 2YR1A 3N2BA 3CU2A 1AQMA 2DZAA 1E6QM 4IP7A 1FKWA 2EPLX 2TPSA 2YYTA 3W7DA 1B3VA 4Y96A 4KS0A 4HMCA 5C0QA 4PMYA 4JX4A 1MQPA 1LQ2A 3UWEA 5C2XA 4AIOA 1XG3A 4UTWA 3B05A 4MB4A 3N34A 4TTUA 1RSCA 1BVWA 1R3YA 2C1IA 3GU1A 1VYPX 2VUNA 1O94A 4ZB0A 1WUEA 3WJZA 7ENLA 1KFCA 2FZDA 4M1RA 2VGFA 4GFSA 1DWHM 2QJJA 3TTEA 1UWSA 4WJXA 4FXJA 1ZRQA 5F7UA 4AD1A 5K4XA 3U5UA 1Z41A 3URQA 3UWQA 1IR2A 3U7BA 1DJQA 4XB3A 5J8LA 4AX7A 2J74A 2C18A 4ZO6A 4AWSA 1EL3A 3GSMA 4RZ6A 2C7FA 3MYPA 3LGEA 1TR1A 4EKJA 1OGGA 3N29A 3EWBX 1UUMA 4KQNA 2WBKA 2FZBA 4PCSA 1CZ1A 1RAKA 3TU9A 5DLCA 2B7OA 3W0KA 1WNOA 1NH6A 4H41A 2ACRA 1DJIA 1A5SA 3AICA 4UOJA 5E0KA 5CGTA 1UH4A 1SJDA 3ARYA 3L23A 3C2EA 3E38A 4MNJA 1KXHA 4GIAA 4Y9MA 2GZXA 5ABHA 3SGZA 3VKBA 1JZ3A 2AGTA 3EDKA 3SCSA 1O5RA 3IWPA 2VP8A 1X8FA 4GHRA 3WQ5A 1AW2A 5EA9A 5REQB 4IMEA 4AZBA 4C6OA 5BXTA 4ML4A 1C92A 3OZMA 4CNNA 2YFNA 4LEFA 4K36A 4V2XA 5L6UA 1KFKA 1KTNA 2QLYA 3ONCA 5XIAA 1O12A 2QCGA 3LHYA 3H24A 2D23A 2NLYA 3WBAA 1ZJHA 2DH3A 1ZB5A 4K68A 1J10A 5CZKA 2O4MA 1SSGA 1LLWA 3AMGA 3IJDA 1TV3A 2X09A 1DWAM 3A47A 1TR9A 4KERA 4RKAA 2G50A 4ALDA 1XFCA 5E5CA 2WZIA 2J77A 2WC3A 5IDIA 3LB0A 3C3NA 5HJYA 2VO5A 4WDTA 4INFA 3IIPA 2XZ9A 1EBGA 2P1FA 3ABZA 1J0HA 4QDPA 6A3HA 2JGYA 3KHJA 4QHRA 3FK4A 2ZRYA 3A4WA 3DFNA 4O1FA 4DNHA 2H3BA 2H90A 1S3HA 5D32A 3USBA 1MXDA 3N18A 1W3KA 1ADDA 3ZJKA 2VMFA 1J12A 2GQAA 1V0LA 3BLIA 3M1ZA 2FDSA 1K9FA 3C56A 3O6DA 3I10A 5ABEA 3GFXA 4GZEA 4E3TA 4YJ5A 2DSKA 4JTEA 3CUXA 3WJXA 1P48A 4NNBA 3GY1A 4DUVA 2WV8A 2Q6ZA 4U3AA 4K8HA 3QR3A 3W22A 5I23A 3GKFA 4MZ8A 2DORA 1GVIA 2HXUA 4E0CA 4YCOA 1I75A 2X40A 4RK8A 2RDWA 3M47A 2RGMA 4JKKA 4XO7A 1DXIA 5E6YA 2FPVA 3VZYA 4LNYA 2HQAA 3AISA 4G6CA 5E0FA 2CPUA 1ISWA 2J9YA 3NQBA 3FAXA 1PHWA 5IRPA 1LWIA 1XH0A 4FXFA 4ZOEA 1V6XA 3APTA 4HKPA 1SO4A 1UHVA 2V3EA 3UPBA 4P8WA 1E5JA 5KITA 4UBPC 3QFWA 3QYQA 4DXXA 1ISVA 4ENLA 3BLFA 1A50A 1KKOA 3CV7A 1UMLA 3WH8A 4FIQA 4MY8A 4XUGA 4FO4A 2Z7KA 4G56A 3EA3A 4HU8A 4UQAA 3N4AA 3UG5A 4PMXA 3SURA 3DFHA 1EUNA 1GPFA 2PD9A 4PCPA 5KMYA 3RFAA 1UH2A 4DJFC 4RLIA 4IGHA 4E2VA 2ZXQA 3HG2A 3M0KA 3RPDA 3PBGA 5H6HA 3IANA 4D6JA 2DV0A 4P7NA 3SM0A 2Q09A 1G4TA 7TAAA 1XBYA 4HNVA 1QHOA 3ZR6A 1LBLA 1Y7VA 1YNYA 1WDWA 4NJHA 4GQBA 3Q4DA 2VX7A 4ZBCA 1VFLA 2G3FA 2V63A 3FA5A 4B5XA 1GHRA 3QQ1A 1K8YA 2EKGA 3QR0A 2DIEA 4W8AA 1OZQA 4DBDA 1RBOB 4IISA 2NQHA 2DQXA 3RPMA 3W2UA 1PIFA 5M17A 4HYRA 3GU2A 3DEQA 4KRUA 4QJ1A 4MKVA 5MKGA 3RITA 2OCZA 2FJUB 4ZQPA 2PWFA 1QPQA 3ATZA 4JCLA 3R6IA 4KIRA 1EJWC 3UU0A 3F4WA 1F3TA 1CGWA 1W1PA 1AD4A 2IXUA 2FVKA 1XC6A 5CGMA 3H4WA 2CERA 4FB7A 3EX1A 3FYPA 1O4UA 4DVOA 1D3CA 5HJLA 4RUBA 2VC5A 1PKMA 2Y62A 5PTDA 2D2GA 3LCLA 1XKJA 5DX7A 3XISA 4KEMA 1Q6OA 4YHGA 3PTKA 1L6YA 3T0AA 1XIDA 3OVGA 3QJAA 2J8GA 2VEGA 3GU9A 3VNDA 4O16A 2QJIA 2P53A 1KRAC 3TJXA 3NQ7A 4PBEA 3UXDA 5DRCA 3ARVA 3EKZA 4U10A 4JFUA 1W5PA 3C8NA 1LT7A 9CGTA 2GLKA 2ZX6A 1CWYA 3EGJA 2GDQA 3KCLA 3K4AA 2DSUA 4RE2A 2CU0A 3II1A 4JDYA 3IPWA 3W29A 1S2CA 3HM7A 3LTSA 3HO8A 3REQB 3FYYA 3V16A 2PCQA 4AY8A 2O7QA 2BOGX 5I07A 2GK1A 3QYSA 4I6KA 4R7JA 4PMQA 3EMQA 3KP0A 5C2CA 4WZHA 4AIBA 1Q7QA 3LPFA 3KM8A 3HPSA 3ZS4A 5LNUA 1GT8A 3OA3A 4HOXA 1A0DA 4ILSA 1V7AA 2R1MA 8CGTA 1OC5A 4MAVA 3QV6A 3GFZA 1P4CA 2E6YA 1RP9A 1ONWA 5CSRA 2ASHA 1Z7AA 2D0GA 3A3HA 4Y9AA 2ZC1A 4M82A 2JK2A 3H2MA 3M43A 4LBSA 1NWUA 3JUGA 4G1KA 3SCVA 3A64A 3UR8A 1KXQA 5HATA 3MP5A 3QPZA 1I6NA 4YTRA 2INZA 5U7SA 1T8QA 3HPFA 1SZRA 2OELA 3F4VA 2ZZ6A 3ECQA 4V27A 1B3OA 4D6DA 4S39A 1WKFA 3MS8A 4L65A 4UFJA 5EMJA 1ECQA 2IKIA 1W1IE 1J01A 1P0DA 1DJZA 3O2LA 2AQOA 1IWPA 1TWZA 2FB2A 3DBNA 1LUCA 2V5KA 4LYRA 2Y24A 4R7WA 2W91A 3MV11 3ZWTA 3H70A 1I2RA 5HBFA 4E2DA 1TSIA 3WEOA 4W8BA 3UW6A 1N8IA 4OOZA 1HJSA 2PLCA 2XSBA 2FKPA 2DPEA 3IGSA 2HXTA 4L9XA 1TX2A 3PY2A 3DBPA 1ZTVA 3IVTA 1TPVA 1EF2A 2P8CA 1EP3A 1PWLA 2X30A 5FF3A 2Z1BA 4N9CA 3LBCA 2PD5A 3E2SA 4UQEA 4NJKA 3BO9A 1HJUA 1SFSA 4JY9A 3T9PA 5G2WA 3KW3A 4PCTA 5DBTA 4HZ8A 3HQPA 3BJTA 3TYAA 3VA8A 3UJ2A 4JQ3A 2VR2A 5HMFA 4NG3A 3ATYA 3SN1A 4JD4A 4GO9A 4NASA 4QROA 1H7WA 4OKDA 2WVSA 4MJ2A 5DEZA 1JYVA 3AUOA 2VZTA 1KBBA 3NDOA 3TN5A 1M3UA 4XD4A 3AS2A 2XIBA 2XPKA 4JHMA 2A3HA 1UWRA 3KS6A 3N73A 4X0NA 3H21A 4HPGA 1EX1A 1F8MA 2FMNA 5A6BA 9XIMA 1BQCA 5D03A 3HJEA 2Z0IA 1E71M 1E4NA 4ATLA 3RLVA 2WHJA 1CT5A 2AL2A 2GYIA 1U1UA 2XN0A 5BNKA 1K1DA 2VEKA 4JICA 3W25A 1A3XA 3APGA 4FMVA 3CZLA 4WDWA 3GKAA 3R2GA 4FOUA 4AEFA 1E9ZB 3GR7A 4GYPA 3CYVA 4DLFA 2Q02A 4EE9A 5E1QA 1MO0A 4L7ZA 1GQJA 3E74A 4IFOA 2J4GA 1DYSA 4Z0SA 2IS7A 1TWWA 3P62A 1NFGA 4YPJA 2E6FA 4S3GA 1EXBA 4C7GA 4M24A 4DJFA 5AYYA 1ZU8A 3HF3A 7XIMA 1FKXA 1X8CA 4OV4A 2PWEA 3V1HA 1K03A 1LF1A 2EBNA 4NI8A 3MU7A 2R1NA 4CEXC 1V77A 3S1VA 3TVAA 1R47A 4K2SA 1CNVA 2B0MA 1PV8A 5BXSA 1MNSA 2HS6A 1OK6A 1XRFA 3R94A 2PGEA 1UBPC 3KHDA 4OJYA 4AU0A 5DN1A 3NM1A 1NWRA 2FTWA 3V0UA 3R5EA 3NEHA 1Q8AA 2UZ9A 2HV5A 4PE8A 2OU4A 2VM8A 2PU0A 1TTIA 1VS1A 2V0TA 3MQTA 4MHBA 2PDGA 3O05A 3ZR5A 4W89A 1EQPA 1GJPA 2Y8VA 3BMVA 3CH9A 4LY4A 5FF4A 4JQ2A 4EXBA 3NO3A 3OGVA 4XBJA 5DT7A 1AODA 4PUKA 1X38A 2OT0A 4L4OA 2QF8A 2RKXA 4CU8A 2PF0A 2PURA 3RM4A 1C8QA 3DG7A 1UKOA 1NQKA 2VOTA 3R0UA 4AHPA 5G1TA 4GLEA 1MEIA 3SN4A 3W3OA 3PZOA 3BZJA 2NUYA 1VEOA 4O4VA 1J8VA 1VC4A 1FWEC 2FHBA 4HK6A 4ADUA 1S2UA 1V3LA 2NXGA 2HISA 2CLLA 5C7HA 1LDCA 3CQJA 1PB0A 3NGJA 1JPKA 5CJ5A 1OG0A 3R43A 4KRZA 1FWDC 1NJJA 3W6MA 5D8WA 2PGFA 1QK2A 1A5KC 1XLDA 4O8AA 1J6PA 2A21A 1F6PA 3LGGA 3RU6A 3QMTA 3U48A 5E9AA 4TO8A 1JULA 3OGSA 4KWVA 3TR9A 1EO7A 3LXBA 2NQLA 5AZ1A 5A6LA 3RCNA 3EAUA 2QDGA 2VDGA 1YDOA 1BXBA 4IG2B 3AYSA 3LEPA 3L4VA 3WLPA 1PDZA 3WQ8A 5HDRA 3R8RA 4IL0A 3MMWA 1RXOB 4XISA 3W73A 4DJDD 3C86A 4GE8A 3QHOA 2WZEA 2NQ9A 3QY8A 2INEA 1XHGA 3MY9A 3WH9A 5G2HA 5C6MA 3G2GA 1YYAA 3DDMA 3VABA 3N15A 4Q7NA 1G94A 2VT0A 1UZ1A 1OD8A 3HPXA 3QVQA 2Q01A 4TIMA 3GFYA 5A95A 1H1ZA 5D04C 3W1AA 1UD2A 1ICSA 4ZQNA 1VLWA 3DG3A 2QAPA 1OYAA 4QE1A 4CCDA 1UP3A 3TYUA 3GVRA 1EOMA 1DXEA 2EPNA 4HCHA 2J78A 1UUOA 2A7NA 3CGTA 3EWUA 4QIUA 1GQNA 4FNSA 1WOBA 3EOLA 1OT1A 3V7PA 2XZ7A 4XSMA 2XIJA 4L9ZA 2GQ3A 5FJOA 3CT7A 2W61A 1ZP4A 1UYQA 1EC8A 3VCNA 5B7YA 1K77A 1PX4A 5CJNA 1R86A 4EF8A 1VJIA 2QJNA 5C70A 3BG9A 3SCUA 4O11A 4CQ9A 4P7RA 5TBOA 1E0WA 2OGYA 1M68A 3BURA 3H8AA 1YTEA 2XN2A 5CH9A 3PTDA 1VH7A 3FVDA 1WDRA 3CL6A 3KDOA 3AXMA 2UY3A 2GJXB 1EHAA 2X0SA 3VO0A 3WO8A 1DQXA 1TWSA 4KT2A 3UZJA 1QHZA 4ZEPA 2BMBA 3IRSA 3HQ1A 2NW0A 3RRXA 1S46A 3R8HA 3V4BA 2ZZ7A 3DC8A 1V3JA 3W7KA 4LCRA 3EDJA 3DHDA 3OP2A 5HPCA 3L4UA 2VZVA 4GO8A 2DEPA 4GCXA 2IXVA 2ABAA 3PJTA 4ZO8A 2AL2B 4JL2A 3IAQA 1NOWA 2OWWA 3T7VA 3LY0A 3TW7A 4WY0F 2BOFX 2BODX 4ZQOA 4US5D 4PUEA 3HMCA 1KTBA 1WDDA 5T9CE 3H4XA 2EQDA 3WH6A 2DT1A 2OWXA 1WBJA 1GQLA 3KOYA 1VCGA 1NDZA 1ITUA 3VNIA 5CG0A 4H6QA 1ZBWA 2PB1A 1E43A 1OEPA 1YXDA 2R1LA 3W1PA 3JR2A 3AZSA 4XVEA 1XCFA 2WMJA 5A1AA 4J3WA 1TIMA 1KQYA 1KGXA 2CXGA 4WY0A 3W7RA 2UV8G 1EYEA 1PKLA 2ZZ4A 1ZNNA 2ZUTA 1SZEA 4HHPA 3TFCA 3CEUA 1WDQA 3GVVA 4KETA 3UF9A 5AC5A 4O14A 2D3LA 1FDZA 4DY1A 3UA3A 3T0BA 4CVWA 1W3HA 3HN3A 3WBYA 4LUIA 4KWSA 1JCYA 3B0UX 4DF0A 5EMMA 2VUYA 2C3ZA 3RR4A 1OYBA 3D3AA 3MWAA 4RNHA 4V1XA 4D6GA 4PTNA 1EJTC 3SCPA 2GDVA 3MI2A 4RZ4A 2ZWZA 3WLSA 4A8LA 1VQTA 3AS1A 5K9DA 4DUOA 1HW6A 1EPXA 1KFBA 4UNLA 4L5ZA 2PC8A 3KUMA 5M2FX 3V5FA 3SUTA 1RA5A 1ZSXA 4GZIA 3WD1A 1OCQA 4QEEA 4KEUA 3NZQA 1KRCC 1PEZA 2W4XA 3WK2A 1W8SA 3DYPA 1XDMA 2O9PA 2WHKA 4JTSA 3AALA 3KLKA 4H9VA 2DSZA 4O15A 2VFEA 1OX4A 2Z26A 2QR6A 3PSVA 3TN6A 4QQ3A 3AIVA 4JIEA 2XFYA 5CSYA 1HJVA 1I4NA 3QW4B 1UOKA 2W92A 3LXCA 1HJQA 1Y5WA 4EWJA 3LPPA 4K3ZA 3L66A 1AQ0A 4DHGA 1YDYA 2G3MA 1AJ0A 3PZNA 4C5ZA 2W79A 3UWZA 4B15A 2XWDA 5A8QA 1AFSA 3UPMA 2A5HA 4Q4RA 5HUOA 1BYAA 1QATA 2ZX7A 3QM3A 4J2MA 3AIQA 3LV6A 3B8VA 1QASA 1FH7A 1XLKA 1JAEA 5DMNA 3W7NA 3ARSA 2QUNA 6TIMA 5D2YA 1JVNA 1WAUA 3ZSSA 1P7TB 4Z17A 4OTKA 4IH3A 2Y89A 1UR0A 4HJWA 4BA0A 5FCZA 4PUDA 1P43A 2FZ9A 1JG9A 3MMDA 1H09A 4MPQA 3PBWA 3B04A 3P82A 2FPTA 1R3QA 3Q67A 3UG4A 2Q8LA 1V51A 3CIWA 4NAFA 5FI8A 1F2JA 1QCWA 1R3TA 5I6SA 1X7IA 3LTPA 3W71A 1IR1A 5E70A 1EXPA 4PH6A 2VCBA 4LB4A 1T8XA 3AU6A 2AL1A 4PEEA 3QV9A 4HNCA 1PKYA 1ONEA 2ZRXA 5C9WA 3K8MA 4LVDA 4Z1AA 3VDHA 1UPMB 2ODOA 4DXVA 1FFQA 2PP0A 1PCKA 3VPLA 5LIWX 4M81A 4WIWA 4PGLA 3SQMA 4K37A 1DL3A 3OEXA 5G1MA 4LYPA 1JDEA 4HHHA 2QAFA 4L6OA 1O6IA 1HGWA 4OBRA 3ARRA 3SCRA 1Q8JA 2CBIA 4AH7A 2PRLA 5BOOA 1IEWA 4EIVA 3CPRA 3PPGA 5HK4A 1ZAHA 4LUTA 4CQCA 3RX2A 3AYVA 4NY2A 3A24A 4A22A 3CIVA 1ZP3A 5I0DA 5HQEA 4CEUC 1Q6FA 1IV8A 3NQAA 3GDKA 3VD4A 4XD6A 1IEQA 4DO5A 2X42A 3TYEA 5HWNA 1WZKA 1EBHA 4BEUA 4S3JA 1YRRA 4C90A 4IMDA 4M6QA 1EIXA 1D7KA 1G5AA 3IACA 4EP8C 2ATMA 1U33A 3GRIA 2V5JA 3VGFA 3TWAA 4AHOA 3NL6A 1IXOA 5DELA 3INPA 1E5NA 3S2MA 5A8OA 2PGRA 3F7JA 1J9YA 2GDUA 4PTVA 3GTXA 3EWCA 3EWZA 4DEFA 3WF1A 4ZFCA 1T0OA 3V3WA 3C0QA 8XIAA 1PPIA 1O95A 4HYVA 2E0PA 4HSNA 3UJSA 5CBIA 1S2WA 3ERPA 4JHOA 4XG1A 3OHMB 5JH2A 4IQLA 1GWJA 1RUSA 1JPMA 1UKQA 4GVGA 1Q5MA 1BYCA 1H7NA 3ICJA 5CZ0A 3MW7A 3F1QA 1HO1A 3JS3A 1GVEA 5M03A 3YPIA 1E0UA 4TXEA 1FWBC 2OVLA 2ALRA 4QJ5B 3AROA 1ICPA 3PZQA 4DAIA 4YIWA 3VGBA 4D6HA 2WVTA 4L6DA 4QX4A 3C2OA 1JNDA 1VEMA 3FLUA 3TLLA 3OYZA 3AI0A 3WLTA 3PJXA 3UR7A 3UZXA 2JBMA 3W00A 2JALA 3U57A 4JL1A 5FIPA 3BSGA 1YXCA 1XW8A 1RCXB 4BI5A 4HCDA 3AXXA 1J6OA 1NWTA 4JGDA 4GUGA 1S1RA 4TVDA 1WZMA 1PYFA 1R85A 4J3SA 5A6BD 3AXIA 1GNXA 2PWDA 3BOLA 1CCWB 1CGUA 4NJJA 5AY7A 5T26A 4NU7A 2E25A 3V5OA 3CPGA 4MTVA 2QJMA 2YZRA 3RHGA 2REQB 5TNVA 3HGOA 1SZNA 1SVDA 3S83A 2G8ZA 4PTWA 1FHLA 1EF3A 4IUGA 1KWKA 2V2HA 4RZBA 4GJIA 3T6CA 1EJ7L 4FHAA 4ZE4A 2PLJA 1GJWA 2QMKA 3MJYA 2XIIA 2OQHA 2GPTA 1QI5A 1Z42A 4H9UA 1XV8A 4Z1BA 2FTYA 1A49A 3EA1A 1XYMA 1DTUA 3G1AA 1FP8A 1E0XA 3WLHA 2F6KA 4N4QA 4FX6M 5F2MA 1AMYA 3QSTA 2CHRA 3DOPA 3MUCA 3F5JA 3HFYA 4UOQA 3IRDA 1VKFA 4O0ZA 1EPVA 3EXTA 3ZT7A 3R11A 4Q8TA 1MUWA 1IEIA 4CKQA 3M0VA 5FF7A 1C29A 3UP8A 4MJZA 1KV8A 1TCMA 4HNUA 1KM3A 2OGJA 5AHMA 2PU1A 1DWGM 4UXDA 2V67A 4JIIX 1TKKA 3MDWA 2D22A 4YN5A 1R87A 1OYCA 1QO2A 1WQ5A 3PS7A 4AXKA 4OT7A 3W6LA 3WLKX 5I3JA 5CKSA 4X9SA 1CDGA 4Q4PA 1QHPA 4OFCA 4HBKA 3ABQA 3QN3A 2NT1A 1FUYA 4N9DA 4M51A 3TC6A 1RJRA 3G3DA 4PMJA 3QPEA 4KW2A 1X96A 3CB8A 1MWOA 1WDPA 5A6MA 3TZFA 3EBVA 2HVNA 5CC7A 1XQKA 3CNYA 3GG0A 3M4HA 1V3KA 4RW5A 4I5UA 2D2HA 3ANUA 2FFCA 3MMUA 4Q6XA 2YXGA 4UB9A 4XZBA 3BANA 2VFGA 1O5KA 4MNLA 3H2CA 1VYSX 3W1XA 3B8WA 2A3BA 1GONA 3W2MA 2CKSA 5FD0A 2C13A 2YW4A 3G6MA 1IXNA 3SRKA 4H00A 4WSHA 4PYSA 1LL7A 1QOQA 2ON3A 3GIQA 4TX9A 5GNZA 1QPOA 4B5WA 4PEKA 2FGZA 3CAKA 1LLZA 1MEWA 4XUYA 4YVPA 1K6AA 3B8TA 3M9YA 5DCEA 2CLIA 3E12A 3PB0A 3S1UA 2CHOA 4JR5A 3UGVA 2FLIA 1E6PA 2W63A 5CPOA 3P93A 3IIVA 2QV5A 3NVTA 5A2CA 4J27A 4HMNA 1NIUA 4LS0A 4EOUA 2CLPA 2DT0A 3RLUA 3AIBA 1L6GA 3NQVA 3AIUA 4KCTA 4JIQA 2BV9A 2WANA 4DJDA 3I3DA 1FH8A 2XU2A 1EC7A 4OBTA 3KLLA 3I3BA 3N11A 4PMDA 2Y8UA 4HA3A 3QH2A 4WKAA 3VGHA 3IUDA 1HKJA 2AMXA 2YA2A 2AAMA 3CZ8A 4UNKA 1Q6LA 3L67A 1OHLA 4GD0A 3APYA 3MHFA 3N14A