2BY5X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by5X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by5X02
1P02A 4ISLA 2Z9JA 2J95A 1O3CA 1PFXC 1HAXB 3OTJE 1C2FA 2BXUH 2ZCHP 1O3HA 2ZHWH 2FI4E 3SV6A 1C1UH 1F0UA 3PTNA 3UY9A 4BTTB 1C2IA 3QZRA 1O5CB 3LGTA 1O2ZA 8LPRA 3T2NA 1IQJA 2J2UA 1EAWA 4VGCC 3PLPA 4CRCA 3U1JB 3M5NA 4DIHH 1QB9A 1DXPA 3F68H 3TK6A 1LMWB 3LC5A 1NFUA 3M3SA 2PGBB 1FV9A 1CE5A 1ETTH 3A8DA 1K1MA 1V2JT 1FPHH 1UVTH 5LPRA 5DO4H 3GCHB 1GBIA 3P92A 4A6LA 1GHAF 1O2UA 3GDUA 1ELTA 1Y5BT 3BTTE 5HYOA 1D3PB 1MBQA 5FX6A 3S9AA 5FCRA 1BMNH 5L2YH 3SU0A 2UWLA 2D2DA 1GBMA 2CXVA 2BOHB 3VXEH 1C5TA 1GI8B 1IHSH 4OGXA 1DANH 4AFQA 2G8TA 4B74A 3UNRA 2FS9A 3ATLA 4X1SU 2G00A 1KXEA 1SFQB 5LPEA 2A5AA 1LPGB 3GY4A 3RXBA 3U69H 3TH3H 4QT8C 1UVSH 2PUQH 2ZDLA 1SGTA 3FZDA 1OS8A 2B8OH 1FLEE 2BHGA 3OY6U 4K1EA 1SOZA 7GCHG 1GHWH 1DWCH 5TJXA 2GZ8A 1TAWA 1L4DA 1RJXB 2BY8X 3ZVAA 1ETRH 4A7IB 2OC1A 1ZSKA 1P2QA 2QIQA 2WYJA 4ISOA 2GCHG 1O30A 4B76A 1W8BH 2GMTC 1AGJA 4X2VA 1BUIA 5DP3A 4D9RA 1FQ3A 1UK3A 1C5UA 1JBUH 1MD7A 2BD9A 4K8BA 3D49H 3SNDA 4JCNA 3RXJA 1P3EA 2ANKH 1ABJH 1D3QB 1B0EA 2F3CE 1PYTC 3H7TA 2BVSH 1SOTA 1JRTA 1E35B 1UTOA 4O3TA 4X8SH 3HK3B 3ZZ8A 2G5VA 1TBRH 1GBCA 2A4OA 5IYTA 2GV7A 4B2BA 3MH4A 2ZGJA 4I8HA 1P04A 1C5QA 1FY1A 2PLXA 5BPEA 3MMGA 4YLQH 1AVGH 4FU8A 2BOKA 1V2UT 1ZRBA 2XBWA 4RKJB 1EJMA 4TWWA 1G9IE 1G3EA 1P2IA 1VJ9U 3DFLA 3SV2H 1DVAH 1EAUA 3IG6B 1F0TA 1YPMH 1V2NT 1ZGVA 2BD4A 2FXRA 2A4QA 1SLXB 3B8JA 1JRSA 5C3NA 6GCHG 3A8CA 2ULLA 3GCNA 2QXJA 1OXGA 1OWJA 4CHAC 1TNHA 4NA9H 1J16A 1CSOE 1O37A 3RMNH 1KDQA 4B2AA 1EUFA 1MU8B 4GLYA 1GVKB 1O2MA 2A5KA 5HGGA 1TX7A 1O38A 4THNH 2GX4A 1F0SA 1QR3E 3FZZA 3RXSA 1TGNA 1ZMLA 1NRPH 2GD4B 3TNTA 4GPGA 1GJBB 1UK2A 1CT2E 1Y3WA 4K8YA 2A7JA 4Y11E 4YESB 3AW0A 3LJJA 2BDBA 1WTHD 2FOMB 1NFXA 1C5NH 1NY22 1BTWA 2YNAA 2NU2E 4BXSA 1O2OA 2FP7B 4KELA 4I33A 4WY3A 1NRSH 1P9UA 4Y0YE 3GCHC 1O2LA 1CVWH 1GVZA 3GY7A 3LGWA 2AEIH 2ZHDA 2KAIA 4X6PA 2XC0A 2XC5A 1HPGA 3VPKA 2ZGCA 3M5LA 1YPGH 2WPJS 1A3EH 1YPEH 4TY6A 2Z9KA 1MCTA 2KAIB 1TX6A 2J38A 5EW2H 4ISNA 3PLKA 5EPYA 3UOUA 4MDSA 4CRAA 1O5GH 3U1IB 1ETSH 4ZAEA 1O3KA 2A31A 1EOJA 5EXLA 3ZV8A 4D7GA 1GCTC 4B2CA 3VGCB 3ENSB 5I46H 4YZUA 2OCVB 2BD3A 5BRRE 2ZPSA 2SGQE 4K2YA 1KTTB 1P05A 1MKWK 3P8NA 1GMCG 2A2XH 2BD5A 2FX6A 1C5SA 1MZAA 3KNXA 3LOXA 5JPMH 2FWWA 1GBTA 1EJNA 1S85A 2FOEA 1DS2E 4BTIB 1TX8A 4AB9A 2XBXA 1T4VH 1B5GH 3ZZDA 4YOGA 3VB4A 2ZPRA 1FXYA 1SG8B 2JH5D 3P8OA 1BB0B 4Y71A 3SW2B 1ZZZA 2AGIX 1LHGH 1QTFA 2O9QA 2HPPH 4LK4A 3Q77A 2PUXB 1O3IA 1GPZA 1OP2A 1MH0A 1BIOA 2C3SA 2P95A 1A3BH 1K28D 5TCAA 1CHOF 1P01A 2BZAA 4F4OC 1O5AB 1TA2A 4GUXA 5FBIA 3E0PB 2RA3A 1L1GA 1UTJA 1W0ZU 3SJ9A 3SNBA 2Q6DA 1TGTA 2XBVA 3HKJB 1ZLRA 1W13U 1HYLA 3UNQA 7LPRA 1SGQE 1PQ7A 2XTTB 2FS8A 1BITA 1O3GA 1YM0A 1GI7B 2G51A 1ZMJA 1BCUH 1WYKA 3RXDA 2XRCA 1MKXH 3TLOA 2SGDE 1AVWA 3B9FH 3EGKH 1NU9A 1BMLA 2Z94A 2ZU5A 5LH8A 1MTVA 4IBLH 1C2GA 3M37A 1GBHA 2TIOA 3ZYDA 2FDAA 1A0LA 2W3IA 1QJ7B 4H4FA 1WU1A 2PFEA 4INLA 1T4UH 2AGEX 2ZFSA 2XW9A 3M7QA 4MNXA 1AKSA 2TPIZ 2V3OH 3ATIA 4AFUA 3TH2H 1PQAA 1TRYA 1JOUB 4KTSA 2BTCE 1DICA 1TABE 2BY7X 1AKSB 3K2UA 3EYDA 4AGJA 3MHWU 2VH6A 5F03A 2H5CA 1LVYA 1TQ0B 1EXFA 3ZZAA 1V2TT 1WCZA 5HMAA 1UHBB 4DURA 4TWYA 4WWYA 3E0NB 3P8FA 6CHAB 1E37B 3VFEA 4CRBA 3M35A 1ELVA 5EW1H 2FPZA 3SGQE 3MO9A 5DK1A 1GG6B 1O33A 2BVXH 3QTVH 4UEHH 1K1OA 3T27A 3VGCC 1AB9B 1NRRH 4NWLA 2ANMH 1ARBA 2G55A 3A8AA 5DP8A 3BTQE 1CGJE 3DT0H 3SJ8A 3V0XA 2A0QB 1WTGH 3KN2A 2H1UA 4I7YH 4X8TH 3SHCH 5EG4A 1O36A 1RFNA 2BYAX 2VJ1A 4MNVA 1ZPBA 1TPOA 1SGRE 2OP9A 2B9LA 4B75A 2FOCA 1K1PA 3G01A 3PYHA 4X1NU 1NO9H 4AFSA 3GY6A 4X6NA 1O35A 3Q3KA 1YKTA 1QQUA 1EB2A 2ILNA 1HLTH 3RXOA 4JZ1A 1AFEH 7GCHF 3RXGA 2ZHFH 3E1XB 5DP9A 3BG4B 1RTFB 4LOYH 2M5TA 4MLFB 3AASA 1TGCA 4BANB 4CRFA 1AD8H 1SR5C 3F9FA 1P10A 1UK4A 1N1LA 2GCHF 4INHA 1EB1H 3RC6A 7ESTE 5L30H 1SLUB 1WV7H 2VVCA 1NN6A 2PKSB 4JK6A 3FP7E 3S9CA 1YPJH 2FYRA 1P2JA 3KHVA 3OX7U 1S6FA 2AH4X 1C5WB 2ALPA 4GSOA 3FVFB 2PTCE 3PB1E 2BX3A 4CREA 1AUJA 1ORFA 1NC6A 3S0NA 1MU6B 1QB6A 1RD3B 1ELAA 3RC5A 1Z8JB 4GHTA 5LGOA 3SNAA 3TITA 3E6PH 5FPSA 5EQQA 4I8GA 5EU8A 1RXPA 3PO1B 3PV4A 3E8LA 1Y59T 3A89A 1BTUA 1NU7B 3M3VA 1C5RA 1CU1A 3SV8A 1F2SE 1QBOA 1CT4E 1XVOA 3A7VA 2SGAA 2TGTA 1C5YB 1C5XB 1QCPA 2Z9IA 1S0QA 4Y8YA 1BBRE 5T6DA 4NIVA 1IQIA 3I78A 1D3TB 3AAVA 1FI8A 4Y0ZE 2I6QA 1SPJA 1ZTLA 6GCHF 1S84A 1KXFA 1YPLH 1IOEA 2CF8H 3QUMP 3VB3A 3V3MA 4B71A 3RXKA 5JBAS 2V0BA 4UFGH 3TGJE 2FOFA 1PPZA 2VWMA 2F9VA 2FOBA 1HIAB 3C1KA 3P8GA 2ZPQA 1ZRKA 1HDTH 2A2QH 6CHAC 3HPTB 1ZPZA 3GCTF 3QWCH 1V3XA 1C5PA 3A88A 1JIMA 3RXQA 4ABEA 2WV4A 1GG6C 1A61H 3O8BA 4UFDH 1TOMH 3PMJA 2J94A 1G2MA 1GHXH 2QF3A 4MNYA 4YM9A 5LPFA 2AMQA 2BLVA 2QY0B 1AB9C 3RXCA 2SGFE 4FVDA 5JBCS 4DGJA 1GI3A 3UREA 2FI3E 2FESH 1IAUA 2ZGBH 4U01A 5AHGH 1HCGA 2BY9X 2VWLA 5FXLA 2FOHA 5HXFA 3ZZ7A 1GBDA 5A0CA 3A82A 3NK8A 2O8LA 1VCQA 5A8ZA 4D9QA 1KSNA 4ZHLU 1L1NA 3NZIA 3EA8A 4OS2A 2ZDVH 2JETB 2ZFPH 2AIQA 2Z3EA 5A8XA 2CJIA 1O5FH 2OD3B 2IOTA 2VWNA 2PHBA 3BTKE 2ZIQH 2NU1E 1QB1A 2R0LA 1GI6A 3GYMA 2Z3DA 1DM4B 3BTWE 1MKWH 1LKAA 1OWKA 3MYWA 1SGDE 1QBNA 1EX3A 5E8EH 1KY9A 3BTHE 2B5TB 3EA7A 1DY8A 1YC0A 1NFWA 2ZDKA 1LPZB 1IHTH 1PQ8A 3BG4C 4XBCA 1J14A 2ZA5A 1LKBA 1WUNH 4ZXYH 3E90B 4OS5A 1AHTH 5CHAB 1HGTH 2BB4A 1A5IA 4AX9H 2ZDAH 1OWEA 2ZDMA 1MQ5A 1ABIH 1BTHH 1O3DA 5HM9A 2QA9E 4X2XA 3BIUH 2PKSC 2FMJA 5J4SA 1O2RA 1C4Y2 1ELBA 1C1SA 4GCHG 1DFPA 5DGJA 2UUYA 1VCPA 2J9NA 1V2QT 1A1RA 2IN2A 1F5KU 5G4BA 1C4U2 5DKMA 1OP0A 1V2ST 4XE4A 2G4UA 4OS4A 5EPNA 3S7KB 2EEKA 3UTUH 5E2PA 1LHEH 4H42U 3EA9A 2OC7A 3PO1C 1KLIH 5E0JA 1C5LH 1ARCA 1SGFG 1TONA 3B23B 1T32A 1BJVA 1O3AA 1C2LA 1KXAA 4IMQA 4IMZA 1W7XH 1GCTB 3TIUA 3DD2H 2GZ7A 3M7TA 4XBBA 1Y8TA 4AG1A 1V2WT 1P57B 4GHQA 3LGYA 1X7AC 3A7YA 2FM2A 1D6RA 1MTNB 1P2MA 1ZGIA 1Z1JA 2W7UA 4MPXA 1VZQH 3ZVDA 1GJ9B 4K1TA 1SGEE 5CE1A 4O97A 3P95A 2QCYA 2WUCA 5E0HA 3SOSA 4IN1A 2YNBA 2RCEA 1RTKA 1ZOMA 2OXSA 1K21H 3GCOA 4ZKSU 3ZVEA 3FFGA 1FN8A 2O8UA 4K3JA 4AYVB 4CRDA 1IQGA 3ZZ3A 1FMGA 3RMLH 1ANEA 1PJPA 2J92A 4UFFH 2NU0E 5J4QA 3D65E 3EQ0H 4SGBE 2BDAA 3K6ZA 4E06H 2V3HH 1H1BA 3UR9A 2VIPA 2AGGX 1FPCH 1P09A 2A4RA 1GI4A 4DOQA 4ABJA 2K1QA 3A87A 1BJUA 2R3YA 4Y76A 1PPHE 5H4IB 4RN6A 1FJSA 2BZ6H 1TNLA 1GCDA 2H9HA 3LC3A 3BG8A 1LQEA 3F9HA 2H9TH 2JETC 3A7XA 2AYWA 4BAKB 4Y10E 1O2XA 1TBZH 1O3OA 1GBEA 2BXTH 4WJG2 4HTCH 1O32A 1MUEB 1ID5H 1HV7A 1XXDA 3SN8A 4MG3A 1SMFE 3UQOA 1CGHA 2GKVE 4CH2B 1F5RA 3ZZ6A 1NFYA 2O8WA 2SFAA 4IGDA 4Q7ZA 4XOJA 4O3UA 2BDCA 1O2GH 1IQFA 1YF4A 1GDUA 2OC8A 5F6MA 1KDQB 1AUTC 1A0HB 1WQVH 3EDXB 5CHAC 4NSYA 1OYQA 3GCTG 2GT7A 3GY2A 5DP5A 1Z6EA 4NA7A 4NGAH 2BLOA 1HXEH 2BX4A 1S6HA 1G36A 1MTWA 2O8MA 2TRMA 3A7WA 2ANYA 7KMEH 3LH1A 5JBBS 5EOKA 2XYAA 2GCTB 5I25A 1QY6A 1ZTJA 3L33A 4DW2U 1UCYH 3ZV9A 1O3JA 3MWIU 1O3MA 1V6DA 4FUHA 3P17H 4ZXXH 3UWIA 3OYPA 4ABGA 2SGPE 2WPMS 1S83A 1UTPA 3RU4D 2XC4A 1EZXC 2ZEBA 3GDVA 4Y6DA 1O3FA 3MFJA 1LHFH 1UMAH 4GVUA 1LVBA 1SGCA 4AYYB 1AE8H 2G81E 3IWMA 3FAOA 4ABAA 4IW4E 4A1XA 2ZNKH 2BQ7B 3GOVB 3RUOA 1M9UA 1QFKH 5ETXA 2VIOA 4BAOB 8ESTE 1U6QA 1P12E 4WVPE 4I8KA 1O5EH 1SC8U 3SU3A 1KXDA 2ZI2H 3QX5H 2BMGB 1MTNC 3AVZA 1AO5A 3QGJA 1TMBH 1QQ4A 1QIXB 1B0FA 1A5GH 1C5ZB 3RLWH 1ZJKA 4A5TS 1ZHRA 1VJAU 3RXUA 1GJAB 3BTFE 2Z9GA 3LH3A 1GI1A 5JB8S 1SSXA 1A0JA 1W11U 3RM2H 3RP2A 5C2ZA 2ANWA 3SUDA 4FXGH 1P11E 2THFB 2VH0A 4WH6A 4DJZB 1ELFA 2ZTXA 1E0FD 2ZGXH 2ESTE 2JH0D 5TCCA 1GWAA 4LZ4B 1L4ZA 1QL9A 2FLBH 5FAHA 1A4WH 4OS6A 1UTNA 1SLWB 4DY7B 1A2CH 4XBDA 3STJA 1TRMA 3F6UH 1P0SH 1S5SA 1EKBB 1YPHC 3U98H 1TA6A 1TWXB 2XWBI 3TJOA 3MU0A 3S69A 3URDA 2FOAA 3TJVA 1MTUA 2ZFQH 2QN5T 4NSVA 5EGMA 1CGIE 1O2YA 1UVOA 4CR5A 2R9PA 1W7GH 1RRKA 3N7OA 2DE8A 1AWFH 1ANBA 2WV5A 3R3GB 1KLTA 5EODA 1K22H 3O8DA 1TALA 1FY8E 2A32A 2Q6GA 3KF2A 2HOBA 2VINA 4WMEA 1Y5UT 3BTGE 4JK5A 3RLYH 1SGIB 1AU8A 1SBWA 1GBFA 2ZFRH 1L0ZA 4WF8A 4O9VA 5FPTA 1FDPA 3SQEE 2A1DB 1G37A 3RXFA 3V12A 3TPIZ 1YCPM 2G5NA 3ZVBA 1NESE 2ZQ2A 1MD8A 4D8NA 2HVXA 4NFFA 3MNXA 1CBWB 1QRXA 2P3UB 1DY9A 2BQWB 2FZZA 5A2MH 2FX4A 1WBGB 1Z71A 2OQUA 3HGPA 2DUCA 1ELEE 2IPHA 1FY4A 1KLJH 3CENA 4WMDA 2ASUB 1MAYA 2F9PA 1SQAA 5A8YA 4YLUA 1TNGA 4ABDA 3GY5A 3TK9A 1DWDH 1ESAA 2C8XB 1Z8IB 1DOJA 1GBJA 1C2MA 1P2OA 2GVFA 1O3BA 2BLWA 2GCTC 1UVUH 1SLVB 1AIXH 3ATWA 1OWIA 1SI5H 1VITH 2Q1JA 1LVOA 1SL3A 5A09A 4AFZA 1GJ8B 3VB6A 2W7SA 1F0RA 2D1JA 4FUFA 1YPKH 2P3TB 4Y7BA 3MNBA 5DP7A 1HFDA 3RM0H 1TRNA 1BHXB 1O2KA 1T31A 2OTVA 1C4V2 1P9SA 3MNSA 1OP8A 2TGPZ 1A46H 3UNSA 4MPUA 1RTLA 4E05H 1EP5A 1C1TA 5EXNA 4DCDA 3HKIB 1GBLA 4GCHF 4MQAA 5DJ7A 1NPMA 1TQ7B 1TIOA 4WXIA 4ZHMU 4INKA 1C1MA 1HAGE 2GTBA 1YGCH 1A7SA 1SHYA 2EI6A 3MI4A 1K1IA 1D4PB 3ZVFA 5B6OA 1LVMA 5C20A 1DXWA 1GBAA 3QDZB 2EA3A 3M7UA 4JYUH 1EPTA 2BY5X 1YYY1 5DP6A 1E34B 5JBTA 1XUKA 2Y7XA 3LDXH 4PROA 3NWUA 1JMOH 1D6WA 2XWAA 5L6NH 2QXHA 2C8YB 4MNWA 4ABFA 1O3EA 1HUTH 1EZQA 1FIZA 4NG9H 4OS1A 4TPYA 1UO6A 2H5DA 3V7TA 1UTQA 1UJ1A 4KP0A 5FX5A 2A7CA 1TGSZ 1O3NA 1VITG 1BMAA 1V2VT 3M3TA 3RXMA 3FP6E 1BHXF 3TNSA 1DSUA 1GGDB 1YLDA 1HJ8A 1GI9B 1C2DA 3ZZ9A 2QXIA 4R0IA 2Z7FE 1UCYK 1BOQA 4BXWA 1ESTA 1DWEH 1MBMA 1T8LA 2C4FH 1RGQA 3ZZ4A 1P03A 3STIA 1GMHF 1XX9A 1GDNA 4IC5A 2O8TA 1BMMH 2QV1A 3PMBB 2Z9LA 1QRZA 3UQVA 1AZ8A 4Q7YA 1C1QA 1BDAA 1KIGH 3H7OA 4ESTE 1XUFA 3F9GA 1K1JA 2P93A 2ZU2A 1HJAB 4CBNA 1V2KT 2V35A 1AY6H 1O2TA 1OPHB 2A5IA 2HNTF 2XNIA 2P94A 2XCFA 1SGNE 3C27B 1DE7H 1J9CH 4RSPA 3L3TA 1VGCB 1EQ9A 3TU7H 2EI8A 1ZHMA 1S0RA 1NRNH 1TOCB 3SNCA 2WYGA 2UWOA 3ELAH 4YO9A 3NPSA 3QTOH 4KGAA 2VIQA 1OX1A 2P59A 3CS0A 1IQNA 4FVBA 2JH6D 3JZ1B 5CMXH 4CH8B 4CRGA 4NIXA 1CBWC 5IDKA 3KEEA 1ELGA 1DUAA 1GL1A 2AS9A 1YLCA 5F8ZA 2A7HA 2D26C 3WY8A 1JIRA 3P70B 4JYTA 2FTMA 1NT1A 1O2JA 2Y7ZA 4NZLA 1HRTH 4WMFA 1EZSC 1JXPA 4AORA 2BD8A 3SI3H 3CS7A 4ASHA 3SNEA 1C5VA 2ZU1A 3GDSA 2ZFTA 3TJNA 3LKWA 1TPPA 1P8VC 4OS7A 1W10U 2LPRA 3D62A 1GHZA 2FI5E 3PMHB 4RKOB 4KKDA 4WXVA 1GJ6A 4U32A 1CT0E 2HRVA 4D76A 4HI3A 1NRQH 4UD9H 1C2HA 1C1NA 1GI0A 1GJCB 3HK6B 4ZMAH 4AG2A 3SV9A 1O2QA 4AN7A 1SHHB 3W94A 4AGKA 1DDJA 6ESTA 2AIPA 1EATA 3LGUA 3BEUA 3BIVH 4K5ZA 3ZYEA 1VCWA 3QK1A 2OC0A 1YCPH 4HZHA 1FZZA 2HGTH 1QURH 1ANCA 3SBKA 4IC6A 2Q6FA 4FUCA 2PKAA 2RG3A 2BVRH 1FONA 4X1QU 3H5CB 3CP7A 3MH6A 3E3TA 4B1TA 1FIWA 2BM2A 2HNTC 1HBTH 1HAZB 1OSSA 2F83A 1QJ1B 1CHGA 1HAOH 1PPBH 1XUGA 1HAVA 1EPTC 2CMYA 2C93B 1T8MA 4BAMB 3E16B 1ZR0A 3PWBA 4WH8A 1V2OT 2JKHA 3KQCA 1OOKB 2C8ZB 2BD2A 4ZROA 1GGDC 3TGIE 2XBYA 9ESTA 2VIWA 2WINI 1GMDG 1TNIA 1KXBA 3A85A 2GDEH 5FCKA 5AF9H 4MPVA 1ZMNA 1XKAC 1Z7KA 1YBWA 2A45B 8GCHF 3BN9A 1A5HA 1QRWA 5GPIB 1GHBF 4U2WA 4FUGA 3SU1A 3ZVCA 3A86A 4DG4A 2BQ6B 3I77A 2SGEE 1GI2A 3LIWA 1THSH 5JB9S 1ANDA 2GT8A 1KYNA 3ODDA 1HJAC 1CO7E 4NCYA 1TB6H 4D7FA 1Q31A 3EE0B 2ZFFH 4Z6AH 3GY3A 4J2YB 5K7RA 1O2HA 1VGCC 1H8IH 3RXLA 3SI4H 1QL7A 1IQHA 1TGBA 4FUDA 1DLKB 1ZPCA 4FU9A 1AN1E 1ZSJA 3GICB 2FTLE 4X2WA 1BA8B 4GAWA 5JYIA 1RIWB 2ALVA 3SGBE 3K6YA 2AMDA 3IITA 1IQEA 1SB1H 3SU5A 1J15A 3NUMA 3A7ZA 4AZ2B 2BDHA 2QF0A 2FOGA 1PPCE 1DPOA 3MO3A 1WSSH 4BOHA 1LPKB 3GYLB 2QGRA 4Q80A 3BEFB 4JYVH 4ZKRU 3BEIB 1N6YA 5SGAE 1NTPA 2PSYA 1O2NA 3L6PA 2CHAB 3Q3XA 4TPIZ 1H9LB 3T62A 2F9NA 3VXFH 1Q3XA 3LU9B 1C2EA 1GMHG 1W3CA 1E38B 4ZH8A 4E7RG 1K2I1 2ODQA 2Y5FA 4NWKA 3FP8E 2G4TA 4HGCA 3RXIA 3S7HB 1P2NA 2R0KA 1Z8GA 2ZF0H 2GV6A 4YT6H 3O8CA 3TGKE 1G3BA 3BSQA 3QO6A 1DWBH 1S82A 2ZHQH 5C1YA 4ZKNU 1WAYB 3RXVA 5GXPA 3RDZA 1D3DB 1BTPA 1P3CA 5PTPA 4X8UH 2VIVA 1UVPA 2Y80A 1ZYOA 2CN0H 3LGIA 4AOQA 3S9BA 1W2KH 3ODFA 1QBVH 3RMMH 1C9PA 3E91A 1ACBE 4FU7A 3SHAH 4H6TA 1YPHE 4ZUHA 4X1RU 3PROA 4LXBH 1LDTT 1MTSA 3RXTA 1BBRH 1C1VH 2WUBA 1Z8RA 3MH5A 9LPRA 3K65B 1C1OA 3A84A 1DUEA 4AB8A 1TNJA 1GBBA 4I31A 1ZTKA 4Z0KA 2I6SA 1Y3XA 1THRH 2VVVA 1TNKA 1UTKA 2IJOB 4Y8ZA 3UR6A 3MO6A 1THPB 4JZEH 5FHTA 3P6ZB 2OUAA 3KQBA 3A7TA 4X1PU 1TBQH 2R2MB 2ZQ1A 1C2KA 2Y82A 2RDLA 1MQ6A 1C2JA 2QC2A 5DG6A 3OY5U 2GZ9A 1EP6A 1G2LA 3SV7A 2NU4E 3ZVGA 3R0FA 1Y3YA 3T26A 4A1TA 1TMUH 2F9UA 1QL8A 1T8OA 1BQYA 1H9HE 2Y81A 4HFPB 5EQSA 2Z3CA 3SQHE 1HJ9A 1AMHA 1VITF 1FN6A 1NROH 4NIWA 2P8OB 1FAKH 4BTUB 3NKKA 2P3FH 1ZSLA 4H6SB 3BTME 1YCPK 2OLGA 3SU2A 3K9XB 1N6XA 1PPFE 3DHKH 1AFQB 2FODA 1XM1A 4A1VA 4E7NA 1O0DH 2C90B 3QLPH 1DT2A 2AERH 3BTEE 1UTLM 2W26A 1RIWC 1EOLA 2Y6TA 1FUJA 3AW1A 2ZGHA 3M36A 1NM6A 3SJKA 1BRUP 1GVLA 2ZZUH 1VR1H 2H9EH 3U9AH 1HAPH 3SJIA 2OQ5A 1G3CA 3PMAB 2H6MA 4Y79A 1NS3A 1LTOA 3MU5A 1O3LA 1PPEE 2VGCB 2NWNA 1Y3VA 2D8WA 3M5OA 2ZECA 4K1SA 3U8TH 4XFQA 5A0BA 1GI5A 3SGAE 2BDIA 1W12U 2CHAC 4R8TB 3JZ2B 4BAQB 5C5OA 2OBOA 4FUEA 2PV9B 1JWTA 3VB7A 1BZXE 5F8TA 1XUJA 2BDGA 4DT7B 8GCHG 2G52A 1GHBG 1H4WA 1GJDB 4TY7A 1AVXA 5GCHG 1MMJN 3RXAA 2WPHS 4ZKOU 1F7ZA 1BRAA 1FNIA 1O2WA 3RU4E 3SO3A 5C5NA 1AI8H 1E36B 2ZU3A 3GISB 4OGYA 1QNJA 2ZCLP 3ZZ5A 1G3DA 1C5OH 3MOCA 4NFEA 2CV3A 1V2PT 1H8DH 1LHDH 1N8OB 2QYIA 2FO9A 1NZQH 3KQDA 1BT7A 3A80A 4X8VH 1SGPE 4ISHH 1HAHH 5T3HA 3DUXH 1K9OE 2BLQA 2PTNA 1OKXA 4KTUA 1QJ6B 1QA0A 3QZQA 1V2RT 1O2SA 1XVMA 3MU1A 1GJ5H 1DSTA 3MU4A 5DPAA 1J17T 1YP9A 4KTCA 4NZQA 2Y5GA 1TE0A 3MNCA 1D9IA 1GHAG 1GDQA 1SVPA 3M5MA 4U30A 4A92A 5L2ZH 3KGPA 5FPYA 4SGAE 1ZHPA 1HNEE 5K0HA 1C1PA 1TLDA 1ZJDA 4ABBA 4BNRA 2FEQH 8KME2 1SQOA 2XCNA 1ELCA 1SFIA 3W95A 2OBQA 3ATMA 2F91A 1EZUC 4NA8A 3NCLA 1CQQA 2HLCA 3RU4T 2UWPA 2FIRH 2ZC9H 5FBEA 1AWHB 3KQEA 1LQDB 1MAXA 3RXHA 3RXEA 1LCYA 3PWCA 1HAYB 2HPQH 3SJOA 1OWHA 4JZIA 2XXLA 2C8WB 3PTBA 1Z6JH 3PLBA 5AFYH 5JDUB 2NU3E 3UWJH 3AAUA 5A0AE 4MVNA 3A81A 5GIBA 1EJAA 2TBSA 1GJ7B 4YOIA 2FLRH 2P8OC 1QGFA 3BTDE 3Q00A 1FAXA 5EXMA 1SGFA 3FANA 3QN7A 1MCVA 3LGVA 1GMDF 1AFQC 1PPGE 1ELDE 1DITH 1O2VA 1XXFA 4UDWH 3U8OH 2WPIS 1UHBA 3U8RH 4JZFH 3RC4A 1K1NA 4LZ1H 1BBRK 2LNCA 1EASA 2H2ZA 1BRCE 2SNVA 5C67A 2ODPA 1GL0E 4IN2A 1O5BB 1T7CA 1IQMA 2GDDA 4J1YA 2PWXA 2ZTZA 1FY5A 2ZHEH 1C5MD 2UUJB 2SNWA 2VGCC 2W3KA 1ESBA 4I32A 4JZDH 2Z6BD 3ZZBA 1P06A 3M61U 2P16A 1OYTH 4UE7H 1L1JA 5F8XA 1TPSA 2R2WU 4FUBA 1O34A 4Q7XA 1RS0A 2F9OA 1XUHA 4B73A 5GJ4B 2GP9B 2VVUA 1F92A 5C1XA 1EPTB 1KTSB 1TFXA 3I29A 2ZKSA 3A83A 2V6NA 2HNTE 1DX5M 4X6MA 1LHCH 5GWZA 4ABIA 1G30B 3D23A 4IS5A 3NXPA 1XKBC 2CF9H 4Y8XA 1L2EA 1N8OC 1V2MT 2BD7A 2VWOA 1IQKA 1V2LT 2ZP0H 1KXCA 2RA0A 3UPEA 1S81A 4YT7H 2OINA 4ZHAA 3RMOH 2PSXA 3ITIA 3Q76A 2ZCKP 5DP4A 3MH7A 1CA0B 2ZG0H 2F9BH 5E2OA 4O03A 1WQSA 3SUGA 4F49A 4FUJA 5E0GA 1SGYE 1P2KA 2PGQB 4Q2KA 3BV9B 2TGDA 1B7XB 1SQTA 6LPRA 4I8JA 3ATKA 3KCGH 5EQRA 3LJOA 1XMNB 5HM2A 1Y3UA 5AVDA 2ZDNA 2QAAA 1TPAE 2EC9H 4VGCB 3UFAA 2FYQA 1UTMA 3SU4A 1TMTH 2PW8H 2AMPA 1DLEA 1HAIH 5T6GA 3EAJA 4DIIH 3SUEA 4BAHB 1O2PA 4YTAA 1K1LA 3TH4H 2BY6X 2VU8E 3LPRA 1C1WH 1QHRB 2R3UA 5ESTE 2UUFB 3DA9B 2QXGA 4DVAU 5ESBA 1CA8B 3ESTA 4X2YA 2WPKS 1HXFH 1C1RA 1FY3A 3UUZA 3MTYA 3GY8A 3T28A 1O5DH 4JMYA 3ZZCA 4ABHA 1AQ7A 1BTXA 3VEQB 2DE9A 4K69A 1AE5A 3TJUA 4X0WU 2EI7A 4M7GA 2GGVB 3QGNB 3RXPA 1W14U 1F5LA 1Y5AT 2B7DH 3MU8A 5T6FA 1XUIA 2AFQB 1BRBE 2WPLS 1HB0B 2VIDA 5ABWA 4K60A 4MTBA 3SUFA 3VB5A 4CBOA 1PYTD 1GHYH 2J34A 2Y5HA 1HIAA 4TYDA 1CHOG 1INCA 3UIRA 3O8RA 4ISIH 5AFZH 1O3PB 1O39A 3OU0A 1C9TA 1O31A 3HGNA 3T29A 2HALA 3TK5A 3LT3A 3KL6A 2YOLA 1QA7A 4Y7AA 1O2IA 2GMTB 2ZTYA 3F1SB 1BTZA 2CGAA 3A8BA 1GBKA 5C1UA 2UUKB 3TVJB 2TGAA 2A4GA 1WOFA 1G32B 3OSYA 3URCA 2ODYB 3LONA 2PKAB 2ZWLH 2ZO3H 1EAIA 2BDYA 2B0FA 3PM3A 2PR3A 3V13A 3SU6A 1MKXK 5GDSH 2W5EA 1IQLA 1GJ4H 3UOPA 3KIDU 3T25A 1LO6A 4NIYA 1UCYE 1HAVB 3F9EA 4XSKU 4UFEH 3SZNA 1W0YH 1AZZA 3HATH 4YOJA 4FUIA 2STAE 2STBE 1J8AA 1Z1IA 3DFJA 2ZU4A 3SORA 1OWDA 1T8NA 1BTYA 1EAXA 1Q2WA 1MZDA 1PQ5A 3BF6H 4XDEA 4X6OA 3T5FH 4I8LA 1TYNA 3RXRA 4UONA 1CA0C 4MPWA 3Q3YA 4CR9A 4CHAB 2J4IA 5GCHF 1GMCF 2VNTA 1GHVH 1H9IE 2HWLB 2VB0A
chains in the Genus database with same CATH superfamily
1P02A 4ISLA 2Z9JA 2J95A 1O3CA 1PFXC 1HAXB 3OTJE 5KECA 1C2FA 2BXUH 2ZCHP 1O3HA 2ZHWH 2FI4E 3SV6A 1C1UH 1F0UA 3PTNA 3UY9A 4BTTB 1C2IA 3QZRA 1O5CB 3LGTA 1O2ZA 8LPRA 3T2NA 1IQJA 2J2UA 1EAWA 4Q63A 3PLPA 4VGCC 4CRCA 3M5NA 3U1JB 1QB9A 4DIHH 1DXPA 3F68H 3TK6A 1LMWB 3LC5A 1NFUA 3M3SA 2PGBB 1FV9A 1CE5A 1ETTH 3A8DA 1K1MA 1V2JT 1FPHH 1UVTH 5LPRA 5DO4H 3GCHB 1OHHD 1GBIA 3P92A 4A6LA 1GHAF 1O2UA 3GDUA 1ELTA 1Y5BT 3BTTE 5HYOA 1D3PB 1MBQA 5FX6A 3S9AA 5FCRA 1BMNH 2EY4C 5L2YH 3SU0A 3H09A 2UWLA 2D2DA 1GBMA 2CXVA 2BOHB 3VXEH 1C5TA 1GI8B 1IHSH 4OGXA 1DANH 4AFQA 2G8TA 4B74A 3UNRA 2FS9A 2RDEA 3ATLA 4X1SU 2G00A 1KXEA 1SFQB 5LPEA 2A5AA 1LPGB 3GY4A 3RXBA 3U69H 3TH3H 4QT8C 1UVSH 2PUQH 2ZDLA 1SGTA 3FZDA 1OS8A 2B8OH 1FLEE 2BHGA 3OTPA 3OY6U 4K1EA 1SOZA 7GCHG 1GHWH 1DWCH 1S6LA 2GZ8A 1TAWA 1L4DA 1RJXB 2BY8X 5TJXA 3ZVAA 1ETRH 4A7IB 2OC1A 3ZIAD 1ZSKA 1P2QA 2QIQA 2WYJA 2XOKD 4ISOA 2GCHG 1O30A 2JDID 4B76A 1W8BH 2GMTC 1AGJA 3SZEA 4X2VA 1BUIA 3FO8D 5DP3A 4D9RA 1FQ3A 1UK3A 1C5UA 1JBUH 1MD7A 4DT4A 2BD9A 4K8BA 3D49H 4TT3D 3SNDA 4JCNA 4P02A 3RXJA 1P3EA 2ANKH 1ABJH 1D3QB 1B0EA 4Z1MD 2F3CE 1PYTC 3H7TA 2BVSH 1SOTA 1JRTA 1E35B 1UTOA 4O3TA 4X8SH 3HK3B 3ZZ8A 2G5VA 1TBRH 1GBCA 2A4OA 5IYTA 2GV7A 4B2BA 2W6JD 3MH4A 2ZGJA 4I8HA 1P04A 1C5QA 1FY1A 2PLXA 5BPEA 1W0JD 3MMGA 4YLQH 1AVGH 4FU8A 2BOKA 1V2UT 1ZRBA 2XBWA 4RKJB 2L74A 1EJMA 4TWWA 1G9IE 1G3EA 1P2IA 1VJ9U 3UAIC 5T1VA 3DFLA 3SV2H 1QZ8A 1DVAH 1EAUA 3IG6B 1F0TA 1YPMH 1V2NT 1ZGVA 2BD4A 2FXRA 2A4QA 1SLXB 3B8JA 1JRSA 5C3NA 6GCHG 3A8CA 2ULLA 3GCNA 2QXJA 1OXGA 1OWJA 4CHAC 1TNHA 3PV5A 4NA9H 1J16A 1CSOE 1O37A 3RMNH 1KDQA 4B2AA 1E1RD 1EUFA 1MU8B 4GLYA 1GVKB 1O2MA 2A5KA 2F4LA 5HGGA 1TX7A 1O38A 4THNH 2GX4A 1F0SA 1QR3E 3FZZA 3RXSA 1TGNA 1ZMLA 1NRPH 2GD4B 3TNTA 4GPGA 2KCAA 3F0PA 1GJBB 1UK2A 1CT2E 1Y3WA 4K8YA 2A7JA 4Y11E 4YESB 3AW0A 3LJJA 2BDBA 4XD7D 1WTHD 2FOMB 1NFXA 1C5NH 1NY22 1BTWA 2YNAA 2NU2E 4BXSA 1O2OA 1E79D 2FP7B 4KELA 4I33A 4WY3A 1NRSH 1P9UA 4Y0YE 3GCHC 1O2LA 1CVWH 1GVZA 3GY7A 3LGWA 2AEIH 2ZHDA 2KAIA 4X6PA 2XC0A 2XC5A 1HPGA 3VPKA 2ZGCA 3M5LA 1YPGH 2WPJS 1A3EH 1YPEH 4TY6A 2Z9KA 1MCTA 2KAIB 1TX6A 2J38A 5EW2H 4ISNA 2WHXA 3PLKA 5EPYA 3UOUA 4MDSA 4CRAA 1O5GH 3U1IB 1ETSH 4ZAEA 1O3KA 2A31A 1EOJA 5EXLA 3ZV8A 4D7GA 1GCTC 4B2CA 3VGCB 3ENSB 5I46H 4YZUA 2OCVB 2BD3A 5BRRE 2ZPSA 2SGQE 4K2YA 1KTTB 1P05A 1MKWK 3P8NA 1GMCG 2A2XH 2FX6A 2BD5A 1C5SA 1MZAA 3KNXA 3LOXA 5JPMH 2FWWA 1YLNA 1GBTA 1EJNA 1S85A 2FOEA 1DS2E 4BTIB 1TX8A 4AB9A 2XBXA 1T4VH 1B5GH 3ZZDA 2WSSD 4YOGA 2M2AA 3VB4A 2ZPRA 1FXYA 1SG8B 2JH5D 3P8OA 1BB0B 4Y71A 3SW2B 3OE7D 1ZZZA 2AGIX 1LHGH 1QTFA 2O9QA 2HPPH 4LK4A 3Q77A 2PUXB 3PRDA 4AC9A 1O3IA 1GPZA 3F0OA 1OP2A 1MH0A 1BIOA 2C3SA 2P95A 1A3BH 1K28D 5TCAA 1CHOF 1P01A 2BZAA 4F4OC 2KFWA 1O5AB 1TA2A 4GUXA 5FBIA 3E0PB 2RA3A 1L1GA 1UTJA 1W0ZU 3SJ9A 3SNBA 2Q6DA 1TGTA 2XBVA 3HKJB 1ZLRA 1W13U 1HYLA 4YXWD 3UNQA 7LPRA 1SGQE 1PQ7A 2XTTB 2FS8A 1BITA 1O3GA 1YM0A 1GI7B 2G51A 1ZMJA 1BCUH 1WYKA 3RXDA 2XRCA 1MKXH 3WWFA 3TLOA 2SGDE 1AVWA 3B9FH 3EGKH 1NU9A 1BMLA 2Z94A 2ZU5A 5LH8A 1MTVA 4IBLH 1C2GA 3M37A 1GBHA 2TIOA 3ZYDA 2FDAA 1A0LA 2W3IA 2KM0A 1QJ7B 4H4FA 1WU1A 2PFEA 4INLA 1T4UH 2AGEX 4F48B 2ZFSA 2XW9A 3M7QA 4MNXA 1AKSA 2F43B 2TPIZ 2V3OH 3ATIA 4AFUA 3TH2H 1PQAA 2RFKC 1TRYA 1JOUB 4KTSA 2BTCE 1DICA 1TABE 2BY7X 1AKSB 3K2UA 3EYDA 1NBMD 4AGJA 3MHWU 2VH6A 5F03A 2H5CA 1LVYA 1TQ0B 1EXFA 3ZZAA 1V2TT 1WCZA 5HMAA 1UHBB 4DURA 4TWYA 4WWYA 3E0NB 3P8FA 6CHAB 1E37B 3VFEA 4CRBA 3M35A 1ELVA 2LELA 3F2FA 2FPZA 3SGQE 5EW1H 3MO9A 5DK1A 1GG6B 1O33A 2BVXH 3QTVH 4UEHH 1K1OA 3T27A 2VBCA 3VGCC 1AB9B 1NRRH 4NWLA 2ANMH 1ARBA 2G55A 3A8AA 5DP8A 3BTQE 1CGJE 4B6FA 3GS9A 3DT0H 1VKYA 3SJ8A 3V0XA 2A0QB 3KYGA 1WTGH 3KN2A 4TSFD 2H1UA 4I7YH 4X8TH 3SHCH 5EG4A 1O36A 1RFNA 2BYAX 2VJ1A 4MNVA 1ZPBA 1TPOA 1SGRE 2OP9A 2B9LA 4B75A 2FOCA 1K1PA 3G01A 3PYHA 4X1NU 1NO9H 4AFSA 3GY6A 4X6NA 1O35A 3Q3KA 1YKTA 1QQUA 1EB2A 2ILNA 1HLTH 3RXOA 4JZ1A 1AFEH 7GCHF 3RXGA 2ZHFH 3E1XB 5DP9A 3BG4B 1RTFB 4LOYH 2M5TA 4MLFB 3AASA 3PRBA 1TGCA 4BANB 4CRFA 1AD8H 1SR5C 3F9FA 1P10A 1UK4A 1N1LA 2GCHF 4INHA 1EB1H 3RC6A 7ESTE 5L30H 1SLUB 1WV7H 2VVCA 1NN6A 2PKSB 4JK6A 3FP7E 3S9CA 1YPJH 4M9FA 2FYRA 1P2JA 3KHVA 3OX7U 1S6FA 2AH4X 3DCLA 1C5WB 2ALPA 4GSOA 3FVFB 2PTCE 3PB1E 2J98A 2BX3A 4CREA 1AUJA 1ORFA 1NC6A 3S0NA 1MU6B 1QB6A 1RD3B 1ELAA 3RC5A 2OK5A 1YWUA 1Z8JB 4GHTA 5LGOA 3SNAA 3TITA 3E6PH 5FPSA 5EQQA 4I8GA 5EU8A 1RXPA 3PO1B 3PV4A 3E8LA 1Y59T 3A89A 1BTUA 1NU7B 3M3VA 1C5RA 1CU1A 3SV8A 1F2SE 1QBOA 3FOAA 1CT4E 1XVOA 3SYJA 3A7VA 2SGAA 2TGTA 1C5YB 1C5XB 1QCPA 2Z9IA 1S0QA 4Y8YA 1BBRE 5T6DA 4NIVA 1IQIA 1SKYE 3I78A 1D3TB 3AAVA 1FI8A 4Y0ZE 2I6QA 1SPJA 1ZTLA 6GCHF 1S84A 1KXFA 1YPLH 1IOEA 2CF8H 3QUMP 3VB3A 3V3MA 4B71A 3RXKA 5JBAS 2V0BA 4UFGH 3TGJE 2FOFA 1PPZA 2VWMA 2F9VA 2FOBA 1HIAB 3C1KA 3P8GA 2ZPQA 1ZRKA 2KR7A 5EJLA 1HDTH 2A2QH 6CHAC 3HPTB 1ZPZA 3GCTF 3QWCH 1V3XA 1C5PA 3A88A 1JIMA 1FX0B 3RXQA 4ABEA 2WV4A 1GG6C 5CHBA 1A61H 3O8BA 4UFDH 1TOMH 3PMJA 2J94A 1G2MA 1GHXH 2QF3A 4MNYA 4YM9A 5LPFA 2AMQA 2BLVA 2QY0B 1AB9C 3RXCA 2SGFE 4FVDA 5JBCS 4DGJA 1GI3A 3UREA 2FI3E 2FESH 1IAUA 2ZGBH 4U01A 5AHGH 1HCGA 2BY9X 3OAAD 2VWLA 5FXLA 2FOHA 5HXFA 3ZZ7A 1GBDA 5A0CA 3A82A 3NK8A 2O8LA 1KMHB 1VCQA 5A8ZA 4D9QA 1KSNA 4ZHLU 1L1NA 3NZIA 3EA8A 4OS2A 2ZDVH 2JETB 2ZFPH 2AIQA 2Z3EA 5A8XA 2CJIA 1O5FH 2OD3B 2IOTA 2VWNA 2PHBA 3BTKE 2ZIQH 2NU1E 1QB1A 2R0LA 1YY3A 1GI6A 3GYMA 2Z3DA 1DM4B 3BTWE 1MKWH 1LKAA 1OWKA 3MYWA 1SGDE 1QBNA 1EX3A 5E8EH 1KY9A 3BTHE 2B5TB 3EA7A 1DY8A 1YC0A 1NFWA 2ZDKA 1LPZB 1IHTH 1PQ8A 3BG4C 4XBCA 1J14A 2ZA5A 1LKBA 1WUNH 4ZXYH 3E90B 4OS5A 1AHTH 5CHAB 1HGTH 2BB4A 1A5IA 4AX9H 2ZDAH 1OWEA 2ZDMA 1MQ5A 1ABIH 1BTHH 1O3DA 5HM9A 2QA9E 4X2XA 3BIUH 2PKSC 2FMJA 5J4SA 1O2RA 1C4Y2 1ELBA 1C1SA 4GCHG 1DFPA 5DGJA 2UUYA 1VCPA 2J9NA 4OM9A 1V2QT 1A1RA 2IN2A 1F5KU 5G4BA 1C4U2 5DKMA 1OP0A 3PV2A 1V2ST 4XE4A 2G4UA 4OS4A 5EPNA 3S7KB 2EEKA 3UTUH 5E2PA 1LHEH 4H42U 3EA9A 2OC7A 3PO1C 1K0HA 1KLIH 5E0JA 1C5LH 1ARCA 1SGFG 1TONA 3B23B 1T32A 1BJVA 1O3AA 1C2LA 1KXAA 4IMQA 4IMZA 1W7XH 1GCTB 3TIUA 3DD2H 2GZ7A 3M7TA 4XBBA 1Y8TA 4AG1A 1V2WT 1P57B 4GHQA 3LGYA 1X7AC 3A7YA 2JIZD 2FM2A 1D6RA 1MTNB 1P2MA 1ZGIA 1Z1JA 2W7UA 4MPXA 1VZQH 3ZVDA 1GJ9B 2K8IA 4K1TA 1SGEE 5CE1A 4O97A 3P95A 2QCYA 2WUCA 5E0HA 3SOSA 4IN1A 2YNBA 2RCEA 1RTKA 1ZOMA 2OXSA 1K21H 3GCOA 4ZKSU 3ZVEA 3FFGA 1FN8A 2O8UA 4K3JA 4AYVB 4CRDA 2XNDD 1IQGA 3ZZ3A 2HVYB 1FMGA 3RMLH 1ANEA 1PJPA 2J92A 4UFFH 2NU0E 5J4QA 3D65E 3EQ0H 4SGBE 2BDAA 3K6ZA 4E06H 2V3HH 1H1BA 3UR9A 2VIPA 2AGGX 1FPCH 1P09A 2A4RA 1GI4A 4DOQA 5C17A 4ABJA 5C0UA 3DSOA 2K1QA 4ACBA 3A87A 1BJUA 2R3YA 4Y76A 1PPHE 5H4IB 4RN6A 1FJSA 2BZ6H 1TNLA 1GCDA 2H9HA 3LC3A 3BG8A 1LQEA 3F9HA 2H9TH 2JETC 3A7XA 2AYWA 4BAKB 4Y10E 1O2XA 1TBZH 1O3OA 1GBEA 2BXTH 4WJG2 4HTCH 1O32A 1MUEB 1ID5H 1HV7A 1XXDA 3SN8A 4MG3A 1SMFE 3UQOA 1CGHA 2GKVE 4CH2B 1F5RA 3ZZ6A 1NFYA 2O8WA 2SFAA 4IGDA 4Q7ZA 4XOJA 2KCOA 4O3UA 2BDCA 1O2GH 1IQFA 1YF4A 1GDUA 2OC8A 5F6MA 1KDQB 1AUTC 1A0HB 1WQVH 3EDXB 5CHAC 4NSYA 1OYQA 3GCTG 2GT7A 3GY2A 5DP5A 1Z6EA 4NA7A 4NGAH 2BLOA 2JJ2D 1HXEH 2BX4A 4P00A 1S6HA 1G36A 5EIYA 1MTWA 2O8MA 2TRMA 3A7WA 2ANYA 7KMEH 3LH1A 5JBBS 5EOKA 5EJZA 2XYAA 2GCTB 5I25A 2JJ1D 1QY6A 1ZTJA 3L33A 4DW2U 1UCYH 3ZV9A 1SQRA 1O3JA 3MWIU 1O3MA 1V6DA 4FUHA 3P17H 4ZXXH 3UWIA 3OYPA 4ABGA 2SGPE 2WPMS 1S83A 1UTPA 3RU4D 1WXRA 2XC4A 1EZXC 2ZEBA 3GDVA 4Y6DA 1O3FA 3MFJA 1LHFH 1UMAH 4GVUA 1LVBA 1SGCA 4AYYB 1AE8H 2G81E 3IWMA 3FAOA 4ABAA 4IW4E 4A1XA 2ZNKH 2BQ7B 3GOVB 3RUOA 1M9UA 1QFKH 3F2HA 5ETXA 2VIOA 4BAOB 8ESTE 1U6QA 1P12E 4WVPE 4I8KA 1O5EH 1SC8U 3SU3A 2KCPA 1KXDA 2ZI2H 3QX5H 2BMGB 1MTNC 3AVZA 1AO5A 3QGJA 3OEHD 1TMBH 1QQ4A 1QIXB 1B0FA 1A5GH 1C5ZB 3RLWH 1ZJKA 4A5TS 1ZHRA 1VJAU 3RXUA 1GJAB 3BTFE 2Z9GA 3LH3A 1GI1A 5JB8S 4Q4LA 1SSXA 1A0JA 1W11U 3RM2H 3RP2A 5C2ZA 2ANWA 3SUDA 5B6LA 2GJGA 4FXGH 1P11E 2THFB 2VH0A 4WH6A 4DJZB 1ELFA 2ZTXA 1E0FD 2ZGXH 2ESTE 2JH0D 5TCCA 1GWAA 4LZ4B 1L4ZA 1QL9A 2FLBH 5FAHA 1A4WH 4OS6A 1UTNA 1SLWB 4DY7B 1A2CH 4XBDA 3STJA 1TRMA 3F6UH 1P0SH 1S5SA 1EKBB 1YPHC 3U98H 1TA6A 1TWXB 2XWBI 3TJOA 3MU0A 3S69A 3URDA 2FOAA 3TJVA 1MTUA 4RT0A 2ZFQH 2QN5T 4NSVA 5EGMA 1CGIE 1O2YA 1UVOA 4CR5A 2R9PA 5C94A 1W7GH 1RRKA 3N7OA 2DE8A 1AWFH 1ANBA 2WV5A 3R3GB 1KLTA 5EODA 1K22H 3O8DA 1TALA 1FY8E 2A32A 2Q6GA 3KF2A 2HOBA 2VINA 4WMEA 1Y5UT 3BTGE 4JK5A 3RLYH 1SGIB 1GBFA 1SBWA 1AU8A 2ZFRH 1L0ZA 4WF8A 4O9VA 5FPTA 1FDPA 3SQEE 2A1DB 1G37A 3RXFA 3V12A 3TPIZ 1YCPM 2G5NA 3ZVBA 1NESE 2ZQ2A 1MD8A 4D8NA 2HVXA 4NFFA 3MNXA 1CBWB 1QRXA 2P3UB 1DY9A 2BQWB 2FZZA 5A2MH 2FX4A 1WBGB 1Z71A 2OQUA 3HGPA 2DUCA 1ELEE 2IPHA 5DN6D 1FY4A 1KLJH 3CENA 4WMDA 2KX4A 2ASUB 1MAYA 2F9PA 1SQAA 5A8YA 4YLUA 1TNGA 4ABDA 2AHME 3GY5A 3TK9A 1DWDH 1ESAA 2C8XB 1Z8IB 1DOJA 1GBJA 1C2MA 1P2OA 2GVFA 1O3BA 2BLWA 2GCTC 1UVUH 1SLVB 5KEDA 1AIXH 3ATWA 1OWIA 1SI5H 1VITH 2Q1JA 1LVOA 1SL3A 5A09A 4AFZA 1GJ8B 3VB6A 3N99A 2W7SA 1F0RA 2D1JA 4FUFA 1YPKH 2P3TB 4Y7BA 3MNBA 5DP7A 1HFDA 3VG8A 3RM0H 1TRNA 1BHXB 1O2KA 1T31A 2OTVA 1C4V2 1P9SA 3MNSA 1OP8A 2TGPZ 5CDFE 2IJD1 1A46H 3UNSA 4MPUA 1RTLA 2CK3D 4E05H 1EP5A 1C1TA 5EXNA 4DCDA 3HKIB 1GBLA 4GCHF 2WV9A 4MQAA 5DJ7A 1NPMA 1TQ7B 1TIOA 4WXIA 4ZHMU 4INKA 1C1MA 1HAGE 2GTBA 1YGCH 4ACAA 1A7SA 1SHYA 2EI6A 3MI4A 1K1IA 1D4PB 3ZVFA 5B6OA 1LVMA 5C20A 1DXWA 1GBAA 3QDZB 2EA3A 3M7UA 4JYUH 1NBME 1EPTA 2BY5X 1YYY1 5DP6A 1E34B 5JBTA 1XUKA 2Y7XA 3LDXH 4PROA 3NWUA 1JMOH 1D6WA 2XWAA 5L6NH 2QXHA 2C8YB 4MNWA 4ABFA 1O3EA 1HUTH 1EZQA 1FIZA 4NG9H 4OS1A 4TPYA 1UO6A 2H5DA 3V7TA 1UTQA 1UJ1A 4KP0A 5FX5A 2A7CA 1TGSZ 1O3NA 1VITG 5HIYA 1BMAA 1V2VT 5F53A 3M3TA 3RXMA 3FP6E 1BHXF 3TNSA 1DSUA 1GGDB 1YLDA 1HJ8A 1GI9B 1C2DA 3ZZ9A 2QXIA 5DSFA 4R0IA 2Z7FE 1UCYK 1BOQA 4BXWA 1ESTA 1DWEH 1MBMA 1T8LA 2C4FH 1RGQA 3ZZ4A 3F3BA 1P03A 3STIA 1GMHF 1WDIA 1XX9A 1GDNA 4IC5A 2O8TA 1BMMH 2QV1A 3PMBB 2Z9LA 1QRZA 3UQVA 1AZ8A 4Q7YA 1C1QA 1BDAA 1KIGH 3H7OA 4ESTE 1XUFA 3F9GA 1K1JA 2P93A 5HIZA 2ZU2A 1HJAB 4CBNA 1V2KT 2V35A 1AY6H 1O2TA 1OPHB 2A5IA 2HNTF 2XNIA 2P94A 2XCFA 1SGNE 3C27B 1DE7H 1J9CH 2J98B 4RSPA 3L3TA 1VGCB 1EQ9A 3TU7H 2EI8A 1ZHMA 1S0RA 1NRNH 1TOCB 3SNCA 2WYGA 2UWOA 3ELAH 4YO9A 3NPSA 1H8HD 3QTOH 4KGAA 2VIQA 1OX1A 2P59A 3CS0A 4F55A 1IQNA 4FVBA 2JH6D 3JZ1B 5CMXH 4CH8B 4CRGA 4NIXA 1CBWC 5IDKA 3KEEA 1ELGA 1DUAA 1GL1A 2AS9A 1YLCA 5F8ZA 2A7HA 2D26C 3WY8A 1JIRA 3P70B 4JYTA 2FTMA 1NT1A 1O2JA 2Y7ZA 4NZLA 1HRTH 4WMFA 2KZ4A 1EZSC 1JXPA 1EFRD 4AORA 2BD8A 3SI3H 3CS7A 3MQKC 4ASHA 3SNEA 1C5VA 2ZU1A 3GDSA 2ZFTA 3TJNA 3LKWA 1TPPA 1P8VC 4OS7A 1W10U 2LPRA 3D62A 1GHZA 2FI5E 3PMHB 4RKOB 4KKDA 4WXVA 1GJ6A 4U32A 1CT0E 1W0KD 2HRVA 4D76A 4HI3A 1NRQH 4UD9H 1C2HA 1C1NA 1GI0A 1GJCB 3HK6B 3W1EA 4ZMAH 4AG2A 3SV9A 1O2QA 4AN7A 1SHHB 3W94A 4AGKA 1DDJA 6ESTA 2AIPA 1EATA 1BMFD 3LGUA 3BEUA 3BIVH 4K5ZA 3ZYEA 1VCWA 3QK1A 2OC0A 1YCPH 4HZHA 1FZZA 2HGTH 1QURH 1ANCA 3SBKA 4IC6A 2Q6FA 4FUCA 2PKAA 2RG3A 2BVRH 1FONA 4X1QU 3H5CB 3CP7A 3MH6A 3E3TA 3KYFA 4B1TA 1FIWA 2BM2A 2HNTC 1HBTH 1HAZB 1OSSA 2F83A 1QJ1B 1CHGA 2WPDD 1HAOH 3F2GA 1PPBH 1XUGA 1HAVA 1EPTC 2CMYA 2C93B 1T8MA 4BAMB 3E16B 1ZR0A 3OFND 3PWBA 4WH8A 1V2OT 2JKHA 3KQCA 2QF5A 1OOKB 2C8ZB 2BD2A 4ZROA 1GGDC 3TGIE 2XBYA 9ESTA 2VIWA 2WINI 1GMDG 1TNIA 1KXBA 3A85A 2GDEH 5FCKA 5AF9H 4MPVA 1ZMNA 1XKAC 1Z7KA 1YBWA 2A45B 8GCHF 3BN9A 1A5HA 1QRWA 5GPIB 1GHBF 4U2WA 4FUGA 3SU1A 3ZVCA 2QE7D 3A86A 4DG4A 4RT1A 2BQ6B 3I77A 2SGEE 1GI2A 3LIWA 1THSH 5JB9S 1ANDA 2GT8A 2HLDD 1KYNA 3ODDA 1HJAC 1CO7E 3FN8A 4NCYA 1TB6H 4D7FA 1Q31A 3EE0B 2ZFFH 4Z6AH 3GY3A 4J2YB 5K7RA 1O2HA 1VGCC 1H8IH 3RXLA 3SI4H 1QL7A 1IQHA 1TGBA 4FUDA 1DLKB 1ZPCA 4FU9A 1AN1E 1ZSJA 3GICB 2FTLE 4X2WA 1BA8B 4GAWA 5JYIA 1RIWB 2ALVA 5KGOA 3SGBE 3K6YA 2AMDA 3IITA 1IQEA 1SB1H 3SU5A 1UW7A 1J15A 3NUMA 3A7ZA 4AZ2B 2BDHA 2QF0A 2FOGA 1PPCE 1DPOA 3MO3A 1WSSH 4BOHA 1LPKB 3GYLB 2QGRA 4Q80A 3BEFB 4JYVH 4ZKRU 3BEIB 1N6YA 5SGAE 1NTPA 2PSYA 1O2NA 3L6PA 2CHAB 3Q3XA 4TPIZ 1H9LB 3T62A 2F9NA 3VXFH 1Q3XA 3LU9B 1C2EA 1GMHG 1W3CA 1E38B 4ZH8A 4E7RG 1K2I1 2ODQA 2Y5FA 4NWKA 3FP8E 2G4TA 4HGCA 3RXIA 3S7HB 1P2NA 2R0KA 1Z8GA 2ZF0H 2GV6A 4I86A 4YT6H 3O8CA 3TGKE 1G3BA 3BSQA 3QO6A 1DWBH 1S82A 2ZHQH 5C1YA 4ZKNU 1WAYB 1E1QD 3RXVA 3WW7A 5GXPA 3RDZA 1D3DB 1BTPA 1P3CA 5PTPA 4X8UH 2VIVA 1UVPA 2Y80A 1ZYOA 2CN0H 3LGIA 4AOQA 3S9BA 1W2KH 3ODFA 1QBVH 3RMMH 5EJ1A 1C9PA 3E91A 1ACBE 4FU7A 3SHAH 4H6TA 1YPHE 4ZUHA 5FL7D 4X1RU 3PROA 4LXBH 1LDTT 1MTSA 3RXTA 1BBRH 1C1VH 2WUBA 1Z8RA 3MH5A 9LPRA 3K65B 1C1OA 3A84A 1DUEA 4AB8A 1TNJA 1GBBA 4I31A 1ZTKA 4Z0KA 2I6SA 1Y3XA 1THRH 2VVVA 1TNKA 1UTKA 3EE7A 2IJOB 4Y8ZA 3UR6A 3MO6A 1THPB 4JZEH 5FHTA 3P6ZB 2OUAA 3KQBA 3A7TA 4X1PU 1TBQH 2R2MB 2ZQ1A 1C2KA 2Y82A 2RDLA 1MQ6A 1C2JA 2QC2A 5DG6A 3OY5U 2GZ9A 1EP6A 1G2LA 3SV7A 2NU4E 3ZVGA 3R0FA 1Y3YA 3T26A 4A1TA 1TMUH 2F9UA 1QL8A 1T8OA 1BQYA 1H9HE 2Y81A 4HFPB 5EQSA 2J5UA 2Z3CA 3SQHE 1HJ9A 1AMHA 1VITF 1FN6A 1NROH 4NIWA 2P8OB 1FAKH 4BTUB 3NKKA 2P3FH 1ZSLA 4H6SB 3BTME 1YCPK 2OLGA 3SU2A 3K9XB 1N6XA 1PPFE 3DHKH 4B6EA 1AFQB 2FODA 1XM1A 4A1VA 5HKKD 4E7NA 1O0DH 2C90B 3QLPH 1DT2A 2AERH 3BTEE 1UTLM 2W26A 1RIWC 1EOLA 2Y6TA 1FUJA 3AW1A 2ZGHA 3M36A 1NM6A 3SJKA 1BRUP 1GVLA 3DSGA 2ZZUH 1VR1H 2H9EH 3U9AH 1HAPH 3SJIA 2OQ5A 1G3CA 3PMAB 2H6MA 4Y79A 1NS3A 1LTOA 3MU5A 1O3LA 1PPEE 2VGCB 2NWNA 1Y3VA 2J97A 2D8WA 3M5OA 2ZECA 4K1SA 3U8TH 4XFQA 5A0BA 1GI5A 3SGAE 2BDIA 1W12U 2CHAC 4R8TB 3JZ2B 4BAQB 5C5OA 2OBOA 4FUEA 2PV9B 1JWTA 3FKSD 3VB7A 1BZXE 5F8TA 1XUJA 2BDGA 4DT7B 8GCHG 2G52A 1GHBG 1H4WA 1GJDB 4TY7A 1AVXA 5GCHG 1MMJN 3RXAA 2WPHS 4ZKOU 1F7ZA 1BRAA 1FNIA 1O2WA 3RU4E 2V7QD 3SO3A 5C5NA 1AI8H 1E36B 2YMSD 2ZU3A 3GISB 4OGYA 1QNJA 2ZCLP 3ZZ5A 1G3DA 1C5OH 3MOCA 4NFEA 2CV3A 1V2PT 1H8DH 1LHDH 1N8OB 2QYIA 2FO9A 1NZQH 3KQDA 1BT7A 3A80A 4X8VH 1SGPE 4ISHH 1HAHH 2K0QA 5T3HA 2LP6A 3DUXH 1K9OE 2BLQA 2PTNA 1OKXA 4KTUA 1QJ6B 1QA0A 3QZQA 1V2RT 1O2SA 1XVMA 3MU1A 1GJ5H 1DSTA 3MU4A 5DPAA 1J17T 1YP9A 4KTCA 4NZQA 2Y5GA 1TE0A 3MNCA 1D9IA 1GHAG 1GDQA 1SVPA 3M5MA 4U30A 4A92A 5L2ZH 2YMSB 3KGPA 5FPYA 4SGAE 1ZHPA 1HNEE 5K0HA 1C1PA 1TLDA 1ZJDA 4ABBA 4BNRA 2FEQH 8KME2 1SQOA 2XCNA 1ELCA 1SFIA 2L6OA 2OBQA 3W95A 3ATMA 2F91A 1EZUC 2PP6A 4NA8A 3NCLA 1CQQA 2HLCA 3RU4T 2UWPA 3WWBA 2FIRH 2ZC9H 5FBEA 1AWHB 3KQEA 1LQDB 1MAXA 3RXHA 3RXEA 1LCYA 3PWCA 1HAYB 2HPQH 3SJOA 1OWHA 4JZIA 2XXLA 2C8WB 3PTBA 1Z6JH 3PLBA 5AFYH 5JDUB 2NU3E 3UWJH 4RI0A 3AAUA 5A0AE 4MVNA 3A81A 5GIBA 1EJAA 2TBSA 1GJ7B 4YOIA 2FLRH 2P8OC 1QGFA 3BTDE 3Q00A 1FAXA 5EXMA 1SGFA 3FANA 3QN7A 1MCVA 3LGVA 3DSPA 1GMDF 1AFQC 1PPGE 1ELDE 1DITH 5C0TA 1O2VA 1XXFA 4UDWH 3U8OH 2WPIS 1UHBA 3U8RH 4JZFH 3RC4A 1K1NA 4LZ1H 1BBRK 2LNCA 1EASA 2H2ZA 1BRCE 2SNVA 5C67A 2ODPA 1GL0E 5GNDA 4IN2A 1O5BB 1T7CA 1IQMA 2GDDA 4J1YA 2PWXA 2ZTZA 2EQNA 1FY5A 2ZHEH 1C5MD 2UUJB 2SNWA 2VGCC 2W3KA 1ESBA 4I32A 4JZDH 2Z6BD 3ZZBA 1P06A 3M61U 3NRLA 2P16A 1OYTH 4UE7H 1L1JA 5F8XA 1TPSA 2R2WU 4FUBA 1O34A 4Q7XA 1RS0A 2F9OA 1XUHA 4B73A 5GJ4B 2GP9B 2VVUA 1F92A 5C1XA 1EPTB 4HG6A 1KTSB 1TFXA 3I29A 2ZKSA 3A83A 2V6NA 2HNTE 1DX5M 4X6MA 1LHCH 5GWZA 4ABIA 1G30B 3D23A 4IS5A 3NXPA 1XKBC 2CF9H 4Y8XA 5IK2D 1L2EA 1N8OC 1V2MT 2BD7A 2VWOA 1IQKA 1V2LT 2ZP0H 1KXCA 2RA0A 3UPEA 2WZQA 1S81A 4YT7H 2OINA 4ZHAA 3RMOH 2PSXA 3ITIA 3Q76A 2ZCKP 5DP4A 3MH7A 1CA0B 2ZG0H 2F9BH 5E2OA 4O03A 1WQSA 3SUGA 4F49A 4FUJA 5E0GA 1SGYE 1P2KA 2PGQB 4Q2KA 3U28C 3BV9B 2YMSC 2TGDA 1B7XB 1SQTA 2IPQX 6LPRA 4I8JA 3ATKA 2QF4A 3KCGH 5EQRA 3LJOA 1XMNB 5HM2A 1Y3UA 5AVDA 2ZDNA 2QAAA 1MABB 1TPAE 2EC9H 4VGCB 3UFAA 2FYQA 1UTMA 3SU4A 1TMTH 2PW8H 2V3MA 4XRNA 2AMPA 1DLEA 1HAIH 5T6GA 3EAJA 4DIIH 3SUEA 4BAHB 1O2PA 4YTAA 1K1LA 3TH4H 2BY6X 2VU8E 3LPRA 1C1WH 1QHRB 2R3UA 5ESTE 2UUFB 3DA9B 2QXGA 4DVAU 5ESBA 1CA8B 3ESTA 4X2YA 2WPKS 1HXFH 1C1RA 1FY3A 3UUZA 3MTYA 3GY8A 3T28A 1O5DH 2KCYA 4JMYA 3ZZCA 4ABHA 1AQ7A 1BTXA 2W6ID 3VEQB 2DE9A 4K69A 1AE5A 3TJUA 4X0WU 3N7EA 2EI7A 4M7GA 2GGVB 3QGNB 3RXPA 1W14U 1F5LA 1Y5AT 2B7DH 3MU8A 5T6FA 1XUIA 4ZCNA 2AFQB 1BRBE 2WPLS 1HB0B 2VIDA 5ABWA 4K60A 4MTBA 3SUFA 3VB5A 4CBOA 1PYTD 4FOUC 1GHYH 2J34A 3N7DA 2Y5HA 1HIAA 4TYDA 1CHOG 1INCA 3UIRA 3O8RA 4ISIH 5AFZH 1O3PB 1O39A 3OU0A 1C9TA 1O31A 3HGNA 3T29A 2HALA 3TK5A 3LT3A 3KL6A 2YOLA 1QA7A 4Y7AA 1O2IA 2GMTB 2ZTYA 3F1SB 4ASUD 1BTZA 2CGAA 3A8BA 1GBKA 5C1UA 2UUKB 3TVJB 2TGAA 2A4GA 1WOFA 1G32B 3OSYA 3URCA 2ODYB 3CNRA 3LONA 2PKAB 2ZWLH 2ZO3H 1EAIA 2BDYA 3UB0A 2B0FA 3PM3A 2PR3A 3V13A 3SU6A 1MKXK 5GDSH 2W5EA 1IQLA 1GJ4H 3KQ5A 3UOPA 3KIDU 3T25A 1LO6A 4NIYA 1UCYE 1HAVB 3F9EA 4XSKU 4UFEH 3SZNA 1W0YH 1AZZA 3HATH 4YOJA 4FUIA 3AK5A 2STAE 2STBE 1J8AA 1H8ED 1Z1IA 3DFJA 2ZU4A 4FETA 3SORA 1OWDA 1T8NA 1BTYA 1EAXA 1COWD 1Q2WA 1MZDA 1PQ5A 3BF6H 4XDEA 4X6OA 3T5FH 4I8LA 1TYNA 3RXRA 4UONA 1CA0C 4MPWA 3OEED 3Q3YA 4CR9A 4CHAB 2J4IA 5GCHF 1GMCF 2VNTA 1GHVH 1H9IE 2HWLB 2VB0A
chains in the Genus database with same CATH topology
1P02A 4ISLA 2Z9JA 2J95A 1O3CA 1PFXC 1HAXB 3OTJE 1C2FA 2BXUH 2ZCHP 1O3HA 2ZHWH 2FI4E 3SV6A 1C1UH 1F0UA 3PTNA 3UY9A 4BTTB 1C2IA 3QZRA 1O5CB 3LGTA 1O2ZA 8LPRA 3T2NA 1IQJA 2J2UA 1EAWA 4VGCC 3PLPA 4CRCA 3U1JB 3M5NA 4DIHH 1QB9A 1DXPA 3F68H 3TK6A 1LMWB 3LC5A 1NFUA 3M3SA 2PGBB 1FV9A 1CE5A 1ETTH 3A8DA 1K1MA 1V2JT 1FPHH 1UVTH 5LPRA 5DO4H 3GCHB 1GBIA 3P92A 4A6LA 1GHAF 1O2UA 3GDUA 1ELTA 1Y5BT 3BTTE 5HYOA 1D3PB 1MBQA 5FX6A 3S9AA 5FCRA 1BMNH 5L2YH 3SU0A 2UWLA 2D2DA 1GBMA 2CXVA 2BOHB 3VXEH 1C5TA 1GI8B 1IHSH 4OGXA 1DANH 4AFQA 2G8TA 4B74A 3UNRA 2FS9A 3ATLA 4X1SU 2G00A 1KXEA 1SFQB 5LPEA 2A5AA 1LPGB 3GY4A 3RXBA 3U69H 3TH3H 4QT8C 1UVSH 2PUQH 2ZDLA 1SGTA 3FZDA 1OS8A 2B8OH 1FLEE 2BHGA 3OY6U 4K1EA 1SOZA 7GCHG 1GHWH 1DWCH 5TJXA 2GZ8A 1TAWA 1L4DA 1RJXB 2BY8X 3ZVAA 1ETRH 4A7IB 2OC1A 1ZSKA 1P2QA 2QIQA 2WYJA 4ISOA 2GCHG 1O30A 4B76A 1W8BH 2GMTC 1AGJA 4X2VA 1BUIA 5DP3A 4D9RA 1FQ3A 1UK3A 1C5UA 1JBUH 1MD7A 2BD9A 4K8BA 3D49H 3SNDA 4JCNA 3RXJA 1P3EA 2ANKH 1ABJH 1D3QB 1B0EA 2F3CE 1PYTC 3H7TA 2BVSH 1SOTA 1JRTA 1E35B 1UTOA 4O3TA 4X8SH 3HK3B 3ZZ8A 2G5VA 1TBRH 1GBCA 2A4OA 5IYTA 2GV7A 4B2BA 3MH4A 2ZGJA 4I8HA 1P04A 1C5QA 1FY1A 2PLXA 5BPEA 3MMGA 4YLQH 1AVGH 4FU8A 2BOKA 1V2UT 1ZRBA 2XBWA 4RKJB 1EJMA 4TWWA 1G9IE 1G3EA 1P2IA 1VJ9U 3DFLA 3SV2H 1DVAH 1EAUA 3IG6B 1F0TA 1YPMH 1V2NT 1ZGVA 2BD4A 2FXRA 2A4QA 1SLXB 3B8JA 1JRSA 5C3NA 6GCHG 3A8CA 2ULLA 3GCNA 2QXJA 1OXGA 1OWJA 4CHAC 1TNHA 4NA9H 1J16A 1CSOE 1O37A 3RMNH 1KDQA 4B2AA 1EUFA 1MU8B 4GLYA 1GVKB 1O2MA 2A5KA 5HGGA 1TX7A 1O38A 4THNH 2GX4A 1F0SA 1QR3E 3FZZA 3RXSA 1TGNA 1ZMLA 1NRPH 2GD4B 3TNTA 4GPGA 1GJBB 1UK2A 1CT2E 1Y3WA 4K8YA 2A7JA 4Y11E 4YESB 3AW0A 3LJJA 2BDBA 1WTHD 2FOMB 1NFXA 1C5NH 1NY22 1BTWA 2YNAA 2NU2E 4BXSA 1O2OA 2FP7B 4KELA 4I33A 4WY3A 1NRSH 1P9UA 4Y0YE 3GCHC 1O2LA 1CVWH 1GVZA 3GY7A 3LGWA 2AEIH 2ZHDA 2KAIA 4X6PA 2XC0A 2XC5A 1HPGA 3VPKA 2ZGCA 3M5LA 1YPGH 2WPJS 1A3EH 1YPEH 4TY6A 2Z9KA 1MCTA 2KAIB 1TX6A 2J38A 5EW2H 4ISNA 3PLKA 5EPYA 3UOUA 4MDSA 4CRAA 1O5GH 3U1IB 1ETSH 4ZAEA 1O3KA 2A31A 1EOJA 5EXLA 3ZV8A 4D7GA 1GCTC 4B2CA 3VGCB 3ENSB 5I46H 4YZUA 2OCVB 2BD3A 5BRRE 2ZPSA 2SGQE 4K2YA 1KTTB 1P05A 1MKWK 3P8NA 1GMCG 2A2XH 2BD5A 2FX6A 1C5SA 1MZAA 3KNXA 3LOXA 5JPMH 2FWWA 1GBTA 1EJNA 1S85A 2FOEA 1DS2E 4BTIB 1TX8A 4AB9A 2XBXA 1T4VH 1B5GH 3ZZDA 4YOGA 3VB4A 2ZPRA 1FXYA 1SG8B 2JH5D 3P8OA 1BB0B 4Y71A 3SW2B 1ZZZA 2AGIX 1LHGH 1QTFA 2O9QA 2HPPH 4LK4A 3Q77A 2PUXB 1O3IA 1GPZA 1OP2A 1MH0A 1BIOA 2C3SA 2P95A 1A3BH 1K28D 5TCAA 1CHOF 1P01A 2BZAA 4F4OC 1O5AB 1TA2A 4GUXA 5FBIA 3E0PB 2RA3A 1L1GA 1UTJA 1W0ZU 3SJ9A 3SNBA 2Q6DA 1TGTA 2XBVA 3HKJB 1ZLRA 1W13U 1HYLA 3UNQA 7LPRA 1SGQE 1PQ7A 2XTTB 2FS8A 1BITA 1O3GA 1YM0A 1GI7B 2G51A 1ZMJA 1BCUH 1WYKA 3RXDA 2XRCA 1MKXH 3TLOA 2SGDE 1AVWA 3B9FH 3EGKH 1NU9A 1BMLA 2Z94A 2ZU5A 5LH8A 1MTVA 4IBLH 1C2GA 3M37A 1GBHA 2TIOA 3ZYDA 2FDAA 1A0LA 2W3IA 1QJ7B 4H4FA 1WU1A 2PFEA 4INLA 1T4UH 2AGEX 2ZFSA 2XW9A 3M7QA 4MNXA 1AKSA 2TPIZ 2V3OH 3ATIA 4AFUA 3TH2H 1PQAA 1TRYA 1JOUB 4KTSA 2BTCE 1DICA 1TABE 2BY7X 1AKSB 3K2UA 3EYDA 4AGJA 3MHWU 2VH6A 5F03A 2H5CA 1LVYA 1TQ0B 1EXFA 3ZZAA 1V2TT 1WCZA 5HMAA 1UHBB 4DURA 4TWYA 4WWYA 3E0NB 3P8FA 6CHAB 1E37B 3VFEA 4CRBA 3M35A 1ELVA 5EW1H 2FPZA 3SGQE 3MO9A 5DK1A 1GG6B 1O33A 2BVXH 3QTVH 4UEHH 1K1OA 3T27A 3VGCC 1AB9B 1NRRH 4NWLA 2ANMH 1ARBA 2G55A 3A8AA 5DP8A 3BTQE 1CGJE 3DT0H 3SJ8A 3V0XA 2A0QB 1WTGH 3KN2A 2H1UA 4I7YH 4X8TH 3SHCH 5EG4A 1O36A 1RFNA 2BYAX 2VJ1A 4MNVA 1ZPBA 1TPOA 1SGRE 2OP9A 2B9LA 4B75A 2FOCA 1K1PA 3G01A 3PYHA 4X1NU 1NO9H 4AFSA 3GY6A 4X6NA 1O35A 3Q3KA 1YKTA 1QQUA 1EB2A 2ILNA 1HLTH 3RXOA 4JZ1A 1AFEH 7GCHF 3RXGA 2ZHFH 3E1XB 5DP9A 3BG4B 1RTFB 4LOYH 2M5TA 4MLFB 3AASA 1TGCA 4BANB 4CRFA 1AD8H 1SR5C 3F9FA 1P10A 1UK4A 1N1LA 2GCHF 4INHA 1EB1H 3RC6A 7ESTE 5L30H 1SLUB 1WV7H 2VVCA 1NN6A 2PKSB 4JK6A 3FP7E 3S9CA 1YPJH 2FYRA 1P2JA 3KHVA 3OX7U 1S6FA 2AH4X 1C5WB 2ALPA 4GSOA 3FVFB 2PTCE 3PB1E 2BX3A 4CREA 1AUJA 1ORFA 1NC6A 3S0NA 1MU6B 1QB6A 1RD3B 1ELAA 3RC5A 1Z8JB 4GHTA 5LGOA 3SNAA 3TITA 3E6PH 5FPSA 5EQQA 4I8GA 5EU8A 1RXPA 3PO1B 3PV4A 3E8LA 1Y59T 3A89A 1BTUA 1NU7B 3M3VA 1C5RA 1CU1A 3SV8A 1F2SE 1QBOA 1CT4E 1XVOA 3A7VA 2SGAA 2TGTA 1C5YB 1C5XB 1QCPA 2Z9IA 1S0QA 4Y8YA 1BBRE 5T6DA 4NIVA 1IQIA 3I78A 1D3TB 3AAVA 1FI8A 4Y0ZE 2I6QA 1SPJA 1ZTLA 6GCHF 1S84A 1KXFA 1YPLH 1IOEA 2CF8H 3QUMP 3VB3A 3V3MA 4B71A 3RXKA 5JBAS 2V0BA 4UFGH 3TGJE 2FOFA 1PPZA 2VWMA 2F9VA 2FOBA 1HIAB 3C1KA 3P8GA 2ZPQA 1ZRKA 1HDTH 2A2QH 6CHAC 3HPTB 1ZPZA 3GCTF 3QWCH 1V3XA 1C5PA 3A88A 1JIMA 3RXQA 4ABEA 2WV4A 1GG6C 1A61H 3O8BA 4UFDH 1TOMH 3PMJA 2J94A 1G2MA 1GHXH 2QF3A 4MNYA 4YM9A 5LPFA 2AMQA 2BLVA 2QY0B 1AB9C 3RXCA 2SGFE 4FVDA 5JBCS 4DGJA 1GI3A 3UREA 2FI3E 2FESH 1IAUA 2ZGBH 4U01A 5AHGH 1HCGA 2BY9X 2VWLA 5FXLA 2FOHA 5HXFA 3ZZ7A 1GBDA 5A0CA 3A82A 3NK8A 2O8LA 1VCQA 5A8ZA 4D9QA 1KSNA 4ZHLU 1L1NA 3NZIA 3EA8A 4OS2A 2ZDVH 2JETB 2ZFPH 2AIQA 2Z3EA 5A8XA 2CJIA 1O5FH 2OD3B 2IOTA 2VWNA 2PHBA 3BTKE 2ZIQH 2NU1E 1QB1A 2R0LA 1GI6A 3GYMA 2Z3DA 1DM4B 3BTWE 1MKWH 1LKAA 1OWKA 3MYWA 1SGDE 1QBNA 1EX3A 5E8EH 1KY9A 3BTHE 2B5TB 3EA7A 1DY8A 1YC0A 1NFWA 2ZDKA 1LPZB 1IHTH 1PQ8A 3BG4C 4XBCA 1J14A 2ZA5A 1LKBA 1WUNH 4ZXYH 3E90B 4OS5A 1AHTH 5CHAB 1HGTH 2BB4A 1A5IA 4AX9H 2ZDAH 1OWEA 2ZDMA 1MQ5A 1ABIH 1BTHH 1O3DA 5HM9A 2QA9E 4X2XA 3BIUH 2PKSC 2FMJA 5J4SA 1O2RA 1C4Y2 1ELBA 1C1SA 4GCHG 1DFPA 5DGJA 2UUYA 1VCPA 2J9NA 1V2QT 1A1RA 2IN2A 1F5KU 5G4BA 1C4U2 5DKMA 1OP0A 1V2ST 4XE4A 2G4UA 4OS4A 5EPNA 3S7KB 2EEKA 3UTUH 5E2PA 1LHEH 4H42U 3EA9A 2OC7A 3PO1C 1KLIH 5E0JA 1C5LH 1ARCA 1SGFG 1TONA 3B23B 1T32A 1BJVA 1O3AA 1C2LA 1KXAA 4IMQA 4IMZA 1W7XH 1GCTB 3TIUA 3DD2H 2GZ7A 3M7TA 4XBBA 1Y8TA 4AG1A 1V2WT 1P57B 4GHQA 3LGYA 1X7AC 3A7YA 2FM2A 1D6RA 1MTNB 1P2MA 1ZGIA 1Z1JA 2W7UA 4MPXA 1VZQH 3ZVDA 1GJ9B 4K1TA 1SGEE 5CE1A 4O97A 3P95A 2QCYA 2WUCA 5E0HA 3SOSA 4IN1A 2YNBA 2RCEA 1RTKA 1ZOMA 2OXSA 1K21H 3GCOA 4ZKSU 3ZVEA 3FFGA 1FN8A 2O8UA 4K3JA 4AYVB 4CRDA 1IQGA 3ZZ3A 1FMGA 3RMLH 1ANEA 1PJPA 2J92A 4UFFH 2NU0E 5J4QA 3D65E 3EQ0H 4SGBE 2BDAA 3K6ZA 4E06H 2V3HH 1H1BA 3UR9A 2VIPA 2AGGX 1FPCH 1P09A 2A4RA 1GI4A 4DOQA 4ABJA 2K1QA 3A87A 1BJUA 2R3YA 4Y76A 1PPHE 5H4IB 4RN6A 1FJSA 2BZ6H 1TNLA 1GCDA 2H9HA 3LC3A 3BG8A 1LQEA 3F9HA 2H9TH 2JETC 3A7XA 2AYWA 4BAKB 4Y10E 1O2XA 1TBZH 1O3OA 1GBEA 2BXTH 4WJG2 4HTCH 1O32A 1MUEB 1ID5H 1HV7A 1XXDA 3SN8A 4MG3A 1SMFE 3UQOA 1CGHA 2GKVE 4CH2B 1F5RA 3ZZ6A 1NFYA 2O8WA 2SFAA 4IGDA 4Q7ZA 4XOJA 4O3UA 2BDCA 1O2GH 1IQFA 1YF4A 1GDUA 2OC8A 5F6MA 1KDQB 1AUTC 1A0HB 1WQVH 3EDXB 5CHAC 4NSYA 1OYQA 3GCTG 2GT7A 3GY2A 5DP5A 1Z6EA 4NA7A 4NGAH 2BLOA 1HXEH 2BX4A 1S6HA 1G36A 1MTWA 2O8MA 2TRMA 3A7WA 2ANYA 7KMEH 3LH1A 5JBBS 5EOKA 2XYAA 2GCTB 5I25A 1QY6A 1ZTJA 3L33A 4DW2U 1UCYH 3ZV9A 1O3JA 3MWIU 1O3MA 1V6DA 4FUHA 3P17H 4ZXXH 3UWIA 3OYPA 4ABGA 2SGPE 2WPMS 1S83A 1UTPA 3RU4D 2XC4A 1EZXC 2ZEBA 3GDVA 4Y6DA 1O3FA 3MFJA 1LHFH 1UMAH 4GVUA 1LVBA 1SGCA 4AYYB 1AE8H 2G81E 3IWMA 3FAOA 4ABAA 4IW4E 4A1XA 2ZNKH 2BQ7B 3GOVB 3RUOA 1M9UA 1QFKH 5ETXA 2VIOA 4BAOB 8ESTE 1U6QA 1P12E 4WVPE 4I8KA 1O5EH 1SC8U 3SU3A 1KXDA 2ZI2H 3QX5H 2BMGB 1MTNC 3AVZA 1AO5A 3QGJA 1TMBH 1QQ4A 1QIXB 1B0FA 1A5GH 1C5ZB 3RLWH 1ZJKA 4A5TS 1ZHRA 1VJAU 3RXUA 1GJAB 3BTFE 2Z9GA 3LH3A 1GI1A 5JB8S 1SSXA 1A0JA 1W11U 3RM2H 3RP2A 5C2ZA 2ANWA 3SUDA 4FXGH 1P11E 2THFB 2VH0A 4WH6A 4DJZB 1ELFA 2ZTXA 1E0FD 2ZGXH 2ESTE 2JH0D 5TCCA 1GWAA 4LZ4B 1L4ZA 1QL9A 2FLBH 5FAHA 1A4WH 4OS6A 1UTNA 1SLWB 4DY7B 1A2CH 4XBDA 3STJA 1TRMA 3F6UH 1P0SH 1S5SA 1EKBB 1YPHC 3U98H 1TA6A 1TWXB 2XWBI 3TJOA 3MU0A 3S69A 3URDA 2FOAA 3TJVA 1MTUA 2ZFQH 2QN5T 4NSVA 5EGMA 1CGIE 1O2YA 1UVOA 4CR5A 2R9PA 1W7GH 1RRKA 3N7OA 2DE8A 1AWFH 1ANBA 2WV5A 3R3GB 1KLTA 5EODA 1K22H 3O8DA 1TALA 1FY8E 2A32A 2Q6GA 3KF2A 2HOBA 2VINA 4WMEA 1Y5UT 3BTGE 4JK5A 3RLYH 1SGIB 1AU8A 1SBWA 1GBFA 2ZFRH 1L0ZA 4WF8A 4O9VA 5FPTA 1FDPA 3SQEE 2A1DB 1G37A 3RXFA 3V12A 3TPIZ 1YCPM 2G5NA 3ZVBA 1NESE 2ZQ2A 1MD8A 4D8NA 2HVXA 4NFFA 3MNXA 1CBWB 1QRXA 2P3UB 1DY9A 2BQWB 2FZZA 5A2MH 2FX4A 1WBGB 1Z71A