2BY8X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by8X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by8X02
1IQNA 1NFXA 3RLYH 1A1RA 4I8GA 1Z8RA 3OY5U 1KTSB 1N8OB 3OSYA 1SGIB 4TY7A 2C90B 1UVSH 1GI2A 1AGJA 1MKXK 4IBLH 3VXFH 2VIDA 1KTTB 1C5NH 1CE5A 1THSH 4IMQA 3T29A 1NZQH 2SGFE 1VITH 2Y5HA 5CE1A 1QL8A 2FOEA 2OC0A 4IW4E 1KLIH 3QGNB 3ZZ6A 3LONA 1K9OE 1Y3XA 1CHOG 1G3CA 3M37A 3URCA 4B2AA 3ZZ8A 3C27B 3KCGH 2ZGJA 3BV9B 3UOUA 1E37B 2H9TH 1ZSKA 1G30B 1EPTB 1TONA 1T8NA 2W7SA 4ZKNU 2JH6D 2ZHDA 4BTUB 1DSUA 1AB9C 1L1NA 1TMTH 1A7SA 1DDJA 1K1IA 2XC5A 4GHTA 1QA0A 2ZU2A 4SGBE 4PROA 1K1MA 2QF0A 4OS5A 3RDZA 1UK2A 3ZYDA 1ETRH 1SFIA 1DE7H 2XW9A 1TAWA 3HPTB 3EDXB 3SUDA 1BQYA 1J16A 2QN5T 3ENSB 2VVUA 1KXFA 4DIIH 1A0LA 1DWEH 4CHAC 1P12E 3ZZCA 1O2UA 1GVZA 2FO9A 2Y81A 2C8WB 2J4IA 1UCYE 4GUXA 1SFQB 3GCOA 1GG6C 3GICB 5C5OA 1WTHD 1QGFA 2XCFA 1MMJN 2OQUA 3PTNA 1OPHB 1H9HE 3TGKE 1QRZA 1ELEE 1GI3A 4Z0KA 4U32A 1EASA 1Q3XA 1UK3A 3SJ9A 4YO9A 2RDLA 1WTGH 1KLTA 4A92A 1E36B 1GI7B 1SGDE 2EA3A 1W12U 2D26C 4LK4A 1TNKA 3DT0H 5K7RA 4ABAA 1V2JT 3RXQA 1ELBA 3KQEA 4OS7A 4JZIA 3BIUH 2TPIZ 3QWCH 1Z7KA 5AF9H 1GPZA 1V2QT 2Z9IA 1ABIH 1ELCA 1IHSH 3MNCA 4ISHH 1BRAA 3SGBE 3E91A 1FPHH 1BZXE 1FAXA 1MTWA 2RG3A 1KDQA 4MNVA 1JOUB 2A7HA 3U9AH 1MTUA 2VWOA 2JETC 2ZECA 4XSKU 3SJ8A 1MCTA 3A81A 4Q2KA 4NIYA 1QBNA 3F9EA 1AWFH 3GY3A 3PYHA 4K2YA 3T2NA 3TK5A 3FFGA 2VWLA 3GY6A 5JBCS 2PGBB 1O2ZA 2V6NA 3UREA 3VB7A 2HNTC 4K5ZA 1V2OT 4Y0ZE 1W7GH 1C1VH 1Z6EA 2I6QA 2XYAA 3BF6H 4FUFA 4GHQA 3D23A 1C5ZB 5L30H 1GJBB 4OS1A 3U69H 2C3SA 2V3OH 3VEQB 4I8LA 4X6MA 3SHCH 1YKTA 3GY8A 1SBWA 1LVOA 1AVXA 4GAWA 1P03A 2BD2A 1FY3A 3F6UH 2P94A 1ZPCA 1OSSA 2TRMA 1FN6A 1TX7A 4LZ4B 4FUHA 1O2KA 1O37A 1FJSA 3T28A 2O8WA 3TJUA 1BMNH 5DKMA 1FZZA 5DP4A 3L6PA 4AFZA 1O2VA 4NZLA 1TA2A 1V6DA 3IWMA 1M9UA 4E7NA 2GX4A 4O3TA 1TQ0B 4X1PU 3TITA 2TIOA 8KME2 3STJA 2VIVA 1TX8A 1K28D 3BG4B 1G37A 2A4RA 3PMHB 2H9HA 1FQ3A 2HNTE 2ZTYA 2BQ6B 1YPEH 4DJZB 2EC9H 2PR3A 4FUCA 1GBTA 5ESTE 2KAIB 4B2CA 5I25A 2V35A 1FY4A 1HNEE 4JYUH 1RIWC 2ZU4A 1T4UH 3ZZ4A 3A85A 1LVMA 2A4OA 1EB1H 2ZHWH 1NC6A 2C8YB 2FX6A 3M3SA 3BTEE 1F5KU 1JIRA 2G4TA 1OOKB 1O3BA 3OYPA 1T7CA 2BDYA 3RC6A 3FZDA 3TH4H 3SNDA 2ZHQH 1ANEA 1RD3B 3JZ1B 3JZ2B 3PLPA 4JZEH 3K9XB 2RA0A 2R3YA 4DCDA 2OC1A 1YYY1 1UTKA 1DUEA 1O3NA 3M5OA 2TGTA 2HRVA 3D62A 2A32A 2QXIA 1C2GA 1GBIA 1BMAA 4AN7A 1TX6A 2XNIA 1JIMA 2PUQH 4GSOA 1DX5M 3M7UA 2BY9X 3SU2A 1B7XB 1ARCA 1YGCH 2ALVA 1BTWA 3I29A 4CRGA 4H4FA 2FMJA 1O3AA 2ZC9H 1UVOA 3RMNH 3O8CA 2ZIQH 3GY4A 3LJOA 1D3PB 2R0LA 4NA9H 4UE7H 3T25A 3AAVA 2ZGCA 3ZYEA 1SGPE 1INCA 4B1TA 1WQVH 3KN2A 1D9IA 2UWLA 1IQJA 4TPIZ 2ZDMA 1QL7A 1O2RA 1OYQA 2GCHG 4SGAE 4Y79A 3D65E 4NWKA 4BXWA 1HAPH 1YLDA 1G2LA 1PPZA 2Z9GA 5A0AE 2YNBA 2FI4E 1GBMA 3G01A 1BUIA 3PMAB 1DWBH 2O8LA 2CF8H 1C1PA 4AFSA 3LGWA 1C1UH 1EQ9A 4AYVB 3QTVH 4Q7XA 1A0JA 1IQFA 1HAYB 1AHTH 1DM4B 4A1XA 2AEIH 2PW8H 2VGCC 5JBAS 3PTBA 2QGRA 3QDZB 3MHWU 2JH0D 3D49H 3RXGA 1SGFG 2F9UA 2FIRH 3SN8A 2OTVA 1GMCF 3CENA 1AE5A 1GBCA 4DY7B 3TLOA 6CHAC 5ETXA 1V2LT 5AFZH 3NUMA 5FX6A 3V0XA 3VB4A 2J92A 1CT2E 1O2NA 1ABJH 1PPGE 4BAQB 4CBOA 2AERH 1GHAG 1GL1A 2ODYB 2FWWA 1TNJA 3ATIA 2WPIS 1Q2WA 5FPSA 1S84A 5A09A 2R9PA 2VNTA 3P17H 2W26A 2PKSB 3V13A 4Q7ZA 3KGPA 1Y5AT 1HCGA 2AMQA 1P2NA 2VINA 1P2JA 4DIHH 4LZ1H 4ZHMU 2WINI 5F8ZA 2FXRA 1T8OA 1ZRBA 5E0GA 1TRNA 5DGJA 3RUOA 1A5HA 2ANYA 1UTMA 2STBE 2Y7ZA 1Y5BT 4BAHB 3K6YA 1UTQA 1V2TT 1GL0E 2H9EH 4Q7YA 3Q77A 3A84A 1BRBE 1GVLA 2ZTXA 4BAKB 1MD7A 1ZPZA 1JBUH 2XXLA 5DP8A 1SLVB 1NFUA 1XXFA 1Z1JA 2UUJB 2W7UA 2QV1A 2ZFQH 1RGQA 4I32A 4RKJB 4WXVA 1DUAA 5HGGA 3NK8A 3VGCB 4ESTE 1ZSJA 5L2YH 3UR9A 2TGDA 3ZV9A 1L2EA 1N6YA 3UUZA 2J38A 4GVUA 3VFEA 1J8AA 2GT8A 3SU0A 1VCWA 1GI6A 1CA8B 4XE4A 4D9RA 1LPKB 1BBRK 2Z7FE 3RXMA 1CGIE 4MPVA 3UQVA 3PO1B 1XM1A 4I8HA 6CHAB 4VGCB 1H1BA 1BTHH 1GBHA 1TBQH 1XUKA 1MQ6A 1SHYA 1D3DB 3KF2A 1L1GA 4Y7BA 1TBRH 3SUGA 2YNAA 3SU4A 1GVKB 2OBQA 3FAOA 4DVAU 3U8TH 1AY6H 1PPFE 1C2LA 1TPAE 2HNTF 1SL3A 4JZDH 2ZF0H 2GMTC 2SGEE 2M5TA 3DFJA 4RSPA 1O2IA 1AE8H 4UONA 1VJAU 2WPJS 1RTFB 1NS3A 1NFYA 1GMCG 2VIQA 4K69A 2Y6TA 3DUXH 2C4FH 2SFAA 1SGNE 2GGVB 3BTDE 4JYVH 1TPPA 2PTNA 2WUBA 3NZIA 1QURH 4IC6A 1MU8B 1C1NA 1O3IA 3RXBA 1C5LH 3NWUA 2FOMB 1AI8H 3TK9A 4ABGA 3RM0H 1ELFA 1HFDA 1QA7A 2ODQA 4A1VA 1ESBA 1YBWA 5DG6A 1TMBH 2NU0E 3I77A 1RJXB 1SR5C 4AOQA 3O8RA 4FU8A 1UTNA 1FI8A 1WV7H 3CS7A 3MFJA 3S7HB 2OUAA 2WPHS 2FS8A 2CV3A 5FBIA 2BDCA 1GHBG 3MYWA 5FCKA 4X6PA 2KAIA 1IQMA 1MUEB 2DE8A 3EA7A 4ISNA 1GI4A 4FVBA 1MCVA 2ZU3A 1O3LA 3E1XB 1J17T 3R0FA 4K1SA 3STIA 1AFQB 1GJ8B 3SQEE 2BYAX 3A8BA 2V0BA 3BEIB 5FPTA 1K21H 1EB2A 2C8XB 1PPCE 1FONA 4LXBH 4JZ1A 1ANDA 2BZ6H 3MOCA 1P8VC 1ZRKA 2BQWB 3SUEA 4Y0YE 1L4DA 1RS0A 2ASUB 2XBXA 3SJOA 3MU4A 5LH8A 5K0HA 2QC2A 2BLWA 4Y8YA 1RIWB 3IG6B 1TPSA 5ABWA 5A8XA 1O2MA 1BTYA 4XDEA 3UNSA 4O3UA 1EPTC 1KLJH 3MTYA 3A80A 1O35A 4ABBA 4NIWA 4WVPE 1BDAA 2F9BH 2Y5FA 4AB8A 1MU6B 1Z8IB 1O2LA 5C2ZA 3ZVAA 4ZKSU 1EUFA 4K60A 2GZ8A 2XTTB 1L4ZA 3UWIA 2FZZA 5E2PA 3SNEA 3ZVDA 1ZTLA 3SOSA 2Z94A 4ABDA 2BD5A 2G51A 1SGTA 2EI6A 1T4VH 1LKBA 2QXGA 3M5NA 2UUYA 1SGFA 2HPPH 4YT6H 3BTWE 2A4QA 1IQLA 1L1JA 1XUHA 1A61H 5GJ4B 3P8FA 4Y76A 3LKWA 3GCTF 1C2EA 5E8EH 1Z6JH 4IMZA 5C1UA 2DE9A 2P93A 4DOQA 1BOQA 1O2GH 1MAXA 4NGAH 3GY2A 2CGAA 3AVZA 4KELA 1UTLM 1TWXB 1MKWH 1PPEE 1LVYA 4D9QA 1FMGA 1ANBA 1S0RA 2FODA 3KEEA 1V2RT 3T5FH 2VIPA 5HMAA 4Q80A 1LVBA 1UHBA 1CVWH 1C2DA 4TWWA 3W94A 4X2XA 4KTCA 1S81A 1DT2A 2Z6BD 1H9IE 4YOGA 2ILNA 3H5CB 1NN6A 2OCVB 4FXGH 1KXEA 7GCHG 2NU4E 2Y5GA 4UDWH 1NROH 3RMLH 4JK5A 1W2KH 3SJIA 1C2HA 1GHBF 5ESBA 3Q3KA 3VB3A 1F0TA 4MTBA 1O5GH 1AKSB 1P02A 1O3GA 1C9PA 2G00A 1CGJE 3A7TA 2A45B 2A5IA 3HK3B 2JKHA 3MO3A 4UFEH 2UUKB 2FDAA 4H42U 4O97A 5DPAA 1V2VT 2WV4A 4X2WA 1F7ZA 1S6FA 3GYLB 2A5KA 3IITA 1C2IA 1DY9A 2P8OB 3OY6U 2R2WU 2PGQB 1EOLA 2EI8A 1BHXF 3KQBA 1Y3YA 3UQOA 7ESTE 1TOCB 3UPEA 4JK6A 1MTVA 1PQ5A 3LC3A 1B0EA 3TGJE 3M7TA 1EPTA 1G3EA 8LPRA 2QIQA 3UY9A 2QXHA 1WAYB 3HGNA 4WH6A 2G4UA 8ESTE 1ZGVA 1C5PA 1DFPA 1Z1IA 5EXNA 1TGSZ 1YF4A 1SMFE 1HXFH 1GWAA 1HAXB 1O3CA 1MKWK 1UTJA 1O3DA 1SVPA 1QQ4A 2ANMH 1P2QA 2TGAA 2ZDNA 1DLEA 4YLQH 3PLBA 4CHAB 2BLOA 2B8OH 4VGCC 4Y10E 1GDNA 1A0HB 2AIPA 2OC8A 3QN7A 1QRXA 2VWNA 2H6MA 1GJCB 2GCTC 2UUFB 5JB9S 4R8TB 1ZMJA 5FXLA 1RRKA 3U1JB 1XMNB 1A3BH 4CH8B 1K1LA 1HAOH 3RXSA 1AB9B 1C1RA 4ZUHA 1ZTKA 4WMFA 4CH2B 2FYQA 3E90B 2W5EA 2QF3A 3LPRA 3SV7A 2BDHA 1F0RA 1CHGA 7KMEH 3L3TA 3UTUH 1CQQA 2A2QH 4RN6A 3RM2H 1C2KA 2ZFSA 1UVPA 1ACBE 1HAVB 1SLXB 4Y8ZA 1LDTT 2HALA 3S7KB 1XKAC 2Q6FA 3N7OA 1AD8H 4A1TA 1QIXB 5F8TA 1QY6A 2XRCA 4CBNA 2BQ7B 3ZZ9A 1H4WA 1S82A 2THFB 1C5TA 2VIWA 3ZVBA 2GTBA 1TNLA 3M61U 1LQEA 1G32B 1MTSA 3PM3A 1P3CA 1J14A 3UR6A 2PKAB 4X6NA 4BAMB 2PSYA 3SI4H 5EPYA 2P3UB 1C1TA 3FP7E 2BXTH 3UWJH 4MLFB 1MQ5A 1QBVH 1SGRE 2A31A 1O5FH 1S0QA 1UCYK 1C2JA 2Z3DA 3MH5A 4FUDA 3SV9A 2H5DA 1P04A 1C4U2 2FESH 2Z9LA 4UD9H 1FAKH 1FY8E 4FU9A 2H1UA 4YZUA 1V2UT 3T27A 4KKDA 1Y5UT 1CGHA 4NFFA 5EPNA 4BXSA 1QCPA 1AIXH 1OKXA 3GY5A 1LHDH 1TPOA 3LGTA 2R3UA 2GCHF 1J15A 3MI4A 4TYDA 1O34A 5EW1H 3SNAA 1ELGA 4I31A 2A5AA 1UO6A 5GPIB 2OINA 1SPJA 4THNH 3GCNA 3KNXA 1HLTH 1O3KA 1AU8A 2BB4A 1BTXA 5EQRA 3LGUA 2R0KA 1W13U 2WYGA 1LMWB 1KYNA 3BTHE 4INLA 3UNQA 2VGCB 2GV6A 4ZAEA 1GMHF 4AG1A 5A2MH 2BOHB 1P2KA 1TGCA 1SQOA 1G3BA 2FLBH 2GMTB 2BLQA 1DY8A 3LGIA 1Y3VA 3A83A 1LCYA 4F49A 1HJAB 2B5TB 2XWAA 1C5MD 1AVGH 1LQDB 2B7DH 3A7WA 4CRFA 2CMYA 1J9CH 1UVUH 3TVJB 6LPRA 1AUTC 1CHOF 2RCEA 2AYWA 3EYDA 2PHBA 1ZMNA 3TPIZ 1YCPH 3L33A 1DLKB 2D2DA 1C5RA 3PO1C 4MPUA 4F4OC 1BBRE 1QRWA 2SGDE 1PQAA 3MU8A 1O2JA 2BD4A 5GCHF 1ZSLA 6GCHG 1O31A 1SOTA 5EU8A 3SU3A 2NWNA 2BDBA 1CT4E 2J94A 3C1KA 1NU9A 1K1JA 1GI9B 1LPGB 1QNJA 1EP5A 3PWBA 4MNWA 3GCHB 1TRMA 1B5GH 4MPWA 1VCPA 4TWYA 1THPB 2BDAA 1JXPA 1ANCA 3HKJB 2HVXA 3ZZAA 1T31A 3ATWA 1BA8B 1CT0E 1DPOA 4MQAA 2W3KA 3MNBA 1IQKA 4MNXA 4WH8A 1CA0C 2P16A 1FNIA 1AWHB 3MH7A 3U8RH 1L0ZA 1V2PT 4O03A 1Q31A 4WXIA 4E05H 3TH3H 2OBOA 4Y6DA 1V2MT 3NXPA 1IQIA 3VGCC 1EAXA 3GOVB 5FPYA 1KXCA 3MNSA 3RMOH 3MO6A 1O5AB 4H6SB 5AVDA 1C1WH 2ANKH 1ZOMA 1O33A 3ZVEA 3TK6A 1C9TA 1Z8GA 4X6OA 5HYOA 2ZFTA 1MBMA 1PQ7A 1O2SA 1P11E 3RXPA 1CU1A 1YPMH 3UFAA 1IQEA 2VH0A 1FPCH 1O5CB 2ZNKH 1EZSC 1HPGA 4TY6A 5J4SA 5LPFA 1OWJA 1DSTA 5BRRE 3RXJA 4CRCA 3SV8A 1RXPA 1CSOE 3MMGA 1O3PB 5SGAE 3GCHC 2D1JA 4AX9H 5EW2H 1FV9A 1KXAA 1O30A 2STAE 5GWZA 1HDTH 1TALA 1QQUA 4MNYA 1TLDA 4MPXA 5CHAB 1GJDB 1GBKA 1N6XA 1JRSA 4B75A 1W11U 2OQ5A 2GD4B 4K8YA 3KL6A 4NCYA 3NPSA 1O5BB 3A82A 3V12A 3GCTG 1TBZH 2Y7XA 2ZG0H 3S9CA 4AB9A 1HUTH 3M3VA 1ARBA 1ID5H 2QXJA 3RXDA 1UCYH 4ZKRU 1P06A 2VVVA 5I46H 3MNXA 4GLYA 4WWYA 4OGXA 5A8ZA 3BG8A 2ZDAH 5C3NA 1F0SA 1GMDF 3ODFA 1O36A 2XC4A 1QJ6B 2ZKSA 3ZZDA 1H8IH 1HJAC 2P59A 1YPGH 1P3EA 2J34A 3MU5A 1GBJA 3ATLA 2GVFA 2HGTH 4WJG2 2ZP0H 1G9IE 1YPHC 3A7VA 1YLCA 1XUGA 4D8NA 1ESTA 1QJ1B 3TIUA 1HAVA 3QZQA 1W0YH 1GHVH 1HXEH 1UVTH 2SNWA 3Q3YA 5HM9A 1A3EH 3P8NA 3SW2B 1OWDA 1O3JA 3F9HA 1VZQH 3A7ZA 2VIOA 4XBCA 1D6WA 1O0DH 2XCNA 3OU0A 1CO7E 3HGPA 1ZR0A 1C4V2 1D4PB 1BMMH 1GI8B 1QB1A 2BLVA 3RU4D 5CMXH 1O3HA 1KY9A 1Y59T 1W14U 3E0PB 3VB5A 2P95A 3Q3XA 3RXHA 1LHFH 4BNRA 4Y7AA 3CS0A 1U6QA 5T3HA 1HIAA 2PKAA 1C2MA 8GCHG 1GHWH 1D6RA 1GBBA 5C67A 4XBDA 2EI7A 1BITA 2WPKS 1FDPA 4OS4A 3NKKA 4FUEA 4M7GA 2BOKA 1ELAA 3TJOA 1T8LA 4ABJA 3ATKA 3DA9B 2QY0B 1FIWA 1TE0A 3GDVA 4ISIH 1BCUH 4JYTA 3UNRA 5HXFA 3TU7H 3QLPH 1E38B 4AG2A 1KIGH 2ZPRA 3E6PH 4Y8XA 4YTAA 3TNTA 4NA7A 5T6DA 5TCAA 5HM2A 5FCRA 1B0FA 2NU2E 1BRCE 3LJJA 4I8JA 7LPRA 4BTTB 1C4Y2 1FLEE 1C5XB 2PUXB 4JCNA 1LHEH 1O2OA 1PJPA 3KIDU 2B9LA 2PTCE 3AASA 1SLUB 1MZDA 5JBBS 1OWIA 5PTPA 4ZMAH 3PV4A 1P9SA 3SZNA 4ZXXH 4YOIA 2ZO3H 2B0FA 2G55A 2G52A 4DT7B 1VCQA 1LHGH 3BG4C 3ZZ3A 3FANA 1QBOA 2FTMA 1GHZA 1F92A 5FAHA 1W8BH 2GZ9A 3M36A 3U1IB 2VJ1A 1AMHA 2BVXH 4H6TA 1ELVA 1XX9A 1VR1H 2F3CE 1O2QA 1SQAA 3EAJA 3ODDA 1PPBH 2FTLE 4CRAA 1UTOA 3V3MA 1GJ4H 1VJ9U 4X8UH 2BHGA 2ZGHA 2ZDVH 1X7AC 4U30A 3KQCA 5JDUB 2K1QA 3A7YA 3M7QA 2WPLS 4K3JA 1EATA 1W0ZU 5E0JA 1G2MA 1E0FD 4ABFA 1ETTH 1O39A 3A8DA 3SUFA 4AGKA 2RA3A 2JETB 1BHXB 4KTUA 1ETSH 5EODA 3OTJE 3O8BA 1SGQE 1C1SA 5LPEA 3ZZ7A 1BTPA 2P3FH 3PWCA 4OS6A 2XBYA 2O8MA 2ZGXH 3A88A 5F03A 1ZHRA 1BMLA 1BIOA 1GJ9B 1MD8A 4X2YA 1IAUA 1ELTA 4YM9A 1O2HA 3LIWA 2ZHFH 1W7XH 2BXUH 4WMDA 4BAOB 1XUFA 1SGCA 5EQSA 3RXCA 1WYKA 1QL9A 2F9VA 3B9FH 5AFYH 1ZPBA 1KDQB 2ESTE 2ZFPH 3SI3H 2BVRH 3F9GA 2VH6A 1HAGE 3FP6E 3A7XA 1MAYA 2ZPQA 4X1SU 2LPRA 3QX5H 1S5SA 3RC5A 2GV7A 4A7IB 2CJIA 2VVCA 3K6ZA 1GHYH 3ESTA 4X8VH 4NSYA 3ZV8A 2BM2A 3M5LA 2FOAA 1W3CA 4KGAA 2FPZA 3P6ZB 3SO3A 2AGIX 2BMGB 2FOCA 1GJAB 2CN0H 1P2IA 1A46H 1P9UA 2NU3E 1C1QA 3E3TA 1IQGA 1XUIA 4X8TH 2VU8E 4FUBA 1HJ9A 1IOEA 4GCHF 3CP7A 2DUCA 3RXIA 4HZHA 4IN1A 3QO6A 1D3TB 1ZTJA 4ABHA 2XBVA 3QZRA 2I6SA 2UWPA 4ZH8A 1QB6A 1BB0B 2EEKA 3P92A 3P8GA 3SQHE 3SNBA 1K1NA 2OD3B 5LPRA 1KSNA 1O3EA 4NG9H 1HB0B 1QB9A 2PLXA 4NIVA 1C5YB 2FOBA 1GBFA 2WUCA 2F91A 3QGJA 3A87A 4OGYA 3QUMP 1XUJA 5BPEA 1SSXA 2FYRA 4INKA 1SOZA 5IDKA 2G81E 4K8BA 3P70B 2GKVE 2BY8X 5DP9A 1OYTH 4HTCH 4DW2U 1C1MA 1TGTA 1NU7B 1WOFA 4ZHLU 3GY7A 1EZQA 4GCHG 1Y3WA 2FX4A 1O5DH 1QJ7B 1XVOA 1QFKH 4Z6AH 2PFEA 1Y3UA 3SORA 5G4BA 3MWIU 4YOJA 2ANWA 4BTIB 3LGVA 3QTOH 2XWBI 2Y80A 1ORFA 1C5UA 2AFQB 4BANB 4B74A 3SV6A 2ZFRH 1AZZA 5JYIA 3EA8A 1EJAA 2F83A 2ZZUH 1S6HA 4MVNA 5T6FA 1P2OA 1EXFA 3DHKH 5FBEA 5C5NA 6GCHF 2HWLB 4I33A 1DICA 2HOBA 3MU0A 4K1TA 3LGYA 3BTME 1K2I1 5JPMH 4YESB 3VB6A 2IJOB 1PQ8A 4A5TS 2Q6GA 3ELAH 3P8OA 1K1PA 2FS9A 5DP5A 2OC7A 3ZVGA 2ZFFH 2Q6DA 1GDUA 2GZ7A 1QHRB 3RU4E 3W95A 3BTTE 1O2WA 2BY6X 1EAWA 4NIXA 4NA8A 2TGPZ 2LNCA 3MO9A 3PB1E 2PKSC 2Z3EA 1AFEH 1AO5A 4LOYH 1P09A 2FI3E 2G5VA 1WBGB 4CR5A 4AZ2B 4DGJA 1C5OH 1UMAH 1AFQC 2ZCLP 2Z3CA 2AMDA 4DG4A 1P2MA 2ZTZA 2ZDKA 1THRH 2SGAA 4UFFH 1FUJA 1NRQH 4NFEA 3UIRA 5DO4H 4O9VA 2NU1E 2FP7B 1P0SH 3RXUA 3LH3A 3SV2H 2ZA5A 3PROA 4J2YB 1ZHPA 4XFQA 1DOJA 5C1YA 7GCHF 1TGBA 4UFGH 2H5CA 1LHCH 1EZXC 1O3OA 1V2WT 2AH4X 2BDIA 4ISOA 1V2NT 1XVMA 1GCTC 2P3TB 1W10U 1UHBB 1HBTH 2PSXA 4IC5A 2FM2A 4CRDA 5EGMA 4U01A 1HAHH 5E2OA 2QAAA 4YT7H 1O3MA 2CHAC 1FY5A 4JZFH 5T6GA 4ASHA 3RU4T 2F9NA 2AGEX 2FOGA 2A7CA 2ZDLA 2GT7A 3GISB 3ZZ5A 1RTKA 1GI5A 3M5MA 2F9PA 1NPMA 1HYLA 5L2ZH 2C8ZB 1HAZB 1GBLA 5A8YA 1AZ8A 5EOKA 2FEQH 2ZQ2A 1F5RA 1NT1A 1ZJKA 2IPHA 1AUJA 3LDXH 2ZU5A 1GHAF 1NFWA 2BY7X 5EG4A 5H4IB 1HAIH 1KXBA 3Q00A 1UTPA 5DP7A 2BD9A 1TABE 2Q1JA 3BTQE 3ZVCA 4CRBA 2A0QB 2ZPSA 4FUGA 3GYMA 1OWHA 3KHVA 1OXGA 4AYYB 3RXEA 1GGDB 2FLRH 3V7TA 2OXSA 4Y11E 4AFUA 4X1NU 5AHGH 4FVDA 3AAUA 1VGCB 3R3GB 3BEFB 4INHA 1HJ8A 1Y8TA 3BSQA 3M3TA 1DWDH 1TFXA 4DURA 1YCPM 1ZLRA 2ZQ1A 2A4GA 4UEHH 3UOPA 3P95A 2BDGA 5GIBA 4U2WA 3RXLA 5F8XA 1LO6A 1QTFA 1YPJH 1NRNH 1F5LA 2D8WA 2TBSA 1DXWA 3SJKA 4ZKOU 1O2PA 3PMJA 1TIOA 1G3DA 3E0NB 3RXKA 2CF9H 3RXOA 1E35B 3F1SB 1C1OA 1PPHE 1E34B 4WY3A 3NCLA 1GHXH 1NRPH 1T32A 1SGYE 2G8TA 1YP9A 4FU7A 5DK1A 1O32A 1AKSA 2FOHA 2GDDA 5TCCA 1OX1A 3S69A 3ATMA 1P05A 3PLKA 2ZI2H 3H7OA 2GDEH 4XBBA 1WCZA 4ABEA 2AGGX 2WPMS 4NZQA 2BD3A 1V2ST 2AMPA 1MTNB 3E16B 1GJ6A 1XKBC 1C5WB 4X2VA 5FX5A 1GBAA 3AW0A 1MH0A 1XXDA 1PFXC 4TPYA 3SGQE 1T8MA 4KP0A 2F9OA 2PWXA 2ZCHP 1NRRH 5J4QA 3TNSA 1CA0B 5GXPA 4OS2A 2BX4A 5GCHG 5A0BA 3RLWH 1EZUC 1OWEA 3MU1A 2OLGA 5FHTA 4ABIA 3EA9A 3ZVFA 1BJUA 1NESE 3RXTA 1EAUA 1CBWC 1TQ7B 3B8JA 5EQQA 1BTZA 5IYTA 4I7YH 1C2FA 2ZEBA 1C5VA 3BTKE 3A8CA 4E7RG 5DP3A 1C5SA 1A5GH 1NO9H 4BOHA 3RXAA 1N1LA 4E06H 1EP6A 1A5IA 2O8UA 1O2XA 1BBRH 1S85A 1TRYA 2GP9B 2A1DB 1EAIA 1GJ7B 1RTLA 1O38A 1OWKA 3MH4A 1KXDA 3U8OH 5EXMA 3EGKH 4MG3A 1YCPK 3PMBB 4IS5A 1MZAA 3RC4A 3BTGE 3URDA 4X8SH 3RP2A 8GCHF 1DS2E 3K2UA 1LKAA 3TJNA 1BT7A 1DVAH 3FVFB 1OS8A 2O9QA 3TGIE 1HRTH 1EJMA 1EKBB 3VPKA 2ODPA 5TJXA 1RFNA 1LTOA 4WF8A 1UK4A 1CBWB 1ZGIA 2BZAA 3RXVA 3MH6A 3K65B 2J2UA 3SBKA 5B6OA 2Z9KA 4HFPB 1TNHA 4B73A 3LOXA 2SNVA 1SI5H 1VITG 3H7TA 4NWLA 1FY1A 1O2TA 1Z8JB 1DITH 1ZMLA 1GCTB 5JBTA 3BEUA 4CR9A 2H2ZA 4MDSA 3Q76A 1TYNA 2A2XH 2UWOA 1TNIA 5L6NH 2A7JA 3M35A 5CHAC 3SU1A 3WY8A 1MKXH 1GCDA 3SHAH 3HKIB 3EE0B 3F9FA 1ZZZA 1P57B 3LT3A 1HIAB 2G5NA 2QA9E 3LH1A 3S9BA 2Z9JA 1YPLH 1YM0A 1SQTA 2BTCE 2AS9A 2WV5A 9LPRA 3DFLA 5EXLA 1EJNA 1JRTA 3LC5A 4CREA 1GDQA 4D76A 1F0UA 3BTFE 1UJ1A 3RMMH 1ESAA 1LPZB 2SGQE 4X1RU 2ZU1A 4B76A 3A8AA 3VXEH 1MTNC 4ZHAA 2YOLA 4D7FA 1MBQA 5A0CA 4Y71A 4X0WU 3RXRA 1K1OA 1Z71A 1SGEE 2WYJA 1NRSH 1A2CH 1C5QA 1TMUH 1N8OC 4JMYA 4XOJA 2IN2A 9ESTA 4B2BA 4YLUA 2R2MB 1VGCC 2BVSH 1WSSH 1JWTA 5F6MA 3RXFA 1EX3A 3I78A 2Y82A 1TNGA 1TGNA 3GDUA 2BY5X 1H9LB 4RKOB 2ZGBH 4ISLA 1FIZA 1GJ5H 1TA6A 3LU9B 1F2SE 1TOMH 4B71A 2W3IA 1JMOH 4WMEA 3QK1A 3F68H 3S9AA 3T62A 3SU6A 1S83A 3A89A 4FUIA 1SC8U 1TB6H 4KTSA 1AQ7A 1ZJDA 4I8KA 2BX3A 2GCTB 3SU5A 1HGTH 1GGDC 5C1XA 3U98H 2OP9A 3DD2H 1P01A 1ZYOA 1WUNH 1FN8A 1QR3E 2CHAB 3SGAE 2ULLA 1HV7A 4K1EA 3T26A 1NM6A 2BD7A 1PYTD 1DWCH 1ELDE 1K22H 1GMDG 2O8TA 4R0IA 1O2YA 2FOFA 3EQ0H 1P10A 2JH5D 1O5EH 3O8DA 1SHHB 1BJVA 1DXPA 2QYIA 4AGJA 4ZXYH 1GMHG 5E0HA 5C20A 4ZROA 4AORA 5LGOA 4J1YA 1DANH 2J95A 1BRUP 1V2KT 2VB0A 3HK6B 5GDSH 4FUJA 3AW1A 1BTUA 1GG6B 1D3QB 2P8OC 3A86A 1OP0A 3FP8E 2ZCKP 5DJ7A 2SGPE 1AVWA 3GDSA 2AIQA 2IOTA 1GBDA 2PV9B 3ZZBA 1YPHE 1WU1A 1YC0A 3TJVA 1IQHA 1EOJA 3BN9A 2HLCA 1GI0A 5JB8S 1G36A 3HATH 2QCYA 1AN1E 3ITIA 2J9NA 1H8DH 4AFQA 1O3FA 1OP8A 1NY22 4IGDA 3KQDA 4QT8C 4X1QU 1ZHMA 4HI3A 4UFDH 1PYTC 1SG8B 3BIVH 4NSVA 2FI5E 3OX7U 2XC0A 4A6LA 2C93B 2XBWA 1FXYA 3TH2H 1WQSA 4GPGA 1NTPA 4HGCA 2BD8A 2HPQH 3B23B 2ALPA 5DP6A 1YPKH 6ESTA 2VWMA 1A4WH 3FZZA 3SNCA 3S0NA 1GBEA 2ZHEH 1IHTH 1SB1H 1V3XA 4IN2A 3E8LA 1GI1A 4D7GA 2ZWLH 2CXVA 1OP2A 1VITF 1SLWB 2V3HH
chains in the Genus database with same CATH superfamily
1IQNA 1NFXA 3OE7D 3RLYH 1A1RA 4I8GA 1Z8RA 3OY5U 1KTSB 1N8OB 3OSYA 1SGIB 4TY7A 2C90B 1UVSH 1GI2A 1AGJA 1MKXK 4IBLH 3VXFH 2VIDA 1KTTB 1C5NH 1CE5A 1THSH 4IMQA 3T29A 1NZQH 2SGFE 1VITH 2Y5HA 5CE1A 1QL8A 2FOEA 2OC0A 4IW4E 2VBCA 1KLIH 3QGNB 3ZZ6A 3LONA 1K9OE 1Y3XA 1CHOG 1G3CA 3M37A 3URCA 4B2AA 3ZZ8A 3C27B 3KCGH 2ZGJA 3BV9B 3UOUA 1E37B 2H9TH 1ZSKA 1G30B 1EPTB 1TONA 1T8NA 2W7SA 4ZKNU 2JH6D 2ZHDA 4BTUB 1DSUA 1AB9C 1L1NA 1TMTH 1A7SA 1DDJA 1K1IA 2XC5A 4GHTA 1QA0A 2ZU2A 3EE7A 4SGBE 4PROA 1K1MA 2QF0A 4OS5A 3RDZA 1UK2A 3ZYDA 1ETRH 1SFIA 1DE7H 2XW9A 1TAWA 3HPTB 3EDXB 3SUDA 1BQYA 1J16A 2QN5T 3ENSB 2VVUA 1KXFA 4DIIH 1A0LA 1DWEH 4CHAC 1P12E 3ZZCA 1O2UA 1GVZA 1UW7A 2FO9A 2Y81A 2C8WB 2J4IA 4ACBA 1UCYE 4GUXA 1SFQB 5KEDA 3GCOA 1GG6C 3GICB 5C5OA 1WTHD 1QGFA 2XCFA 1MMJN 2OQUA 3PTNA 1OPHB 1H9HE 3TGKE 1QRZA 1ELEE 1GI3A 4Z0KA 4U32A 5GNDA 1EASA 1Q3XA 1UK3A 3SJ9A 4YO9A 2RDLA 1WTGH 1KLTA 4A92A 1E36B 1GI7B 1SGDE 2EA3A 1W12U 2D26C 4LK4A 1TNKA 3DT0H 5K7RA 4ABAA 1V2JT 3RXQA 1ELBA 3KQEA 4OS7A 4JZIA 3BIUH 2TPIZ 3QWCH 1Z7KA 5AF9H 1GPZA 1V2QT 2Z9IA 1ABIH 1ELCA 1IHSH 3MNCA 4ISHH 1K0HA 1BRAA 3SGBE 3E91A 1FPHH 1BZXE 1FAXA 1MTWA 2RG3A 1KDQA 4MNVA 1JOUB 2A7HA 3U9AH 1MTUA 2VWOA 2JETC 2ZECA 4XSKU 3SJ8A 1MCTA 2M2AA 3A81A 4Q2KA 4NIYA 1QBNA 3F9EA 4DT4A 1AWFH 3GY3A 3PYHA 4K2YA 3T2NA 3TK5A 3FKSD 3FFGA 2VWLA 3GY6A 5JBCS 2PGBB 1O2ZA 2V6NA 3UREA 3VB7A 3UB0A 2HNTC 4K5ZA 1V2OT 4Y0ZE 1W7GH 1C1VH 1Z6EA 2I6QA 2L6OA 2XYAA 3BF6H 4FUFA 4GHQA 3D23A 1C5ZB 5L30H 3DCLA 1GJBB 4OS1A 3U69H 2C3SA 2V3OH 3VEQB 4I8LA 4X6MA 2YMSB 3SHCH 1YKTA 3DSGA 3GY8A 1SBWA 1LVOA 3OEHD 1AVXA 4GAWA 1P03A 2BD2A 1FY3A 3F6UH 2P94A 1ZPCA 1OSSA 2TRMA 1FN6A 1TX7A 4LZ4B 2JIZD 4FUHA 5C0TA 5EIYA 1O2KA 1O37A 1FJSA 3T28A 2O8WA 3TJUA 1BMNH 5DKMA 1FZZA 5DP4A 3L6PA 4AFZA 1O2VA 4NZLA 1TA2A 1V6DA 3IWMA 1M9UA 4E7NA 2GX4A 4O3TA 1TQ0B 4X1PU 3TITA 2TIOA 8KME2 3STJA 2VIVA 5HIYA 1TX8A 1K28D 3BG4B 1G37A 2A4RA 3PMHB 2H9HA 1FQ3A 2HNTE 2ZTYA 2BQ6B 1YPEH 4DJZB 2EC9H 2PR3A 4FUCA 1GBTA 5ESTE 2KAIB 4B2CA 5I25A 2V35A 1FY4A 1HNEE 4JYUH 1RIWC 2ZU4A 1T4UH 3ZZ4A 3A85A 1LVMA 2A4OA 1EB1H 2ZHWH 1NC6A 2C8YB 2FX6A 3M3SA 2V3MA 3BTEE 1F5KU 1JIRA 2G4TA 1OOKB 1O3BA 3OYPA 1T7CA 2BDYA 3RC6A 3FZDA 3TH4H 3SNDA 2ZHQH 1ANEA 1RD3B 3JZ1B 3JZ2B 3PLPA 4JZEH 3K9XB 2RA0A 3OAAD 2R3YA 4DCDA 2OC1A 1H8ED 1YYY1 1UTKA 1DUEA 1O3NA 3M5OA 2TGTA 2HRVA 3D62A 2A32A 2QXIA 1C2GA 1GBIA 1BMAA 4AN7A 1TX6A 2XNIA 1JIMA 2PUQH 1SKYE 4GSOA 1DX5M 5EJZA 3M7UA 2BY9X 3SU2A 1B7XB 1ARCA 1YGCH 2ALVA 1BTWA 3I29A 4CRGA 4H4FA 2FMJA 1O3AA 2ZC9H 1UVOA 3RMNH 3O8CA 2ZIQH 3GY4A 3LJOA 1D3PB 2R0LA 4NA9H 4UE7H 3T25A 3AAVA 2ZGCA 3ZYEA 1SGPE 1INCA 4B1TA 1WQVH 3KN2A 1D9IA 2UWLA 1IQJA 4TPIZ 2ZDMA 1QL7A 1O2RA 1OYQA 2GCHG 3F2FA 5DN6D 4SGAE 4Y79A 3D65E 4NWKA 4BXWA 2V7QD 1HAPH 1YLDA 1G2LA 1PPZA 2Z9GA 5A0AE 2YNBA 2FI4E 1GBMA 3G01A 1BUIA 3PMAB 1DWBH 5CDFE 2O8LA 2CF8H 1C1PA 4ASUD 4AFSA 3LGWA 1C1UH 1EQ9A 3F0OA 4AYVB 3QTVH 4Q7XA 1A0JA 1IQFA 1WDIA 1HAYB 1AHTH 1DM4B 4A1XA 2AEIH 2PW8H 2VGCC 5JBAS 3PTBA 2QGRA 3QDZB 3MHWU 2JH0D 3D49H 3RXGA 1SQRA 1SGFG 2F9UA 2FIRH 3SN8A 2OTVA 1GMCF 3CENA 1AE5A 1GBCA 4DY7B 3TLOA 6CHAC 5ETXA 1V2LT 5AFZH 3NUMA 5FX6A 3V0XA 3VB4A 2J92A 1CT2E 1O2NA 1ABJH 1PPGE 4BAQB 4CBOA 2AERH 1GHAG 1GL1A 2ODYB 2FWWA 1TNJA 2IJD1 3ATIA 2WPIS 1Q2WA 5FPSA 1S84A 5A09A 2R9PA 2VNTA 3P17H 3KQ5A 2W26A 2PKSB 3V13A 4Q7ZA 3KGPA 1Y5AT 1HCGA 2F4LA 2AMQA 1P2NA 2VINA 1P2JA 4DIHH 4LZ1H 4ZHMU 2WINI 5F8ZA 2FXRA 1T8OA 1ZRBA 5E0GA 1TRNA 5DGJA 3RUOA 1A5HA 4B6EA 2ANYA 1UTMA 2STBE 2Y7ZA 1Y5BT 1WXRA 4BAHB 3K6YA 1UTQA 1V2TT 1GL0E 3OTPA 2H9EH 4Q7YA 3Q77A 3A84A 1NBME 1BRBE 1GVLA 2ZTXA 4BAKB 1MD7A 1ZPZA 1E1RD 1JBUH 2XXLA 5DP8A 1SLVB 1NFUA 1XXFA 1Z1JA 2UUJB 2W7UA 2QV1A 2ZFQH 1RGQA 4I32A 4RKJB 4WXVA 1DUAA 5HGGA 3NK8A 3VGCB 4ESTE 1ZSJA 5L2YH 3FO8D 3UR9A 2AHME 2TGDA 3ZV9A 1L2EA 1N6YA 3UUZA 2J38A 4GVUA 3VFEA 1J8AA 2GT8A 3SU0A 1VCWA 1GI6A 1CA8B 4XE4A 4D9RA 1LPKB 3FN8A 1BBRK 2Z7FE 3RXMA 1CGIE 4MPVA 3UQVA 3PO1B 1XM1A 4I8HA 6CHAB 4VGCB 1H1BA 1BTHH 1GBHA 3PV2A 1TBQH 1XUKA 2EY4C 1MQ6A 1SHYA 1D3DB 3KF2A 1L1GA 4Y7BA 1TBRH 2WPDD 3SUGA 2YNAA 3SU4A 1GVKB 2OBQA 3FAOA 4DVAU 3U8TH 1AY6H 1PPFE 1C2LA 1TPAE 2HNTF 1SL3A 5C17A 4JZDH 2ZF0H 2GMTC 2SGEE 2M5TA 3DFJA 4RSPA 1O2IA 1AE8H 4UONA 1VJAU 2WPJS 1RTFB 1NS3A 1NFYA 1GMCG 2VIQA 4K69A 4B6FA 2Y6TA 3DUXH 2C4FH 2SFAA 1SGNE 2GGVB 3BTDE 4JYVH 1TPPA 2PTNA 2WUBA 3NZIA 1QURH 4IC6A 1MU8B 1C1NA 1O3IA 3RXBA 1C5LH 3NWUA 2FOMB 4RT1A 1AI8H 3TK9A 4ABGA 3RM0H 1ELFA 4TT3D 1HFDA 1QA7A 2ODQA 4A1VA 4OM9A 1ESBA 1YBWA 5DG6A 1TMBH 2NU0E 3I77A 1RJXB 1SR5C 4AOQA 3O8RA 4FU8A 1UTNA 1FI8A 3SZEA 1WV7H 3CS7A 3MFJA 3S7HB 2OUAA 2WPHS 2FS8A 2CV3A 5FBIA 2BDCA 2QF4A 1GHBG 3MYWA 5FCKA 4X6PA 2KAIA 1IQMA 1MUEB 2DE8A 3EA7A 4ISNA 1GI4A 4FVBA 1MCVA 2ZU3A 1O3LA 3E1XB 1J17T 3R0FA 4K1SA 3STIA 1AFQB 1GJ8B 3SQEE 2BYAX 3A8BA 2V0BA 3BEIB 5FPTA 1K21H 1EB2A 2C8XB 1PPCE 1FONA 4LXBH 4JZ1A 1ANDA 2BZ6H 3MOCA 2XNDD 1P8VC 1ZRKA 2BQWB 3SUEA 4Y0YE 1L4DA 1RS0A 2ASUB 2XBXA 3SJOA 3MU4A 5LH8A 5K0HA 2QC2A 2BLWA 4Y8YA 1RIWB 3IG6B 1TPSA 5ABWA 5A8XA 1O2MA 1BTYA 2J98B 4XDEA 3UNSA 4O3UA 1EPTC 1KLJH 3MTYA 3A80A 1O35A 4ABBA 3F2GA 4NIWA 4WVPE 1BDAA 1E79D 2F9BH 2Y5FA 4AB8A 1MU6B 1Z8IB 1O2LA 5C2ZA 3ZVAA 4ZKSU 1EUFA 4K60A 2GZ8A 2XTTB 1L4ZA 4FETA 3UWIA 2FZZA 5E2PA 3SNEA 3ZVDA 4Q63A 1ZTLA 3SOSA 2Z94A 4ABDA 2BD5A 2G51A 4ZCNA 1SGTA 2EI6A 1T4VH 1LKBA 2QXGA 3M5NA 2UUYA 1SGFA 2HPPH 4YT6H 3BTWE 2A4QA 1IQLA 1L1JA 1XUHA 1A61H 5GJ4B 3P8FA 4Y76A 3LKWA 3GCTF 1C2EA 5E8EH 1Z6JH 4IMZA 5C1UA 4Z1MD 2DE9A 2P93A 4DOQA 1BOQA 1O2GH 1MAXA 4NGAH 3GY2A 2CGAA 3AVZA 1OHHD 4KELA 1UTLM 1TWXB 1MKWH 1PPEE 1LVYA 4D9QA 1FMGA 1ANBA 1S0RA 2FODA 3KEEA 1V2RT 3T5FH 2VIPA 5HMAA 4Q80A 1LVBA 1UHBA 1CVWH 1C2DA 4TWWA 3W94A 1EFRD 4X2XA 4KTCA 1S81A 1DT2A 2Z6BD 1H9IE 4YOGA 2ILNA 3H5CB 1NN6A 2OCVB 4FXGH 1KXEA 7GCHG 2NU4E 2Y5GA 4UDWH 1NROH 3RMLH 4JK5A 1W2KH 3SJIA 1C2HA 1GHBF 5ESBA 3Q3KA 3VB3A 1F0TA 4MTBA 1O5GH 1AKSB 1P02A 3F2HA 1O3GA 1C9PA 3F0PA 2G00A 1CGJE 3A7TA 3PRBA 2A45B 2A5IA 3HK3B 2JKHA 3MO3A 4UFEH 2UUKB 2FDAA 4H42U 4O97A 5DPAA 1V2VT 2WV4A 4X2WA 1F7ZA 1S6FA 3GYLB 2A5KA 3IITA 1C2IA 1DY9A 2P8OB 3OY6U 2R2WU 2PGQB 1EOLA 2EI8A 1BHXF 3KQBA 1Y3YA 3UQOA 7ESTE 1TOCB 3UPEA 2J97A 4JK6A 1MTVA 1PQ5A 3LC3A 1B0EA 3TGJE 3M7TA 1EPTA 1G3EA 8LPRA 2QIQA 3UY9A 2QXHA 1WAYB 3HGNA 4WH6A 2G4UA 8ESTE 1ZGVA 1C5PA 1DFPA 1Z1IA 5EXNA 1TGSZ 1YF4A 1SMFE 1HXFH 4XD7D 1GWAA 1HAXB 1O3CA 1MKWK 1UTJA 5C94A 1O3DA 1SVPA 1QQ4A 2ANMH 1P2QA 2TGAA 2ZDNA 1DLEA 4YLQH 3PLBA 4CHAB 2BLOA 5DSFA 2B8OH 4VGCC 4Y10E 1GDNA 3F3BA 1A0HB 2AIPA 2OC8A 3QN7A 1QRXA 2VWNA 2H6MA 1GJCB 2GCTC 2UUFB 5JB9S 4R8TB 1ZMJA 5KGOA 4TSFD 1RRKA 5FXLA 3U1JB 1XMNB 1A3BH 4CH8B 1K1LA 1HAOH 3RXSA 1AB9B 1C1RA 4ZUHA 1ZTKA 4WMFA 4CH2B 2FYQA 1NBMD 3N99A 3E90B 2W5EA 2QF3A 3LPRA 3SV7A 2BDHA 1F0RA 1CHGA 7KMEH 3L3TA 3UTUH 1CQQA 2A2QH 4RN6A 3RM2H 3DSPA 1C2KA 2ZFSA 1UVPA 1ACBE 1HAVB 3WWFA 1SLXB 4Y8ZA 1LDTT 2HALA 3S7KB 1XKAC 2Q6FA 3N7OA 5T1VA 1AD8H 4A1TA 5IK2D 1QIXB 5F8TA 4P00A 1QY6A 2XRCA 4CBNA 2BQ7B 3ZZ9A 1H4WA 1S82A 2THFB 1C5TA 2VIWA 3ZVBA 2GTBA 1TNLA 3M61U 1VKYA 1LQEA 1G32B 1MTSA 3PM3A 1P3CA 1J14A 3UR6A 3SYJA 2PKAB 4X6NA 4BAMB 2PSYA 3SI4H 5EPYA 2P3UB 1C1TA 3FP7E 2BXTH 3UWJH 4MLFB 1MQ5A 1QBVH 1SGRE 2A31A 2J5UA 1O5FH 1S0QA 1UCYK 1C2JA 2Z3DA 3MH5A 4FUDA 2QF5A 5KECA 3SV9A 2H5DA 1P04A 1C4U2 4AC9A 2FESH 2Z9LA 4UD9H 1FAKH 1FY8E 4FU9A 2H1UA 2WSSD 4YZUA 1V2UT 3T27A 4KKDA 1Y5UT 1CGHA 4NFFA 5EPNA 4BXSA 1QCPA 1AIXH 1OKXA 2JDID 3GY5A 4FOUC 2HVYB 1LHDH 1TPOA 3LGTA 2R3UA 2GCHF 1J15A 3MI4A 4TYDA 1O34A 5EW1H 3SNAA 1ELGA 4I31A 2EQNA 2A5AA 1UO6A 5GPIB 2OINA 1SPJA 4THNH 3GCNA 3KNXA 1HLTH 1O3KA 1AU8A 2BB4A 1BTXA 5EQRA 3LGUA 3H09A 2R0KA 1BMFD 1W13U 2WYGA 1LMWB 1KYNA 3BTHE 4INLA 3UNQA 3UAIC 2VGCB 2GV6A 4ZAEA 1GMHF 4AG1A 5A2MH 2BOHB 1P2KA 1TGCA 1SQOA 1G3BA 2FLBH 2GMTB 2BLQA 1DY8A 3LGIA 3NRLA 1Y3VA 3A83A 1LCYA 4F49A 1HJAB 2B5TB 2JJ1D 2XWAA 2WHXA 1C5MD 1AVGH 1LQDB 2B7DH 3A7WA 4CRFA 2CMYA 1J9CH 2KM0A 1UVUH 3TVJB 6LPRA 1AUTC 1CHOF 2RCEA 2AYWA 3EYDA 2PHBA 2K0QA 1ZMNA 3TPIZ 2K8IA 1YCPH 3L33A 1DLKB 4XRNA 2D2DA 1C5RA 3PO1C 4MPUA 4F4OC 1BBRE 1QRWA 2SGDE 1PQAA 3MU8A 1O2JA 2BD4A 5GCHF 1ZSLA 6GCHG 1O31A 1SOTA 5EU8A 3SU3A 2NWNA 2BDBA 1CT4E 2J94A 3C1KA 1NU9A 1K1JA 1GI9B 1LPGB 1QNJA 2XOKD 1EP5A 3PWBA 4MNWA 3GCHB 1TRMA 1B5GH 1S6LA 1VCPA 2CK3D 4MPWA 4TWYA 1THPB 2BDAA 1JXPA 1ANCA 3HKJB 2HVXA 3ZZAA 1T31A 3ATWA 1BA8B 1CT0E 1DPOA 4MQAA 2W3KA 3MNBA 1IQKA 4MNXA 4WH8A 1CA0C 2P16A 1FNIA 1AWHB 3MH7A 3U8RH 1L0ZA 1V2PT 4O03A 1Q31A 4WXIA 4E05H 3TH3H 2OBOA 4Y6DA 1V2MT 3NXPA 1IQIA 3VGCC 1EAXA 3GOVB 5FPYA 1KXCA 3MNSA 4Q4LA 3RMOH 3MO6A 1O5AB 4H6SB 5AVDA 1C1WH 3MQKC 2ANKH 1ZOMA 1O33A 3ZVEA 3TK6A 1C9TA 1Z8GA 4X6OA 5HYOA 2ZFTA 1MBMA 1PQ7A 1O2SA 1P11E 3RXPA 1CU1A 1YPMH 3UFAA 1IQEA 2VH0A 1FPCH 1O5CB 2ZNKH 1EZSC 1HPGA 4TY6A 5J4SA 5LPFA 1OWJA 1DSTA 5BRRE 3RXJA 4CRCA 3SV8A 1RXPA 1CSOE 3MMGA 1O3PB 5SGAE 3GCHC 2D1JA 4AX9H 5EW2H 1FV9A 1KXAA 1O30A 1W0JD 2STAE 5GWZA 1HDTH 1TALA 1QQUA 4MNYA 1TLDA 4MPXA 5CHAB 1GJDB 1GBKA 1N6XA 1JRSA 4B75A 1W11U 2OQ5A 5HIZA 2GD4B 4K8YA 3KL6A 4NCYA 3NPSA 1O5BB 3A82A 3V12A 3GCTG 1W0KD 1TBZH 2Y7XA 2ZG0H 3S9CA 4AB9A 1HUTH 3M3VA 1ARBA 1ID5H 2QXJA 3RXDA 1UCYH 4ZKRU 1P06A 2VVVA 5I46H 3MNXA 4GLYA 4WWYA 4OGXA 5A8ZA 3BG8A 2ZDAH 4RI0A 5C3NA 5EJ1A 1F0SA 1GMDF 3ODFA 1O36A 2XC4A 1QJ6B 2ZKSA 3ZZDA 1H8IH 1HJAC 2P59A 1YPGH 1P3EA 2J34A 2F43B 3MU5A 1GBJA 3ATLA 2GVFA 2HGTH 4WJG2 2ZP0H 1G9IE 1YPHC 3A7VA 1YLCA 1XUGA 4D8NA 1ESTA 1QJ1B 3TIUA 1HAVA 3QZQA 1W0YH 1GHVH 1HXEH 1UVTH 2JJ2D 2SNWA 3Q3YA 5HM9A 1A3EH 3P8NA 3SW2B 1OWDA 1O3JA 3F9HA 1VZQH 3A7ZA 2VIOA 4XBCA 1D6WA 1O0DH 2XCNA 3OU0A 1CO7E 3HGPA 3OEED 1ZR0A 1C4V2 1D4PB 1BMMH 1GI8B 1QB1A 2BLVA 3RU4D 5CMXH 1O3HA 1KY9A 1Y59T 1W14U 3E0PB 3VB5A 2P95A 3Q3XA 3RXHA 1LHFH 4BNRA 4Y7AA 3CS0A 1U6QA 5T3HA 1HIAA 2PKAA 1C2MA 8GCHG 1GHWH 1D6RA 1GBBA 5C67A 4XBDA 2EI7A 1BITA 2WPKS 1FDPA 4OS4A 3NKKA 4FUEA 4M7GA 2BOKA 1ELAA 3TJOA 1T8LA 4ABJA 3ATKA 3DA9B 2QY0B 1FIWA 1TE0A 3GDVA 4ISIH 1BCUH 4JYTA 3UNRA 5HXFA 3TU7H 3QLPH 1E38B 4AG2A 1KIGH 2ZPRA 3E6PH 4Y8XA 4YTAA 3TNTA 4NA7A 5T6DA 5TCAA 5HM2A 5FCRA 1B0FA 2NU2E 1BRCE 3LJJA 4I8JA 2OK5A 7LPRA 4BTTB 1C4Y2 1FLEE 1C5XB 2PUXB 4JCNA 1LHEH 1O2OA 1PJPA 3KIDU 2B9LA 2PTCE 3AASA 1SLUB 1MZDA 5JBBS 1OWIA 5PTPA 4ZMAH 3PV4A 1P9SA 5B6LA 3SZNA 4ZXXH 4YOIA 2ZO3H 2B0FA 2G55A 2G52A 4DT7B 1VCQA 1LHGH 3BG4C 3ZZ3A 3FANA 1QBOA 2FTMA 1GHZA 1F92A 5FAHA 1W8BH 2GZ9A 4RT0A 3M36A 3U1IB 2VJ1A 1AMHA 2BVXH 4H6TA 1ELVA 1XX9A 1VR1H 2F3CE 1O2QA 1SQAA 3EAJA 3ODDA 1PPBH 2FTLE 4CRAA 1UTOA 3V3MA 1GJ4H 1E1QD 1VJ9U 4X8UH 2BHGA 2ZGHA 2ZDVH 1X7AC 4U30A 3KQCA 5JDUB 2K1QA 3A7YA 3M7QA 2WPLS 4K3JA 1EATA 1W0ZU 5E0JA 1G2MA 1E0FD 4ABFA 1ETTH 1O39A 2YMSC 3A8DA 3SUFA 4AGKA 2RA3A 2JETB 1BHXB 4KTUA 1ETSH 5EODA 3OTJE 3O8BA 1SGQE 1C1SA 5LPEA 3ZZ7A 1BTPA 3KYFA 2P3FH 3PWCA 4OS6A 2XBYA 2O8MA 2ZGXH 3A88A 5F03A 1ZHRA 1BMLA 1BIOA 1GJ9B 1MD8A 2IPQX 4X2YA 1IAUA 1ELTA 4YM9A 1O2HA 2KCYA 3LIWA 2ZHFH 1W7XH 2BXUH 4WMDA 4BAOB 4F48B 1XUFA 1SGCA 5EQSA 3RXCA 1WYKA 1QL9A 2F9VA 3B9FH 3FOAA 5AFYH 1ZPBA 1KDQB 2ESTE 2ZFPH 3SI3H 2BVRH 3F9GA 2VH6A 1HAGE 3FP6E 3A7XA 1MAYA 2ZPQA 4X1SU 2LPRA 3QX5H 1S5SA 3RC5A 2GV7A 4A7IB 2CJIA 2VVCA 3K6ZA 1GHYH 3ESTA 4X8VH 4NSYA 3ZV8A 2BM2A 3M5LA 2FOAA 1W3CA 4KGAA 2FPZA 3P6ZB 3SO3A 2AGIX 2BMGB 2FOCA 1GJAB 2CN0H 1P2IA 1A46H 1P9UA 2NU3E 1C1QA 3E3TA 1IQGA 1XUIA 4X8TH 2VU8E 4FUBA 1HJ9A 1IOEA 4GCHF 3CP7A 2DUCA 3RXIA 4HZHA 4IN1A 3QO6A 5FL7D 1D3TB 1ZTJA 4ABHA 2XBVA 3QZRA 2UWPA 2I6SA 4ZH8A 1QB6A 1BB0B 2EEKA 3P92A 3P8GA 3SQHE 3AK5A 3SNBA 1K1NA 2OD3B 4YXWD 5LPRA 1KSNA 1O3EA 4NG9H 1HB0B 1QB9A 2PLXA 4NIVA 1C5YB 2FOBA 1GBFA 2WUCA 2F91A 1COWD 3QGJA 3A87A 4OGYA 3QUMP 1XUJA 5BPEA 1SSXA 2FYRA 4INKA 1SOZA 5IDKA 2G81E 4K8BA 3P70B 2GKVE 2BY8X 5DP9A 1OYTH 4HTCH 4DW2U 3PRDA 1C1MA 1TGTA 3PV5A 1NU7B 1WOFA 4ZHLU 3GY7A 1EZQA 4GCHG 1Y3WA 2FX4A 1O5DH 1QJ7B 1XVOA 1QFKH 4Z6AH 2PFEA 1Y3UA 3SORA 2L74A 5G4BA 3MWIU 4YOJA 2ANWA 4BTIB 3LGVA 3QTOH 3WW7A 2XWBI 2Y80A 1ORFA 1C5UA 2AFQB 5F53A 4BANB 4B74A 3SV6A 2ZFRH 1AZZA 5JYIA 3EA8A 1EJAA 2F83A 2ZZUH 1S6HA 4MVNA 5T6FA 2KFWA 1P2OA 1EXFA 3DHKH 5FBEA 5C5NA 6GCHF 2HWLB 4I33A 1DICA 2HOBA 3MU0A 4K1TA 3LGYA 2KR7A 3BTME 1K2I1 5JPMH 4YESB 3VB6A 2IJOB 2GJGA 1PQ8A 4A5TS 2Q6GA 3ELAH 1QZ8A 3P8OA 1K1PA 2FS9A 5DP5A 2OC7A 3ZVGA 2ZFFH 2Q6DA 1GDUA 2GZ7A 1QHRB 3RU4E 3W95A 3BTTE 1O2WA 2BY6X 1EAWA 4NIXA 4NA8A 2TGPZ 2LNCA 3MO9A 3PB1E 2WV9A 2PKSC 2Z3EA 1AFEH 1AO5A 4LOYH 1P09A 2FI3E 2G5VA 1WBGB 4CR5A 4AZ2B 4DGJA 1C5OH 1UMAH 1AFQC 2ZCLP 2W6ID 2Z3CA 2AMDA 4DG4A 1P2MA 2ZTZA 2ZDKA 1THRH 2SGAA 4UFFH 1FUJA 2QE7D 1NRQH 4NFEA 3UIRA 5DO4H 4O9VA 2NU1E 2FP7B 1P0SH 3RXUA 3LH3A 3SV2H 2ZA5A 3PROA 4J2YB 5CHBA 1ZHPA 4XFQA 1DOJA 5C1YA 4P02A 7GCHF 1TGBA 2KX4A 4UFGH 2H5CA 1LHCH 1EZXC 1O3OA 1V2WT 2AH4X 2BDIA 4ISOA 1V2NT 1XVMA 1GCTC 2P3TB 1W10U 1UHBB 1HBTH 2PSXA 4IC5A 2FM2A 4CRDA 5EGMA 4U01A 1MABB 1HAHH 5E2OA 2QAAA 4YT7H 1O3MA 2CHAC 1FY5A 4JZFH 5T6GA 4ASHA 3RU4T 2F9NA 2AGEX 4ACAA 2FOGA 2A7CA 2ZDLA 2GT7A 3CNRA 3GISB 3ZZ5A 1RTKA 1GI5A 3M5MA 2F9PA 1NPMA 1HYLA 5L2ZH 2C8ZB 1HAZB 1GBLA 5A8YA 1AZ8A 3N7EA 5EOKA 2FEQH 2ZQ2A 1F5RA 1NT1A 1ZJKA 2IPHA 1AUJA 3LDXH 2ZU5A 1GHAF 1NFWA 2BY7X 5EG4A 5H4IB 1HAIH 1KXBA 1YLNA 3Q00A 1UTPA 5DP7A 2BD9A 1TABE 2Q1JA 3BTQE 3ZVCA 4CRBA 2A0QB 2ZPSA 4FUGA 4I86A 3GYMA 1OWHA 3KHVA 1OXGA 4AYYB 3RXEA 1GGDB 2FLRH 3V7TA 2OXSA 4Y11E 4AFUA 4X1NU 5AHGH 4FVDA 3AAUA 1VGCB 3R3GB 3BEFB 4INHA 1HJ8A 1Y8TA 3BSQA 3M3TA 1DWDH 1TFXA 4DURA 1YCPM 1ZLRA 2ZQ1A 2A4GA 4UEHH 3UOPA 3P95A 2PP6A 2BDGA 1YWUA 5GIBA 4U2WA 4HG6A 3RXLA 5F8XA 1LO6A 1QTFA 1YPJH 1NRNH 5HKKD 1F5LA 2D8WA 2TBSA 1DXWA 3SJKA 4ZKOU 1O2PA 3PMJA 1TIOA 1G3DA 3E0NB 3RXKA 2CF9H 3RXOA 1E35B 3F1SB 1C1OA 1PPHE 1E34B 4WY3A 3NCLA 1GHXH 1NRPH 1T32A 1SGYE 2G8TA 1YP9A 4FU7A 5DK1A 1O32A 1AKSA 2FOHA 2GDDA 5TCCA 1OX1A 3S69A 3ATMA 2WZQA 1P05A 3PLKA 2ZI2H 3H7OA 2GDEH 3OFND 4XBBA 1WCZA 4ABEA 2AGGX 2WPMS 5C0UA 4NZQA 2BD3A 1V2ST 2AMPA 1MTNB 3E16B 1GJ6A 1XKBC 1C5WB 4X2VA 5FX5A 1GBAA 3AW0A 1MH0A 1XXDA 1PFXC 4TPYA 3SGQE 1T8MA 4KP0A 2F9OA 2PWXA 2ZCHP 2LP6A 1NRRH 5J4QA 3TNSA 1CA0B 5GXPA 4OS2A 2BX4A 5GCHG 5A0BA 3RLWH 1EZUC 1OWEA 3MU1A 2OLGA 5FHTA 4ABIA 3EA9A 3ZVFA 1BJUA 1NESE 3RXTA 3ZIAD 1EAUA 1CBWC 1TQ7B 3B8JA 5EQQA 1BTZA 5IYTA 2J98A 4I7YH 1C2FA 2ZEBA 1C5VA 3BTKE 3A8CA 4E7RG 1YY3A 5DP3A 1C5SA 1A5GH 1NO9H 4BOHA 3RXAA 1N1LA 4E06H 1EP6A 1A5IA 2O8UA 1O2XA 2KCOA 2YMSD 1BBRH 1S85A 1TRYA 2GP9B 2A1DB 1EAIA 1GJ7B 2KZ4A 1RTLA 1O38A 1OWKA 3MH4A 1KXDA 3U8OH 2LELA 5EXMA 3EGKH 4MG3A 1YCPK 3PMBB 4IS5A 1MZAA 3RC4A 3BTGE 3URDA 2KCAA 4X8SH 3RP2A 3N7DA 8GCHF 1DS2E 3K2UA 1LKAA 3TJNA 1BT7A 1DVAH 3FVFB 1OS8A 2O9QA 3TGIE 1HRTH 1EJMA 1EKBB 3VPKA 2ODPA 5TJXA 1RFNA 3VG8A 1LTOA 4WF8A 1UK4A 1CBWB 1ZGIA 2BZAA 3RXVA 3MH6A 3K65B 2J2UA 3SBKA 5B6OA 2Z9KA 4HFPB 1TNHA 4B73A 3LOXA 2SNVA 1SI5H 1VITG 3H7TA 4NWLA 1FY1A 1O2TA 1Z8JB 1DITH 1ZMLA 1GCTB 5JBTA 3BEUA 4CR9A 2H2ZA 4MDSA 3Q76A 1TYNA 2A2XH 2UWOA 1TNIA 5L6NH 2A7JA 1H8HD 3M35A 5CHAC 3SU1A 3WY8A 1MKXH 1GCDA 3SHAH 3HKIB 3EE0B 3F9FA 1ZZZA 1P57B 3LT3A 1HIAB 2G5NA 2QA9E 3LH1A 3S9BA 2Z9JA 1YPLH 1YM0A 1SQTA 2BTCE 2AS9A 2WV5A 9LPRA 1FX0B 3DFLA 5EXLA 1EJNA 1JRTA 3LC5A 4CREA 1GDQA 3U28C 1KMHB 4D76A 1F0UA 3BTFE 1UJ1A 3RMMH 5EJLA 1ESAA 1LPZB 2SGQE 4X1RU 2ZU1A 4B76A 3A8AA 3VXEH 1MTNC 4ZHAA 3GS9A 2YOLA 4D7FA 1MBQA 5A0CA 4Y71A 4X0WU 3RXRA 1K1OA 1Z71A 1SGEE 2WYJA 1NRSH 2RFKC 1A2CH 1C5QA 1TMUH 1N8OC 4JMYA 4XOJA 2IN2A 9ESTA 4B2BA 4YLUA 2R2MB 1VGCC 2BVSH 1WSSH 1JWTA 5F6MA 3RXFA 1EX3A 3I78A 2Y82A 1TNGA 1TGNA 3GDUA 2BY5X 2HLDD 1H9LB 2RDEA 4RKOB 2ZGBH 4ISLA 1FIZA 1GJ5H 3KYGA 1TA6A 3W1EA 3LU9B 1F2SE 1TOMH 4B71A 2W3IA 1JMOH 4WMEA 3QK1A 3F68H 3S9AA 3T62A 3SU6A 1S83A 3A89A 4FUIA 1SC8U 1TB6H 3WWBA 4KTSA 1AQ7A 1ZJDA 4I8KA 2BX3A 3DSOA 2GCTB 3SU5A 1HGTH 1GGDC 5C1XA 3U98H 2OP9A 3DD2H 1P01A 1ZYOA 1WUNH 2W6JD 1FN8A 1QR3E 2CHAB 3SGAE 2ULLA 1HV7A 2KCPA 4K1EA 1NM6A 3T26A 2BD7A 1PYTD 1DWCH 1ELDE 1K22H 1GMDG 2O8TA 4R0IA 1O2YA 2FOFA 3EQ0H 1P10A 2JH5D 1O5EH 3O8DA 1SHHB 1BJVA 1DXPA 2QYIA 4AGJA 4ZXYH 1GMHG 5E0HA 5C20A 4ZROA 4AORA 5LGOA 4J1YA 1DANH 2J95A 1BRUP 1V2KT 2VB0A 3HK6B 5GDSH 4FUJA 4F55A 3AW1A 1BTUA 1GG6B 1D3QB 2P8OC 3A86A 1OP0A 3FP8E 2ZCKP 5DJ7A 2SGPE 1AVWA 3GDSA 2AIQA 2IOTA 1GBDA 2PV9B 3ZZBA 1YPHE 1WU1A 1YC0A 3TJVA 1IQHA 1EOJA 3BN9A 2HLCA 1GI0A 5JB8S 1G36A 3HATH 4M9FA 2QCYA 1AN1E 3ITIA 2J9NA 1H8DH 4AFQA 1O3FA 1OP8A 1NY22 4IGDA 3KQDA 4QT8C 4X1QU 1ZHMA 4HI3A 4UFDH 1PYTC 1SG8B 3BIVH 4NSVA 2FI5E 3OX7U 2XC0A 4A6LA 2C93B 2XBWA 1FXYA 3TH2H 1WQSA 4GPGA 1NTPA 4HGCA 2BD8A 2HPQH 3B23B 2ALPA 5DP6A 1YPKH 6ESTA 2VWMA 1A4WH 3FZZA 3SNCA 3S0NA 1GBEA 2ZHEH 1IHTH 1SB1H 1V3XA 4IN2A 3E8LA 1GI1A 4D7GA 2ZWLH 2CXVA 1OP2A 1VITF 1SLWB 2V3HH
chains in the Genus database with same CATH topology
1IQNA 1NFXA 3RLYH 1A1RA 4I8GA 1Z8RA 3OY5U 1KTSB 1N8OB 3OSYA 1SGIB 4TY7A 2C90B 1UVSH 1GI2A 1AGJA 1MKXK 4IBLH 3VXFH 2VIDA 1KTTB 1C5NH 1CE5A 1THSH 4IMQA 3T29A 1NZQH 2SGFE 1VITH 2Y5HA 5CE1A 1QL8A 2FOEA 2OC0A 4IW4E 1KLIH 3QGNB 3ZZ6A 3LONA 1K9OE 1Y3XA 1CHOG 1G3CA 3M37A 3URCA 4B2AA 3ZZ8A 3C27B 3KCGH 2ZGJA 3BV9B 3UOUA 1E37B 2H9TH 1ZSKA 1G30B 1EPTB 1TONA 1T8NA 2W7SA 4ZKNU 2JH6D 2ZHDA 4BTUB 1DSUA 1AB9C 1L1NA 1TMTH 1A7SA 1DDJA 1K1IA 2XC5A 4GHTA 1QA0A 2ZU2A 4SGBE 4PROA 1K1MA 2QF0A 4OS5A 3RDZA 1UK2A 3ZYDA 1ETRH 1SFIA 1DE7H 2XW9A 1TAWA 3HPTB 3EDXB 3SUDA 1BQYA 1J16A 2QN5T 3ENSB 2VVUA 1KXFA 4DIIH 1A0LA 1DWEH 4CHAC 1P12E 3ZZCA 1O2UA 1GVZA 2FO9A 2Y81A 2C8WB 2J4IA 1UCYE 4GUXA 1SFQB 3GCOA 1GG6C 3GICB 5C5OA 1WTHD 1QGFA 2XCFA 1MMJN 2OQUA 3PTNA 1OPHB 1H9HE 3TGKE 1QRZA 1ELEE 1GI3A 4Z0KA 4U32A 1EASA 1Q3XA 1UK3A 3SJ9A 4YO9A 2RDLA 1WTGH 1KLTA 4A92A 1E36B 1GI7B 1SGDE 2EA3A 1W12U 2D26C 4LK4A 1TNKA 3DT0H 5K7RA 4ABAA 1V2JT 3RXQA 1ELBA 3KQEA 4OS7A 4JZIA 3BIUH 2TPIZ 3QWCH 1Z7KA 5AF9H 1GPZA 1V2QT 2Z9IA 1ABIH 1ELCA 1IHSH 3MNCA 4ISHH 1BRAA 3SGBE 3E91A 1FPHH 1BZXE 1FAXA 1MTWA 2RG3A 1KDQA 4MNVA 1JOUB 2A7HA 3U9AH 1MTUA 2VWOA 2JETC 2ZECA 4XSKU 3SJ8A 1MCTA 3A81A 4Q2KA 4NIYA 1QBNA 3F9EA 1AWFH 3GY3A 3PYHA 4K2YA 3T2NA 3TK5A 3FFGA 2VWLA 3GY6A 5JBCS 2PGBB 1O2ZA 2V6NA 3UREA 3VB7A 2HNTC 4K5ZA 1V2OT 4Y0ZE 1W7GH 1C1VH 1Z6EA 2I6QA 2XYAA 3BF6H 4FUFA 4GHQA 3D23A 1C5ZB 5L30H 1GJBB 4OS1A 3U69H 2C3SA 2V3OH 3VEQB 4I8LA 4X6MA 3SHCH 1YKTA 3GY8A 1SBWA 1LVOA 1AVXA 4GAWA 1P03A 2BD2A 1FY3A 3F6UH 2P94A 1ZPCA 1OSSA 2TRMA 1FN6A 1TX7A 4LZ4B 4FUHA 1O2KA 1O37A 1FJSA 3T28A 2O8WA 3TJUA 1BMNH 5DKMA 1FZZA 5DP4A 3L6PA 4AFZA 1O2VA 4NZLA 1TA2A 1V6DA 3IWMA 1M9UA 4E7NA 2GX4A 4O3TA 1TQ0B 4X1PU 3TITA 2TIOA 8KME2 3STJA 2VIVA 1TX8A 1K28D 3BG4B 1G37A 2A4RA 3PMHB 2H9HA 1FQ3A 2HNTE 2ZTYA 2BQ6B 1YPEH 4DJZB 2EC9H 2PR3A 4FUCA 1GBTA 5ESTE 2KAIB 4B2CA 5I25A 2V35A 1FY4A 1HNEE 4JYUH 1RIWC 2ZU4A 1T4UH 3ZZ4A 3A85A 1LVMA 2A4OA 1EB1H 2ZHWH 1NC6A 2C8YB 2FX6A 3M3SA 3BTEE 1F5KU 1JIRA 2G4TA 1OOKB 1O3BA 3OYPA 1T7CA 2BDYA 3RC6A 3FZDA 3TH4H 3SNDA 2ZHQH 1ANEA 1RD3B 3JZ1B 3JZ2B 3PLPA 4JZEH 3K9XB 2RA0A 2R3YA 4DCDA 2OC1A 1YYY1 1UTKA 1DUEA 1O3NA 3M5OA 2TGTA 2HRVA 3D62A 2A32A 2QXIA 1C2GA 1GBIA 1BMAA 4AN7A 1TX6A 2XNIA 1JIMA 2PUQH 4GSOA 1DX5M 3M7UA 2BY9X 3SU2A 1B7XB 1ARCA 1YGCH 2ALVA 1BTWA 3I29A 4CRGA 4H4FA 2FMJA 1O3AA 2ZC9H 1UVOA 3RMNH 3O8CA 2ZIQH 3GY4A 3LJOA 1D3PB 2R0LA 4NA9H 4UE7H 3T25A 3AAVA 2ZGCA 3ZYEA 1SGPE 1INCA 4B1TA 1WQVH 3KN2A 1D9IA 2UWLA 1IQJA 4TPIZ 2ZDMA 1QL7A 1O2RA 1OYQA 2GCHG 4SGAE 4Y79A 3D65E 4NWKA 4BXWA 1HAPH 1YLDA 1G2LA 1PPZA 2Z9GA 5A0AE 2YNBA 2FI4E 1GBMA 3G01A 1BUIA 3PMAB 1DWBH 2O8LA 2CF8H 1C1PA 4AFSA 3LGWA 1C1UH 1EQ9A 4AYVB 3QTVH 4Q7XA 1A0JA 1IQFA 1HAYB 1AHTH 1DM4B 4A1XA 2AEIH 2PW8H 2VGCC 5JBAS 3PTBA 2QGRA 3QDZB 3MHWU 2JH0D 3D49H 3RXGA 1SGFG 2F9UA 2FIRH 3SN8A 2OTVA 1GMCF 3CENA 1AE5A 1GBCA 4DY7B 3TLOA 6CHAC 5ETXA 1V2LT 5AFZH 3NUMA 5FX6A 3V0XA 3VB4A 2J92A 1CT2E 1O2NA 1ABJH 1PPGE 4BAQB 4CBOA 2AERH 1GHAG 1GL1A 2ODYB 2FWWA 1TNJA 3ATIA 2WPIS 1Q2WA 5FPSA 1S84A 5A09A 2R9PA 2VNTA 3P17H 2W26A 2PKSB 3V13A 4Q7ZA 3KGPA 1Y5AT 1HCGA 2AMQA 1P2NA 2VINA 1P2JA 4DIHH 4LZ1H 4ZHMU 2WINI 5F8ZA 2FXRA 1T8OA 1ZRBA 5E0GA 1TRNA 5DGJA 3RUOA 1A5HA 2ANYA 1UTMA 2STBE 2Y7ZA 1Y5BT 4BAHB 3K6YA 1UTQA 1V2TT 1GL0E 2H9EH 4Q7YA 3Q77A 3A84A 1BRBE 1GVLA 2ZTXA 4BAKB 1MD7A 1ZPZA 1JBUH 2XXLA 5DP8A 1SLVB 1NFUA 1XXFA 1Z1JA 2UUJB 2W7UA 2QV1A 2ZFQH 1RGQA 4I32A 4RKJB 4WXVA 1DUAA 5HGGA 3NK8A 3VGCB 4ESTE 1ZSJA 5L2YH 3UR9A 2TGDA 3ZV9A 1L2EA 1N6YA 3UUZA 2J38A 4GVUA 3VFEA 1J8AA 2GT8A 3SU0A 1VCWA 1GI6A 1CA8B 4XE4A 4D9RA 1LPKB 1BBRK 2Z7FE 3RXMA 1CGIE 4MPVA 3UQVA 3PO1B 1XM1A 4I8HA 6CHAB 4VGCB 1H1BA 1BTHH 1GBHA 1TBQH 1XUKA 1MQ6A 1SHYA 1D3DB 3KF2A 1L1GA 4Y7BA 1TBRH 3SUGA 2YNAA 3SU4A 1GVKB 2OBQA 3FAOA 4DVAU 3U8TH 1AY6H 1PPFE 1C2LA 1TPAE 2HNTF 1SL3A 4JZDH 2ZF0H 2GMTC 2SGEE 2M5TA 3DFJA 4RSPA 1O2IA 1AE8H 4UONA 1VJAU 2WPJS 1RTFB 1NS3A 1NFYA 1GMCG 2VIQA 4K69A 2Y6TA 3DUXH 2C4FH 2SFAA 1SGNE 2GGVB 3BTDE 4JYVH 1TPPA 2PTNA 2WUBA 3NZIA 1QURH 4IC6A 1MU8B 1C1NA 1O3IA 3RXBA 1C5LH 3NWUA 2FOMB 1AI8H 3TK9A 4ABGA 3RM0H 1ELFA 1HFDA 1QA7A 2ODQA 4A1VA 1ESBA 1YBWA 5DG6A 1TMBH 2NU0E 3I77A 1RJXB 1SR5C 4AOQA 3O8RA 4FU8A 1UTNA 1FI8A 1WV7H 3CS7A 3MFJA 3S7HB 2OUAA 2WPHS 2FS8A 2CV3A 5FBIA 2BDCA 1GHBG 3MYWA 5FCKA 4X6PA 2KAIA 1IQMA 1MUEB 2DE8A 3EA7A 4ISNA 1GI4A 4FVBA 1MCVA 2ZU3A 1O3LA 3E1XB 1J17T 3R0FA 4K1SA 3STIA 1AFQB 1GJ8B 3SQEE 2BYAX 3A8BA 2V0BA 3BEIB 5FPTA 1K21H 1EB2A 2C8XB 1PPCE 1FONA 4LXBH 4JZ1A 1ANDA 2BZ6H 3MOCA 1P8VC 1ZRKA 2BQWB 3SUEA 4Y0YE 1L4DA 1RS0A 2ASUB 2XBXA 3SJOA 3MU4A 5LH8A 5K0HA 2QC2A 2BLWA 4Y8YA 1RIWB 3IG6B 1TPSA 5ABWA 5A8XA 1O2MA 1BTYA 4XDEA 3UNSA 4O3UA 1EPTC 1KLJH 3MTYA 3A80A 1O35A 4ABBA 4NIWA 4WVPE 1BDAA 2F9BH 2Y5FA 4AB8A 1MU6B 1Z8IB 1O2LA 5C2ZA 3ZVAA 4ZKSU 1EUFA 4K60A 2GZ8A 2XTTB 1L4ZA 3UWIA 2FZZA 5E2PA 3SNEA 3ZVDA 1ZTLA 3SOSA 2Z94A 4ABDA 2BD5A 2G51A 1SGTA 2EI6A 1T4VH 1LKBA 2QXGA 3M5NA 2UUYA 1SGFA 2HPPH 4YT6H 3BTWE 2A4QA 1IQLA 1L1JA 1XUHA 1A61H 5GJ4B 3P8FA 4Y76A 3LKWA 3GCTF 1C2EA 5E8EH 1Z6JH 4IMZA 5C1UA 2DE9A 2P93A 4DOQA 1BOQA 1O2GH 1MAXA 4NGAH 3GY2A 2CGAA 3AVZA 4KELA 1UTLM 1TWXB 1MKWH 1PPEE 1LVYA 4D9QA 1FMGA 1ANBA 1S0RA 2FODA 3KEEA 1V2RT 3T5FH 2VIPA 5HMAA 4Q80A 1LVBA 1UHBA 1CVWH 1C2DA 4TWWA 3W94A 4X2XA 4KTCA 1S81A 1DT2A 2Z6BD 1H9IE 4YOGA 2ILNA 3H5CB 1NN6A 2OCVB 4FXGH 1KXEA 7GCHG 2NU4E 2Y5GA 4UDWH 1NROH 3RMLH 4JK5A 1W2KH 3SJIA 1C2HA 1GHBF 5ESBA 3Q3KA 3VB3A 1F0TA 4MTBA 1O5GH 1AKSB 1P02A 1O3GA 1C9PA 2G00A 1CGJE 3A7TA 2A45B 2A5IA 3HK3B 2JKHA 3MO3A 4UFEH 2UUKB 2FDAA 4H42U 4O97A 5DPAA 1V2VT 2WV4A 4X2WA 1F7ZA 1S6FA 3GYLB 2A5KA 3IITA 1C2IA 1DY9A 2P8OB 3OY6U 2R2WU 2PGQB 1EOLA 2EI8A 1BHXF 3KQBA 1Y3YA 3UQOA 7ESTE 1TOCB 3UPEA 4JK6A 1MTVA 1PQ5A 3LC3A 1B0EA 3TGJE 3M7TA 1EPTA 1G3EA 8LPRA 2QIQA 3UY9A 2QXHA 1WAYB 3HGNA 4WH6A 2G4UA 8ESTE 1ZGVA 1C5PA 1DFPA 1Z1IA 5EXNA 1TGSZ 1YF4A 1SMFE 1HXFH 1GWAA 1HAXB 1O3CA 1MKWK 1UTJA 1O3DA 1SVPA 1QQ4A 2ANMH 1P2QA 2TGAA 2ZDNA 1DLEA 4YLQH 3PLBA 4CHAB 2BLOA 2B8OH 4VGCC 4Y10E 1GDNA 1A0HB 2AIPA 2OC8A 3QN7A 1QRXA 2VWNA 2H6MA 1GJCB 2GCTC 2UUFB 5JB9S 4R8TB 1ZMJA 5FXLA 1RRKA 3U1JB 1XMNB 1A3BH 4CH8B 1K1LA 1HAOH 3RXSA 1AB9B 1C1RA 4ZUHA 1ZTKA 4WMFA 4CH2B 2FYQA 3E90B 2W5EA 2QF3A 3LPRA 3SV7A 2BDHA 1F0RA 1CHGA 7KMEH 3L3TA 3UTUH 1CQQA 2A2QH 4RN6A 3RM2H 1C2KA 2ZFSA 1UVPA 1ACBE 1HAVB 1SLXB 4Y8ZA 1LDTT 2HALA 3S7KB 1XKAC 2Q6FA 3N7OA 1AD8H 4A1TA 1QIXB 5F8TA 1QY6A 2XRCA 4CBNA 2BQ7B 3ZZ9A 1H4WA 1S82A 2THFB 1C5TA 2VIWA 3ZVBA 2GTBA 1TNLA 3M61U 1LQEA 1G32B 1MTSA 3PM3A 1P3CA 1J14A 3UR6A 2PKAB 4X6NA 4BAMB 2PSYA 3SI4H 5EPYA 2P3UB 1C1TA 3FP7E 2BXTH 3UWJH 4MLFB 1MQ5A 1QBVH 1SGRE 2A31A 1O5FH 1S0QA 1UCYK 1C2JA 2Z3DA 3MH5A 4FUDA 3SV9A 2H5DA 1P04A 1C4U2 2FESH 2Z9LA 4UD9H 1FAKH 1FY8E 4FU9A 2H1UA 4YZUA 1V2UT 3T27A 4KKDA 1Y5UT 1CGHA 4NFFA 5EPNA 4BXSA 1QCPA 1AIXH 1OKXA 3GY5A 1LHDH 1TPOA 3LGTA 2R3UA 2GCHF 1J15A 3MI4A 4TYDA 1O34A 5EW1H 3SNAA 1ELGA 4I31A 2A5AA 1UO6A 5GPIB 2OINA 1SPJA 4THNH 3GCNA 3KNXA 1HLTH 1O3KA 1AU8A 2BB4A 1BTXA 5EQRA 3LGUA 2R0KA 1W13U 2WYGA 1LMWB 1KYNA 3BTHE 4INLA 3UNQA 2VGCB 2GV6A 4ZAEA 1GMHF 4AG1A 5A2MH 2BOHB 1P2KA 1TGCA 1SQOA 1G3BA 2FLBH 2GMTB 2BLQA 1DY8A 3LGIA 1Y3VA 3A83A 1LCYA 4F49A 1HJAB 2B5TB 2XWAA 1C5MD 1AVGH 1LQDB 2B7DH 3A7WA 4CRFA 2CMYA 1J9CH 1UVUH 3TVJB 6LPRA 1AUTC 1CHOF 2RCEA 2AYWA 3EYDA 2PHBA 1ZMNA 3TPIZ 1YCPH 3L33A 1DLKB 2D2DA 1C5RA 3PO1C 4MPUA 4F4OC 1BBRE 1QRWA 2SGDE 1PQAA 3MU8A 1O2JA 2BD4A 5GCHF 1ZSLA 6GCHG 1O31A 1SOTA 5EU8A 3SU3A 2NWNA 2BDBA 1CT4E 2J94A 3C1KA 1NU9A 1K1JA 1GI9B 1LPGB 1QNJA 1EP5A 3PWBA 4MNWA 3GCHB 1TRMA 1B5GH 4MPWA 1VCPA 4TWYA 1THPB 2BDAA 1JXPA 1ANCA 3HKJB 2HVXA 3ZZAA 1T31A 3ATWA 1BA8B 1CT0E 1DPOA 4MQAA 2W3KA 3MNBA 1IQKA 4MNXA 4WH8A 1CA0C 2P16A 1FNIA 1AWHB 3MH7A 3U8RH 1L0ZA 1V2PT 4O03A 1Q31A 4WXIA 4E05H 3TH3H 2OBOA 4Y6DA 1V2MT 3NXPA 1IQIA 3VGCC 1EAXA 3GOVB 5FPYA 1KXCA 3MNSA 3RMOH 3MO6A 1O5AB