2BY8X

Is radiation damage dependent on the dose-rate used during macromolecular crystallography data collection
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Is Radiation Damage Dependent on the Dose-Rate Used During Macromolecular Crystallography Data Collection?
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by8X01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2by8X02
1O3AA 1YYY1 2ZO3H 1NT1A 4FUCA 1AB9C 2P93A 2ODPA 2BD4A 1GI0A 4MPUA 1QR3E 3SO3A 1NFWA 3MH6A 1L2EA 4CH2B 1OWIA 4A1XA 3DT0H 3UFAA 1FY1A 1GMHF 1S82A 1FV9A 1EB2A 1Y5UT 5JYIA 2FEQH 1S81A 2FOBA 3LT3A 3KN2A 4HI3A 3M7TA 3GCNA 2ZKSA 3PO1C 5DGJA 5FAHA 3JZ2B 5LH8A 1GJBB 5J4QA 2HNTE 4SGAE 2Z94A 2PV9B 4JZ1A 1LMWB 3RXSA 1P2IA 1Y3VA 2FDAA 1IHTH 1L0ZA 2XRCA 4Y7BA 1SQOA 1AU8A 3K2UA 1FMGA 1DVAH 3QX5H 3UWJH 3GCOA 1VITG 3FP7E 4B71A 1ELFA 3SV8A 4X1QU 1W7GH 1HLTH 1EAIA 3M5NA 2Q6DA 3BEIB 5L30H 3TLOA 5JBBS 3JZ1B 5DKMA 1UTNA 1O33A 2PGQB 2G52A 1ZPBA 2FOMB 1C1PA 1Y3WA 2D2DA 1LVMA 2WUCA 4IMZA 1FPHH 2P8OB 1PJPA 3EA9A 1TBZH 3GY7A 4X2VA 2BY7X 1T8MA 1K22H 2ZDLA 1CHGA 4ZROA 1OP0A 5C1YA 5FCKA 1KTTB 1OWKA 4A6LA 1GVKB 1HFDA 1QHRB 1BBRE 2BY6X 4UFDH 4FUGA 6GCHF 5TCCA 1GI2A 2Y7XA 5LGOA 1MH0A 4J1YA 3RXJA 4BAQB 1SG8B 2ZIQH 1M9UA 3A8BA 1O0DH 1XMNB 3C1KA 2Z9KA 2WPJS 3SNEA 1GHVH 2VWLA 3SUDA 2PGBB 1S0QA 5F8XA 1GBLA 1ZZZA 2GCTC 2Q6FA 3E1XB 2QXGA 2K1QA 3E0PB 1QL8A 1CBWB 2FOEA 2OQ5A 3U8TH 1F0SA 1O5AB 2F83A 3AVZA 1GCTB 1SGTA 2Z3CA 2F9BH 2P59A 1F92A 1OWJA 1SGFA 1A1RA 1YLDA 3MNCA 5CHAB 1Y3UA 2J92A 5AHGH 2Y5HA 1V2LT 1V6DA 4X1NU 3ZVEA 2FX6A 3RC5A 1W13U 1TMTH 3ATKA 5K7RA 4AB9A 1W7XH 2ODQA 2ZHEH 3ZZ7A 1OWEA 1O2PA 4F4OC 2UWOA 2B7DH 2WPMS 4FUHA 1TYNA 1DWDH 1QA0A 3A7ZA 3F9FA 1C5TA 1QL9A 1XUIA 2ULLA 1OX1A 3T28A 3M3SA 1UTJA 3D23A 3GICB 4ZHLU 1QURH 1P03A 1O5BB 4YM9A 1YGCH 1DLEA 3MMGA 3LU9B 1HJ8A 3MU4A 3RXTA 3V3MA 3STJA 2PHBA 1T8NA 2BTCE 4FUDA 3A89A 2HWLB 4Z6AH 2Z6BD 2G55A 4K60A 1RRKA 1ZPCA 1VITF 3T25A 4Y79A 1EJMA 1HAXB 3RXMA 1HV7A 3PLPA 1TQ7B 2C8YB 4ISNA 1EPTA 1RJXB 1TA6A 2XXLA 5AFZH 1DX5M 3TK6A 5T3HA 1ANBA 3PMJA 1AO5A 1V2KT 4A7IB 1YPKH 2ZHWH 2A31A 1HJ9A 1ZRKA 4GCHG 4FU8A 3K6YA 2ZDMA 3OYPA 2SGAA 1P0SH 2ZFFH 5GCHG 3LGTA 1TONA 3PMBB 1PPGE 1LKBA 5A0AE 1MQ6A 2QGRA 2QXIA 3RXKA 1XVMA 8ESTE 5I46H 5C2ZA 4UFFH 3A85A 1GJ6A 1BTXA 4Y10E 1GHXH 3EDXB 3EGKH 2BDBA 2OCVB 2WV4A 2NU0E 2J34A 1GI1A 3NCLA 2W26A 1S0RA 1TOCB 2HNTC 3BG4C 2LPRA 4LK4A 4TY6A 3RMOH 2PTCE 1EATA 1O2VA 1EZXC 2BD3A 3ZZ9A 1RD3B 1NRQH 3CS0A 1CA0C 6ESTA 4I31A 4UDWH 1EUFA 2QA9E 1QTFA 3LH3A 4OGYA 4K69A 3SV7A 4E06H 3KQEA 3N7OA 1TE0A 1RFNA 3IG6B 1GBKA 3GDUA 4Q7YA 4BAOB 1HXFH 2XTTB 2QV1A 2XWBI 2WV5A 1EOJA 4CRDA 4ZXYH 2OC7A 3CENA 1KLTA 1ZSLA 1P02A 1SOTA 5E0JA 2VIVA 3PTBA 4NZQA 3QTOH 3E8LA 3K65B 4CREA 4NA8A 1WCZA 5FX5A 2H9EH 1T8LA 1WAYB 3T62A 2JETC 1YPGH 3MH4A 2FS9A 4TWYA 1GG6B 1BTWA 4M7GA 3U69H 4XBBA 1ANDA 1O3GA 3TNTA 1V2RT 1SGEE 2ZDAH 2XW9A 1BTZA 3LIWA 4JK6A 1GG6C 4X6NA 1CQQA 1MZAA 1RTKA 1HAPH 4MVNA 1OP2A 2UWLA 3SV9A 1AVXA 1TGCA 2H2ZA 1C2KA 4E7RG 1EZUC 5A0CA 2ZC9H 3ZVDA 4B2CA 2PWXA 1INCA 1W2KH 3TJVA 3OY5U 3CP7A 1UCYK 4FVDA 4X2WA 1WOFA 1O38A 4D7FA 3O8CA 1MBQA 2BB4A 3SNBA 3S69A 4UD9H 2BLOA 4NWKA 1O5DH 1B0EA 4IBLH 1KXDA 1DE7H 1K1IA 1K1MA 1GJCB 8GCHG 1P04A 3K9XB 2BY9X 2H9HA 1RTFB 2XBWA 5F6MA 3BTTE 2BHGA 1W10U 1SBWA 1TALA 2OINA 1CGHA 1OOKB 3VB3A 2BLWA 4AGJA 1BRCE 1XUKA 5A2MH 1DY9A 2GGVB 2HALA 3RC4A 2P3TB 1O3IA 2XC4A 1GBTA 3A88A 1AUJA 1MCVA 3A8DA 3GISB 5DK1A 2GT7A 1QJ6B 1IOEA 4GCHF 4CBOA 5FPTA 1NC6A 2VINA 3MU8A 2CHAB 1MU6B 1Z6JH 2R0LA 3EA7A 5A09A 1TX7A 2HOBA 2BDGA 2XC5A 4QT8C 1MAYA 1N8OB 3RXCA 3PWBA 4OS6A 4X2XA 2Q1JA 2RG3A 1NS3A 3LGWA 1G3CA 1T32A 1Z7KA 1J8AA 1XKAC 5E8EH 1IQFA 2A5AA 4MDSA 1MTNB 3MU5A 2QN5T 2Z9IA 3SHAH 1HPGA 3RMLH 1MD8A 1IQLA 2XBYA 5A8XA 2OC1A 1LHFH 1A4WH 3FZZA 1VITH 3P92A 3SJ9A 4KP0A 5JBTA 1UTLM 3Q3XA 5PTPA 1Q31A 2ZPSA 1V3XA 4IC5A 3G01A 2ALVA 4Y76A 4X8SH 2AGIX 1AWHB 3ENSB 2BD8A 3P8GA 1D9IA 2VIQA 3P8FA 1BRUP 1E37B 5EU8A 1F5RA 2FXRA 3RXHA 2GDDA 1CHOF 1ELGA 2XBVA 1LCYA 5LPRA 2BZ6H 3QDZB 4YTAA 4YT6H 4D9QA 1PPFE 4O97A 5BPEA 1D3DB 2ZTXA 3RU4T 1QBOA 1BUIA 2QY0B 5F8TA 2EI8A 1A3EH 1SLUB 2GZ8A 1BTHH 1S84A 1UVUH 1ZLRA 2PSXA 1C1WH 1P2JA 3BIVH 4INKA 1THRH 5J4SA 4JCNA 1HUTH 2YOLA 4CH8B 2HLCA 1H1BA 5JBAS 7ESTE 1Q3XA 1ZYOA 4ISOA 4K8BA 2H9TH 2LNCA 2GTBA 2FOAA 1GDNA 3A82A 1RIWB 1BOQA 2ZCHP 2W3IA 2ZCLP 4WJG2 4O3TA 1C4V2 2B8OH 2ZFPH 3A7XA 4ASHA 2OP9A 4JYUH 1P12E 1FY5A 2BQ6B 1H9IE 2C8XB 2TGTA 1O3BA 2VGCB 4E7NA 2OLGA 3QZQA 1C5SA 8GCHF 1W11U 1XUGA 2BVSH 2HVXA 4DOQA 2CF9H 1C4Y2 2PFEA 4VGCC 5HM9A 3NZIA 1NTPA 3M5MA 1C9TA 2WUBA 4I7YH 4HGCA 1AGJA 1O2GH 1V2TT 1SLVB 3SHCH 1G36A 1G30B 1PQ7A 1AVGH 1J9CH 1ELAA 4KTSA 1CU1A 1GHAG 3L3TA 4IC6A 1O3PB 1QRWA 1O5GH 2TGDA 2FX4A 3RXOA 1ZR0A 2H5DA 3T29A 3VB7A 2ZU1A 2GP9B 2O8LA 1RXPA 1JXPA 1TWXB 5G4BA 1GGDB 3EYDA 2DUCA 2W7UA 1O39A 4ABEA 2BD2A 3UNRA 1SHHB 4E05H 2ZF0H 4NFFA 1O3MA 2ZG0H 5FX6A 1IQGA 1RGQA 2Q6GA 3LC5A 1FJSA 1C2IA 1NRNH 5FXLA 3KNXA 4D8NA 3S7KB 4BANB 1WTGH 4SGBE 3QTVH 2BX4A 4ZAEA 2B9LA 3V13A 2O8UA 2ZDVH 2NU3E 1KSNA 1FDPA 3M35A 4MNYA 3FAOA 4ZHAA 1ZHMA 5C1UA 1O3JA 7GCHF 1AWFH 4GUXA 2OC0A 3LOXA 2WPIS 2BOKA 1GDUA 2PR3A 2PW8H 3MWIU 2BX3A 5DP8A 2EI7A 3OX7U 1KDQA 1EKBB 1TRMA 3HKJB 1O2MA 3KF2A 1G3EA 1AB9B 3VB4A 8KME2 1C1TA 1WQSA 4DGJA 1QJ1B 2C93B 3SI4H 1HB0B 2C90B 2VU8E 1DSUA 5E0GA 5ABWA 3GYMA 2F9NA 1TRNA 3NK8A 2D26C 1ORFA 2IOTA 1C1SA 1A61H 1SLXB 3W94A 3TGJE 1O2UA 3A86A 1ETRH 3URDA 3RMNH 1NZQH 1HCGA 3RDZA 4CR9A 1O3CA 1GVLA 1YPMH 2HNTF 1ESAA 3ODFA 3PO1B 3SW2B 1FIWA 1VJ9U 1THSH 1DXPA 1H8IH 3LDXH 2UUYA 2EI6A 2AH4X 3PV4A 5FHTA 2CN0H 5HM2A 4X6PA 3S9BA 2FP7B 3A87A 4IS5A 1J14A 3SN8A 1LPZB 2DE8A 4IW4E 2FOHA 5L2YH 3SU3A 4I8GA 4MTBA 2OQUA 2J2UA 1GL1A 2RCEA 3QWCH 1GBHA 2I6QA 1TNKA 1EP6A 3MH5A 4JZFH 1Z71A 1BJVA 1E0FD 4FVBA 2BQWB 2ANYA 4DG4A 1ZSJA 1AMHA 1OKXA 1GHZA 3ESTA 2FODA 1V2NT 1E34B 4NIYA 1KLIH 4NCYA 1XM1A 4Y7AA 5E2PA 1DUEA 2FOGA 4Y6DA 5DP9A 2PTNA 1GDQA 3KGPA 1JIMA 1EAUA 3U1IB 3VGCC 1CGJE 1VCQA 1UCYE 1O2JA 3MH7A 1D3QB 3A7YA 1OXGA 3U8RH 2J38A 2FZZA 1AFQC 1VGCC 1GHAF 1P2NA 1AI8H 1XUJA 2P95A 1YBWA 2GCHG 1PPZA 2FYQA 1BCUH 1GBJA 4XBDA 1IQMA 1UVSH 4AB8A 3KCGH 3PB1E 1NRRH 1UO6A 3MTYA 3RXFA 1XUHA 3UR6A 5JBCS 4WWYA 1P3EA 1O2NA 1O5CB 1LQEA 3SV6A 1ZMLA 2GCTB 2PSYA 3ATMA 4OS2A 1YF4A 2D8WA 5SGAE 2QF0A 1HYLA 1IQHA 3ZVFA 1LDTT 4MNVA 4BXWA 1CO7E 3P8NA 1TB6H 1ELDE 2HRVA 3H7OA 4JYVH 2ZHDA 4K2YA 1P9SA 1A0HB 2RDLA 3KIDU 1JWTA 1C5ZB 7KMEH 2BDAA 1GI5A 4AYYB 4DIHH 3SQEE 3GDVA 5GPIB 1EASA 1P2KA 2GZ7A 6CHAC 3BG8A 4JZEH 5AFYH 5DJ7A 3A8AA 1EB1H 3WY8A 1C4U2 3TGIE 2G51A 4ABBA 4JZDH 1JIRA 1MQ5A 2A32A 5C5NA 3HATH 2W3KA 2Y7ZA 1MTUA 1SFQB 2ZPQA 5L6NH 1KYNA 1L4DA 1O2RA 1YCPH 1O36A 1DUAA 1J15A 1E35B 1CT4E 4X6MA 2A4GA 1LPKB 2G00A 3ZZ8A 3GY4A 1DDJA 1A3BH 3L33A 3RXPA 1UTOA 1W0ZU 2ZGCA 4AOQA 3ZZAA 2ALPA 1QL7A 1Z1JA 1KDQB 3D65E 4MG3A 4BNRA 1NM6A 1O2ZA 3GY6A 4XFQA 1HRTH 1TBQH 1P06A 1FPCH 1KXFA 3MI4A 3HKIB 4KGAA 3P17H 2F91A 4X1RU 4AG1A 2IN2A 2RA0A 2P3FH 1W0YH 1SQTA 3BF6H 5DP3A 1C2EA 1O2XA 2QF3A 1V2MT 4O3UA 1MBMA 4B75A 4A1TA 3UTUH 2J94A 3FFGA 2C8ZB 1NY22 1QY6A 2A7CA 2F9UA 2CJIA 2B0FA 2BZAA 1ZHRA 1FN8A 4OS1A 1UTKA 2FESH 2ZGBH 1C5VA 4K5ZA 3LJJA 1GI4A 2THFB 4K3JA 2WPKS 1Y8TA 2ZA5A 2H5CA 2BDYA 4GPGA 4U01A 5A0BA 3RXQA 4AN7A 1FAKH 3DFJA 1O2QA 4TPYA 2CGAA 4Q7ZA 2QYIA 4XE4A 1BMAA 1AFEH 1FI8A 2TGAA 4U2WA 1TNIA 3T26A 1DPOA 1CT0E 4Y11E 2CF8H 3E0NB 2BQ7B 2FI5E 2GCHF 1VJAU 1WU1A 4OS4A 4NIXA 3ZZDA 3BG4B 2GT8A 1QGFA 2A7JA 1BA8B 1YCPK 4IGDA 2SGPE 1HAHH 2M5TA 2ZECA 3SJOA 1P05A 1CA0B 1SGRE 2XBXA 1UK3A 3KQDA 2FLRH 3U98H 5E2OA 5HMAA 1UK4A 1KLJH 1D6WA 1GJ5H 1OWHA 1Z6EA 1V2WT 2UUFB 5DP5A 1GMCF 3TIUA 3A80A 1F5LA 3SNCA 4MNXA 1A0LA 3LGVA 4ABIA 1WUNH 1EP5A 1H9LB 5DP4A 5C67A 2CXVA 1C2JA 2A2XH 1KIGH 1EAXA 2C8WB 2R3YA 2HPQH 1G9IE 2ILNA 3B9FH 3A83A 3SU1A 2BXTH 1BBRH 1LHGH 1AZZA 1S85A 2RA3A 4I8LA 5ESTE 1KXCA 2F3CE 1CHOG 4B2BA 1HGTH 2F9PA 2JETB 1V2VT 1UTQA 1QB1A 5C20A 1BQYA 2VIOA 1CSOE 1AY6H 2ZI2H 3ZVBA 1CA8B 2WPLS 4AORA 4DURA 1NPMA 1EXFA 2O8WA 1KTSB 2Z9LA 2ZNKH 1C1NA 4LOYH 1VZQH 1ZJKA 4BOHA 2PKSC 3ITIA 1DSTA 1UVTH 1VCWA 1TIOA 2PUXB 1TPPA 2XWAA 3E16B 5FPSA 5EOKA 2SGQE 4Y8YA 2FLBH 1C9PA 1UVOA 3SI3H 1BDAA 3BTWE 5EGMA 1ZOMA 3PLKA 4FUFA 1C5QA 3SJIA 1BB0B 3P70B 2Y81A 3PROA 2GVFA 2HGTH 4JK5A 4BTIB 5E0HA 3S0NA 4KTUA 5L2ZH 3U1JB 3M5OA 2Z7FE 3ZV8A 1SSXA 1GBDA 1MKWH 4UFGH 2OTVA 2GDEH 3O8RA 2NWNA 5EW1H 2SNWA 3QLPH 1C1MA 3SUEA 2GX4A 4Q80A 2EA3A 3R0FA 1OYTH 2D1JA 3H7TA 1C5RA 1BMNH 8LPRA 1UK2A 4PROA 2VIPA 3UOUA 4MQAA 4TPIZ 4Y0ZE 1T31A 4B73A 1A5HA 3P8OA 3BTME 3QGJA 1L1JA 5DP6A 4IMQA 3P6ZB 2STAE 1HBTH 4ABFA 1C5UA 3TH4H 3MO9A 2G5VA 3RMMH 1L1NA 3CS7A 2Z9GA 4CHAC 4NIWA 1YPEH 1LHCH 3UPEA 1DS2E 3RLYH 4H6TA 4H6SB 1BRAA 1WSSH 1MU8B 2QIQA 1PYTD 1G2MA 3BTKE 5HYOA 3GYLB 5C1XA 1L1GA 4CRBA 4ABAA 3ODDA 1QQUA 3RXUA 1FONA 1V2OT 2WPHS 4GHQA 1U6QA 1IQNA 4YZUA 1ELBA 2VVUA 5GIBA 1C2GA 7GCHG 1TPOA 1SC8U 2BY5X 2A4RA 2ZGHA 2ZTZA 2ZWLH 2ZU3A 2P94A 2Y5FA 3M5LA 4ZHMU 4ZKNU 4FUEA 4FUIA 5EODA 5H4IB 1DICA 1O3KA 1T8OA 1GVZA 1ELVA 5LPFA 5EXMA 3STIA 4HTCH 2BMGB 4I8JA 3M36A 1EPTC 1NROH 3T2NA 1FXYA 2ZTYA 3HGNA 2R2MB 4NA7A 4O03A 1HJAC 3Q00A 2V3HH 1O3FA 1GJ7B 1HAVB 4OGXA 1K28D 3NWUA 1G37A 2FPZA 1NRSH 1O3NA 4X0WU 1YP9A 2VH6A 2A4QA 2QCYA 1Y3XA 2WYGA 5GWZA 4YOJA 1NO9H 2VVCA 4NZLA 2J4IA 4MLFB 1BJUA 2CV3A 2C4FH 3SNDA 1LVOA 1OPHB 3MFJA 3HPTB 3BV9B 1XX9A 2SNVA 2Y80A 2W7SA 1GJ8B 1FY4A 1QJ7B 2ZHFH 2BVXH 1XXDA 1N6YA 4ISIH 1TX8A 1J16A 4AX9H 1GBCA 1O5EH 1PPCE 3BEFB 3KL6A 1MUEB 1K1JA 3BTGE 3SU5A 2VB0A 1DANH 1AHTH 9ESTA 4VGCB 2ZPRA 2GMTC 1WV7H 2O8MA 5GJ4B 1HAOH 4B1TA 1TNJA 1PPHE 1TRYA 1B5GH 1N6XA 2QAAA 1P2MA 1Q2WA 2R3UA 2TPIZ 3SBKA 4NSYA 1PQ8A 3UOPA 4AYVB 2EC9H 3AAUA 3VXFH 4ZH8A 1PFXC 3E91A 1ESTA 3LGIA 1YCPM 1PPEE 3E6PH 3S9CA 3RU4E 3RXDA 2FOFA 1D4PB 5FBIA 4WF8A 1TX6A 2BM2A 3EE0B 1IQKA 3VB5A 5IDKA 1C1VH 2QXHA 2XCFA 1W8BH 3S9AA 3ZYEA 2AERH 3KQBA 1AE5A 3RM0H 4FUJA 1NN6A 1XKBC 4JMYA 2ZEBA 3GY5A 1DXWA 3TJUA 5A8YA 3DFLA 2ANMH 1EAWA 1JOUB 1QBNA 2BDIA 2ZCKP 1SQAA 4CR5A 1LTOA 1P3CA 2BY8X 1PPBH 3VB6A 2I6SA 1AD8H 1FY8E 2OBQA 1MCTA 1Z8IB 3RM2H 2IPHA 1GMDG 5A8ZA 3TITA 1V2QT 5EPYA 3UNQA 2VIDA 1NU9A 1AQ7A 3UUZA 4AFSA 2VNTA 2BLVA 1BMLA 1WBGB 1SGIB 1DFPA 1K1OA 1VCPA 5CE1A 3LJOA 3VFEA 1TA2A 1O2TA 1E36B 4WVPE 1G2LA 1HAZB 1AVWA 1LPGB 4XBCA 1C2FA 1TQ0B 4MPVA 2AGGX 2C3SA 3ATWA 1SGPE 4OS5A 2KAIA 3AAVA 2A1DB 2JH6D 2ZFQH 3QUMP 2ANKH 3HK3B 4KTCA 4INHA 3QK1A 1GJ4H 1TGNA 1TBRH 3TH3H 1GJAB 3F9GA 1NFXA 2AMDA 1K1PA 3SJ8A 1GWAA 2BDHA 5BRRE 5JDUB 4F49A 4JYTA 4ESTE 1WTHD 3ZZ4A 3V12A 3LPRA 3UY9A 1QB6A 1JMOH 2AMPA 5T6FA 5DO4H 3UQVA 4BAMB 1TNLA 2UUKB 3SU0A 5DP7A 1EOLA 3LH1A 3O8DA 4Y0YE 5ESBA 3SNAA 3OSYA 1HAGE 5TJXA 5TCAA 2FYRA 3PWCA 3GCHB 1ABJH 1O37A 1MTWA 3MU0A 4YOGA 2F9OA 1TFXA 1OP8A 1LVYA 1O3DA 1SL3A 3R3GB 2VIWA 3Q3YA 2BXUH 4GVUA 1XVOA 3GCHC 1C2DA 3A7WA 3BTHE 4IN2A 1P2QA 1QQ4A 1C2LA 1TOMH 3PTNA 2AGEX 1DWCH 3LGYA 1LHEH 2FI4E 2G81E 4U30A 4DVAU 1O30A 2J9NA 1C5XB 2UUJB 4GSOA 2XYAA 1H4WA 3U8OH 3VGCB 1P57B 3NXPA 1FQ3A 2FM2A 3BN9A 4ABGA 4DY7B 1AFQB 1VGCB 3B8JA 3RU4D 1ZSKA 1O2LA 1C5PA 4O9VA 3SORA 4LXBH 3OU0A 2PKAA 3TNSA 2GKVE 3A7TA 1MZDA 1A46H 3OY6U 1FLEE 2V35A 4FU9A 3BTEE 2XNIA 3MO6A 3M7UA 5CMXH 4MPWA 2GV6A 2H1UA 4XOJA 1Z8GA 1TPAE 2SGDE 2DE9A 5EXNA 3K6ZA 3PYHA 3ELAH 1P9UA 1UVPA 4NWLA 1XXFA 2ZQ1A 1O2HA 4I32A 2GZ9A 1TAWA 4AZ2B 3O8BA 2AYWA 9LPRA 1LQDB 2P8OC 3NPSA 4NSVA 2G8TA 4WMDA 4Z0KA 3SUFA 4K1EA 1HXEH 1XUFA 1ELEE 3F68H 4X1SU 1H9HE 2WINI 1TMBH 1FNIA 2YNAA 1HAIH 1ELTA 2AEIH 4ZKRU 1JBUH 1SGNE 3PMAB 1C5MD 1GMCG 3E90B 4HZHA 1ACBE 5T6GA 1GMDF 3KHVA 6CHAB 4YOIA 1BITA 1D6RA 1SGQE 1O2KA 3MU1A 1F0UA 3RP2A 2BYAX 2FOCA 4WH6A 3QGNB 2BD5A 3BTDE 1ESBA 2ZDNA 1EX3A 1GI9B 5EQRA 3SZNA 3LKWA 1BHXF 1K1LA 4CRAA 1WQVH 3ZV9A 4OS7A 3VEQB 3ZVCA 5DG6A 1AKSA 4CRFA 2ZFSA 2A45B 4ABJA 1C2MA 2IJOB 1TLDA 4X2YA 1K21H 1GBAA 4MNWA 4XSKU 4AGKA 4DT7B 4B74A 1QFKH 1MMJN 3MNSA 1Y3YA 1S5SA 1CBWC 2V6NA 1SFIA 1NFUA 4Y8ZA 3MO3A 1GHYH 2CMYA 3GCTF 4FUBA 1GBFA 1GHBF 1A7SA 1ZRBA 1O35A 1W14U 1GCTC 4H42U 1TGTA 1S6HA 3L6PA 1HNEE 3M7QA 2FIRH 4BAHB 1IQIA 1DWBH 4ISHH 1LKAA 2KAIB 3LC3A 3F9HA 4DW2U 5GXPA 2FWWA 1B7XB 2TIOA 5CHAC 1CGIE 4BXSA 5AF9H 4GHTA 2B5TB 4X8VH 2OC8A 1TNGA 5JB8S 3ATIA 1GBMA 1YLCA 3SU6A 1YPJH 2AIPA 2W5EA 1O34A 4BTTB 3MOCA 2Y6TA 3D62A 3SGAE 1O32A 2XC0A 1GBBA 1S6FA 3TH2H 1FZZA 2SGEE 1F0RA 3M3TA 2A0QB 3F9EA 1QNJA 1TGSZ 1A5IA 2ESTE 1SHYA 4H4FA 2JKHA 2O8TA 4THNH 1CE5A 2FMJA 1O3OA 3UREA 2JH5D 3SOSA 2R2WU 3ZYDA 1TMUH 1ZMNA 1O3EA 3H5CB 1YPHE 4DIIH 1KY9A 4FU7A 4R8TB 1MTVA 3KEEA 2UWPA 1ARBA 1QIXB 3I78A 4X8UH 1UHBA 3BEUA 1C1UH 1ELCA 1HIAA 1TGBA 1V2PT 2PLXA 3RXAA 7LPRA 1A2CH 5C5OA 5C3NA 3TJNA 1F2SE 3I29A 3GY2A 5JB9S 1YC0A 4UFEH 2A5KA 1SR5C 4HFPB 1LO6A 3M3VA 1FN6A 2O9QA 3EA8A 1P09A 1GPZA 4RKJB 2P3UB 4U32A 3QZRA 1TPSA 1HAVA 2BD7A 5F8ZA 1ABIH 3E3TA 4ZXXH 4I8KA 3EQ0H 4K1TA 3GDSA 3M37A 1Y5AT 2ZFRH 3UWIA 1GBIA 4Q2KA 3TVJB 3LGUA 1DLKB 2PKAB 4Q7XA 3RXGA 3BIUH 3D49H 1UMAH 2OUAA 1SMFE 2VWOA 4NA9H 3LONA 3TU7H 1UCYH 1F7ZA 5B6OA 3DUXH 3ZZBA 5K0HA 1KXEA 1O2SA 1ZJDA 1KXBA 3S7HB 3BTFE 1MD7A 3SGBE 1SOZA 3DD2H 2FI3E 3PM3A 4BAKB 1G3BA 3TPIZ 1SI5H 1Z8JB 4KKDA 4ZKSU 1UTMA 2BOHB 1ARCA 2PKSB 3GOVB 2G5NA 1EZSC 1ZTLA 2NU1E 3U9AH 3V0XA 1SGCA 1SB1H 4YLQH 4ZKOU 1QRZA 2FO9A 3RXVA 1LHDH 2AFQB 2ZU5A 3ZZ3A 3OTJE 2ZU4A 3DHKH 4DJZB 4ISLA 3V7TA 3DA9B 1MKXH 4A5TS 1JRSA 3GY3A 2A2QH 2TBSA 1ZTJA 1V2UT 3UIRA 2ZGXH 4RN6A 3SJKA 4NGAH 2Z9JA 4WMFA 1SLWB 4D76A 5FBEA 2Z3DA 2FS8A 2R0KA 1ETTH 1AKSB 1GCDA 1G3DA 4UONA 1N1LA 1O2OA 2VWNA 3W95A 1AZ8A 2G4TA 1TNHA 1YPLH 3UQOA 1BMMH 2ANWA 2OBOA 1ZPZA 1GBEA 3I77A 2WYJA 4YT7H 1NESE 1QCPA 1D3PB 5EW2H 1GI3A 4TWWA 1P8VC 3A7VA 5EQSA 2G4UA 1W12U 1AE8H 1BHXB 5JPMH 3F6UH 3IITA 4I8HA 2ZHQH 3T27A 4ABHA 3TJOA 3ATLA 3SGQE 5F03A 4CHAB 2ZQ2A 1BBRK 4INLA 3KQCA 1P2OA 1QBVH 4K8YA 4IN1A 1ID5H 1ZTKA 1T4VH 5EG4A 3RXLA 4AG2A 1NFYA 2FTMA 3MNXA 3TK9A 1NRPH 3BSQA 1DOJA 1K2I1 4RSPA 1T7CA 3AW1A 2EEKA 1J17T 6LPRA 1KXAA 1OWDA 2NU4E 1O2IA 1C1QA 1O5FH 2VJ1A 2ASUB 1LVBA 1O3HA 3T5FH 1IQEA 4ZMAH 4NG9H 2GD4B 3PLBA 5GCHF 4WH8A 1MKXK 4GLYA 2HPPH 3A8CA 1K1NA 4YO9A 1ZGIA 3QO6A 4ABDA 2Y82A 2ZU2A 1GHWH 1C1RA 3PMHB 4A1VA 1C2HA 1UHBB 2CHAC 4AFZA 1T4UH 1SPJA 2TGPZ 2AIQA 4LZ1H 1UTPA 1C5LH 1HIAB 4BTUB 4CRCA 1EPTB 1N8OC 2OXSA 1HJAB 1DM4B 4FXGH 3AW0A 2TRMA 3M61U 1FUJA 3RXBA 2J95A 4KELA 2V3OH 3HGPA 1C5WB 1YPHC 5HXFA 1MKWK 3FVFB 2ZFTA 3SV2H 1E38B 1GI8B 1MTNC 2SFAA 1OYQA 4B76A 1PQ5A 3AASA 3TK5A 4D7GA 2NU2E 4UEHH 4AFQA 1GI7B 2JH0D 3FP8E 3EAJA 1IQJA 3Q77A 1H8DH 4UE7H 1O3LA 3TGKE 1A0JA 3HK6B 3UR9A 2SGFE 1JRTA 5ETXA 1MTSA 5HGGA 1YM0A 2H6MA 3UNSA 4B2AA 1PYTC 5FPYA 3FANA 3IWMA 1FAXA 1W3CA 2PUQH 1C1OA 1F5KU 1OSSA 1RS0A 4RKOB 1BT7A 1NU7B 2ZZUH 1WYKA 5GDSH 1CT2E 1A5GH 1EJAA 1ZGVA 1GMHG 2STBE 3MNBA 2GMTB 2Z3EA 3Q76A 2VVVA 1Z8RA 1G32B 2VWMA 4WMEA 3SU2A 1THPB 5DPAA 1QRXA 2YNBA 3ZVGA 2VH0A 2BVRH 3URCA 4WXVA 3C27B 2GV7A 5AVDA 3VPKA 4YLUA 1IAUA 1ZMJA 1DT2A 5I25A 1ANEA 3Q3KA 3ZZ6A 4A92A 1SGDE 1BTPA 5FCRA 4XDEA 2ZP0H 1HAYB 2QC2A 1HDTH 2A4OA 3P95A 3SUGA 4X1PU 3BTQE 1S83A 4X8TH 4NIVA 1O2YA 1C5NH 1RIWC 1C5OH 4GAWA 1DY8A 1FY3A 3RC6A 4LZ4B 1F0TA 3RUOA 4R0IA 1O2WA 1D3TB 1B0FA 1BRBE 2A5IA 3RLWH 1GJDB 2ODYB 4NFEA 2BDCA 4DCDA 2VGCC 5EPNA 1BTYA 1VR1H 1EJNA 1SVPA 1O31A 2ZDKA 3RXRA 3B23B 1TABE 4D9RA 4TYDA 3MHWU 4WY3A 4MPXA 3ZZ5A 1BZXE 2R9PA 1Y59T 1AUTC 2BLQA 3MYWA 2ZGJA 1GL0E 3NKKA 4JZIA 1FIZA 1L4ZA 1X7AC 1P10A 3A84A 5IYTA 3F1SB 1P11E 1CVWH 1UJ1A 6GCHG 1AN1E 1P01A 1BIOA 1QA7A 3VXEH 1IHSH 1PQAA 3FP6E 4Y8XA 1GGDC 1EQ9A 3QN7A 3NUMA 5EQQA 1SGFG 1V2JT 1QB9A 1Z1IA 4K1SA 4AFUA 1EZQA 1SGYE 4Y71A 3SU4A 3ZZCA 5EXLA 2XCNA 1GI6A 1V2ST 1RTLA 3GY8A 3RXIA 4WXIA 5T6DA 1MAXA 3A81A 1AIXH 1BTUA 3ZVAA 2Y5GA 1DWEH 1OS8A 1C5YB 1DITH 2AS9A 2F9VA 2OD3B 2A7HA 1GJ9B 2FTLE 3SQHE 4TY7A 5LPEA 3RXEA 1Y5BT 1YKTA 2AMQA 3GCTG 1K9OE 4CBNA 3FZDA 2V0BA 1GHBG 4J2YB 1ZHPA 1ANCA 4I33A 4ZUHA 4CRGA 2P16A 1ETSH 4X6OA 2BD9A 2QXJA 4YESB
chains in the Genus database with same CATH superfamily
1O3AA 1YYY1 2ZO3H 1NT1A 2J5UA 3F3BA 4FUCA 1AB9C 2P93A 2ODPA 2BD4A 1GI0A 4MPUA 1QR3E 3SO3A 1NFWA 3MH6A 1L2EA 4CH2B 4ASUD 1OWIA 4A1XA 3DT0H 3OEHD 3UFAA 1BMFD 1FY1A 1GMHF 1S82A 1FV9A 2OK5A 1EB2A 1Y5UT 5JYIA 2FEQH 1S81A 2FOBA 3LT3A 3KN2A 4HI3A 3M7TA 3GCNA 2RDEA 3AK5A 2ZKSA 3PO1C 5DGJA 5FAHA 3JZ2B 5LH8A 1GJBB 5C94A 5J4QA 2HNTE 4SGAE 2Z94A 1VKYA 2PV9B 4JZ1A 1LMWB 3RXSA 1P2IA 1Y3VA 2FDAA 1IHTH 1L0ZA 2XRCA 4Y7BA 1SQOA 1AU8A 3K2UA 1FMGA 1DVAH 3QX5H 3UWJH 3GCOA 1VITG 3FP7E 4B71A 1ELFA 3SV8A 4X1QU 1W7GH 1HLTH 1EAIA 3M5NA 2Q6DA 3BEIB 2JJ1D 5L30H 3TLOA 5JBBS 3JZ1B 5DKMA 1UTNA 1O33A 2PGQB 2G52A 1ZPBA 2FOMB 1C1PA 1Y3WA 2D2DA 1LVMA 2WUCA 4IMZA 1FPHH 2P8OB 1PJPA 2F43B 3EA9A 1TBZH 3GY7A 4X2VA 2BY7X 1T8MA 1K22H 2ZDLA 1CHGA 4ZROA 1OP0A 5C1YA 5FCKA 1KTTB 1OWKA 4A6LA 1GVKB 1HFDA 1QHRB 1BBRE 2BY6X 4UFDH 4FUGA 1NBME 6GCHF 5TCCA 1GI2A 2JIZD 2Y7XA 5LGOA 1MH0A 4J1YA 3RXJA 4BAQB 1SG8B 2ZIQH 1M9UA 3A8BA 1O0DH 1XMNB 3C1KA 2Z9KA 2WPJS 3SNEA 1GHVH 2VWLA 3SUDA 2PGBB 1S0QA 5F8XA 5EJZA 1GBLA 1ZZZA 2GCTC 2Q6FA 3E1XB 2QXGA 2K1QA 3E0PB 1QL8A 1CBWB 2FOEA 2OQ5A 3U8TH 1F0SA 1O5AB 2F83A 3AVZA 1GCTB 1SGTA 2Z3CA 2F9BH 2P59A 1F92A 1OWJA 1SGFA 1A1RA 1YLDA 3MNCA 5CHAB 1Y3UA 2J92A 5AHGH 2Y5HA 1V2LT 1V6DA 4X1NU 3ZVEA 2FX6A 3RC5A 1W13U 1TMTH 3ATKA 5K7RA 4AB9A 1W7XH 2ODQA 2ZHEH 5KGOA 3ZZ7A 1OWEA 1O2PA 4F4OC 2UWOA 2B7DH 2WPMS 4FUHA 1TYNA 2HLDD 1DWDH 1QA0A 3A7ZA 2KFWA 3F9FA 1C5TA 1QL9A 1XUIA 2ULLA 1OX1A 3T28A 3M3SA 1UTJA 3D23A 3GICB 4ZHLU 1QURH 1P03A 1O5BB 2KCYA 4YM9A 1YGCH 4B6EA 1DLEA 3MMGA 3LU9B 1HJ8A 3MU4A 3RXTA 3V3MA 3STJA 2PHBA 1T8NA 4HG6A 2BTCE 4FUDA 3A89A 3KYGA 2HWLB 4Z6AH 2Z6BD 2G55A 1W0JD 4K60A 1RRKA 1ZPCA 1VITF 3T25A 4Y79A 1EJMA 1HAXB 3RXMA 1HV7A 3PLPA 1TQ7B 2C8YB 4ISNA 1EPTA 1RJXB 1TA6A 2XXLA 5AFZH 1DX5M 3TK6A 3ZIAD 5T3HA 1ANBA 3PMJA 1AO5A 1V2KT 4A7IB 1YPKH 2ZHWH 2A31A 1HJ9A 1ZRKA 4GCHG 4FU8A 3K6YA 3FN8A 2ZDMA 3OYPA 2SGAA 1P0SH 2KCOA 2ZFFH 5GCHG 3LGTA 1TONA 3PMBB 1PPGE 1LKBA 5A0AE 1MQ6A 2QGRA 2QXIA 3RXKA 1XVMA 8ESTE 5I46H 5C2ZA 4UFFH 3A85A 1GJ6A 3DCLA 1BTXA 4Y10E 1GHXH 3EDXB 3EGKH 2BDBA 2OCVB 2WV4A 1E1QD 2NU0E 2J34A 1GI1A 3NCLA 2W26A 1S0RA 1TOCB 2HNTC 3BG4C 2LPRA 4LK4A 4TY6A 3RMOH 2PTCE 1EATA 1O2VA 1EZXC 2BD3A 3ZZ9A 1RD3B 1NRQH 3CS0A 1CA0C 6ESTA 4FETA 4I31A 4UDWH 1EUFA 2QA9E 1QTFA 3LH3A 4OGYA 4K69A 3SV7A 4E06H 3KQEA 3N7OA 4ZCNA 1TE0A 1RFNA 3IG6B 1GBKA 3GDUA 4Q7YA 4BAOB 1HXFH 2XTTB 2QV1A 2XWBI 2WV5A 2YMSD 1EOJA 4CRDA 4ZXYH 2OC7A 3CENA 1KLTA 1ZSLA 1P02A 1SOTA 5E0JA 2VIVA 3PTBA 4NZQA 3QTOH 3E8LA 3K65B 4CREA 4NA8A 1WCZA 5FX5A 2H9EH 1T8LA 1WAYB 3T62A 3F2FA 2JETC 1YPGH 3MH4A 2FS9A 4TWYA 1GG6B 1BTWA 4M7GA 3U69H 4XBBA 1ANDA 1O3GA 3TNTA 1V2RT 1SGEE 2ZDAH 2XW9A 1BTZA 3LIWA 4JK6A 1GG6C 4X6NA 1CQQA 1MZAA 1RTKA 1HAPH 1W0KD 4MVNA 1OP2A 2UWLA 3SV9A 1AVXA 1TGCA 2H2ZA 1C2KA 3WWFA 4E7RG 1EZUC 5DSFA 5A0CA 2ZC9H 3ZVDA 4B2CA 2PWXA 1INCA 1W2KH 3TJVA 3OY5U 3CP7A 1UCYK 4FVDA 4X2WA 1WOFA 1O38A 4D7FA 3O8CA 1MBQA 1K0HA 2BB4A 3SNBA 3S69A 4UD9H 2BLOA 4NWKA 1O5DH 1B0EA 4IBLH 1KXDA 1DE7H 1K1IA 1K1MA 1GJCB 8GCHG 1P04A 3K9XB 2BY9X 2H9HA 5EIYA 1RTFB 2XBWA 5F6MA 3BTTE 2BHGA 1W10U 1SBWA 1TALA 2OINA 1CGHA 1OOKB 3VB3A 2BLWA 2YMSC 4AGJA 1BRCE 1XUKA 5A2MH 1DY9A 2GGVB 2HALA 3RC4A 2P3TB 1O3IA 2XC4A 1GBTA 3A88A 1AUJA 1MCVA 3A8DA 3GISB 5DK1A 2GT7A 1QJ6B 1IOEA 4GCHF 4CBOA 5FPTA 1NC6A 4F48B 2VINA 3MU8A 2CHAB 1MU6B 1Z6JH 2R0LA 3EA7A 5A09A 1TX7A 2HOBA 2BDGA 2XC5A 4QT8C 1MAYA 1N8OB 3RXCA 4RT1A 3PWBA 4OS6A 4X2XA 2Q1JA 2RG3A 1YWUA 1NS3A 3LGWA 1G3CA 1T32A 1Z7KA 1J8AA 1XKAC 5E8EH 1IQFA 2A5AA 4MDSA 1MTNB 3MU5A 2QN5T 2Z9IA 3SHAH 1HPGA 3RMLH 1MD8A 1IQLA 2XBYA 5A8XA 2OC1A 1LHFH 1A4WH 3FZZA 1VITH 3P92A 3SJ9A 4KP0A 4F55A 5JBTA 1UTLM 3Q3XA 5PTPA 1Q31A 2ZPSA 1V3XA 4IC5A 3G01A 2ALVA 4Y76A 4X8SH 2AGIX 2PP6A 1AWHB 3ENSB 2BD8A 3P8GA 1D9IA 2VIQA 3P8FA 1BRUP 1E37B 5EU8A 1F5RA 2FXRA 3RXHA 2GDDA 1CHOF 1ELGA 2XBVA 1LCYA 5LPRA 2BZ6H 3QDZB 4YTAA 4YT6H 4D9QA 1PPFE 4O97A 5BPEA 1D3DB 2ZTXA 3RU4T 1QBOA 1BUIA 2QY0B 5F8TA 2EI8A 1A3EH 1SLUB 2GZ8A 1BTHH 1S84A 1UVUH 2QF4A 1ZLRA 2PSXA 1C1WH 1P2JA 3BIVH 3KQ5A 4INKA 1THRH 5J4SA 4JCNA 1HUTH 2YOLA 4CH8B 2HLCA 1H1BA 5JBAS 7ESTE 1Q3XA 1ZYOA 4ISOA 4K8BA 2H9TH 2LNCA 3PV5A 2GTBA 2FOAA 1GDNA 3A82A 1RIWB 1BOQA 2ZCHP 5B6LA 2W3IA 2ZCLP 4WJG2 4O3TA 1C4V2 2B8OH 2ZFPH 3A7XA 4ASHA 2OP9A 4JYUH 5C0UA 1P12E 3UB0A 1FY5A 2BQ6B 1H9IE 2C8XB 2TGTA 1O3BA 2VGCB 4E7NA 2OLGA 2IPQX 3QZQA 1C5SA 8GCHF 1W11U 1XUGA 2BVSH 2HVXA 4DOQA 2CF9H 1C4Y2 2PFEA 4VGCC 5HM9A 3NZIA 1NTPA 3M5MA 1C9TA 1E79D 2WUBA 4I7YH 4HGCA 1AGJA 1O2GH 1V2TT 1SLVB 3SHCH 1G36A 1G30B 1PQ7A 1AVGH 1J9CH 1ELAA 4KTSA 1CU1A 1GHAG 3L3TA 4IC6A 1O3PB 1QRWA 1O5GH 2TGDA 2FX4A 3RXOA 1ZR0A 2H5DA 3T29A 3VB7A 2ZU1A 2GP9B 2O8LA 1RXPA 1JXPA 1TWXB 2WHXA 5C17A 5G4BA 1GGDB 3EYDA 2DUCA 2W7UA 1O39A 4ABEA 2BD2A 3UNRA 1SHHB 4E05H 2ZF0H 4NFFA 1O3MA 2ZG0H 5FX6A 1IQGA 1RGQA 2Q6GA 2V7QD 3LC5A 1FJSA 1C2IA 1NRNH 5FXLA 3KNXA 4D8NA 3S7KB 4BANB 1WTGH 4SGBE 3QTVH 2BX4A 4ZAEA 2B9LA 1KMHB 3V13A 3U28C 2O8UA 2ZDVH 2NU3E 1KSNA 1FDPA 3M35A 4MNYA 3FAOA 4ZHAA 1ZHMA 5C1UA 1O3JA 7GCHF 1AWFH 4GUXA 2OC0A 3LOXA 2WPIS 2BOKA 3EE7A 1GDUA 2PR3A 2PW8H 3MWIU 1YLNA 2BX3A 5DP8A 2EI7A 3OX7U 1KDQA 4P02A 1EKBB 1TRMA 3HKJB 1O2MA 3KF2A 1G3EA 1AB9B 3VB4A 8KME2 2LELA 2KCPA 1C1TA 1WQSA 4DGJA 1QJ1B 2C93B 3SI4H 1HB0B 2C90B 2VU8E 1DSUA 5E0GA 5ABWA 3GYMA 2F9NA 1TRNA 3NK8A 2D26C 1ORFA 2IOTA 1C1SA 1A61H 1SLXB 3W94A 3TGJE 1O2UA 3A86A 1ETRH 3URDA 3RMNH 1NZQH 1HCGA 3RDZA 4CR9A 2KZ4A 1O3CA 1GVLA 1YPMH 2HNTF 1ESAA 3ODFA 3PO1B 3SW2B 1FIWA 1VJ9U 1THSH 1DXPA 1H8IH 3LDXH 2UUYA 2EI6A 2AH4X 3PV4A 5FHTA 2CN0H 3DSGA 5HM2A 4X6PA 3S9BA 2FP7B 3A87A 4IS5A 1J14A 3SN8A 1LPZB 2DE8A 4IW4E 2FOHA 5L2YH 2QE7D 3SU3A 4I8GA 4MTBA 2OQUA 2J2UA 1GL1A 2RCEA 3QWCH 1GBHA 2I6QA 1TNKA 1EP6A 3MH5A 4JZFH 1Z71A 1BJVA 1E0FD 4FVBA 2BQWB 2ANYA 4DG4A 1ZSJA 5CHBA 1AMHA 1OKXA 1GHZA 3ESTA 2FODA 1V2NT 1E34B 4NIYA 1KLIH 4NCYA 1XM1A 4Y7AA 4RT0A 5E2PA 1DUEA 2FOGA 4Y6DA 5DP9A 2PTNA 1GDQA 3KGPA 1JIMA 1EAUA 3U1IB 3VGCC 1CGJE 5KECA 1VCQA 1UCYE 1O2JA 3MH7A 1D3QB 3A7YA 2F4LA 1OXGA 3U8RH 2J38A 2FZZA 1AFQC 1VGCC 1GHAF 1P2NA 1AI8H 1XUJA 2P95A 5EJLA 1YBWA 2GCHG 5F53A 1PPZA 2FYQA 1BCUH 1GBJA 4XBDA 1IQMA 1UVSH 4AB8A 3KCGH 3PB1E 1NRRH 1UO6A 3MTYA 3RXFA 1XUHA 3UR6A 5JBCS 4WWYA 1P3EA 1O2NA 1O5CB 1LQEA 3SV6A 1ZMLA 2GCTB 2PSYA 2M2AA 3ATMA 4OS2A 1YF4A 2D8WA 5SGAE 2QF0A 1HYLA 1IQHA 3ZVFA 1LDTT 4MNVA 4BXWA 1CO7E 3P8NA 1TB6H 1ELDE 2HRVA 3H7OA 4JYVH 2ZHDA 4K2YA 1P9SA 5T1VA 1A0HB 2RDLA 3KIDU 1JWTA 1C5ZB 7KMEH 2BDAA 1GI5A 4AYYB 4FOUC 4DIHH 3SQEE 3GDVA 5GPIB 1EASA 1P2KA 2K0QA 2GZ7A 6CHAC 3BG8A 4JZEH 5AFYH 5DJ7A 5KEDA 3A8AA 1EB1H 3WY8A 1C4U2 3TGIE 2G51A 4ABBA 4JZDH 3SZEA 1JIRA 1MQ5A 2A32A 5C5NA 3HATH 2W3KA 2Y7ZA 1MTUA 1SFQB 2ZPQA 5L6NH 1KYNA 1L4DA 1O2RA 1YCPH 1O36A 1DUAA 1J15A 1E35B 1CT4E 4X6MA 2A4GA 1LPKB 2G00A 4M9FA 3ZZ8A 3GY4A 1DDJA 1A3BH 3L33A 3RXPA 1UTOA 1W0ZU 2ZGCA 4AOQA 3ZZAA 2ALPA 1QL7A 1Z1JA 1KDQB 3D65E 4MG3A 4BNRA 1NM6A 1O2ZA 3GY6A 4XFQA 1HRTH 1TBQH 1P06A 1FPCH 1KXFA 3MI4A 3HKIB 4KGAA 3P17H 2F91A 4X1RU 4AG1A 2IN2A 2RA0A 2P3FH 1W0YH 1SQTA 3BF6H 5DP3A 1C2EA 1O2XA 5FL7D 2QF3A 1V2MT 4O3UA 1MBMA 4B75A 4A1TA 3UTUH 2J94A 3FFGA 2C8ZB 1NY22 1QY6A 2A7CA 2F9UA 2WPDD 2CJIA 2B0FA 2BZAA 1ZHRA 1FN8A 4OS1A 1UTKA 2FESH 2ZGBH 1C5VA 3OAAD 3LJJA 1GI4A 2THFB 4K5ZA 4K3JA 2WPKS 1Y8TA 2ZA5A 2H5CA 2BDYA 4GPGA 4U01A 5A0BA 3RXQA 4AN7A 1FAKH 3DFJA 1O2QA 4TPYA 2CGAA 4Q7ZA 2QYIA 4XE4A 1BMAA 1AFEH 1FI8A 2TGAA 4U2WA 3PRBA 1TNIA 3T26A 1DPOA 1CT0E 4Y11E 2CF8H 3E0NB 2BQ7B 2FI5E 2GCHF 1VJAU 1WU1A 4OS4A 4NIXA 3ZZDA 4XD7D 3BG4B 2GT8A 1QGFA 2A7JA 1BA8B 1YCPK 4IGDA 2SGPE 1HAHH 2M5TA 2ZECA 3SJOA 1P05A 1CA0B 1SGRE 2XBXA 1UK3A 3KQDA 2FLRH 3U98H 5CDFE 5E2OA 5HMAA 1UK4A 1KLJH 1D6WA 1GJ5H 1OWHA 1Z6EA 1V2WT 2UUFB 2J97A 5DP5A 1GMCF 3TIUA 3A80A 1F5LA 3SNCA 4MNXA 2KCAA 1A0LA 3LGVA 4ABIA 1WUNH 1EP5A 1H9LB 5DP4A 5C67A 2CXVA 1C2JA 2A2XH 1KIGH 1EAXA 2C8WB 2R3YA 2HPQH 4XRNA 1G9IE 2ILNA 3B9FH 3A83A 3SU1A 2BXTH 1BBRH 1LHGH 1AZZA 1S85A 2RA3A 4I8LA 5ESTE 1KXCA 2F3CE 1CHOG 4B2BA 1HGTH 2F9PA 2JETB 1V2VT 1UTQA 1QB1A 5C20A 1BQYA 2VIOA 1CSOE 3WWBA 1AY6H 2ZI2H 3ZVBA 1CA8B 2WPLS 4AORA 4DURA 1NPMA 1EXFA 2O8WA 1KTSB 1E1RD 2Z9LA 2ZNKH 1C1NA 4LOYH 1VZQH 1ZJKA 2VBCA 4BOHA 2PKSC 3ITIA 1DSTA 1UVTH 1VCWA 1TIOA 2PUXB 1TPPA 2XWAA 3E16B 5FPSA 5EOKA 3UAIC 2SGQE 4Y8YA 2FLBH 1C9PA 1UVOA 2QF5A 3SI3H 1BDAA 3BTWE 5EGMA 1ZOMA 3PLKA 4FUFA 1C5QA 3SJIA 1BB0B 4ACAA 3P70B 2Y81A 2AHME 3PROA 2GVFA 2HGTH 4JK5A 4BTIB 5E0HA 3S0NA 4KTUA 5L2ZH 3U1JB 3M5OA 2Z7FE 3ZV8A 1SSXA 1GBDA 2YMSB 1MKWH 4UFGH 2OTVA 2GDEH 3O8RA 2NWNA 5EW1H 2SNWA 3QLPH 1C1MA 3SUEA 2GX4A 4Q80A 2EA3A 3R0FA 1OYTH 2D1JA 3H7TA 1C5RA 1BMNH 8LPRA 2GJGA 1UK2A 4PROA 2VIPA 3UOUA 4MQAA 4TPIZ 4Y0ZE 1T31A 4B73A 1A5HA 1EFRD 3P8OA 3BTME 3QGJA 2WSSD 1L1JA 5DP6A 4IMQA 3P6ZB 2STAE 1HBTH 4ABFA 1C5UA 3TH4H 3MO9A 2G5VA 3RMMH 3SYJA 1L1NA 4AC9A 3CS7A 2Z9GA 4CHAC 2CK3D 4NIWA 1YPEH 1LHCH 3UPEA 1DS2E 3RLYH 4H6TA 4H6SB 1BRAA 1WSSH 1MU8B 4DT4A 2QIQA 1PYTD 1G2MA 3BTKE 5HYOA 3GYLB 5C1XA 1L1GA 4CRBA 5HIZA 4ABAA 3ODDA 1QQUA 3RXUA 1FONA 1V2OT 2WPHS 4GHQA 1U6QA 1IQNA 4YZUA 1ELBA 2VVUA 5GIBA 1C2GA 7GCHG 1TPOA 5GNDA 1SC8U 2BY5X 2A4RA 2J98B 2ZGHA 2ZTZA 2ZWLH 2ZU3A 2RFKC 2P94A 2Y5FA 3M5LA 4ZHMU 4ZKNU 4FUEA 4FUIA 5EODA 5H4IB 1DICA 1O3KA 1T8OA 1GVZA 1ELVA 5LPFA 5EXMA 3STIA 4HTCH 2BMGB 2IJD1 4I8JA 3M36A 1EPTC 1NROH 3T2NA 1FXYA 2ZTYA 3HGNA 1S6LA 2R2MB 4NA7A 4O03A 1HJAC 1FX0B 2V3HH 1O3FA 3Q00A 1GJ7B 1HAVB 4OGXA 1K28D 3NWUA 1G37A 1SQRA 2FPZA 1NRSH 1O3NA 4X0WU 1YP9A 2VH6A 2A4QA 2QCYA 1Y3XA 1OHHD 2WYGA 3N7EA 5GWZA 4YOJA 1NO9H 2VVCA 3N99A 4NZLA 2J4IA 4MLFB 1BJUA 2CV3A 2C4FH 3SNDA 1LVOA 1OPHB 4Q4LA 3MFJA 3PRDA 3HPTB 3BV9B 1XX9A 2SNVA 2Y80A 2W7SA 1GJ8B 1FY4A 1QJ7B 2ZHFH 2JDID 2BVXH 1XXDA 1N6YA 4ISIH 1TX8A 1J16A 4AX9H 1GBCA 1O5EH 1PPCE 3BEFB 3KL6A 1MUEB 1K1JA 3BTGE 3SU5A 2VB0A 1DANH 1AHTH 9ESTA 4VGCB 2ZPRA 2GMTC 1WV7H 2O8MA 5GJ4B 1HAOH 4B1TA 1TNJA 1PPHE 1TRYA 1B5GH 3F0OA 1N6XA 2QAAA 3CNRA 1P2MA 1Q2WA 2R3UA 2TPIZ 3SBKA 4NSYA 1PQ8A 3UOPA 4AYVB 2EC9H 3AAUA 3VXFH 4ZH8A 1PFXC 3E91A 1ESTA 3LGIA 1YCPM 5HKKD 1PPEE 3E6PH 3S9CA 3RU4E 3RXDA 2FOFA 1D4PB 5FBIA 4WF8A 1TX6A 2BM2A 3EE0B 1IQKA 3VB5A 5IDKA 1C1VH 2QXHA 2XCFA 1W8BH 3S9AA 3ZYEA 2AERH 3KQBA 1AE5A 3RM0H 4FUJA 1NN6A 1XKBC 4JMYA 2ZEBA 3GY5A 1DXWA 3TJUA 5A8YA 3DFLA 2ANMH 1EAWA 4Z1MD 1JOUB 1QBNA 2BDIA 1COWD 2ZCKP 1SQAA 4CR5A 1LTOA 1P3CA 2BY8X 1PPBH 3VB6A 2I6SA 1AD8H 1FY8E 2OBQA 1MCTA 1Z8IB 3RM2H 2IPHA 1GMDG 5A8ZA 3TITA 1V2QT 5EPYA 3UNQA 2VIDA 1NU9A 1AQ7A 3UUZA 4AFSA 2VNTA 2BLVA 1BMLA 1WBGB 1SGIB 1DFPA 1K1OA 1VCPA 5CE1A 3LJOA 3VFEA 5IK2D 1TA2A 1O2TA 1E36B 4WVPE 1G2LA 1HAZB 1AVWA 1LPGB 4XBCA 1C2FA 1TQ0B 4MPVA 2AGGX 2C3SA 3ATWA 1SGPE 4OS5A 2KAIA 4ACBA 3AAVA 2A1DB 2JH6D 2ZFQH 3QUMP 2ANKH 3HK3B 4KTCA 4INHA 3QK1A 1GJ4H 1TGNA 1TBRH 3TH3H 3FO8D 1GJAB 3F9GA 1NFXA 2AMDA 1K1PA 3SJ8A 1GWAA 2BDHA 5BRRE 5JDUB 4F49A 4JYTA 4ESTE 1WTHD 3ZZ4A 3V12A 3LPRA 3UY9A 1QB6A 1JMOH 2AMPA 5T6FA 5DO4H 3UQVA 4BAMB 1TNLA 2UUKB 3SU0A 5DP7A 1EOLA 3LH1A 3O8DA 4Y0YE 5ESBA 3SNAA 3OSYA 1HAGE 5TJXA 5TCAA 2FYRA 3PWCA 3GCHB 1ABJH 1O37A 1MTWA 3MU0A 4YOGA 2F9OA 1TFXA 1OP8A 1LVYA 1O3DA 1SL3A 3R3GB 2VIWA 3Q3YA 2BXUH 4GVUA 1XVOA 3GCHC 1C2DA 3A7WA 3BTHE 4IN2A 1P2QA 1QQ4A 1C2LA 1TOMH 3PTNA 2AGEX 1DWCH 3LGYA 1LHEH 2FI4E 2G81E 4U30A 4DVAU 1O30A 2J9NA 1C5XB 2UUJB 4GSOA 2XYAA 1H4WA 3U8OH 3VGCB 2V3MA 1P57B 3NXPA 1FQ3A 2FM2A 3BN9A 4ABGA 4DY7B 1AFQB 1VGCB 3B8JA 3RU4D 1ZSKA 1O2LA 1C5PA 4O9VA 3SORA 4LXBH 3OU0A 2PKAA 3TNSA 2GKVE 3WW7A 3A7TA 1MZDA 1A46H 3OY6U 1FLEE 1UW7A 2V35A 4FU9A 3BTEE 4I86A 2XNIA 3MO6A 3M7UA 5CMXH 4MPWA 2GV6A 2H1UA 4XOJA 1Z8GA 1TPAE 2SGDE 2DE9A 5EXNA 3K6ZA 3PYHA 3ELAH 1P9UA 1UVPA 4NWLA 1XXFA 2ZQ1A 1O2HA 4I32A 2GZ9A 1TAWA 4AZ2B 3O8BA 2AYWA 9LPRA 1LQDB 2P8OC 3NPSA 4NSVA 2G8TA 4WMDA 4Z0KA 3SUFA 4K1EA 1HXEH 1XUFA 1ELEE 3F68H 4X1SU 1H9HE 2WINI 1TMBH 1FNIA 2YNAA 1HAIH 1ELTA 2AEIH 4ZKRU 1JBUH 1SGNE 3PMAB 1C5MD 1GMCG 3E90B 4HZHA 1ACBE 5T6GA 1GMDF 3KHVA 3OFND 6CHAB 4YOIA 1BITA 1D6RA 1SGQE 1O2KA 3MU1A 1F0UA 3RP2A 2BYAX 2FOCA 4WH6A 3QGNB 2BD5A 3BTDE 1ESBA 2ZDNA 1EX3A 1GI9B 5EQRA 3SZNA 3LKWA 1BHXF 1K1LA 4CRAA 1WQVH 3ZV9A 4OS7A 3VEQB 3ZVCA 5C0TA 5DG6A 1AKSA 4CRFA 2ZFSA 2A45B 4ABJA 1C2MA 2IJOB 1TLDA 4X2YA 1K21H 1GBAA 4MNWA 4XSKU 4AGKA 4DT7B 4B74A 2L74A 3F2HA 1QFKH 1MMJN 3MNSA 1Y3YA 1S5SA 1CBWC 2V6NA 1SFIA 1NFUA 4Y8ZA 3MO3A 3GS9A 1GHYH 2CMYA 3GCTF 4FUBA 1GBFA 1GHBF 1A7SA 1ZRBA 1O35A 1W14U 1GCTC 4H42U 1TGTA 3VG8A 1S6HA 3L6PA 1HNEE 3M7QA 2FIRH 4BAHB 1IQIA 1DWBH 4ISHH 1LKAA 2KAIB 3LC3A 3F9HA 4DW2U 5GXPA 2FWWA 1B7XB 2TIOA 5CHAC 1CGIE 4BXSA 5AF9H 4GHTA 2B5TB 1H8ED 4X8VH 2OC8A 1TNGA 5JB8S 3ATIA 1GBMA 1YLCA 3SU6A 1YPJH 2AIPA 2W5EA 1O34A 4BTTB 3MOCA 2Y6TA 3D62A 3SGAE 2HVYB 1O32A 2XC0A 1GBBA 1S6FA 3TH2H 1FZZA 2SGEE 1F0RA 3M3TA 2A0QB 3F9EA 1QNJA 2XOKD 1TGSZ 1A5IA 2ESTE 1SHYA 4H4FA 2JKHA 2O8TA 4THNH 1CE5A 2FMJA 1O3OA 3UREA 2JH5D 3SOSA 2R2WU 3ZYDA 1TMUH 1ZMNA 1O3EA 3H5CB 1YPHE 4DIIH 1KY9A 4FU7A 4R8TB 1MTVA 3KEEA 2UWPA 1ARBA 1QIXB 3F0PA 3I78A 1UHBA 4X8UH 3BEUA 2J98A 1C1UH 1ELCA 1HIAA 1TGBA 1V2PT 2PLXA 3RXAA 7LPRA 1A2CH 5C5OA 5C3NA 3TJNA 1F2SE 3I29A 3GY2A 5JB9S 1YC0A 4UFEH 2A5KA 1SR5C 4HFPB 1LO6A 3M3VA 1FN6A 2O9QA 3EA8A 1P09A 1GPZA 4RKJB 2P3UB 4U32A 3QZRA 1TPSA 1HAVA 2BD7A 5F8ZA 1ABIH 3E3TA 4ZXXH 4I8KA 3EQ0H 4K1TA 3GDSA 3M37A 1Y5AT 2ZFRH 3UWIA 1NBMD 1GBIA 4Q2KA 3TVJB 3LGUA 1DLKB 2PKAB 4Q7XA 3RXGA 3BIUH 3D49H 1UMAH 2OUAA 1SMFE 2VWOA 4NA9H 3LONA 3TU7H 1UCYH 1F7ZA 5B6OA 3DUXH 3ZZBA 5K0HA 1KXEA 1O2SA 1ZJDA 1KXBA 3S7HB 3BTFE 1MD7A 3SGBE 1SOZA 2XNDD 3DD2H 2FI3E 3PM3A 4BAKB 1G3BA 3TPIZ 1SI5H 1Z8JB 4KKDA 4ZKSU 1UTMA 2BOHB 1ARCA 2PKSB 3GOVB 3KYFA 2G5NA 1EZSC 1ZTLA 2NU1E 3U9AH 3V0XA 1SGCA 1SB1H 4YLQH 4ZKOU 1QRZA 2FO9A 3RXVA 1LHDH 2AFQB 2ZU5A 3FKSD 3ZZ3A 1YY3A 3OTJE 2ZU4A 3DHKH 4DJZB 4ISLA 3V7TA 3DA9B 1MKXH 4A5TS 1JRSA 3GY3A 2A2QH 2TBSA 2W6ID 1ZTJA 1V2UT 3UIRA 2ZGXH 4RN6A 3SJKA 4NGAH 2Z9JA 4WMFA 1SLWB 4TSFD 4D76A 5FBEA 2Z3DA 2FS8A 2R0KA 1WXRA 1ETTH 1AKSB 1GCDA 1G3DA 4UONA 1N1LA 1O2OA 2VWNA 3W95A 1AZ8A 2G4TA 2KM0A 1TNHA 1YPLH 3UQOA 1BMMH 2ANWA 2OBOA 1ZPZA 1GBEA 5EJ1A 2EQNA 3I77A 2WYJA 4YT7H 1NESE 1QCPA 1D3PB 5EW2H 1GI3A 4TWWA 1P8VC 3A7VA 5EQSA 2G4UA 1W12U 1AE8H 1BHXB 5JPMH 4TT3D 3F6UH 3IITA 4I8HA 2ZHQH 3T27A 4ABHA 2KX4A 3TJOA 3ATLA 3SGQE 5F03A 4CHAB 2ZQ2A 1BBRK 4INLA 3KQCA 1P2OA 1QBVH 4K8YA 4IN1A 1ID5H 1ZTKA 1T4VH 5EG4A 3RXLA 4AG2A 1NFYA 2FTMA 3MNXA 3TK9A 1NRPH 3BSQA 1DOJA 1K2I1 4RSPA 1T7CA 3AW1A 2EEKA 1J17T 6LPRA 1KXAA 1OWDA 2NU4E 1O2IA 1C1QA 1O5FH 2VJ1A 2ASUB 3F2GA 4P00A 1LVBA 1O3HA 3T5FH 1IQEA 4ZMAH 4NG9H 2GD4B 3PLBA 5GCHF 4WH8A 1MKXK 4GLYA 2HPPH 3A8CA 1K1NA 4YO9A 1ZGIA 3QO6A 4ABDA 2Y82A 2ZU2A 1GHWH 1C1RA 1QZ8A 3PV2A 3PMHB 4RI0A 4A1VA 1C2HA 1UHBB 2CHAC 4AFZA 1T4UH 2WV9A 1SPJA 5DN6D 2TGPZ 2AIQA 4LZ1H 1UTPA 1C5LH 1HIAB 4BTUB 4CRCA 4B6FA 1EPTB 2WZQA 1N8OC 2OXSA 1HJAB 1DM4B 4FXGH 3AW0A 2TRMA 3M61U 1FUJA 3RXBA 2J95A 4KELA 2V3OH 2L6OA 3HGPA 1C5WB 1YPHC 5HXFA 1MKWK 3FVFB 2ZFTA 3SV2H 1E38B 1GI8B 1MTNC 2SFAA 3DSOA 1OYQA 4B76A 1PQ5A 3AASA 3TK5A 4D7GA 2NU2E 4UEHH 4AFQA 1H8HD 1GI7B 2JH0D 3FP8E 3EAJA 1IQJA 3Q77A 1H8DH 4UE7H 1O3LA 3TGKE 3W1EA 1A0JA 3HK6B 3UR9A 2K8IA 2SGFE 1JRTA 5ETXA 1MTSA 5HGGA 1YM0A 2H6MA 3UNSA 4B2AA 1PYTC 5FPYA 3FANA 3IWMA 1FAXA 1W3CA 2PUQH 1C1OA 1F5KU 1OSSA 1RS0A 4RKOB 1BT7A 1NU7B 2ZZUH 3OE7D 1WYKA 5GDSH 1CT2E 1A5GH 1EJAA 1ZGVA 1GMHG 2STBE 3MNBA 2GMTB 2Z3EA 3Q76A 2VVVA 1Z8RA 1G32B 2VWMA 4WMEA 3SU2A 1THPB 5DPAA 1QRXA 2YNBA 3ZVGA 2VH0A 2BVRH 3URCA 4WXVA 3C27B 2GV7A 5AVDA 3VPKA 4YLUA 1IAUA 1ZMJA 1DT2A 5I25A 1ANEA 3Q3KA 3ZZ6A 4A92A 1SGDE 1BTPA 5FCRA 4XDEA 2ZP0H 1HAYB 2QC2A 1HDTH 2A4OA 3P95A 3SUGA 4X1PU 3BTQE 1S83A 4X8TH 4NIVA 1O2YA 1C5NH 1RIWC 1C5OH 4GAWA 1SKYE 3N7DA 4OM9A 1DY8A 1FY3A 3RC6A 4LZ4B 1F0TA 3RUOA 4R0IA 1O2WA 1D3TB 1B0FA 1BRBE 2A5IA 3RLWH 1GJDB 2JJ2D 2ODYB 4NFEA 2BDCA 4DCDA 2VGCC 5EPNA 1BTYA 1VR1H 1EJNA 1SVPA 1O31A 2EY4C 2ZDKA 3OTPA 3RXRA 3B23B 1TABE 4D9RA 4TYDA 3H09A 3MHWU 4WY3A 1WDIA 4MPXA 1BZXE 2R9PA 3ZZ5A 1Y59T 1AUTC 4YXWD 2BLQA 3MYWA 2ZGJA 1GL0E 3NKKA 4JZIA 1FIZA 1L4ZA 1X7AC 1P10A 3A84A 5IYTA 3F1SB 2W6JD 3FOAA 1P11E 1CVWH 2KR7A 1UJ1A 6GCHG 1AN1E 1P01A 1BIOA 1QA7A 3NRLA 3VXEH 1IHSH 1PQAA 3FP6E 4Y8XA 1GGDC 1EQ9A 3QN7A 3NUMA 1MABB 5EQQA 1SGFG 1V2JT 1QB9A 1Z1IA 4K1SA 4AFUA 1EZQA 1SGYE 4Y71A 3SU4A 3ZZCA 5EXLA 2XCNA 1GI6A 4Q63A 1V2ST 1RTLA 3GY8A 3RXIA 4WXIA 3MQKC 5T6DA 3OEED 5HIYA 1MAXA 3A81A 1AIXH 1BTUA 3ZVAA 2Y5GA 1DWEH 1OS8A 1C5YB 1DITH 2AS9A 2F9VA 2OD3B 2A7HA 1GJ9B 2LP6A 2FTLE 3SQHE 4TY7A 5LPEA 3RXEA 1Y5BT 1YKTA 2AMQA 3GCTG 1K9OE 4CBNA 3FZDA 2V0BA 1GHBG 4J2YB 1ZHPA 1ANCA 4I33A 3DSPA 4ZUHA 4CRGA 2P16A 1ETSH 4X6OA 2BD9A 2QXJA 4YESB
chains in the Genus database with same CATH topology
1O3AA 1YYY1 2ZO3H 1NT1A 4FUCA 1AB9C 2P93A 2ODPA 2BD4A 1GI0A 4MPUA 1QR3E 3SO3A 1NFWA 3MH6A 1L2EA 4CH2B 1OWIA 4A1XA 3DT0H 3UFAA 1FY1A 1GMHF 1S82A 1FV9A 1EB2A 1Y5UT 5JYIA 2FEQH 1S81A 2FOBA 3LT3A 3KN2A 4HI3A 3M7TA 3GCNA 2ZKSA 3PO1C 5DGJA 5FAHA 3JZ2B 5LH8A 1GJBB 5J4QA 2HNTE 4SGAE 2Z94A 2PV9B 4JZ1A 1LMWB 3RXSA 1P2IA 1Y3VA 2FDAA 1IHTH 1L0ZA 2XRCA 4Y7BA 1SQOA 1AU8A 3K2UA 1FMGA 1DVAH 3QX5H 3UWJH 3GCOA 1VITG 3FP7E 4B71A 1ELFA 3SV8A 4X1QU 1W7GH 1HLTH 1EAIA 3M5NA 2Q6DA 3BEIB 5L30H 3TLOA 5JBBS 3JZ1B 5DKMA 1UTNA 1O33A 2PGQB 2G52A 1ZPBA 2FOMB 1C1PA 1Y3WA 2D2DA 1LVMA 2WUCA 4IMZA 1FPHH 2P8OB 1PJPA 3EA9A 1TBZH 3GY7A 4X2VA 2BY7X 1T8MA 1K22H 2ZDLA 1CHGA 4ZROA 1OP0A 5C1YA 5FCKA 1KTTB 1OWKA 4A6LA 1GVKB 1HFDA 1QHRB 1BBRE 2BY6X 4UFDH 4FUGA 6GCHF 5TCCA 1GI2A 2Y7XA 5LGOA 1MH0A 4J1YA 3RXJA 4BAQB 1SG8B 2ZIQH 1M9UA 3A8BA 1O0DH 1XMNB 3C1KA 2Z9KA 2WPJS 3SNEA 1GHVH 2VWLA 3SUDA 2PGBB 1S0QA 5F8XA 1GBLA 1ZZZA 2GCTC 2Q6FA 3E1XB 2QXGA 2K1QA 3E0PB 1QL8A 1CBWB 2FOEA 2OQ5A 3U8TH 1F0SA 1O5AB 2F83A 3AVZA 1GCTB 1SGTA 2Z3CA 2F9BH 2P59A 1F92A 1OWJA 1SGFA 1A1RA 1YLDA 3MNCA 5CHAB 1Y3UA 2J92A 5AHGH 2Y5HA 1V2LT 1V6DA 4X1NU 3ZVEA 2FX6A 3RC5A 1W13U 1TMTH 3ATKA 5K7RA 4AB9A 1W7XH 2ODQA 2ZHEH 3ZZ7A 1OWEA 1O2PA 4F4OC 2UWOA 2B7DH 2WPMS 4FUHA 1TYNA 1DWDH 1QA0A 3A7ZA 3F9FA 1C5TA 1QL9A 1XUIA 2ULLA 1OX1A 3T28A 3M3SA 1UTJA 3D23A 3GICB 4ZHLU 1QURH 1P03A 1O5BB 4YM9A 1YGCH 1DLEA 3MMGA 3LU9B 1HJ8A 3MU4A 3RXTA 3V3MA 3STJA 2PHBA 1T8NA 2BTCE 4FUDA 3A89A 2HWLB 4Z6AH 2Z6BD 2G55A 4K60A 1RRKA 1ZPCA 1VITF 3T25A 4Y79A 1EJMA 1HAXB 3RXMA 1HV7A 3PLPA 1TQ7B 2C8YB 4ISNA 1EPTA 1RJXB 1TA6A 2XXLA 5AFZH 1DX5M 3TK6A 5T3HA 1ANBA 3PMJA 1AO5A 1V2KT 4A7IB 1YPKH 2ZHWH 2A31A 1HJ9A 1ZRKA 4GCHG 4FU8A 3K6YA 2ZDMA 3OYPA 2SGAA 1P0SH 2ZFFH 5GCHG 3LGTA 1TONA 3PMBB 1PPGE 1LKBA 5A0AE 1MQ6A 2QGRA 2QXIA 3RXKA 1XVMA 8ESTE 5I46H 5C2ZA 4UFFH 3A85A 1GJ6A 1BTXA 4Y10E 1GHXH 3EDXB 3EGKH 2BDBA 2OCVB 2WV4A 2NU0E 2J34A 1GI1A 3NCLA 2W26A 1S0RA 1TOCB 2HNTC 3BG4C 2LPRA 4LK4A 4TY6A 3RMOH 2PTCE 1EATA 1O2VA 1EZXC 2BD3A 3ZZ9A 1RD3B 1NRQH 3CS0A 1CA0C 6ESTA 4I31A 4UDWH 1EUFA 2QA9E 1QTFA 3LH3A 4OGYA 4K69A 3SV7A 4E06H 3KQEA 3N7OA 1TE0A 1RFNA 3IG6B 1GBKA 3GDUA 4Q7YA 4BAOB 1HXFH 2XTTB 2QV1A 2XWBI 2WV5A 1EOJA 4CRDA 4ZXYH 2OC7A 3CENA 1KLTA 1ZSLA 1P02A 1SOTA 5E0JA 2VIVA 3PTBA 4NZQA 3QTOH 3E8LA 3K65B 4CREA 4NA8A 1WCZA 5FX5A 2H9EH 1T8LA 1WAYB 3T62A 2JETC 1YPGH 3MH4A 2FS9A 4TWYA 1GG6B 1BTWA 4M7GA 3U69H 4XBBA 1ANDA 1O3GA 3TNTA 1V2RT 1SGEE 2ZDAH 2XW9A 1BTZA 3LIWA 4JK6A 1GG6C 4X6NA 1CQQA 1MZAA 1RTKA 1HAPH 4MVNA 1OP2A 2UWLA 3SV9A 1AVXA 1TGCA 2H2ZA 1C2KA 4E7RG 1EZUC 5A0CA 2ZC9H 3ZVDA 4B2CA 2PWXA 1INCA 1W2KH 3TJVA 3OY5U 3CP7A 1UCYK 4FVDA 4X2WA 1WOFA 1O38A 4D7FA 3O8CA 1MBQA 2BB4A 3SNBA 3S69A 4UD9H 2BLOA 4NWKA 1O5DH 1B0EA 4IBLH 1KXDA 1DE7H 1K1IA 1K1MA 1GJCB 8GCHG 1P04A 3K9XB 2BY9X 2H9HA 1RTFB 2XBWA 5F6MA 3BTTE 2BHGA 1W10U 1SBWA 1TALA 2OINA 1CGHA 1OOKB 3VB3A 2BLWA 4AGJA 1BRCE 1XUKA 5A2MH 1DY9A 2GGVB 2HALA 3RC4A 2P3TB 1O3IA 2XC4A 1GBTA 3A88A 1AUJA 1MCVA 3A8DA 3GISB 5DK1A 2GT7A 1QJ6B 1IOEA 4GCHF 4CBOA 5FPTA 1NC6A 2VINA 3MU8A 2CHAB 1MU6B 1Z6JH 2R0LA 3EA7A 5A09A 1TX7A 2HOBA 2BDGA 2XC5A 4QT8C 1MAYA 1N8OB 3RXCA 3PWBA 4OS6A 4X2XA 2Q1JA 2RG3A 1NS3A 3LGWA 1G3CA 1T32A 1Z7KA 1J8AA 1XKAC 5E8EH 1IQFA 2A5AA 4MDSA 1MTNB 3MU5A 2QN5T 2Z9IA 3SHAH 1HPGA 3RMLH 1MD8A 1IQLA 2XBYA 5A8XA 2OC1A 1LHFH 1A4WH 3FZZA 1VITH 3P92A 3SJ9A 4KP0A 5JBTA 1UTLM 3Q3XA 5PTPA 1Q31A 2ZPSA 1V3XA 4IC5A 3G01A 2ALVA 4Y76A 4X8SH 2AGIX 1AWHB 3ENSB 2BD8A 3P8GA 1D9IA 2VIQA 3P8FA 1BRUP 1E37B 5EU8A 1F5RA 2FXRA 3RXHA 2GDDA 1CHOF 1ELGA 2XBVA 1LCYA 5LPRA 2BZ6H 3QDZB 4YTAA 4YT6H 4D9QA 1PPFE 4O97A 5BPEA 1D3DB 2ZTXA 3RU4T 1QBOA 1BUIA 2QY0B 5F8TA 2EI8A 1A3EH 1SLUB 2GZ8A 1BTHH 1S84A 1UVUH 1ZLRA 2PSXA 1C1WH 1P2JA 3BIVH 4INKA 1THRH 5J4SA 4JCNA 1HUTH 2YOLA 4CH8B 2HLCA 1H1BA 5JBAS 7ESTE 1Q3XA 1ZYOA 4ISOA 4K8BA 2H9TH 2LNCA 2GTBA 2FOAA 1GDNA 3A82A 1RIWB 1BOQA 2ZCHP 2W3IA 2ZCLP 4WJG2 4O3TA 1C4V2 2B8OH 2ZFPH 3A7XA 4ASHA 2OP9A 4JYUH 1P12E 1FY5A 2BQ6B 1H9IE 2C8XB 2TGTA 1O3BA 2VGCB 4E7NA 2OLGA 3QZQA 1C5SA 8GCHF 1W11U 1XUGA 2BVSH 2HVXA 4DOQA 2CF9H 1C4Y2 2PFEA 4VGCC 5HM9A 3NZIA 1NTPA 3M5MA 1C9TA 2WUBA 4I7YH 4HGCA 1AGJA 1O2GH 1V2TT 1SLVB 3SHCH 1G36A 1G30B 1PQ7A 1AVGH 1J9CH 1ELAA 4KTSA 1CU1A 1GHAG 3L3TA 4IC6A 1O3PB 1QRWA 1O5GH 2TGDA 2FX4A 3RXOA 1ZR0A 2H5DA 3T29A 3VB7A 2ZU1A 2GP9B 2O8LA 1RXPA 1JXPA 1TWXB 5G4BA 1GGDB 3EYDA 2DUCA 2W7UA 1O39A 4ABEA 2BD2A 3UNRA 1SHHB 4E05H 2ZF0H 4NFFA 1O3MA 2ZG0H 5FX6A 1IQGA 1RGQA 2Q6GA 3LC5A 1FJSA 1C2IA 1NRNH 5FXLA 3KNXA 4D8NA 3S7KB 4BANB 1WTGH 4SGBE 3QTVH 2BX4A 4ZAEA 2B9LA 3V13A 2O8UA 2ZDVH 2NU3E 1KSNA 1FDPA 3M35A 4MNYA 3FAOA 4ZHAA 1ZHMA 5C1UA 1O3JA 7GCHF 1AWFH 4GUXA 2OC0A 3LOXA 2WPIS 2BOKA 1GDUA 2PR3A 2PW8H 3MWIU 2BX3A 5DP8A 2EI7A 3OX7U 1KDQA 1EKBB 1TRMA 3HKJB 1O2MA 3KF2A 1G3EA 1AB9B 3VB4A 8KME2 1C1TA 1WQSA 4DGJA 1QJ1B 2C93B 3SI4H 1HB0B 2C90B 2VU8E 1DSUA 5E0GA 5ABWA 3GYMA 2F9NA 1TRNA 3NK8A 2D26C 1ORFA 2IOTA 1C1SA 1A61H 1SLXB 3W94A 3TGJE 1O2UA 3A86A 1ETRH 3URDA 3RMNH 1NZQH 1HCGA 3RDZA 4CR9A 1O3CA 1GVLA 1YPMH 2HNTF 1ESAA 3ODFA 3PO1B 3SW2B 1FIWA 1VJ9U 1THSH 1DXPA 1H8IH 3LDXH 2UUYA 2EI6A 2AH4X 3PV4A 5FHTA 2CN0H 5HM2A 4X6PA 3S9BA 2FP7B 3A87A 4IS5A 1J14A 3SN8A 1LPZB 2DE8A 4IW4E 2FOHA 5L2YH 3SU3A 4I8GA 4MTBA 2OQUA 2J2UA 1GL1A 2RCEA 3QWCH 1GBHA 2I6QA 1TNKA 1EP6A 3MH5A 4JZFH 1Z71A 1BJVA 1E0FD 4FVBA 2BQWB 2ANYA 4DG4A 1ZSJA 1AMHA 1OKXA 1GHZA 3ESTA 2FODA 1V2NT 1E34B 4NIYA 1KLIH 4NCYA 1XM1A 4Y7AA 5E2PA 1DUEA 2FOGA 4Y6DA 5DP9A 2PTNA 1GDQA 3KGPA 1JIMA 1EAUA 3U1IB 3VGCC 1CGJE 1VCQA 1UCYE 1O2JA 3MH7A 1D3QB 3A7YA 1OXGA 3U8RH 2J38A 2FZZA 1AFQC 1VGCC 1GHAF 1P2NA 1AI8H 1XUJA 2P95A 1YBWA 2GCHG 1PPZA 2FYQA 1BCUH 1GBJA 4XBDA 1IQMA 1UVSH 4AB8A 3KCGH 3PB1E 1NRRH 1UO6A 3MTYA 3RXFA 1XUHA 3UR6A 5JBCS 4WWYA 1P3EA 1O2NA 1O5CB 1LQEA 3SV6A 1ZMLA 2GCTB 2PSYA 3ATMA 4OS2A 1YF4A 2D8WA 5SGAE 2QF0A 1HYLA 1IQHA 3ZVFA 1LDTT 4MNVA 4BXWA 1CO7E 3P8NA 1TB6H 1ELDE 2HRVA 3H7OA 4JYVH 2ZHDA 4K2YA 1P9SA 1A0HB 2RDLA 3KIDU 1JWTA 1C5ZB 7KMEH 2BDAA 1GI5A 4AYYB 4DIHH 3SQEE 3GDVA 5GPIB 1EASA 1P2KA 2GZ7A 6CHAC 3BG8A 4JZEH 5AFYH 5DJ7A 3A8AA 1EB1H 3WY8A 1C4U2 3TGIE 2G51A 4ABBA 4JZDH 1JIRA 1MQ5A 2A32A 5C5NA 3HATH 2W3KA 2Y7ZA 1MTUA 1SFQB 2ZPQA 5L6NH 1KYNA 1L4DA 1O2RA 1YCPH 1O36A 1DUAA 1J15A 1E35B 1CT4E 4X6MA 2A4GA 1LPKB 2G00A 3ZZ8A 3GY4A 1DDJA 1A3BH 3L33A 3RXPA 1UTOA 1W0ZU 2ZGCA 4AOQA 3ZZAA 2ALPA 1QL7A 1Z1JA 1KDQB 3D65E 4MG3A 4BNRA 1NM6A 1O2ZA 3GY6A 4XFQA 1HRTH 1TBQH 1P06A 1FPCH 1KXFA 3MI4A 3HKIB 4KGAA 3P17H 2F91A 4X1RU 4AG1A 2IN2A 2RA0A 2P3FH 1W0YH 1SQTA 3BF6H 5DP3A 1C2EA 1O2XA 2QF3A 1V2MT 4O3UA 1MBMA 4B75A 4A1TA 3UTUH 2J94A 3FFGA 2C8ZB 1NY22 1QY6A 2A7CA 2F9UA 2CJIA 2B0FA 2BZAA 1ZHRA 1FN8A 4OS1A 1UTKA 2FESH 2ZGBH 1C5VA 4K5ZA 3LJJA 1GI4A 2THFB 4K3JA 2WPKS 1Y8TA 2ZA5A 2H5CA 2BDYA 4GPGA 4U01A 5A0BA 3RXQA 4AN7A 1FAKH 3DFJA 1O2QA 4TPYA 2CGAA 4Q7ZA 2QYIA 4XE4A 1BMAA 1AFEH 1FI8A 2TGAA 4U2WA 1TNIA 3T26A 1DPOA 1CT0E 4Y11E 2CF8H 3E0NB 2BQ7B 2FI5E 2GCHF 1VJAU 1WU1A 4OS4A 4NIXA 3ZZDA 3BG4B 2GT8A 1QGFA 2A7JA 1BA8B 1YCPK 4IGDA 2SGPE 1HAHH 2M5TA 2ZECA 3SJOA 1P05A 1CA0B 1SGRE 2XBXA 1UK3A 3KQDA 2FLRH 3U98H 5E2OA 5HMAA 1UK4A 1KLJH 1D6WA 1GJ5H 1OWHA 1Z6EA 1V2WT 2UUFB 5DP5A 1GMCF 3TIUA 3A80A 1F5LA 3SNCA 4MNXA 1A0LA 3LGVA 4ABIA 1WUNH 1EP5A 1H9LB 5DP4A 5C67A 2CXVA 1C2JA 2A2XH 1KIGH 1EAXA 2C8WB 2R3YA 2HPQH 1G9IE 2ILNA 3B9FH 3A83A 3SU1A 2BXTH 1BBRH 1LHGH 1AZZA 1S85A 2RA3A 4I8LA 5ESTE 1KXCA 2F3CE 1CHOG 4B2BA 1HGTH 2F9PA 2JETB 1V2VT 1UTQA 1QB1A 5C20A 1BQYA 2VIOA 1CSOE 1AY6H 2ZI2H 3ZVBA 1CA8B 2WPLS 4AORA 4DURA 1NPMA 1EXFA 2O8WA 1KTSB 2Z9LA 2ZNKH 1C1NA 4LOYH 1VZQH 1ZJKA 4BOHA 2PKSC 3ITIA 1DSTA 1UVTH 1VCWA 1TIOA 2PUXB 1TPPA 2XWAA 3E16B 5FPSA 5EOKA 2SGQE 4Y8YA 2FLBH 1C9PA 1UVOA 3SI3H 1BDAA 3BTWE 5EGMA 1ZOMA 3PLKA 4FUFA 1C5QA 3SJIA 1BB0B 3P70B 2Y81A 3PROA 2GVFA 2HGTH 4JK5A 4BTIB 5E0HA 3S0NA 4KTUA 5L2ZH 3U1JB 3M5OA 2Z7FE 3ZV8A 1SSXA