2BYCA

Blrb - a bluf protein, dark state structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSRGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE-LIGHT RECEPTOR OF THE BLUF-FAMILY
publication title Structure of a Bacterial Bluf Photoreceptor: Insights Into Blue Light-Mediated Signal Transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bycA00
3HHLD 4DN9A 2K2PA 2G9OA 3CJKB 1XBWA 2XMVA 1FE4A 1KVJA 1V3ZA 2PD1A 2RSQA 1R6YA 5K9FA 1Y3KA 3QMQA 2AJ1A 2FB0A 2AP6A 2QLXA 2EW9A 3I9ZA 3KG0A 3UDCA 3WDOA 5B0DA 2LQBA 1OSDA 4A47A 2GFFA 4OIXA 4A46A 2IFXA 1SI9A 2OMOA 1KQKA 3TOQA 2OKQA 3HHLC 5B09A 2ASYA 2K7JA 3T9NA 2N4DA 3BR8A 1S6UA 4YDXA 2PGCA 2HFNA 5T7LB 1YJTA 1LQ9A 2XMMA 1SQEA 4ZA1A 2ACYA 4U9RA 5B0CA 3GZ7A 5F0WA 1IUJA 1CC8A 2LXFA 3HHLB 5B0FA 3LGNA 3FMBA 1W2IA 3HX9A 1VQYA 2CRLA 1TL5A 2VV5A 2OD4A 1K0VA 1FVSA 4YEAA 3BB5A 1TR0A 1N5SA 5B0EA 2XMKA 3FGVA 1YJUA 2XMJA 4OJ1A 1CC7A 1FE0A 2K1RA 1OQ3A 1SB6A 4HI1A 4NPOA 3MCSA 1YJVA 2XMWA 1Y3JA 1X0PA 2ZDOA 4FNHA 3CJKA 2K7KA 1GXUA 1JWWA 2FHMA 2KT2A 1ULRA 2RILA 4OJ3A 3BGUA 4OJGA 1QUPA 1Q53A 1N5VA 1N5TA 1TL4A 1TUVA 2FTRA 2LQ9A 1Q8LA 2GA7A 5B08A 1MWYA 2ROEA 2ZDPA 4A48A 1YRXA 3KKFA 5B0BA 2N4CA 1JK9B 1YJRA 2BBEA 2OFGX 2GGPB 2HLTA 3QGPA 2GV1A 2QYCA 3KG1A 3FRYA 5A6WA 2FIUA 4Y2KA 1MWZA 1S6OA 2W4PA 1P6TA 1AFJA 3HHLA 2BJEA 2IYIA 1URRA 4A4JA 2HLUA 4HI2A 4F67A 5A6PA 1AW0A 1Y9OA 3DCAA 4HH0A 1KVIA 1Q4RA 1Q8BA 4DL0C 1FD8A 1OPZA 2GO8A 3HFKA 2GCFA 2LDIA 2OD6A 2HFOA 4OJHA 3BF4A 2JDJA 4Y2IA 1AFIA 1FEEA 2KT3A 2QIFA 2KYZA 3LO3A 3TRGA 3KNGA 2IYGA 2K1RB 3LGMA 1P8GA 3BN7A 3BDEA 1FVQA 3E8OA 1N5QA 2ROPA 3MZIA 1CPZA 2XMTA 2L3MA 5KAKA 2HIQA 2RMLA 2VH7A 5B0AA 3HF5A 2W4CA 2Q3PA 4Q2LA 1TZ0A 3BM7A 4DPOA 5T7LA 4Y2MA 1VQSA 2BJDA 3HDSA 5F0UA 3K7RA 2BUNA 4EFAC 4HL9A 3DXSX 1GXTA 5B0GA 3VTIA 3F44A 4NL5A 2GGPA 4Q2MA 2AW0A 2BYCA 4ZOSA 2OAUA 3TNVA 2OP5A 1WD6A 1APSA 2HQIA 1OQ6A 5IXUA 1YG0A 2KKHA 2QLWA 1Y0HA 2RU9A 2W4DA 4QOTA 2N7YA 3IWLA 1U7LA 2XMUA 1X8DA 4FNIA 4HH1A 2ROGA 1X7VA 2AJ0A 2OFHX 1FESA 3IWXA 1RJJA
chains in the Genus database with same CATH superfamily
4IH5A 1UP1A 1X5TA 2G9OA 5K20B 3OVSA 2MKYA 1XWLA 3M2UB 3E01A 1Y5IB 1RHQB 3QFHA 3DNCA 2WVDA 1FRJA 3W8GA 4M94A 4U9RA 1RQ0A 2ZBPA 1UA0A 3KUHA 2NQPA 2MY8A 3PYDA 1GMVA 2DRDA 5GAHU 2CJBA 4NPOA 4ZMMA 1NJYA 3LOUA 4UOCA 2OUGA 2DHXA 4JI8F 2ZDPA 5IM0B 3NLCA 3UE2A 7FDRA 1F5AA 1S99A 1HNZJ 4ZN3A 2GQCA 2WZ1A 3IR6B 4UUWA 2Y8YA 3UFCX 1S48A 4QBUA 2MZSA 1N36J 3ONQA 1NK4A 3CCTA 1GMUA 3SIPB 4DG1B 3N4WA 3OW2R 2X1GA 1X4BA 4FDFA 2JLGA 4NRTA 4YB6A 2O67A 4Q0BA 1PIEA 4WFNQ 2EC0A 2JEGA 2J9DE 4LSZB 4K8RA 2ASDA 5CQGA 2V2KA 4GMKA 1R6YA 2DEIA 4PUOA 2X3DA 2GJ2A 4KGKA 3GCXP 1N88A 4ZVGA 4X62F 2DH7A 3G6YA 4NZ7A 4LRBA 1SIWB 2IC3B 1M5PC 2D3OR 3PDNA 2SXLA 4JBCA 1HIYA 5F41A 4BS2A 3OLAA 1YJUA 2VASA 2C2MB 4KB7A 4HT5A 4F0HA 4Z7CA 4DQIA 2UU9F 2HYIB 1QVFR 1TUVA 5AE2A 3AT1B 2ROEA 3E01B 1VQ6S 4RUAA 1M90T 4ED1A 2I8EA 3I0RA 1FKOB 3PZPA 1L3KA 2B3TB 1T05B 4BHQA 2MLXA 4URSA 2LEPA 1SBRA 4PWUA 3M8PA 1YJ9S 2DEJA 4DOZA 2OEJA 4C11A 3SQOP 2EWHA 2XBPA 2H54B 2QN6B 2VBXA 4F3MA 2B4OA 3O8WA 3IBWA 3C2PA 1NH8A 4CCHA 2KKHA 1REVA 2PN6A 3N5FA 3WX4A 2I9SA 2AJ0A 2FQQB 2BR0A 1BE4A 1UA1A 2Z56B 2XYPB 4LF9J 3K89A 5H9FK 3NKYA 4LQ3A 4ITSA 5DJBA 4K2JA 3GONA 1S6UA 4DV2J 4ZLPA 2BMBA 4C8NA 2Y0SD 1H6KX 1W2IA 1WG4A 1LWCA 2DHSA 2UZAA 2OPRB 5E3CA 4Q0BB 2GQQA 4ECQA 5KFJA 2VC1A 5E41A 2BQUA 4PUOB 5DZ6A 1WNEA 2PEBA 4NYOA 4AQYJ 4YY3J 2F40A 2YQ0A 4FYXB 1Q82T 1UEKA 5LJ5Y 4DCJB 3MXHP 4PRFA 2HK2A 1WKKA 5EUHA 2WOMA 1FCAA 2NR0A 1NKCA 4FF2A 4B9VA 4RW4A 5D3GA 3NOCA 3X1LB 1A0OB 4W98A 3ISNC 2DGSA 1W7WA 3NL0A 4DL6A 1D9AA 2AW0A 4BC9A 5KFOA 4DJBA 4C8ZA 2Z8QA 1U7LA 4RR5A 3I0RB 1N33J 5L9NA 2A2DA 4DV5F 2F3JA 1CS4A 4IUFA 4DPWA 4M5HA 3M8PB 1FERA 1VBKA 2UV8A 2W01A 2B6AA 3H2VE 2AIRB 2BV3A 3KJQB 2NSCA 1S77D 4ZP6A 3TW0A 3N6NA 1TL5A 3CNQP 4W4MA 4LSLA 2AT1B 1REVB 1RYSA 2FZCB 4LF2A 2K7KA 4HEA9 4OJGA 1T11A 1JXVA 4LF7F 2DXFA 1MU2A 3CJ0A 2LEBA 4JV1A 1V3SA 4DR6J 3CEDA 2KFNA 3RTVA 3FEXB 3LUYA 3VAJA 2FC9A 1SQGA 1LWCB 4RU9A 1RE1B 1NAQA 2KYZA 3LO3A 4LF5J 5DGBA 4F0KA 2JVOA 3GIIA 3FMWA 4DFKA 4B9NA 4ELVA 1TTHB 1TL1A 1ZS6A 2D1CA 3QJLA 1UVNA 5ETMA 2GGPA 1IVZA 4Y34A 5LOQA 1FX2A 4E8UA 5KTQA 4DSIA 2V6AA 1KEKA 1GXLA 2UXDJ 3DI6A 2WOMB 2ACMA 4Q43A 2HKEA 2KHDA 5E3PA 4RW4B 4DFJA 4ECWA 2YKMA 4O3OA 1TR0A 5ETSA 4U6PA 3GV5B 1WDTA 5GAGI 1CS4B 4KGVB 3AA8A 3T9ZA 2KTQA 4RW6B 2KVIA 4WP9A 2R7TA 3CULA 2B6AB 2FLLA 1FDBA 3MM6A 4LREA 4OYIA 2RDIA 2KJWA 2DCLA 1Q0NA 1YBAA 4LSLB 3DM2A 1DY3A 2L3MA 5KAKA 2V4JA 3J81j 3HDSA 3CIMA 5D0RA 3DRSA 1S7HA 4QPTA 2EKNA 2FPHX 2W4DA 2LECA 1SJ4P 4TU7A 1TFYA 2K2PA 2HNDA 5LSLA 5KFUA 2QO3A 1NXIA 2KU7A 2QGFB 2XY5A 3MDFA 1VHIA 1VQ4S 5GVQA 2PE8A 1DQAA 3KOAA 5GMEA 1K73T 2VICA 3QGIA 4NLSA 1TL1B 4C3KA 2RVJA 3RBDA 2CG8A 2B9XA 3AHPA 3NS5A 3BPSP 4JI0J 1SV5A 3IG1A 4ZVQB 4QIVA 5C2GA 4DR2J 3DI6B 2G0JA 4Q5VA 3C6TA 3G82A 4L72B 5F8MA 3PJ9A 4HYKA 3ZZOA 3EJMA 2FZGB 1EKRA 1WG5A 4QR1A 4ILRA 2HBZB 3T1YJ 4XPEA 1TMMA 3I31A 3OVAA 4DU7A 2CAJA 5EX0A 2J8SA 3KNGA 4WP3A 3VCDA 5BR8J 2ROPA 3PO5A 4LT6A 2CG4A 1HNVA 4KKOA 4USMA 4ALZA 5RUBA 2Q43A 1AYEA 3VV2B 2FD2A 3G6ES 3D1OA 4USHA 5GADU 1FRKA 4DUZJ 1RZMA 5IFMA 1BQXA 3CJ8A 3ZXWA 1F1BB 2E5GA 3HHLD 2C1EB 5D0HA 2R7QA 4DLEA 1HI1A 3RBEA 5HROA 4KH0B 2V4JB 5EWEA 1TFWA 2VQFF 2MSSA 1BXNA 1RA6A 5AXMA 4NA3A 4J5OA 2XHCA 1LWXA 2CZ9A 4CLFA 5IT9U 2APOA 1YVFA 2BDPA 3GV7B 2WSEC 3CB4A 2UUCF 3UR0A 2OFGX 1HWJA 1MWZA 4FPIA 2IDLA 4JV0A 4WYWA 2QTWA 1Y9OA 2RUSA 1T02A 1Q8BA 3S1TA 2VB6A 1SV5B 1U2CA 3EZUA 2B9EA 3G82B 3MECA 1UW9A 2XSJA 1KR4A 4FPRA 4BLGA 2F5GA 1WD6A 2HVEA 5DZ7A 1S6PA 2VOOA 3MCNA 1HFEL 2V94A 1NK8A 2FLOA 5JVHQ 1UVJA 2KJVA 2IVMA 3KG0A 1JXEA 2W9CB 1WG1A 2BE9B 1ZM2A 3CJ2A 4GO7X 2AYBA 2EEYA 2BABA 4DI6A 4NLXA 1F2HA 4FZVA 1S5ZA 3QFWA 1LXJA 4C8YA 1B0VA 4A8FA 2QL9B 2M4MA 4DXLA 4RWXA 4EO8A 1IM4A 2B8PA 2BJ8A 2WVFA 1AA1B 3S7RA 1QUPA 2UVVA 1FNXH 4DL4A 3TQEA 5HROB 4N5SA 1IR2A 2CPDA 3R7SB 5L39A 2QSWA 3MD3A 5F3TA 4ID5A 2VBYA 4MIAA 4B3MF 3D6FB 2XMTA 1BHNA 3ZNJ1 3NCQA 1PYSB 4RL1A 2R7OA 1X9MA 2VIHA 3D6MB 2GIRA 3JB9k 3TZZA 3IN5A 4DQQA 3W7BA 4K4ZA 1S12A 2YQ1A 3U7JA 1UETA 2XCAA 3HHKA 1JLEA 3T5KA 3CW2C 3OHBA 1V6HA 3UQSA 1NHKL 1NB7A 1RT1B 4CLLA 4CLKA 4U7UD 2J6TA 4DN0A 5BXIA 2XZTB 2DNPA 2M70A 3DRRB 3QIDA 1N34F 1RAOA 4AFFA 1NNDA 2QYCA 5CD4A 4IKAA 4USWA 1J27A 3BZQA 2Q66A 2RHSB 5C2CA 1RWMB 3MPDA 5IC4B 1PJ7A 1CJKB 4OZJA 4U8VA 1GAOA 3GJSB 3HF5A 1HPZA 1VQOS 3QRPA 4UY85 3G86A 5T7LA 4EGLA 1XQIA 4L3NA 2A18A 3ISZA 4OV6A 2DHAA 4JI8J 1F60B 4IRCA 1J5EF 4BWMA 1BLUA 2DXDA 3QLHA 4I2QA 4ED2A 3W2WA 2E1CA 2V69A 4IQXA 2QA2A 2RU3A 1ZYQA 3THPA 1DTTB 2FUG9 1DBDA 4MT1A 4KV8A 1RTJA 4W90B 2IA6A 3FQLA 4LF8J 2H5JB 1MSWD 3OTDA 2GO9A 5DDQC 1HD0A 2AJ2A 4X62J 3DDIA 4HI2A 5I3QA 4CIOA 4RW8A 2FDNA 1AFIA 1I94F 2LMIA 1P8GA 5EWGA 3M8RA 1PILA 2A0FB 5B0AA 2W4CA 2DTJA 4WF9Q 3T5HA 2UU9J 1JNRB 4FXWA 1S59A 4H4OA 3N28A 2J7UA 4AL6A 1OJ4A 3GSIA 4ZPDA 3SFGA 3LANA 1J2VA 3HFZB 5K9FA 3CUNA 3IC1A 3K5PA 3PIPQ 3I82A 2MKIA 1LW2B 4YB7A 1HPZB 1WDDA 5T7LB 4USTA 3VAIA 2ACYA 1QSSA 1RT4A 5KFVA 3SQGB 1XNQF 4DS4A 2XB2D 4F04B 4O44A 2G0CA 3KHRA 4CO3A 1DZ5A 2WAQD 1SCJB 3ADAC 1TK5A 3QLHB 3HULA 4I64A 3V6DA 3JSYA 3MR7A 1SL2A 3W2WB 1S1WB 1ZM3A 1SC4B 3BGRA 2DGXA 3F73A 4DL0C 1E6VA 2R42A 2D3ZA 5A8WA 4KV8B 1RTJB 3JXOA 1EETA 1WSVA 1FWLA 5LL6d 3CT9A 2CQPA 3NCPA 3SV3A 2AJ4A 3TA0A 3IWNC 2CPHA 3QT6A 3EZOA 5J1EA 1X8DA 4ZCKA 4TU8A 4ES3A 1G6BA 1YSJA 4RW8B 1Y3KA 2XLIA 4UOFA 3GMGA 4BCAA 4O0IA 4Y00A 4A8KA 2V9KA 4F36A 2E7VA 4L75A 5DG7A 4USUA 2V5HG 1AZSB 4QCLA 2UV8G 2CRLA 1RHKB 4ZVRB 2HWHA 2ZDOA 2R7UA 1AXQA 3MUTP 5F8IA 4RJVA 4ZPVR 4DV5J 1U6BA 1FFSB 1YJ7A 1P9YA 3MEKA 1IQZA 4C8KA 3QWPA 1RHMB 2FJAB 3LALA 5CCLA 1RT4B 1B64A 2XYHB 2BACA 3R5JB 2RQCA 1T9UA 1ROFA 4O44B 2DRAA 5GMDA 4RX6A 1U09A 4P2SA 3MWBA 4OYMA 2IYGA 3PYFA 4XO0A 3R1LA 1LW0A 3Q8YA 4WKYA 1FTCA 2CNNB 2IM2A 3RRGA 1F3VA 2AEMA 4BC7A 2VOPA 3V6DB 4LF7J 4YS2A 2VPXB 2GMLA 4ID8A 3V81B 5GADI 1YRUA 3SMZA 2MY7A 2KL8A 3MAAA 1V5VA 5K5MA 2YTCA 1E6VB 3BBCA 3CF5Q 4N56A 3ZFVA 1SVDA 3V5RA 1EETB 2XCPA 2IFXA 2IRYA 1Y5NB 4C2MA 4X2BA 4I6YA 3O1LA 1OMSA 1T95A 2R2TA 3HSJA 4XIUA 2OD4A 1S7IA 2HEKA 4OHXA 2Y9HA 1H0HB 2KFZA 5AJ3F 1Q8LA 3UN5A 1YK9A 2U2FA 4G6VB 1WHXA 2KM8B 5DG9A 1RSCA 2JRSA 3TO8A 5ETRA 4NLWA 2YWKA 2VQEJ 3TRGA 4D3HA 3BH7B 4C97A 3KJFB 3QT5A 4ECVA 4P7TA 4YB1P 5IC6B 2XS5A 1NK7A 2XEXA 5KT3A 1RK8A 1X7VA 2F8MA 3HD2A 4RNNA 3BDPA 2YKNB 3W9HA 4OIXA 3WBZA 3AD9C 1L3UA 1TAQA 2NYIA 4NLQA 1HBMA 1LW0B 4WFAQ 4PG5A 2DGOA 4MYTA 2DR6A 2HFNA 2FC8A 2GMJA 5ETKA 1JKHA 4DSLA 2C2EA 4LF4F 4RW9B 3MAAB 5C5JA 3QIPB 1VBZA 4ZIWA 1KONA 2DHGA 2G1DA 4LIRA 1OSCA 5B0BA 4N47A 3GPAA 2R8GA 3LP0A 3BO4A 5KG6A 3L7PA 1Z1ZA 3K57A 1EAYC 2VBZA 3KK3B 3MUMP 2RD5C 5KFZA 2M7SA 1EX8A 4QW9A 4DPTA 1HARA 4CO1A 2PO4A 1PJ6A 2MQ8A 5AXNA 2CQ0A 5L1KA 2MQMA 1V3RA 1YTYA 3NBPA 2RH3A 3OD2A 1HBNA 3JYTA 1FX4A 3JS9A 2ZKUA 2OKQA 3OJSA 4JUZA 2AKWB 3CSKA 1GEHA 2WTFA 5HP1A 2HW3A 4ZCIA 3H7HB 2ZH9A 2JFKA 4KGZB 1CC7A 4CO5A 3QAUA 2QT7A 5E3AA 1JWWA 4YHHJ 3W8PA 2HHVA 1P27B 3AJ2A 5G0RA 3TR5A 1ZPWX 1JNZB 3ITHA 3EVWA 2YKQA 1YJRA 2CDRB 3KLHA 2CWKA 5SUHA 1NUEA 2XG8A 1JKHB 1EKSA 4TYBA 3BDEA 2H48B 3CJSA 1CPZA 2Y1IA 3MM8A 2FHJD 4ECZA 3DLJA 4Y2MA 1LWFA 3BJYA 3CIZA 2WSCC 3OTBA 1MWQA 2UUCJ 3GLJA 5IOLA 1SKUB 1QSLA 4NCGA 2Z30B 1GTEA 2AEJA 3SCLE 4F50A 4YR3A 2DH8A 7FD1A 2B5JA 5D4LA 1SXLA 2MEWA 3BSAA 4G3IA 2NSBA 3K8WA 2Y1LB 1WORA 3G6VA 1VJQA 2I2YA 1NEEA 4QZVB 5A8KA 4JV2A 2CPJA 3EDRB 2XNQA 4RW7B 2BM1A 5EGYA 2W1BA 3JYTB 1HBNB 2C2NA 2UUBF 2HHHJ 3QAEA 4Y2CA 2MKKA 2Y1RI 2P9EA 4DX7A 3KUEA 5E7OB 4ZJOA 3UVJA 5A6PA 3JQJA 3NP5A 3FBBA 3D6TB 1VLYA 3CMES 2NUUG 1JLFA 3NOGA 2J9EA 3MPWA 1RLDA 5B7WA 3TJ9A 4P71A 1GX5A 1TZ0A 2EK1A 1IR1A 5GMKa 1BUXA 3U1LA 4BDPA 2Z58B 1UCNA 3ITHB 3H2LA 2MGZB 3I87A 1U8WA 3KLHB 3CGIA 3VZIA 1PYOB 4XPCA 2AJ1A 4K5RA 4YMEA 1S4FA 3QJJA 3PW0A 3G8TA 2QG9B 3MM8B 4WXOA 1FFGB 2CQ4A 4C9DA 2E1MC 1MG7A 1T9XA 1LWFB 1R8PA 4ZIVA 4DSEA 4I6WA 3FSYA 3K0JA 4NCGB 1S1TA 3ZTOA 4KC5A 4K7QA 3BGFA 4TQRA 4CO0A 1T9VA 4Q8FA 2B5JB 1X5OA 2EXUA 2WVEA 1XR5A 3AOBA 2P2CB 1EP4A 5D78A 3OUYA 3C15A 1IKXB 3EGWB 2KZMA 1FD8A 2YWGA 4AD6A 5DQHA 5A8KB 2ABYA 1C1BB 3AQPA 3W9JA 1IKVA 5KOXA 3DOLA 3VVUA 3E8OA 3DLHA 4IDKA 3D68A 4DPOA 4OMFG 3GCWP 3L3CA 1PSDA 5KG1A 1N34J 1S1VA 3ICLA 4ANCA 4FNIA 5J1NA 3Q0AA 3UVJB 4EWTA 3CMAS 4L76A 5LSRA 1KVJA 3CCJS 3HP6A 5DETA 2FB0A 3NNAA 2DBBA 3US5A 1JLFB 2A2CA 4DR7J 2ADBA 5CAAA 5KFRA 4WK1A 2F65A 2XGQA 2KXFA 3QSYB 3LPEA 5G4DA 4X4NA 4OZ5A 4IRKA 1IBLJ 4B9TA 1EHWA 1J5EJ 5KFYA 2ZH4A 3TYTA 4LJMA 2XO7A 5IQ6A 4WIQA 3NXZA 3H25A 1JLGA 3J7Z5 3BSOA 4ZLLA 3JSMA 2G13A 3JAMY 2OSQA 2R8HA 3MCOA 4ZP7A 1UVKA 4KRWA 2IM0A 4ELUA 3H5UA 4MYUA 1S1TB 1MMDA 2CJQA 2PMZD 3H4DA 3EYZA 2OTJS 2GAHC 1FKPA 5M2RA 3EWGA 1SJRA 1U0HA 3M8QB 1EP4B 2ZUGA 3OUYB 3C15B 4HTJA 3A12A 1HHTP 3H42A 2RSQA 2XLKA 1RCOB 3KWMA 4OX8A 3DOLB 5KG7A 4PQAA 4A8XA 4IDKB 2VFRA 4LFAJ 2KN4A 2FVQA 3EGZA 1RT6B 1XJWB 2BKPA 3ENQA 4K4UA 3H59A 1LFWA 1ZM9A 3SCIE 2HBRB 3D1QA 3CD7A 4PR6A 4F3OA 3D28A 5KFNA 1N32F 4TXSA 1NH7A 2I5JA 2RKIB 3M6XA 2WONA 3K58A 3O2IA 2OJ3A 5K8OA 2EFGA 3DCAA 1MNEA 3RGIA 2BOAA 2EVZA 1RAEB 1XNQJ 1IJFB 4NEZA 2FJWA 2DO0A 4H4MA 3KUGA 2RAQA 4X4PA 3GYNA 2BJDA 3N5BA 5A0YA 4LF1A 4ZPBA 1JLGB 2EK6A 2VD3A 1FWPA 1CULA 4I6AA 1JLBA 3BPDA 1RWOB 1IBKJ 5A8RB 3UI3A 2FJDB 5KFGA 2LU1A 3HHDA 3BR9A 4LUBA 3C66A 2V0NA 1G7CB 3ZZUA 4O3NA 2BJ7A 1GT8A 3BO3A 2X7IA 4DL7A 3A8JA 1FF2A 1U0HB 3PJWA 3C16A 1KWMA 2HS0A 2LA4A 2YVSA 3KXDA 1RABB 3W66A 2MMYA 4J9KA 3IRWP 4PXCA 3BBBA 2NZ4A 3D3CJ 1M0SA 3ILIA 3L4BC 2PA3A 4UZCA 2HZCA 1Q5YA 2BZ2A 4P75A 3LP1A 1S9FA 5LSOA 1HBOB 2I5JB 4C6AA 1XMOF 3QRRA 2MKHA 4CQ1A 2FVRA 2WONB 4JI2F 2HBYB 1H2VZ 3IO1A 2B0GA 5HMWA 2JSXA 1FKAF 5ETVA 3UCGA 2J0QD 3LP2A 1N6QA 3LAMA 4NMLA 4F8RA 1IBMF 1WHVA 4H4MB 1HBUA 2N4DA 3HSDA 5KG3A 1UVIA 4F3QA 4TKTA 1RACB 3HHLB 3AOAA 2QFJA 3HVWA 2H1YA 1OQ3A 2AJFE 3CVKA 2E1RA 2O01C 2QMWA 2IY5B 4AE5A 1CULB 5CYJA 3M6UA 1OWXA 4LF9F 2R7SA 1KC8T 3DC2A 4ECXA 1TL4A 1KFDA 2XHWA 4USIA 4X4RA 1YRXA 3LGHA 4DV2F 1PC4A 5KFIA 3W63A 3QYYA 2A6MA 2JFDA 2V8DA 1WEYA 3N01A 2Y8WA 3AD8C 2CJXB 3OTCA 3C16B 1Q81T 4DSJA 4DZ6A 5CA5A 4KPCA 5J2NA 4IR9A 3OPKA 4DV4F 4O3RA 1VCTA 3GP9A 4MIWA 4YY3F 1G4CA 2XNRA 2VDIA 2IBKA 2OFHX 1CQMA 1BY9A 2BQRA 3Q8PB 3TP2A 1XN9A 1HNIB 3EXCX 2VUGA 3H0PA 4Y28C 3R5DA 3TA1A 4ED8A 1TKXA 1WEXA 2HVHA 4FF3A 3J7AN 3LP1B 3MD1A 1YJTA 5CHCB 3KNAA 2BX6A 4LBHA 5K14A 3ZTSA 1V5IB 1N33F 3D3BJ 2QMUB 2MZRA 3AA9A 3G9CA 3DLBA 2KHCA 3CTRA 4HACB 1U45A 1VQ8S 3BO2A 3LP2B 1Q53A 1N6QB 2W9AA 1UTAA 4DLGA 1NHUA 2AZ1A 5CZXA 2N4CA 2JVRA 1HD1A 4WFBQ 4URQU 3TX0A 5HJYA 2R7WA 4LF4J 2Z2YB 2V2VA 3NGTA 1WC6A 2DJWA 4WXWA 3HXMA 4DSFA 4X65J 1A6LA 1NJZA 4CO2A 1SKRA 2DNRA 4DR6F 1NPRA 3H20A 3TJ8A 3LTOA 3CCWA 3PX6A 3SCKE 1R3NA 4PKDB 3IRXA 4LF5F 2L9WA 2JNJA 2AP6A 1QTMA 1FTRA 3VALA 2PMWA 1OO0B 4DDFA 2XY7A 4YR2A 2C22A 5J2NB 3ZO7A 2QC3A 4JI5J 3M30A 3W9IA 3PW2A 1QTNB 1X4EA 4G1QA 5KG0A 3MCSA 2CQ1A 2GS8A 1X60A 4WCEQ 3NGUA 4NASA 2FTRA 4NLOA 1IKYA 2CPFA 1XEZA 3M2RA 2IAJB 2ZOGA 2E9TA 4HDHA 2A3JA 2B9YA 5D4OA 2YNFA 4XAKA 2F63A 3TQ1A 5EX3A 5HL7Q 4M5GA 2DGWA 1MROA 2HVDA 2BOPA 2HHPA 1H98A 3N9UC 3MOZA 1Z2LA 1VC6A 2EBEA 4LR7A 1U1NA 1WC3A 1TKTB 2CQDA 1TUWA 5KFKA 5HATA 5LXRA 2X1FA 2J9DA 1NJIT 2HHTA 1UEUA 4QWCA 1S79A 4P7VA 1TAUA 3GJQB 4E98A 2GHVC 4CLSA 1N0VC 1QAIA 2AGPA 3CCVS 5I3PA 3LW5C 4RPFA 2K7JA 2OLWA 2XTJP 4YB5A 2RDDA 2K3IA 2NXJA 3A4TA 3VVTA 4CT9A 1RT3A 1WF0A 3TI0A 4OX6A 3ETOA 1TVRA 1GH8A 3PTWA 3B4DA 1DLOB 1D09B 4PXBA 1WKJA 1RCXB 5ETPA 2AEFA 4N8NA 3DKDA 2FLNA 4NLPA 2RE1A 3K5NA 3W62A 2VG5A 4WYLA 2M9KA 3HHNB 3O3LA 2W4PA 1AFJA 3VQSA 1F9HA 1HW8A 4HVZA 2MQLA 2UVRA 2V63A 4IFYA 2IPOB 4OZ1A 2L08A 1CJVA 2V34A 4JI7F 4HT7A 2HS3A 3MR3A 2KG0A 5JUMA 4NXNJ 2ZC3A 1YX2A 5HAOA 1CJUA 2UUBJ 4Q2MA 4M5KA 1IKYB 1R6VA 4O4RA 2L9DA 3IWLA 2R7XA 2HWTA 4UY8T 5KFEA 2RRAA 4DV1J 4LSNA 2NZCA 2YNFB 4NI2B 3UCZP 1TMJA 4WZMA 2CQIA 1MROB 1KD1T 4FBTA 4LQ9A 3KLVA 3T9NA 1C0TA 4O3SA 3SI8A 4DFPA 2CPXA 3EGNA 2QA4S 3VR1A 3ILJA 4ED0A 2DCUB 3DDNA 2XMKA 2RUGA 5K8PA 5I4MA 1GXUA 4P10A 4PG8A 5KFCA 2GIFA 1T03A 3P3DA 2XS2A 3Q83A 4ZVHA 2A1BA 3QGPA 1U6ZA 3DGPB 3M6VA 5HMYA 1B7FA 2BJ1A 1RT3B 3R5GA 2GO8A 1M5SA 3CDEA 2R7VA 1TVRB 2MJUA 4DV3F 3K17A 1HWUA 4X4SA 2NS1B 1XNRJ 3PR4A 3HVRA 1S9EB 1VK8A 2UUWA 3HO1A 2W25A 2BANB 5F0UA 2MJNA 2B9WA 3FBEA 2HQ3A 2BE2B 1GNKA 2E44A 1F0XA 4LFCF 4USKA 4KT0C 3HSZA 3AAWB 1LOUA 2DPJA 1OY6A 3CJ5A 4FYDA 2ASLA 4RUCA 4NXMJ 2KO1A 3OHAA 2CZ4A 1CJVB 5C25A 3R7NB 3G96A 4GVBA 1NPPA 3MAQA 2R2SA 1SC3B 1U26A 4BBYA 4FVCA 1WKLA 1FVSA 1KKHA 1UZDA 3DLKA 1FWKA 3BN4A 4OHYA 4LSNB 5KT7A 1VR6A 2NLWA 2ZZNA 1C4CA 2LQ9A 1C2PA 2VFVA 2HLTA 3M8SA 8AT1B 3J7YU 4B3OA 4DWIA 4ZKAA 4OHWA 2H65B 3M32A 5KT6A 2KT3A 2EG2A 2HVZA 1KQGB 3RB6A 1GFWB 5HSPA 4MKBA 4PYAA 2VPWB 2MQNA 4B3TF 1S0VA 1S72S 3FCHA 4H4KC 3WZ0A 1Y0HA 1WACA 2MQPA 3FBCA 2C3OA 3MGJA 1TK0A 3TAMA 1JJ2R 2YNHA 4NMXA 3PJXA 5A76A 2M0GB 4DG1A 3FVYA 2ZVSA 3BGLA 1S57A 3R7BB 4WFZA 4IG0B 1YKWA 5MLCV 5F8JA 2CJYB 2B4UA 5L8RC 1T9YA 5D8HB 4DL2A 3TA2A 3TVKA 2DGUA 3HHEA 5BYSA 1FJ7A 2MPUA 3Q24A 2ZH3A 2BRKA 3TAPA 4KBIA 4A48A 1VISA 1VQPS 5C25B 1R8BA 2XWXA 3KG1A 4QIEA 2BEFA 3PV8A 4Y2KA 2RDJA 1L5UA 3D4JA 3CO9A 5IT4A 2IM3A 5L1IA 5D6GA 1K0TA 4OLOA 2HQFA 3DLKB 1EJ7L 4UUXA 1RKJA 3OL6A 1UPMB 3E3XA 5L38A 4Q2LA 1ZBTA 1N32J 3CCRS 1SC1B 2PEHA 1U4BA 3TNVA 2N7CA 1FKOA 4B3OB 3W5YA 2AMCB 3VAMA 3QQCD 1T05A 4ZHRA 3M32B 2CPYA 4DN9A 5HK4A 1XBWA 2MSTA 3QMQA 4EMDA 2G2OA 2FVSA 4JI4J 4YOEA 3RRKA 3VGVA 3OR2B 4DR5J 3D67A 2DPIA 3GZ7A 4P2XA 1HLWA 3V6JA 3P96A 1VQNS 4J7CA 4ZVSB 4ERDA 3GJRB 1Y00A 5KT5A 3WIUA 3BYPA 3TAMB 1UEVA 1ULRA 3HMJG 4ATNA 3HD1A 2YNHB 1ZA2B 1Q95G 4U8YA 2D41A 2KM8C 4L74A 4U7CA 3OVBA 1YJNS 4N41A 2W2OP 1U24A 2PT0A 4H54A 4ILLA 3AXMA 2X1AA 3R8YA 4JYAF 3AJDA 1P6TA 1VQ9S 3JQKA 1ZETA 2IA0A 3SEOA 2OPRA 5KG4A 4Y2IA 4TQSA 3A13A 1WI8A 5DLGA 4LF8F 4PEOA 4MK9A 4QWEA 2VA2A 5IZHA 1U2FA 4UTGA 4B3SJ 5FJ4A 1DQ8A 2IJRA 1FJGF 4N76A 4CLUA 3ZZPA 5B09A 4CT8A 3QATA 1RISA 5I42A 2FGCA 1CVJA 4ZP8A 3EGVA 3IS9A 3PM9A 3NMAA 2W8LA 4QU7A 1C0UB 4U95A 2I1RA 3OL9A 3RB3A 1RAAB 1KOOA 1XMOJ 4NLRA 2RS8A 3BKUA 4TY9A 4JI2J 4ZHRB 1UW4A 1K9MT 4QW8A 2YPYA 4M1KA 3MR2A 4DPXA 1IBMJ 2CNOB 1Y4ZB 3B6BA 2HPUA 3GB0A 3PW5A 5EN1A 3BBFA 4QR2A 4WFXA 1URRA 2MB0B 1UAWA 2E9RX 1I1GA 1WSRA 2VZ9A 2ZKTA 3C3LA 4NA1A 2VH7A 3LQVA 4KY3A 1RWPB 4ANDA 5CZVA 3Q2TC 2OTLS 6AT1B 2XI2A 4KAIA 4K4WA 2HSEB 3KTQA 2BW2A 4X4OA 4HR2A 3D5MA 1NK9A 1WUUA 2D74B 4OI0A 1KHWA 2KXNB 1YWXA 3EZ5A 1Q79A 4MTPA 2KVQE 4DV4J 3W61A 1CC8A 1TQLA 3RW6A 1YHQS 2CUYA 2FHMA 4NEYA 4NLTA 1HR0J 5I42B 1CQNA 3IS9B 2Q1LA 2J7KA 2AHOB 3WC2A 2P6SA 3SFUA 1MMNA 1Z2ZA 4C4WA 6FDRA 3MM9B 1IJEB 2QYGA 3GWCA 3OJUA 3W60A 5A2QU 2HS4A 5J2MB 3FCWA 2HIQA 2ZHBA 1E6YA 4RW6A 1IM6A 4K4SA 3PXGa 3PX0A 5B0GA 1R0AB 3F44A 4LVOP 1OQ6A 1RADB 4OI4A 3UNYA 1GMWA 1ZAXA 1U25A 4ZVFA 4JI3F 1UVMA 5ETNA 4I67A 3MR5A 3W5ZA 1D3WA 3OL8A 2BQ3A 3QGGA 3WDOA 2IMWP 2VFSA 3Q22A 1SKWA 1B0PA 2A6OA 5LT5A 2R8KA 2DR7A 2BKNA 3RZAA 2MHNA 1RTZA 1U02A 2ZBRA 4RKUC 2W7OA 3HX9A 4P2FA 1H3DA 2EG1A 2NCKL 3MF5A 1R0BG 2CPIA 4J9MA 3O44A 1U49A 3KK1A 4B9SA 2OGUA 2UUAF 2QX0A 3H5SA 3RBZA 2IIHA 1X4GA 2XZDB 1RTDB 1NJWA 1NKEA 3GYGA 1OY9A 3WC0A 2C2OB 2VBWA 1NU4A 4IOAQ 3UD3P 3SCJE 5L1LA 3A8IA 1RXOB 4M5LA 2M88A 3LGMA 1ACMB 3OFEA 2FLPA 1NDPA 4FF4A 1R31A 1AUSL 4IO1A 2W2MP 3QBCA 2J7WA 4X4TA 2QLWA 4DPUA 4OI6A 5DS7A 2VQEF 4J37A 1VJWA 2EKYA 5DQIA 2RF2A 3QSIA 4MK8A 3OBIA 2ZBIA 4ZPWR 4ZVUB 1E6YB 3CCQS 4DL5A 1JB0C 1DRZA 4YP3A 3M9OB 4YQWA 2HAIA 2MZ1A 2EFVA 1VMBA 2EBGA 3NG8A 4DQSA 3OR1B 4OYBA 2AD9A 2BW7A 2DNKA 1X4AA 4M5IA 4WP8A 2EFQA 3T41A 5KFDA 2QA4G 4PPZA 1RBAA 3I56S 3PO4A 3HKZD 4ELTA 1FK9B 4RLEA 4P72A 3FRYA 3EM1A 1QD1A 1UWBA 4Y6IA 3GV8B 4F67A 1U1OA 3DMJA 2I6WA 3J7YI 1WC1A 1JJ4A 2Z2MA 2VPYB 1T0TV 3KK1B 1Q8IA 2XWYA 3FQKA 3H40A 2FY1A 5DM7Q 3NNHA 3C6UA 2P9GA 5BYQA 3T1HF 1IKWA 4NLUA 4EUVA 3Q89A 2ZWOA 3OLBA 4G1IA 3C46A 2IBOA 2BYCA 3UW1A 2OP5A 2LQ5A 3H4BA 2YQ3A 1IQTA 3ELHA 1NPKA 3KMSA 2ZVIA 3QT8A 1TU0B 4I56A 2UXBJ 4JI7J 4G1PA 3BR8A 1A7GE 1U1QA 4KPYA 2Y3YA 2R8JA 2HFSA 4EO6A 4CM0A 5HQ8A 2FJBB 4NLVA 2UP1A 4WZQA 1L3SA 1KRPA 1UMJA 4CO4A 3NY0A 5ETQA 3LWMA 4J9SA 1UPPA 2RF2B 1TL3A 2W9CA 1RT2A 4Q44A 3FZBA 2GV1A 4ZLNA 3HCXA 3TWZA 2OSRA 1S10A 4A4JA 1K44A 4A8OA 2R2RA 4HH0A 2WBRA 1TUGB 1Y11A 3PKMA 2ZNYA 3J7ZT 1X9SA 4YHHF 4ICLA 3DU5A 3P5TL 4M5NA 3DRXA 2ZC4A 5ETOA 2AYMA 4DFMA 3AOCA 1YBTA 5DLFA 5LMUJ 1RT7A 3D0GE 1UWBB 2ZNZA 4CNYA 2XYGB 3DMJB 2EI5A 1A9NB 3BSNA 3JTOA 1NDCA 2AJQA 2LQJA 1DARA 3CPWR 4DV3J 3WIVA 5GAHI 4IQMA 2ASYA 3IMQJ 3C6UB 5D15A 1IKWB 1D0EA 1FRXA 2KRBA 4DCPB 3I32A 2MTLA 4U67Q 4ZPCA 5DGAA 3M05A 2P9CA 4M5JA 4LFCJ 2HQCA 1EQMA 4ED3A 3Q8QB 4OZ3A 2CXEA 4LF6F 1P9QC 3HKWA 3MPYA 4XTTA 3GFZA 2GHWA 1VFJA 1D1UA 2ZE2A 1HI0P 5JJBA 3NGSA 3OT9A 1FNOA 4EBEA 1RT1A 4Z37A 2AGQA 2E7XA 1VOMA 2VG7B 5CXTA 4QIWD 2QV6A 2HHHF 3DRRA 1TL3B 1RT2B 4YFUA 3T19A 2RU9A 2N7YA 3M9NB 4C7QA 4FYVB 1SIZA 4WE1A 3JAMU 3DHWC 1CJKA 4ICLB 4XK8C 4PABA 2KFYA 1LV5A 3ENAA 4ZVOB 1XR6A 4B3TJ 1UZHA 1QE1B 5B0EA 2ZD1A 1RT7B 5HMZA 1VGYA 4DR4J 3GE9A 1G1XA 3UN3A 1H2UX 2W9BB 3DDKA 3V4MA 1OS5A 3AFGA 1S9GB 1RI7A 1HQUA 3PIOQ 2OPQB 1HWIA 3D6HB 1DTTA 3CJ4A 4OLPA 1F3FA 3M7VA 4K4YA 3TZXA 2JJ4D 1F9FA 3R6LB 4DV6F 1LFPA 1T8EA 3HI9A 1KLNA 2ZUAA 5HVFA 1UFKA 4FS2A 3JTPA 1DJ0A 3QZ7A 4D3GA 5CYQB 1Q7LB 3NRBA 4CLZA 1KSPA 4DZDA 5HVHA 3I4PA 3C14B 3GR1A 3SBMA 1RLCL 3GFXA 2ZE2B 1ZTWA 3PHTA 1RU1A 5KFWA 4A47A 4DF8A 4B9MA 2KI2A 4DR3F 1UKUA 3HHLC 2YX7A 1TELA 5B0FA 1NJXA 4CWBA 3G8SA 2DY1A 4E0DA 2XMJA 2KG1A 4LBPA 3NGKA 3SDEB 4MMOA 1HYSB 4J9PA 3CDAA 1SL0A 4DR7F 2RILA 4RNHA 4WE1B 4PPDA 4DUYF 4PWWA 3KLFB 1LW2A 1NSKL 4KH1B 3KKFA 4A8WA 3DGVA 2DIVA 4OHZA 3SV4A 3SQGA 4MKYA 1IBLF 4KFBA 5ETLA 2IVYA 2ZD1B 4IH7A 1CJTA 1OPIA 1IXKA 4PXDA 3DLEA 4FKYA 2VFUA 3EUNA 3OXFA 1YQHA 2QEXS 4ZVPB 1S1WA 1HQUB 1IBCB 1JLCB 2HZVA 1WELA 4OYAA 3EDQB 3SYZA 1O8BA 3ZTQA 4JYAJ 2E66A 3SSQA 3MURP 2JC0A 3I0SA 2ZHAA 4GKJF 3NAIA 2O3DA 3TVZA 1CSJA 2E5LF 1JLAB 2NXEA 4ZA1A 3NAHA 1S0NA 1FD2A 3PRVA 3D7SB 3KFWX 3SSRA 1ZOTA 4WJBA 2G0IA 1D8ZA 2K1RA 1WJ9A 2DNQA 4PG4A 3U27A 4GKKF 4H4KA 4RBUA 1FJGJ 1SUQA 3D1HA 3UO0A 5KFXA 2LDYA 3TEHB 3I55S 2PIIA 3KJVB 2B4PA 1WTBA 3IBCB 4DQRA 1N0UA 4LFAF 3D9BA 1N5YA 2ZEJA 2MDAA 4OI3A 4OYOA 4F0MA 1AZSA 2HLUA 3PFEA 5ITHA 1KP6A 1QY7A 2LDIA 1B99A 2JC1A 1ICEB 4QYRA 2QRRA 4P74A 2Q79A 3AJ1A 4PZVA 3NGRA 3H98A 2HQIA 1YG0A 1U1MA 2PC6A 3W64A 5HQMA 4KFBB 2Q6BA 1VBYA 2AYGA 2DKOB 2VDHA 4ECYA 1CJTB 2GFFA 4J9VA 2C42A 2NPIA 3DLEB 4K0KF 2R9LA 5M2UA 4RUBA 3IA0A 3IBFB 2C3UA 3EVOA 1N5SA 3V81A 2J0XA 4DX8H 5H1SV 1IBKF 2VG6A 3G71S 3VGTA 4UZBA 3I0SB 3L95X 4KIAA 3DLGA 3KLEA 2QFIA 3LH2S 5L1JA 3MEEA 3M8WA 3GTYX 1M1HA 2HHXA 1OPZA 1OYDA 1GQEA 4DCOB 4OJHA 3IXQA 4QWDA 5D0GA 3ISND 3MOJB 3FSXA 2K1RB 1RUSA 5AXKA 4JV5J 2DNZA 3IGVA 3Q8SB 2IJNA 2JEFA 2J8AA 1SUQB 1X4DA 2UXCF 2CQGA 3QJPA 3KDNA 5EHHA 2HFZA 2E5JA 1R43A 1LWEA 3LAKA 1N5YB 4OL8A 1FT8A 3JSRA 4DS5A 1M1KT 3CJKB 3MTKA 2W7AA 2KB2A 3LA0A 3ZNUA 2F4FA 2RRBA 4C8LA 4F4KA 1NZAA 2CQHA 2LEAA 4CNZA 2M8HA 3MM5A 3UNGC 4HTIA 1PG5B 3UD4P 2ZBCA 1HNXF 5FLXU 2WVBA 2YKNA 4JI3J 5C42B 2Z57B 3P8BB 3MMCA 2CQ2A 4I1TA 1HW9A 1D9DA 2B7CB 5A6WA 1AB8A 2Z4PA 3I9V9 1VQ7S 3CCES 1HHQA 5KFLA 5KFQA 4ECSA 1FA0A 4RW9A 3QWUA 4TN2A 2WHOA 2C2ZB 2XC9A 2VG6B 3QIPA 2YX4A 2UUAJ 3ZTRA 5CCMA 2DNHA 3DLGB 3KLEB 4ES1A 3PACA 1IR0A 4CH7A 4QOTA 4HH1A 2OEMA 3MEEB 3E51A 1P1LA 1FJEB 2Y1JA 1NB2A 3KK3A 2MZQA 3OTOJ 2YX1A 3B4MA 3UDCA 2FYXA 2YY3A 2VU5A 3G8QA 4EZ9A 3DXBA 3OSPA 3ILLA 3PRBA 3BSCA 2U1AA 4AUKA 3GYXB 3VQTA 1LWEB 2MQQA 3GILA 1Q1KA 3UCUP 2HURA 5CH7B 3CDUA 3CJQA 3VAKA 2LCWA 1PCAA 3HK2A 1JMTA 3L9ZA 4YR0A 1VBXA 2DISA 2BBEA 2BJ9A 4TLQA 1T7PA 4Q8EA 3FK4A 3MPVA 3M4XA 4P2MA 3MM5B 2OI2A 2OO4A 2QSFA 3CCMS 1IWAA 2DRBA 3HVAA 4WKRA 2YKAA 3MMCB 3R97A 2W2QP 2G2ZA 4KHPF 5E2QA 2F8HA 1WHYA 4LMZA 3P5BP 4EK2A 4GVLA 1ITPA 2V8VA 5A2QY 1ZTTA 1RU2A 3B54A 3Q8VA 1WWHA 3FCVA 4J90A 1OSDA 3DHXA 4NRUA 5KFTA 4X65F 4MKAA 2M5YA 4X64F 3B78A 3T1HJ 4R25A 5BYRA 4FF1A 4LVNP 2HHQA 3A8EA 2XSFA 4ZP9A 3I5BA 3R2DJ 1X5PA 5HI7A 4C11B 1X0FA 3K59A 2B51A 3QZ8A 5H9EJ 4LRCA 1GX6A 3CC4S 4JI6J 4JI5F 3TUZC 1BMQB 3H8YA 5BJRA 1S4EA 1T9WA 4KGXB 1UVLA 3BF4A 4KTQA 4CH1A 2M2BA 4RW7A 5ADZA 1VRQC 1B70B 1RWNB 2NXUA 4DEZA 3PHEA 4HL9A 4HDGA 2AU0A 1ZH5A 5T41A 4ZOSA 2GJIA 2CYYA 2ROGA 1H7WA 1H74A 3UPFA 4CZCA 3K8VA 4USJC 2D9OA 4RO0A 2LYVA 3RU0A 1RKIA 2JEJA 4K50A 1K8AT 4NA2A 1YJWS 3GIJA 3THTA 1RT5A 1BWVA 3SXLA 2MGZA 4LRFA 3KHHA 1NHVA 1O6XA 4DX5A 4OZLA 1HWKA 5KG5A 5D3GB 2UVWA 5JVGQ 3K5MA 4P73A 3EPGA 4NYPA 3NNCA 1FDAA 4L3KA 1CLFA 1XK8A 2GCFA 3UWTA 4FBUA 2C3PA 4WFYA 3LWLA 4DV0J 1GK8A 1SL1A 4OYXA 2MQOA 2ZZTA 4FP9A 4LF6J 1IKXA 3GG1A 3CDBA 3OFFA 1YGYA 3EXYA 1QAJA 1C1BA 4Q7AA 4B17A 3Q2SC 4PAAA 3I9ZA 3R5CA 1X4HA 3VHQA 2CJ9A 5M2PA 4NXNF 1MU2B 2VC0A 2K8GA 2VFTA 2D7SA 3QT7A 3MMAA 1SQEA 4OZNA 4TNOA 2HK3A 4C8OA 1EARA 3V4IA 2XY6A 3Q86A 1S76D 4DV1F 4C3LA 2HRTA 1Y3JA 3OXGA 1S6QA 4PYDA 1LKZA 2ZOMA 2ZBQA 4UOGA 1PBAA 1F6TA 1RTHA 2K3KA 1NO8A 2GGPB 4IYQA 5THWA 2WB1D 1SJ3P 4XDCA 1VHFA 5AT1B 1RT5B 2HQGA 3ZZRA 2WCXA 3CE8A 1YRTA 3R3TA 1XR7A 3M8YA 4NWBA 3BQ2A 2HG4A 1F5CA 1I51B 4PQUA 1AROP 3EE3A 2Z2ZA 2YKMB 3HLUA 3T5LA 4FXDA 4GO5X 2ZJQQ 1HMVA 1JIHA 2XMVA 3NMRA 2XO6A 1XNRF 4N8OA 4KHRA 3I5AA 5E5NA 2N3OA 4A46A 2XULA 3SZ2A 4LRDA 1SI9A 4DHVA 1ZZNA 4ED6A 3GG0A 3VWSA 4DV6J 1KTVA 3MM6B 2LXFA 1VQYA 3M8QA 1KBRA 3QPIA 3HFVA 2BRLA 4E2FB 4OI2A 3DM2B 3VAFA 1N48A 1FRLA 2W8KA 4NXMF 2N3LA 2YNGA 2ALZA 2PI4A 2HNYA 2E1AA 3KDOA 2L48A 2PMHA 2VJUA 4DR3J 3DRSB 2NPFA 2OPPA 5LMNJ 3MMAB 2QL7B 3I5CA 1VQKS 1RT6A 1KVIA 2I38A 5KG2A 1WHWA 2HNDB 3V4IB 2KYXA 1X4FA 1FDDA 2QE5A 1JXLA 3T6BA 3W5XA 2O1PA 1ZA1B 1S6QB 1S0MA 5F8LA 1Y7PA 2RKIA 4P52A 3W2VA 2CNKB 4A8QA 1RTHB 4DUYJ 4EU0A 3G6XA 5IXUA 4MAKA 2GW8A 4KGMA 3MM7A 4R5PA 3H2UB 3J81U 3NEKA 3IG1B 2CVEA 3OFGA 2VKZG 3C6TB 1WI6A 4J9LA 2ALYB 4PG7A 2OMOA 4J9UE 3MI7X 4A8SA 5AE3A 1QLNA 1CBKA 4PQUB 4RZRA 2H5EA 4ETXA 3A8KA 4A8MP 4NLDA 4HI1A 4WWSA 4R8UA 1NDLA 1HMVB 2XLJA 1SH3A 4A8YA 2DIUA 5A8RA 4OX9F 5HMXA 3FSIA 1ZAWA 1HNVB 1ZM4A 4KKOB 4PWDA 1YITS 3ENVA 4GKJJ 4OQJA 4MFBA 2VHGA 1NMEB 4ED7A 2E5LJ 2L41A 3F0NA 2O66A 3CC2S 1SJQA 3OFHA 2GMHA 3IFEA 1VQ5S 3BQ0A 3T5JA 5F9NA 2RQMA 2PDAA 4GKKJ 4IG3A 2Q3PA 2YNGB 2CQ3A 1XERA 1R8HA 1HKAA 1N54B 2CPZA 2DR5A 2HNYB 1TP7A 1NZ8A 3HZGA 5GAEU 3L7OA 2ZH1A 2D3UA 2D9PA 2OPPB 2HFUA 2NXNA 5AXLA 3IWXA 3FJ2A 2BM0A 1YZ7A 1U1PA 2KZZA 2ZM6F 1R89A 1VYAA 3TOQA 2ZJPQ 2CDQA 3PW7A 1HBOA 2C3MA 1NCLA 3W2VB 2RHQB 4L73A 5IV3A 4WU2A 2H9ZA 3TEGA 2FVCA 3MFHA 1URNA 4CYUA 3MM7B 4R5PB 5I3UA 2ZJRQ 1D9FA 2COLA 2DNNA 2QLFB 2MHEA 4JI4F 3MMJA 3MECB 2XSJB 4DR5F 2XGPA 1F2GA 3B82A 4P6QA 1RDRA 1AUDA 2FIUA 3NS6A 4K0KJ 4ZLJA 1S6PB 4NCBA 3HHLA 2DY9A 4C48A 1NK0A 1FVQA 2Z0GA 2HQDA 4R8UB 4QIFA 4PWDB 2BJ3A 3TZWA 4MFBB 4USVA 5F8HA 2Y0BB 2LXUA 2PI5A 3B8HA 1Q5VA 5HBMA 4DV7F 1MMLA 2PSZA 2HHSA 3KG4A 4W92B 4IG3B 3R5AA 3N0VA 4B3SF 5B0CA 2O5DA 2YWEA 2UXCJ 3CC7S 3I6PA 1FDNA 4S0MA 4ID5B 3BQ1A 4WTYA 1S49A 3TUPA 1U8SA 1ZAVA 1HNIA 2QZ8A 3DFEA 1BGXT 2ZHOA 4DBQA 1PYTA 1U47A 1UFWA 2QMXA 2V50A 4UF4A 2VKRA 1KFSA 5F8NA 3R5BA 2DGQA 4MJKA 3HFKA 3TZYA 4QIGA 3MCMA 3O6QA 2ILZA 2ZH7A 4CYUB 5CD4H 5I3UB 1N4LA 1HNWF 1HNXJ 4HACA 3F56A 5IWAF 4PG6A 4YUDA 3QNWB 3GIRA 4MIBA 2MZTA 3K7RA 2YBVA 4FVMA 1JLEB 2J0WA 2E7WA 5JXSA 5HANA 2DNYA 2POKA 4I7FA 3ULHA 5HO4A 4J9QA 3HVTA 3RG6A 2QA1A 1SC6A 2GAGC 2BE7D 3NWGA 1FJCA 1B7YB 1EZZB 4RBVA 1YBUA 4ECRA 1F9EB 3EVMA 4KO0A 4YEAA 3NWRA 1NSQA 3BH6B 2M52A 2V4QA 2AV5A 1WC5A 2DHHA 3AY0A 5HBMB 2EFPA 4AXJA 4Y65A 2VODA 3CJ3A 2ZH2A 1QAXA 2FZKB 2QLJB 2HVIA 1PAEX 1SPBP 4UT4A 1X4CA 1I3OB 2NREA 3H5XA 3GIKA 2PA8D 4I2QB 4U96A 1HR0F 3K5OA 4FYWB 1L3VA 1PO6A 2RNEA 2LA6A 4ZK7M 2DGTA 2IAJA 2ILYA 3BV8A 2GC8A 2CJAA 2V68A 2X3GA 2YKOA 4NE9C 4RNOA 3AODA 2VONA 3RUBL 1LEOA 1TKTA 3M9MB 2X51A 4QYZK 4KHPJ 2LFVA 2KXHA 4I7FB 3V6KA 4OYZA 5DRKA 3HVTB 4CRJA 9RUBA 4OX7A 2HGMA 3CD0A 4M8LA 1S0OA 2KRRA 1HA1A 1O5JA 2HIYA 3IAM9 1MWYA 5IQQA 3MR6A 5JMNA 2ATCB 4H4OB 4LR8A 2FY8A 2R4FA 3G87A 3CWJA 4CM2A 4X64J 2EPIA 2CJKA 3HJVA 3PX4A 3Q23A 2EC2A 1RAHB 4AL5A 2YPZA 2JLFA 2RIJA 1QVGR 1I5OB 4KO0B 2DVIA 1N52B 2DR9A 2DB1A 5FLXY 1DLOA 4AYBD 3HT3A 5HN0A 2G1HA 4V1Ak 2I0XA 2IDEA 4LIWA 4HHUA 5DQGA 4OV1A 2DYAA 3FZ2A 2H3EB 3CDWA 2GVZA 4FYYB 1FI4A 2BVZA 1TK8A 2W2PP 2F4VF 3MTJA 4C8MA 2AX0A 4WIIA 2AZ3A 1FESA 9ATCB 1RA7A 5DDRC 3TVYA 2C2KB 2DH9A 8ATCB 4DF4A 3K2YA 1FXRA 4DQPA 3DYAA 1RAFB 2ZH8A 1B3TA 2HNZA 2L9NA 3BGRB 2FHOB 2P5VA 3VAGA 5HLFA 5A8WB 4I69A 4F4YA 3EICA 4NI2A 2ZITA 3W3SA 4CTAA 4X66F 3U1NA 3BKFA 2FJXA 4ZVTB 3RYLA 4IR1A 4QQBA 4EZ6A 2E5IA 2RJZA 1N8RT 2DNGA 1SH0A 1VK3A 5J1EB 3TUJC 4TY8A 4ER8A 3WHIA 4ZJQA 1DFDA 2YWWA 1W2BR 2HFOA 4OZ0A 2LQ8A 3BN7A 4EEYA 5J2PA 3FEZA 2BXJA 4KSEB 1KLMA 4M63A 2MLYA 1UJ4A 5D77A 3GU0A 4JI1F 1KHVA 4RWWA 1NBEB 2VA3A 3D0HE 4ZCLA 1SKSA 2RB7A 2CVIA 1NK5A 3DGPA 2XMAA 4UW2A 4X4QA 1W26A 2RQKA 1S9EA 3A1YG 2BANA 2P8IA 3ZC4A 2J0SD 2BE2A 3PFOA 2LKZA 2DK2A 1LXNA 2GVZB 2LP4A 1BQMA 3HZEA 3J80U 3KLGA 3PW4A 2B7BB 4ECUA 1BWEA 4B9UA 2K06A 1SQFA 4B08A 2UXBF 2ZH6A 3W65A 4LR9A 8RUCA 3GQCA 4ZPAA 3DYAB 1EIYB 2HZAA 2HNZB 2FJEB 4IO9Q 1PAUB 1S1XA 2CQBA 4ZPTR 1VQLS 5HLFB 3BYRA 4DSKA 1U48A 2MKJA 4O3PA 2WBMA 4CTAB 3BM7A 5H9FJ 1FO1A 2CIMA 3QGHA 4ED4A 5GAEI 2WSFC 4TY8B 2V4RA 2XM3A 1NLKL 3WQPA 3ET6A 2J6SA 3V6HA 4OYWA 5B0DA 4QPXA 3S01A 2FGOA 5J2PB 1Q86T 3DOMA 4DR1F 1MN9A 4ZITA 2HRYA 1YZ6A 1RB0A 4LRAA 1ZPVA 1KLMB 1RBLA 3T1AA 2V2ZA 5LMUF 3FNNA 2LXIA 3BB5A 1U6FA 2LU2A 4LFBF 1VIXA 1JJHA 3FFIA 3VF0B 3CO0P 4F02A 1SH2A 3BEGB 2HWIA 2MZJA 2B56A 3L7UA 1N5TA 2WVCA 3CCZA 1VS3A 4ANEA 4IG0A 4YDDB 2YXLA 5D0EA 5KFFA 4I0WA 1NM2A 4B9LA 1BQMB 4CLYA 2R2UA 1FEEA 4ES2A 3KLGB 3RBXA 4I4BA 1WTFA 1RWXB 4V19J 3IR5B 1HBMB 3D54A 2BUNA 3CD5A 2F8EX 3GJTB 5IT0A 2VQFJ 2HMIA 3IP0A 1K1SA 2M8DB 1S1XB 3MAHA 2AQ4A 5F8GA 2ZH5A 1PJ5A 3FUYA 4Q45A 2LQBA 4KE5A 4C98A 2OEKA 2J6UA 1EQ0A 3CJRA 3RR8A 3UN2A 3EX7B 4CH0S 2XQCA 2GIQA 3LP0B 5HJXA 1XMQF 1DTQA 4OJ1A 1RHRB 1QDUB 3M8ZA 5E0OA 1T94A 3ET6B 1C4AA 2A10A 5DM6Q 4Z7YA 3AD7C 4GRSA 3HM9A 3DOMB 3OR2A 1MN7A 6FD1A 4IFVA 1AW0A 3DRPA 1Q4RA 4DR4F 1RHJB 2HGLA 3NBPB 4IOBA 4CDIA 1NSPA 2H5IB 1XTZA 3FFIB 5L9XA 3DN9A 2FVPA 4OX9J 1KVKA 4NCAA 5MAOA 1U2RA 2Z2LA 3UDLA 4F2RA 4LBIA 2DXEA 3BGOP 5HP1B 7AT1B 2XMUA 2RQ4A 2ERRA 4RBTA 3G2XA 2W24A 4V19X 5KFSA 2QLXA 4FN5A 4KYZA 5KFMA 5G0RB 5FD1A 4F7VA 2E1PA 2IJFA 1RYRA 3GFHA 2V8PA 2XZWA 3CCUS 1VC5A 1C1CA 1FRIA 2V9WA 1RAIB 4RU2A 2HMIB 4MK7A 3RAXA 4UQTA 2W7PA 3DU6A 1NK6A 2ASJA 3Q8UA 4B3MJ 2HGNA 4WPAA 2OELA 2YNIA 2ZM6J 3AB4B 5FDLA 1C0UA 4FXVA 1H72C 4ZJLA 4JOUA 1UFLA 2PFFB 1OIAA 1XIQA 4IH6A 3IGNA 3RW7A 4M5DA 4QR0A 1H2TZ 3TUIC 1DTQB 4F4WA 1YDLA 3PVXA 2GVDA 1BD6A 3TARA 1BQNA 5IT9Y 3X3UA 4ECTA 4RNMA 2GQ2A 3A3NB 2JHEA 1WC4A 4DPYA 4IFVB 3DRPB 4O3QA 3RAMA 1V3ZA 1KN6A 1RP5A 3AH6A 3GSDA 1VRTA 4OYPA 1UWAA 1HHSA 2C28A 4DMZA 3ZTPA 3J81Y 2G4BA 3N6LA 2F7VA 3ENWA 2D69A 3OV7A 2IMOA 2FHJA 1R0CB 1GMWD 4P9SA 4QWAA 2FHKA 2GX8A 4OJ3A 3R1HA 4DV7J 3HPOA 1ELOA 2ATLA 2OIHA 1LK7A 1C1CB 1JQGA 4F25A 3M6WA 3C19A 4B3RF 4K4TA 2QJ3A 1WC0A 2DD8S 3BKTA 2DITA 4C0HA 1H73A 2C2RA 3LF0A 1Y10A 3EMTA 4CLPA 1SJ1A 5KT4A 2YNIB 4Y2AA 5K8NA 2HRUA 5FDLB 3J7A1 1REGX 3FC9A 2VL1A 1WOSA 5KOWA 5KFHA 4M5DB 3RR7A 3MM9A 2P6TA 2OPSA 4WK3A 2F1FA 5J2MA 5HQLA 1HNWJ 1KTQA 4YDXA 1QJHA 5IWAJ 1L3TA 1LQ9A 3PR5B 3MUVP 1R0AA 4DUTA 3FMBA 2GVDB 2JEIA 2ADCA 1BQNB 2ZZMA 3PYEA 3K5LA 1I94J 1IKVB 4K5SA 4TVAB 4X84A 2DO4A 2CWXA 2JH3A 1VRTB 3SSSA 1RGVA 3ILOA 1M5HA 1MW7A 1DHMA 4ZN1A 1S1VB 1BC6A 4IOCQ 3D2WA 3M1VA 4NLGA 1QUVA 2J5AA 3VGSA 3OTEA 5EDWA 5H9EK 5C7PA 1VQSA 1VC0A 1PBUA 4Y3CA 4NL5A 1RTDA 2JOQA 3I96A 4EBDA 1EB0A 3HJFA 5K8MA 1WF1A 3D66A 1X31C 1RJJA 4K2XA 4I2PA 2MYFA 1KNZA 3HSGA 1FE4A 3NS7B 4EI2A 4JV5F 1B0TA 5KFPA 2VF3A 4OFZA 3PYGA 1JX4A 1MLAA 3MEGA 5EWFA 3VAHA 2RRNA 1HNZF 3H90A 3T6JA 3JSMB 1VQMS 4WU3A 3WX8A 3MEDA 1N36F 4C3MA 2YH1A 5D4PA 1UJ6A 5J2QA 4ZDNA 2J9CA 2HAFA 2AWZA 2ZFHA 2NUHA 1D8YA 4NX9A 4C0BA 2OPSB 4O0NA 2OMLA 1FKPB 2WRMA 4CLWA 1VI7A 3O5TB 2DNLA 3OXLA 4K4VA 2WW4A 2XS7A 2CFXA 3OR1A 2H51B 3I4HX 1SJFA 1T3OA 2MKCA 5CABA 1TV6A 1FK9A 3DRYA 4OI1A 3GIMA 1VRUA 3TX8A 4M95A 4AT1B 4MH8A 3M1VB 2EW9A 4JB8B 1T9TA 2YKPA 4EYIB 1R8CA 4Z2XA 3PCOB 5KFBA 2YWHA 1T3NA 4FS1A 3E2EA 2MKSA 2WW8A 1IUJA 3RAQA 1Q8KA 3TJAA 3V2UC 5LXYA 1FNMA 2F4VJ 3OTOF 2XMWA 1UL3A 2CPEA 4FNHA 4I2PB 3KJNB 5J1PA 5FIIA 1KQFB 3P6YC 1KDNA 3PKYA 2GA7A 5A0YB 3MEGB 4J9RA 1S6OA 5U47A 4KQZA 2BJEA 2IYIA 5LM7E 1JLBB 1RWVB 3MEDB 1U0SA 3VGUA 5J2QB 1K1QA 1VIOA 2HHWA 2HBQB 4K59A 1B4SA 3IM9A 4N7TA 4UOHA 4X66J 3KLIA 1HI8A 4EFAC 1QM9A 3VTIA 2AYEA 3F41A 4O4GA 5IV4A 3CXCR 1WOOA 3MMBA 3DOKA 1CEZA 1OY8A 4TYAA 4ZVEA 2E9ZA 4EYHB 3OL7A 4DL3A 5ETTA 4AQYF 5AJ3J 3QO9A 4Y0FA 2WB4A 3BS9A 3JTNA 1I6JA 2DGVA 5AE1A 2V67A 2KH9A 4NYZA 1M5VC 2GJFA 1TV6B 1VRUB 4JI1J 3N6MA 2MXYA 1TL7A 3UD5A 1U1KA 1X0PA 4QU6A 4PCQA 2CZVC 5F3ZA 1N5VA 3PRDA 3KHLA 4OZ2A 4DX6A 2VJVA 5B08A 2VPZB 1JK9B 1Z4UA 1H38A 1U1LA 3LPYA 1NDKA 2AX1A 3CMQA 2EFNA 1QSYA 1FRMA 3U02A 4KHMA 3CJTA 3KYLA 3MHYA 2XI3A 3FRZA 1RWKB 1HBUB 1PGZA 5KT2A 1RAJA 1W25A 2MLZA 4JI6F 3DXSX 4AXIA 2NXCA 5IS2A 3UR3C 1DURA 2J76E 4ETZA 3RB0A 2B43A 2ZOFA 3PEHA 3U1MA 2N82B 5T14A 3RJMB 3HT0A 2ZWPA 3POTA 1M5OC 2Q6CA 4DU8A 2B4VA 2VG7A 4KR0B 1KQKA 2JZ5A 3OSNA 3DLLQ 3PG9A 1Q78A 3KLIB 5E3RA 3LGNA 1NKBA 4F2SA 2JLEA 1TKDA 4O4GB 1VDHA 1FE0A 1N56A 1RWWB 3MMBB 3DOKB 5DDPC 1M5KC 2R7RA 4NLYA 2KT2A 1PKUA 2UUTA 1FHTA 3QO9B 3D0IE 1Q16B 5LJ3Y 2V2QA 3FKBA 3R9LA 4DR1J 2E29A 2UXDF 3T3FA 1FXLA 4NOHA 3EPIA 2M3DA 1QE1A 1YIJS 1TL7B 4URGA 4QYZJ 4LFBJ 2W9BA 2JWNA 3MZIA 1TKXB 2CADA 2C3YA 2HFVA 3IAS9 1S9GA 2PFDA 5D4NA 5K14B 1NRKA 2OPQA 4ZS6A 3P4UB 3FEYB 2IHR1 1Y5LB 2PD1A 1HQ2A 4DV0F 4OHVA 3P45B 3PEJA 4NZ6A 4F4ZA 2BKOA 1S1UA 2F9JA 3UDEA 1YLXA 2VV5A 1LK5A 2QLBB 5CYQA 2V8GA 5DO2A 1KOHA 3FGVA 3KHGA 4FKXA 3C8YA 1X5SA 3C14A 4B02A 1WOPA 4X4UA 2X1BA 4WBFA 3POTB 2DR8A 2DNMA 2QL5B 1CG2A 3AB2B 4C0OC 1IWGA 1QAYA 5KFAA 3BREA 1XC9A 3J80Y 5DG8A 3IRXB 2AGOA 4XDDA 3SDEA 1PC5A 1HYSA 4O23A 1XMQJ 1RBOB 1P1TA 4L6V3 1K47A 5DDOC 1VLOA 4PXEA 2DT9A 4J91A 3S6EA 3IR7B 4I68A 2CNLB 3L09A 3S8SA 4HHJA 3KLFA 4EBCA 2F9DA 4TU9A 1GXTA 2DNOA 3NGDA 3M30B 2GZOA 4U7UK 3ETMA 4ZCMA 4JI0F 2YWFA 4MKVA 2W2NP 2GNKA 4DR2F 2R3VA 4G1QB 3CCSS 4GC6A 4J9OA 3TAQA 5F9LA 3CCLS 1V9OA 4HLBA 1S97A 3P49B 3PNIA 4R0JA 3M2RB 3T1YF 2PGCA 2XMMA 4KJIA 4M5MA 3RRHA 1RTIA 1RAGB 1JLCA 2BA9A 1U1RA 4ED5A 5C24A 4ENOA 5BR8F 1YJVA 2AF6A 1G3OA 4IRDA 1XMBA 2RT3A 3NCRA 4CI0B 3CD6S 1KS2A 4DUZF 1RHUB 3Q8RB 1WEZA 1JLAA 4UQGA 1S1UB 3KK2A 4K4XA 1DAXA 3ZZ0A 1H7XA 3R6GB 3W1YC 2RS2A 2UVUA 4HHHA 4CLTA 3RB4A 1LNQA 3KJVA 2V8HA 2EFOA 1HQEA 4RUHA 5LMNF 4ILMA 1YI2S 4JP8A 1O51A 1FRHA 1JLQA 1WF2A 3MFIA 3AXKA 4HKQA 2G2YA 2D3O1 3OQ2A 4F4AA 2IM1A 2LVWA 3JQMA 2OHDA 4F26A 2OH2A 2H4YB 5CYMA 2VG5B 1DQ9A 4AL7A 5F0WA 1TKZA 2HHUA 1K0VA 2IVFB 1HL6A 3MPUB 5GAGU 3ZZYA 1J5OA 3A3PB 2IRXA 4BWJA 3N79A 4IFYB 3R27A 1HWLA 5SZTA 1JJCB 2CQCA 2KT5A 1Q7YT 3UDVA 1CJUB 1G2EA 2CA9A 2FJVA 3AQOA 4N77A 3M2VA 3THVA 2JL9A 1F5BA 3KMQA 1RWUA 1KQSR 1RTIB 4RNFA 2OD6A 4F4XA 2QIFA 3M2UA 5C24B 2JX2A 1N5QA 2KDOA 2RMLA 4YN3B 1C0TB 3PY8A 1NSAA 1UJ5A 2OAUA 1APSA 1FEHA 3ZZZA 4GC7A 1OYEA 2E5HA 3KK2B 2LLZA 1R27B 3GFYA 1GTHA 4NZ0A 1T03B 4B3RJ 4R0EA 5IM0A 2H4WB 4J9NA 3VZHA 4G65A 1AT1B 5E3QA 1HQEB 3A3OB 3G4SS 3IM8A 4X4VA 5L46A 2B8QA 4WTOB 1SB6A 3R2CJ 4CP5A 1JLQB 2CKWA 2R8IA 3CJKA 3H5YA 3BGUA 1IN0A 3QRQA 2NYHA 1O0PA 1R7IA 3ZZTA 5E33A 5CYMB 4TLRA 5HVGA 3JSBA 2YH0A 2GHPA 1TKZB 1R8AA 3GR0A 3TANA 2JDJA 4QJVA 4QWBA 1J5OB 2WK4A 1M1GA 3FBFA 5C42A 1ZZFA 1FFWB 3FDSA 2IC3A 4GVBB 2IRUA 2C2DA 1X9WA 3M2VB 1FXDA
chains in the Genus database with same CATH topology
4IH5A 1UP1A 3VZIA 1X5TA 2G9OA 2X3GA 2YKOA 3OVSA 4XPCA 2AJ1A 4K5RA 3KMSA 4YMEA 4RNOA 1XWLA 1S4FA 3M2UB 3QJJA 3PW0A 3G8TA 3E01A 4I56A 1Y5IB 2VONA 3DNCA 3MM8B 4WXOA 4G1PA 3BR8A 1A7GE 2CQ4A 1TKTA 4C9DA 1FRJA 3M9MB 1U1QA 4KPYA 2E1MC 4M94A 4U9RA 1LWFB 2X51A 1RQ0A 1UA0A 1R8PA 4DSEA 2NQPA 4I6WA 2MY8A 3FSYA 2R8JA 4EO6A 5GAHU 2CJBA 4NPOA 2KXHA 3K0JA 5HQ8A 2FJBB 4NCGB 4NLVA 4ZMMA 1S1TA 4I7FB 2UP1A 3V6KA 5DRKA 4KC5A 4WZQA 1L3SA 1KRPA 1NJYA 3HVTB 1UMJA 4CO4A 4OX7A 2HGMA 3CD0A 3LOUA 4M8LA 3LWMA 4J9SA 1S0OA 3BGFA 4TQRA 4CO0A 2RF2B 2KRRA 1HA1A 1O5JA 1TL3A 4UOCA 2W9CA 2B5JB 4Q8FA 1X5OA 1RT2A 2DHXA 3IAM9 1MWYA 5IQQA 2ZDPA 4JI8F 3MR6A 1XR5A 5IM0B 3NLCA 3FZBA 2GV1A 4H4OB 4Q44A 2R4FA 3UE2A 3CWJA 7FDRA 1EP4A 2EPIA 2CJKA 3PX4A 3Q23A 2OSRA 5D78A 1S10A 1F5AA 3OUYA 4A4JA 1S99A 1IKXB 4AL5A 3EGWB 2GQCA 4A8OA 2R2RA 4HH0A 2JLFA 2RIJA 2WBRA 3IR6B 1QVGR 4UUWA 2KZMA 1FD8A 4KO0B 1S48A 2YWGA 3UFCX 4QBUA 5A8KB 1N52B 5DQHA 2DVIA 2DR9A 2DB1A 2ABYA 2MZSA 1DLOA 5FLXY 1C1BB 3AQPA 3PKMA 2ZNYA 3J7ZT 4AYBD 3HT3A 1IKVA 5HN0A 5KOXA 3ONQA 1X9SA 2I0XA 1NK4A 4YHHF 3DOLA 3E8OA 3CCTA 4ICLA 3DU5A 3P5TL 4LIWA 5DQGA 3DLHA 3DRXA 4IDKA 4DG1B 4OV1A 3FZ2A 4DPOA 2ZC4A 3N4WA 4OMFG 3L3CA 2AYMA 3OW2R 2X1GA 1X4BA 4DFMA 1PSDA 2JLGA 3CDWA 4NRTA 5KG1A 4YB6A 1S1VA 2O67A 2BVZA 5DLFA 1TK8A 4Q0BA 1RT7A 2F4VF 3ICLA 3D0GE 3MTJA 4WFNQ 4FNIA 4C8MA 1UWBB 2AX0A 4WIIA 2EC0A 5J1NA 2ZNZA 2JEGA 1FESA 4CNYA 2J9DE 3Q0AA 1RA7A 4EWTA 3CMAS 3DMJB 2EI5A 5DDRC 5CQGA 2ASDA 1A9NB 2V2KA 4GMKA 3TVYA 2DH9A 5LSRA 1KVJA 3CCJS 3HP6A 5DETA 3BSNA 1R6YA 3JTOA 2FB0A 4PUOA 3NNAA 2DBBA 3US5A 2AJQA 1JLFB 2LQJA 1DARA 2A2CA 3CPWR 2GJ2A 4DF4A 4KGKA 5GAHI 2ADBA 4IQMA 1N88A 4ZVGA 3K2YA 2ASYA 3C6UB 1FXRA 5KFRA 4WK1A 4X62F 4DQPA 2DH7A 1D0EA 1IKWB 3DYAA 2ZH8A 3G6YA 1FRXA 2HNZA 4NZ7A 2XGQA 1SIWB 2KRBA 3I32A 2IC3B 1M5PC 2KXFA 2D3OR 3PDNA 2SXLA 4JBCA 2L9NA 4U67Q 3BGRB 4ZPCA 5DGAA 5G4DA 4X4NA 3M05A 5F41A 4OZ5A 2P9CA 3OLAA 1YJUA 4BS2A 2FHOB 2P5VA 2VASA 3VAGA 5HLFA 5A8WB 4I69A 4F4YA 4KB7A 4HT5A 2ZITA 3W3SA 4CTAA 4B9TA 4DQIA 4X66F 3U1NA 2FJXA 5KFYA 2ZH4A 2UU9F 2HYIB 3RYLA 3TYTA 4ED3A 1QVFR 3Q8QB 1TUVA 5AE2A 4IR1A 4LJMA 4QQBA 2XO7A 5IQ6A 4EZ6A 2ROEA 4LF6F 2E5IA 1P9QC 3E01B 3HKWA 3MPYA 2RJZA 1VQ6S 3H25A 1JLGA 4RUAA 1X0FA 1N8RT 1M90T 3J7Z5 4ED1A 3BSOA 2I8EA 3JSMA 3I0RA 1FKOB 2DNGA 1SH0A 1VK3A 3GFZA 1L3KA 5J1EB 3TUJC 2GHWA 4TY8A 3PZPA 2B3TB 1VFJA 2G13A 1T05B 3JAMY 1DFDA 4BHQA 1W2BR 2OSQA 1D1UA 2R8HA 2ZE2A 4URSA 1HI0P 2LEPA 2HFOA 4OZ0A 5JJBA 4ZP7A 1SBRA 1FNOA 1UVKA 4EBEA 4KRWA 1RT1A 2IM0A 4Z37A 2AGQA 3H5UA 4ELUA 3BN7A 4MYUA 3M8PA 4PWUA 4EEYA 5J2PA 2E7XA 1YJ9S 4DOZA 1S1TB 1VOMA 1MMDA 4C11A 3FEZA 2VG7B 2EWHA 5CXTA 4QIWD 2BXJA 2CJQA 2QV6A 2HHHF 4KSEB 3DRRA 2PMZD 3H4DA 3EYZA 2XBPA 2OTJS 1KLMA 4M63A 1FKPA 5M2RA 1UJ4A 5D77A 2VBXA 4F3MA 2B4OA 1TL3B 4JI1F 1KHVA 4RWWA 3O8WA 1RT2B 1SJRA 4YFUA 2VA3A 3IBWA 3C2PA 1NH8A 3D0HE 2KKHA 4ZCLA 3T19A 4CCHA 2RU9A 3M8QB 1SKSA 2N7YA 2RB7A 1REVA 1EP4B 2PN6A 3N5FA 3WX4A 2I9SA 2ZUGA 2CVIA 1NK5A 2AJ0A 3M9NB 3DGPA 3OUYB 4C7QA 4HTJA 1SIZA 2BR0A 1L3UA 1HHTP 1UA1A 4WE1A 2RSQA 3DHWC 4UW2A 2XLKA 4X4QA 2RQKA 1S9EA 3KWMA 4OX8A 3DOLB 4ICLB 5KG7A 3A1YG 4XK8C 3NKYA 4PQAA 2KFYA 4A8XA 4LQ3A 4ITSA 2BANA 5DJBA 1LV5A 4IDKB 2VFRA 1S6UA 3ZC4A 4ZLPA 2J0SD 2KN4A 4C8NA 2BE2A 3PFOA 2FVQA 2LKZA 2Y0SD 1H6KX 1W2IA 1WG4A 1XR6A 2DK2A 1LWCA 3EGZA 1LXNA 1RT6B 2DHSA 2OPRB 2UZAA 1QE1B 1BQMA 5E3CA 5B0EA 4Q0BB 2GQQA 2ZD1A 3ENQA 1RT7B 3HZEA 5HMZA 1VGYA 3KLGA 3PW4A 4K4UA 3GE9A 3H59A 1LFWA 1ZM9A 3SCIE 1G1XA 3D1QA 2B7BB 4ECQA 4ECUA 3CD7A 1H2UX 2W9BB 5KFJA 4PR6A 4F3OA 1BWEA 3D28A 3DDKA 5KFNA 2VC1A 5E41A 4B9UA 1N32F 2BQUA 4B08A 3V4MA 4TXSA 1NH7A 2I5JA 1OS5A 2RKIB 4PUOB 2UXBF 1S9GB 1RI7A 3M6XA 1WNEA 2ZH6A 4NYOA 1HQUA 2WONA 3K58A 2F40A 3PIOQ 3GQCA 4ZPAA 1Q82T 3DYAB 3O2IA 5LJ5Y 2HNZB 2OPQB 2OJ3A 5K8OA 2EFGA 1HWIA 2FJEB 3MXHP 4PRFA 3DCAA 1MNEA 4IO9Q 1DTTA 3CJ4A 2EVZA 4OLPA 1S1XA 5EUHA 2WOMA 1FCAA 1IJFB 2CQBA 4ZPTR 2NR0A 1VQLS 4K4YA 1NKCA 5HLFB 4FF2A 4B9VA 2FJWA 2JJ4D 1F9FA 4RW4A 4DSKA 1U48A 5D3GA 4DV6F 2DO0A 1LFPA 2MKJA 1T8EA 3HI9A 4H4MA 4O3PA 1KLNA 2WBMA 4CTAB 3X1LB 3BM7A 4X4PA 4FS2A 3GYNA 3ISNC 2BJDA 5H9FJ 2DGSA 3JTPA 3NL0A 1DJ0A 3N5BA 1D9AA 4DL6A 1FO1A 5A0YA 2AW0A 4BC9A 5KFOA 3QZ7A 2CIMA 4DJBA 4ZPBA 1JLGB 2EK6A 4D3GA 5CYQB 3QGHA 1Q7LB 2VD3A 2Z8QA 3NRBA 1U7LA 3I0RB 1KSPA 5GAEI 2WSFC 4TY8B 3I4PA 2V4RA 4I6AA 1JLBA 5L9NA 2A2DA 4DV5F 2F3JA 3GR1A 4IUFA 2J6SA 3GFXA 2ZE2B 3V6HA 5A8RB 3UI3A 1ZTWA 5B0DA 2FJDB 4QPXA 5KFGA 2LU1A 3S01A 5KFWA 3HHDA 4A47A 4DF8A 4B9MA 3BR9A 2FGOA 4LUBA 3M8PB 1FERA 3C66A 2KI2A 2V0NA 3DOMA 5J2PB 1UKUA 4DR3F 2UV8A 1Q86T 1G7CB 2B6AA 3HHLC 3H2VE 4DR1F 2HRYA 4O3NA 3ZZUA 2YX7A 1GT8A 2BV3A 1ZPVA 3BO3A 4DL7A 2NSCA 1S77D 1KLMB 3T1AA 4ZP6A 3TW0A 5LMUF 5B0FA 3N6NA 1FF2A 3FNNA 1NJXA 1TL5A 2LXIA 3PJWA 3BB5A 3G8SA 1U6FA 2LU2A 4LSLA 4E0DA 2XMJA 4LFBF 2KG1A 1VIXA 1REVB 1JJHA 1RYSA 3FFIA 3NGKA 3SDEB 2HS0A 4MMOA 1HYSB 2LA4A 3VF0B 4F02A 4J9PA 2K7KA 3CDAA 1SL0A 4DR7F 1SH2A 1HYSA 2YVSA 2RILA 3BEGB 4RNHA 4WE1B 2HWIA 2MZJA 4HEA9 4OJGA 2B56A 4PPDA 4DUYF 4LF7F 1N5TA 1MU2A 3CJ0A 3CCZA 3KLFB 1LW2A 2LEBA 3KKFA 4A8WA 2MMYA 4JV1A 2DIVA 4OHZA 1VS3A 3IRWP 4J9KA 1V3SA 3SV4A 3CEDA 4PXCA 3RTVA 2KFNA 3SQGA 3FEXB 4IG0A 3LUYA 4YDDB 4MKYA 3VAJA 2NZ4A 2FC9A 1IBLF 1M0SA 1LWCB 4KFBA 5KFFA 4I0WA 4B9LA 1BQMB 4RU9A 2R2UA 1FEEA 2IVYA 2ZD1B 1NAQA 4ES2A 4IH7A 3KLGB 2KYZA 3LO3A 2PA3A 5DGBA 4I4BA 1OPIA 1WTFA 2JVOA 2HZCA 1IXKA 4PXDA 3GIIA 4V19J 3DLEA 3IR5B 3FMWA 2BZ2A 4DFKA 4B9NA 4ELVA 1HBMB 3D54A 3LP1A 1S9FA 1TL1A 2VFUA 3EUNA 5LSOA 1HBOB 2BUNA 2I5JB 3CD5A 3OXFA 2D1CA 1YQHA 3QJLA 2F8EX 2QEXS 1XMOF 1UVNA 1S1WA 2GGPA 2MKHA 4CQ1A 5IT0A 4Y34A 1HQUB 2FVRA 2WONB 1JLCB 4E8UA 2HMIA 1WELA 4JI2F 5KTQA 1K1SA 4DSIA 1H2VZ 2M8DB 3SYZA 3IO1A 1O8BA 2B0GA 5HMWA 2E66A 1KEKA 1GXLA 2JSXA 3SSQA 3MURP 3DI6A 1FKAF 1S1XB 2JC0A 3UCGA 2WOMB 3I0SA 3MAHA 2AQ4A 2ZHAA 5F8GA 2J0QD 3LP2A 2ZH5A 4Q43A 1N6QA 4GKJF 4Q45A 3LAMA 2LQBA 4NMLA 4F8RA 4KE5A 2KHDA 3NAIA 5E3PA 4C98A 4RW4B 1IBMF 2O3DA 3TVZA 2J6UA 1WHVA 4H4MB 1CSJA 1HBUA 2N4DA 5KG3A 2E5LF 1JLAB 4ZA1A 4DFJA 3RR8A 3NAHA 3EX7B 4CH0S 4ECWA 1UVIA 4F3QA 4TKTA 2GIQA 3LP0B 3HHLB 2YKMA 4O3OA 1S0NA 2QFJA 1FD2A 1TR0A 3KFWX 3HVWA 3SSRA 1XMQF 4U6PA 1DTQA 1ZOTA 4OJ1A 4WJBA 1D8ZA 2K1RA 1OQ3A 3GV5B 2DNQA 3U27A 4PG4A 2AJFE 4GKKF 3CVKA 2E1RA 2O01C 4H4KA 2QMWA 4AE5A 5CYJA 3M6UA 5E0OA 1OWXA 5GAGI 4LF9F 1T94A 4RBUA 2R7SA 3AA8A 1C4AA 1KC8T 3T9ZA 1SUQA 2A10A 3D1HA 3DC2A 4RW6B 5DM6Q 2KVIA 5KFXA 4ECXA 2KTQA 2LDYA 2R7TA 3I55S 1TL4A 2PIIA 3KJVB 2B4PA 1KFDA 2XHWA 1WTBA 4DQRA 4USIA 4X4RA 1YRXA 1N0UA 3HM9A 4DV2F 3OR2A 4LFAF 3CULA 2B6AB 2FLLA 1PC4A 1FDBA 1N5YA 2MDAA 4OI3A 5KFIA 6FD1A 3MM6A 4IFVA 2HLUA 3QYYA 1AW0A 2RDIA 3PFEA 3DRPA 2JFDA 2V8DA 1Q4RA 4DR4F 2KJWA 5ITHA 2DCLA 1QY7A 2LDIA 2HGLA 1WEYA 3N01A 3NBPB 1YBAA 4IOBA 4LSLB 3OTCA 3DM2A 2JC1A 1Q81T 1XTZA 3FFIB 5L9XA 4DSJA 3DN9A 5CA5A 2L3MA 5KAKA 5J2NA 4IR9A 2V4JA 4QYRA 2QRRA 2Q79A 3OPKA 2FVPA 4DV4F 3AJ1A 4O3RA 3HDSA 4NCAA 4MIWA 3CIMA 5MAOA 4YY3F 1U2RA 2Z2LA 2XNRA 3UDLA 4F2RA 3DRSA 3H98A 1S7HA 2HQIA