2BYCA

Blrb - a bluf protein, dark state structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSRGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE-LIGHT RECEPTOR OF THE BLUF-FAMILY
publication title Structure of a Bacterial Bluf Photoreceptor: Insights Into Blue Light-Mediated Signal Transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bycA00
2XMJA 1N5TA 1P6TA 1URRA 1X7VA 3K7RA 2K7JA 2OP5A 2OMOA 1APSA 1XBWA 2XMMA 5K9FA 3LGNA 4FNHA 4HH1A 2K7KA 1OQ6A 2K1RA 2ZDPA 3HX9A 1YRXA 2HQIA 3KKFA 2BUNA 2KT3A 3TNVA 1SI9A 2LXFA 5KAKA 1AFIA 1YJRA 1YJVA 1VQYA 2QLWA 2ZDOA 2EW9A 1S6UA 2JDJA 2RMLA 4DPOA 1P8GA 1FVSA 1IUJA 1LQ9A 1TL5A 4NPOA 1FESA 2GCFA 2QIFA 5B0BA 2GFFA 4EFAC 4OIXA 4A47A 2LDIA 2K1RB 1N5SA 3LO3A 1TUVA 4HI1A 2PGCA 1GXTA 1MWZA 2VH7A 5A6WA 1Y0HA 1Y9OA 1VQSA 2BYCA 2RSQA 1YJTA 5A6PA 3T9NA 2IYIA 2HLTA 2XMVA 1ULRA 2XMWA 4F67A 3TRGA 4Q2LA 1FD8A 3HHLC 1X8DA 1GXUA 2GA7A 1CC8A 1YG0A 4OJGA 1X0PA 1Y3KA 2KT2A 2QLXA 3CJKB 1Y3JA 1V3ZA 3HHLD 2GO8A 3DCAA 5B0GA 1MWYA 3BM7A 2OAUA 1RJJA 1KQKA 3BDEA 2VV5A 2LQ9A 3IWXA 2IYGA 2OD4A 4QOTA 1AW0A 5B08A 1Q8LA 4A4JA 4Q2MA 1JWWA 2ASYA 2W4CA 4DL0C 2N4DA 3GZ7A 3KNGA 2HLUA 3CJKA 2ROEA 5T7LA 1Q53A 1R6YA 1KVJA 2AP6A 2FTRA 2RILA 4HI2A 4U9RA 2BBEA 1TR0A 2KYZA 1N5VA 3KG1A 4Y2MA 2L3MA 2AW0A 2XMTA 3FRYA 1QUPA 4FNIA 2FIUA 4ZOSA 1FVQA 2BJEA 2Q3PA 1OSDA 5F0WA 4A48A 4YDXA 2G9OA 2W4PA 4Y2IA 1WD6A 1TZ0A 2AJ1A 3WDOA 3BR8A 2N7YA 1K0VA 4HH0A 5T7LB 2LQBA 4OJHA 2OKQA 2XMKA 2GV1A 3BF4A 1W2IA 2QYCA 2PD1A 4HL9A 2ACYA 1S6OA 2RU9A 1OPZA 1SB6A 3HHLA 5F0UA 2N4CA 2GGPA 3MZIA 1AFJA 3F44A 3FGVA 1FE4A 2HFOA 3KG0A 3BB5A 4OJ3A 4A46A 3DXSX 3I9ZA 2OFHX 2HFNA 3LGMA 2CRLA 3TOQA 2IFXA 1FEEA 5IXUA 2W4DA 2ROGA 4YEAA 3HHLB 3UDCA 3BN7A 1N5QA 2GGPB 1Q4RA 5B0EA 5B0DA 3QMQA 5B0CA 1CPZA 3FMBA 2BJDA 2FB0A 2K2PA 2OD6A 4OJ1A 1TL4A 2KKHA 2AJ0A 1SQEA 2ROPA 1CC7A 2FHMA 2XMUA 4DN9A 4NL5A 3HF5A 1YJUA 5B0AA 1KVIA 2OFGX 3HFKA 1JK9B 4ZA1A 3IWLA 3VTIA 4Y2KA 1Q8BA 3QGPA 1FE0A 2HIQA 5B0FA 5B09A 3E8OA 3HDSA 3MCSA 3BGUA 1U7LA 1OQ3A
chains in the Genus database with same CATH superfamily
2A10A 1R8CA 2D1CA 2YNHA 3DGVA 3LUYA 2I6WA 4G3IA 1GTHA 1B0TA 3MM8B 3A13A 4WF9Q 1RYSA 3M8PB 4OIXA 1RAOA 4IUFA 3TW0A 1UA0A 2V8VA 2Z56B 3ZNUA 3MMCA 1RJJA 4NLDA 1GXLA 4IRCA 3L7OA 4DR1J 4J9LA 5HMWA 4ZJLA 3MMAA 2JNJA 4NCAA 4QIVA 2FJAB 1LWCA 4YB1P 4ED5A 4WFBQ 4LF8J 5DDOC 3M6UA 1RAJA 3EVOA 2UZAA 2HHHF 3DYAA 3P4UB 4I68A 4EYIB 3LGMA 3HSGA 3QSYB 3CCVS 3N6MA 3P5BP 3I32A 1B0VA 3I31A 2ABYA 5ITHA 1T3OA 2XMJA 1P6TA 2I0XA 1UJ5A 1CJVA 4CT9A 4R8UB 3AA8A 1TL3B 1U0HA 2HSEB 1UW4A 1YJVA 3RG6A 3ENQA 1TKXB 2JDJA 3THTA 4DDFA 1RT4A 3BEGB 4Z2XA 1FXLA 3GIKA 1RABB 1DAXA 2YWHA 4JI7F 2KN4A 3HXMA 1WACA 1GXUA 4H4OB 1WG5A 3OL7A 1Z4UA 1YDLA 2XS7A 3HVAA 2L9WA 3P8BB 4ETZA 1D1UA 3NBPA 2XSFA 3W66A 4I67A 1VK3A 1R3NA 1XJWB 1RE1B 3DLGA 5FJ4A 4WP8A 3AD7C 1M5HA 2NUUG 5L1IA 1I6JA 4RUBA 1T05B 4CH7A 2XZDB 3ZNJ1 4C0OC 3DXSX 3DXBA 2GQQA 1JLFA 3GG0A 3MOJB 4YB5A 1CC7A 3DM2A 1IVZA 1Y4ZB 2M8HA 1J5OB 5IT4A 3OFHA 2UUCJ 4CH1A 3NS6A 2FYXA 4PYAA 2YNIA 5SZTA 3SFGA 3N6NA 1RB0A 2VQEF 4DQQA 4OLPA 5IV3A 2DHHA 1VCTA 3C6TA 4IFYB 2EEYA 2RSQA 3EZOA 2VKZG 5A8WA 1FKOB 1KP6A 3FBFA 2DCLA 1RT1B 3FBCA 4HYKA 1G2EA 3I0SB 3D1OA 1N4LA 2L08A 2HBYB 2QL9B 3UNYA 2QZ8A 2MQ8A 3AODA 4DCOB 1FJEB 3BO4A 1KWMA 1NDCA 2ACMA 4ZPDA 2OPPB 1OSCA 1X9MA 1PYSB 1CJUA 1RLCL 2B0GA 4JI8F 4N76A 1AFJA 5J1PA 1EETA 4C9DA 5L1KA 2DD8S 2NPFA 3FEZA 4JI6F 2Y1LB 2FPHX 2PMWA 4CI0B 2DY9A 2XWXA 4LF7J 3J7A1 2J9DE 5C5JA 2D41A 4IFVA 2RH3A 2U1AA 2AJ4A 3R1HA 2PO4A 4IG3A 1XBWA 4LSNA 2BE2B 3LGNA 4F4YA 1VQOS 1FXDA 4FPIA 2E5LJ 1HBNA 5D77A 1S77D 1D0EA 2M5YA 1NK7A 2V94A 3SDEA 5KG0A 1YLXA 3T9NA 5C25B 1U8WA 1X4GA 2IBOA 2DCUB 2AYMA 5H9FJ 2WBRA 3MR7A 4CWBA 2WTFA 2XM3A 1YSJA 4Q45A 1IR0A 3EJMA 1FK9B 1IJFB 1GMWD 1S9FA 4WYWA 2N4CA 1VGYA 3K59A 4ED6A 3D3CJ 4DV6J 2B8QA 1Q8IA 3M2UB 1VBYA 4RW8A 1GFWB 2UUAJ 3MM9A 2RS2A 1HHQA 2RJZA 1FJCA 3VCDA 5DG9A 2Y1RI 4C3LA 4OL8A 4QPXA 4TLRA 3CJ0A 1H98A 3T5LA 1A6LA 4DXLA 3NCQA 1GMWA 1OQ3A 4PRFA 2EG1A 3NY0A 3GG1A 2QLJB 2DGVA 1YRUA 2CG4A 3S1TA 2HQIA 4ZKAA 4X65F 1SJ3P 3JSBA 5CD4A 2QL5B 2IMWP 4N7TA 2VFTA 1PAEX 3HP6A 5DETA 4Q2LA 3G86A 3DRRB 3QIDA 4CDIA 4NLYA 4QW9A 1XNRJ 5DZ6A 1CJTA 3CDBA 1XMQF 1X4FA 3MM7B 5LSLA 1ZAVA 1MSWD 2VG7A 1EKRA 1Q1KA 2RT3A 4ID8A 4ECWA 1EHWA 3KJQB 5EWEA 3LPEA 2CUYA 3OFGA 5DGAA 1JLGA 5CCLA 3CMES 3CJ5A 3GB0A 3BJYA 2VQFF 2R7RA 5KFWA 3BGFA 2D69A 3GFZA 1EQ0A 1MMLA 2YXLA 2KVIA 1VDHA 3HZEA 1Q8BA 4K8RA 1SKSA 1HNWJ 5KT4A 3I0RB 1FTCA 2IAJA 1IBLF 2GJFA 2AYEA 4JV2A 5LM7E 3RBZA 1QD1A 1AFIA 1ZETA 3J81j 2ZC4A 4ZCLA 3AB2B 2GMLA 2WONB 3IFEA 2XYPB 1PIEA 2UUBJ 2VH7A 2XS2A 3ADAC 4LRFA 5A6PA 4PWDB 4DS4A 3CIMA 1S59A 4YFUA 5KG7A 4PG5A 2ZH6A 2GHPA 4PAAA 1TVRA 1WKLA 3AD8C 5GMDA 3FCVA 2CNOB 5L39A 3N9UC 1WOPA 1ZM2A 2Z4PA 3JTPA 2G13A 4NLQA 3G87A 3MPYA 3MUTP 3W62A 4ECXA 5K8OA 2BW2A 3QJLA 2Z30B 1OY8A 2PSZA 4DZDA 1S76D 1FO1A 3R2DJ 5K5MA 1WC5A 3NCRA 4ZP9A 2HG4A 2YH1A 3AY0A 3CW2C 2HVIA 3UPFA 4ELTA 3QIPA 4C3KA 2V4QA 2IJNA 2D3UA 4LUBA 3PYDA 4WE1B 5AT1B 4C8KA 3PHTA 2CQ3A 4ZIVA 1LQ9A 2ZH8A 3K8WA 3R6LB 4LT6A 2KYXA 2CPDA 2YQ0A 1WC0A 1RWMB 2JC1A 4QW8A 3TRGA 5H9FK 1V3ZA 2J0SD 4AQYF 3CC7S 2WK4A 3EGWB 2BQUA 1RI7A 3M8YA 1RT1A 3D54A 4DCJB 4F8RA 2BACA 4M95A 1V3SA 3A1YG 3C16B 4KC5A 3FCHA 1WD6A 4HT7A 4M63A 3U27A 2ILYA 1IKXB 2IRYA 3TAMB 4LFBF 1ZH5A 3K2YA 3BREA 5KFZA 4ZVSB 4S0MA 3KK2B 5AJ3J 1TV6A 5IT9Y 2C3OA 5A8KA 2M88A 4OI2A 3LQVA 2VB6A 3I82A 3ZTOA 4R5PB 2FD2A 2VBXA 5A8RB 2Z2ZA 2KI2A 5LOQA 2J5AA 4ICLB 5DM6Q 4A8SA 2QLWA 4DZ6A 4N47A 2HNYA 3DLLQ 2M3DA 4A47A 1S79A 1JXVA 1N54B 1WTFA 1LXNA 2HPUA 1SUQA 4K4TA 1S99A 3MR5A 2XMVA 2BX6A 4HDGA 2B6AB 3ZXWA 2KL8A 4A8KA 2JLEA 2HHVA 2BJ3A 3B8HA 2W4CA 3ONQA 4WKYA 1Q53A 1T8EA 3I5BA 4OV1A 2QA2A 1NAQA 3MTJA 3Q22A 4K4ZA 4CQ1A 1RLDA 2MJNA 1N52B 4X66F 4K0KF 3QT8A 4UOGA 2P5VA 2P6SA 2XC9A 5C2GA 4YEAA 2DXDA 2MTLA 2G0IA 5ETPA 3QPIA 1B7FA 4N56A 5FLXU 4EUVA 2FY8A 3HM9A 6FD1A 3TR5A 2FVCA 4IRDA 2VBZA 4QYZJ 4LRDA 3KKFA 5IQ6A 3NGDA 5G0RB 3QT5A 1WC3A 1VQ5S 2I5JB 2OEJA 5AXMA 2LU1A 4ATNA 5E7OB 1S5ZA 1VOMA 2KDOA 4F0HA 4TVAB 3SEOA 3ISZA 1L3VA 2NR0A 4EO6A 3ENWA 3VAFA 2OD4A 5KOWA 4OYZA 2VASA 1HYSA 5DLGA 3OLAA 1UL3A 2KYZA 2G2ZA 1O5JA 3KLEA 4Y6IA 3CCJS 3ZC4A 2O01C 2AKWB 1SCJB 3KLVA 3VGVA 4OI3A 2W9BB 2AX1A 3FZBA 2W2QP 4CNZA 3OTOJ 4IG0B 4NI2A 2KKHA 4RX6A 2EC0A 2I38A 2OFGX 4PXBA 1UPPA 3CJQA 3GCWP 4Y2KA 5DDPC 3J81U 2LU2A 2QMWA 1NKCA 4U7CA 2VG6A 3T1YF 1DBDA 3HHDA 4KHPF 2NUHA 1J2VA 5LXYA 3H5XA 2XO7A 3I87A 4GO5X 2DNRA 3H5UA 2LDIA 1HR0F 2VJUA 4KT0C 2GMHA 3ICLA 2XZWA 1VLYA 1UVNA 4LSLB 1S49A 1PJ5A 4CLPA 4DEZA 1M1HA 2I9SA 4DSEA 2UXDF 3KG1A 3KUGA 1NBEB 2IRUA 2PMHA 1JLBB 4OYXA 1SVDA 1WI6A 2NZ4A 3VAMA 2YBVA 1K8AT 2L9NA 1Z1ZA 3V81A 1CJKB 1IKWB 3C8YA 3B6BA 5HN0A 2XZTB 5LMNJ 2CPZA 3FMBA 2FB0A 3BQ1A 3EPIA 1IWGA 3R97A 3CMQA 2XHWA 3UVJB 4ES3A 5KT2A 4KGXB 4MIWA 3MPDA 4QPTA 2X3DA 1YITS 3IBCB 4I56A 4C98A 4K7QA 3QGGA 2YPYA 2MZTA 4PWUA 9RUBA 1GXTA 3D6HB 3FCWA 2C28A 1JX4A 7FD1A 1HLWA 1Y3KA 5IWAJ 1RT6A 2NLWA 2ASYA 2ZJPQ 1ACMB 2VJVA 2AYGA 4PEOA 3SQGA 3R7NB 4IKAA 1JNZB 2OI2A 4UT4A 3BR8A 3W8GA 3BF4A 5CXTA 1VIOA 1IKYB 4OZ5A 1X5OA 1FDAA 3DI6B 4JBCA 2HRYA 3A3OB 2DR8A 3N0VA 5HQMA 2XG8A 3MXHP 2X1BA 2ZBPA 3PKMA 1ELOA 3QWUA 4NZ7A 5HLFA 1N6QA 1RWPB 2BQ3A 1VS3A 3BS9A 4EGLA 1R0AB 5K8MA 4RJVA 4NXMJ 5A2QU 2XI3A 1S57A 4LQ9A 3TJ8A 2DNKA 4OZ2A 4LR7A 4MIBA 5DDQC 2ADCA 3MECA 2DNPA 4I2PB 3AOBA 2RD5C 4LFAJ 2YTCA 2HFUA 3PX6A 1ZTTA 1NJYA 1KC8T 2IYIA 4MFBA 3CE8A 3TAPA 3THPA 4JI4J 4AT1B 5C42B 4LF4F 3G82B 2H48B 2HGLA 1KS2A 2V2ZA 3KLIB 1RT3B 5EHHA 5F8JA 4FS2A 2KRRA 1M5VC 2DH8A 1H7XA 4D3HA 2B9XA 4P6QA 5KT3A 5CD4H 1M5PC 2V67A 2N7YA 1GQEA 3ET6B 2R7WA 3RR7A 1CS4B 4DWIA 4FF2A 1NSPA 1KHVA 4PABA 1L3SA 2F9DA 3LP2B 4TY9A 1NK4A 2FUG9 1RU1A 2ROGA 4YOEA 3DN9A 3TA1A 2UU9F 3DRSB 3IBWA 3HDSA 3LAKA 1NPRA 2OMOA 4DV2J 2Y9HA 4GKJJ 2E7VA 1TK0A 3X3UA 2ZDOA 3GTYX 2GAGC 2MY8A 3H2UB 4IH7A 4HEA9 2J9EA 2HBZB 1T9WA 4DQIA 2XLKA 1RTHB 2W2OP 3IRWP 3DU5A 2W25A 1RWXB 4DUTA 2V8DA 2DHSA 4FF4A 4DR3F 2QRRA 3D0IE 2YWEA 3CCES 5CA5A 3EGNA 1LW2B 4FNIA 3ILJA 1N32J 2GX8A 4O44B 3A8IA 3GFXA 1S1XB 3CEDA 5KG5A 5KFJA 1U26A 5F0UA 5LT5A 3Q2SC 3KG0A 1B0PA 2RQKA 5KFEA 4Q43A 1Y5LB 3BGRA 3QRPA 3GU0A 3VV2B 1S1TA 5CCMA 4KFBA 4DFJA 3Q24A 3GPAA 3VZHA 2MZQA 4GRSA 2EI5A 1I94J 4LF8F 5HVGA 4UF4A 4IO1A 4QU6A 1XMOJ 4BWMA 1QUVA 4DL4A 4RW7B 1H6KX 1YJRA 2YKAA 1G7CB 4I7FB 3ZTPA 2AGQA 2DPJA 1GX5A 1Z2ZA 4F3OA 2AEFA 3MI7X 4YN3B 3O5TB 4PG7A 2Y0BB 1LW0B 2ZITA 1A9NB 5DDRC 3U1NA 2IDEA 3D1QA 1KN6A 3I4PA 3HVRA 3IN5A 2DO0A 2MQMA 3MEEB 3P49B 3EM1A 3V4MA 3DOLA 3OW2R 4M5MA 4Y2IA 2HHPA 3GV5B 4PQUB 3BBBA 4X4NA 3NKYA 2J7KA 1HWLA 1K47A 3DMJA 2MZSA 3C46A 1SB6A 1UEUA 4IR1A 1C4AA 4ZPTR 3M8QB 1EP4A 3MAHA 1F6TA 4F4AA 1G4CA 2NSCA 2QTWA 2FHMA 5HBMB 1DZ5A 4HHHA 1WF2A 4HACB 3J81Y 1BWVA 1U1RA 4KGMA 3NNCA 3CCQS 1DTTA 1HBUA 2VKRA 4ZLPA 4I6AA 4WZQA 4DV7J 3HX9A 2W9CB 3GP9A 2E1MC 4DV4F 4EZ6A 1RUSA 3OXFA 2QJ3A 4U7UD 3QRQA 4JI0J 4J9OA 1RT2B 3BBCA 3OFEA 3AJ2A 2F8MA 1AUDA 1VMBA 3F41A 4FXWA 2OIHA 3HSDA 4BLGA 1Q86T 3NNHA 3H42A 3RR8A 4DPWA 3GYXB 1Q8LA 1LK7A 5JVGQ 1U45A 5CYMA 4R0EA 2RILA 1WDDA 3SV4A 1N5VA 3KLHA 3KFWX 3KJVA 3DLEA 3H5YA 2V0NA 2R2TA 1ZM4A 1HW8A 3BKUA 4QU7A 3RRKA 3DDKA 3DI6A 4UUWA 1VK8A 2LXUA 3HHLB 4FYDA 1CPZA 1IN0A 3MFHA 2DR9A 3ITHA 2N3LA 2B51A 1TKZB 1S9GB 5J2NB 2QLBB 1HQEB 2C22A 4RR5A 1VRUB 1IBKF 1NJIT 4J9UE 1OQ6A 3H2VE 3ZZTA 1NUEA 1JJCB 2IDLA 5HP1A 3DLHA 2IY5B 3BQ2A 1TL5A 2HHHJ 4BS2A 4NPOA 1U1NA 4CIOA 5E3AA 3DLBA 3DOMA 1M1KT 2HLTA 4TU7A 1TUWA 1HBMA 4FN5A 3SFUA 1RAFB 4OLOA 2E9TA 2VL1A 3RUBL 3JB9k 4L6V3 3OT9A 2RDDA 3ILOA 2MZRA 4Y2MA 5GAEU 4YR0A 4KGVB 3CJ2A 2G9OA 2ZNYA 2KRBA 2WVCA 5I3UB 3M6WA 3MEDB 3D9BA 3U1LA 4FDFA 1R0CB 3O2IA 3CDUA 1F9EB 4JI7J 1X31C 2CYYA 4OYMA 2DKOB 1KLMB 3TI0A 4CLWA 3MPUB 2RNEA 4M8LA 2J6TA 3KLGB 4IDKB 3UCGA 3K8VA 5A2QY 3PACA 3EICA 2AHOB 4QR0A 1XN9A 1UFKA 4RW6A 4M5NA 3KK3B 1VBXA 4ZVFA 2OMLA 3W2WA 2CQ1A 4J37A 3FK4A 1RKJA 4B9TA 4YR2A 3ZZRA 3E01A 2NREA 3EUNA 2ZD1B 1CLFA 4OZLA 4OI1A 2XULA 4IOBA 4CYUA 1NMEB 3L3CA 2LFVA 2VQEJ 4X4RA 1QE1A 2WVFA 1BQMA 3AOAA 2GJIA 3SYZA 3EE3A 1CULB 2D3O1 2GGPA 3UNGC 2Q6BA 1N5YB 1BQNA 4CZCA 3TVYA 1RWNB 4QCLA 2DYAA 3JYTA 3OTCA 1EIYB 2OEMA 2V4JB 1WHXA 4H4MA 1S0VA 4B3SF 1U1OA 3I5CA 3W7BA 4DL2A 4K2JA 3CJ4A 1TFWA 1FRXA 3AAWB 4ID5A 3MURP 4JI8J 4RLEA 3WX4A 1QM9A 5D78A 1HNXF 1S6UA 2YWGA 3R8YA 3MWBA 4YY3F 2ZZTA 4J5OA 4JI6J 4AUKA 4P74A 4FVCA 2PGCA 4K4VA 3HMJG 3OJSA 1WOOA 3L95X 3V4IA 5GADI 1NXIA 4A8WA 3N5FA 2AIRB 1RHQB 3E3XA 1E6YA 2AJFE 2YH0A 1KQSR 2AJQA 2VU5A 2XO6A 3OBIA 1O6XA 3CT9A 3MEEA 3CO9A 1UWBA 3MAAA 1XC9A 3MMBB 1C0TA 2XMKA 2QYCA 1U4BA 2P8IA 5U47A 1T9VA 4AXJA 2GS8A 3HSJA 2H4YB 4QWAA 1VQ7S 3LF0A 4P2FA 2FLNA 3RRGA 4K4WA 2AGOA 1HFEL 3SV3A 1S1VA 3CCLS 4ZVRB 3MDFA 1RWWB 4B3OA 4NLUA 1TL4A 3N79A 2YX7A 3HK2A 3FVYA 1R7IA 5LMUF 1D9FA 1YJWS 2HEKA 3L7PA 5L38A 1XEZA 2VF3A 5MLCV 2BRKA 2R2UA 2H1YA 2C2OB 2ZM6F 2CWKA 4HTJA 3GIMA 1JXLA 4CLKA 1TFYA 4DX7A 2GVDA 4ZHRA 2E7WA 1TL1B 4MK8A 1YTYA 2ZH9A 2H9ZA 5DQGA 4LF1A 1LWEB 3KNGA 4L3NA 2Z58B 1Q0NA 3W9HA 4F4XA 4X65J 2HQCA 1YBUA 3Q83A 4XDDA 3M2VA 3G6YA 4HH0A 4O4GB 4M5DB 3TO8A 2DXFA 4OI6A 1T95A 2MHNA 2BANB 3C15B 2R7UA 4EBDA 3BDPA 4DV5F 2MKJA 3TWZA 1SV5A 4DBQA 1SH0A 5AE3A 2MDAA 2CQIA 2DHXA 3JQKA 2AJ0A 1FTRA 4PWWA 3UR0A 3CIZA 5HVFA 1XMQJ 3IRXA 3VAHA 2KH9A 3BKFA 4J9NA 2KO1A 4RW9A 4CLYA 3QWPA 2FC9A 3PJWA 3HVTB 4R0JA 4U95A 2R8HA 2HWTA 3UR3C 5AJ3F 4NCGA 2K1RB 2VQFJ 1RAAB 2FY1A 1AZSB 1RTDB 1PCAA 2ZH3A 2PFFB 3CD5A 3ULHA 2ADBA 2MLZA 5D3GB 2FQQB 1R6VA 4WXWA 1IBLJ 3KJNB 3OUYA 3MAQA 3CSKA 4M94A 4C2MA 4K5RA 1VQ6S 1YKWA 2EK6A 2HAIA 1RHKB 5J2MB 2GVZA 1U49A 3IR7B 2FHJD 1CSJA 4I2QB 4G1QB 4M5LA 1DLOB 4QIEA 5ETTA 1FRKA 1X5PA 3RYLA 3WBZA 3PEHA 2G0JA 2IFXA 3NEKA 3KK1A 2DXEA 5HVHA 2WOMA 2YWFA 2V8GA 5J2QA 2PA8D 2B5JB 2IC3A 2ZH7A 2MQQA 1HQ2A 2R42A 3E8OA 5E5NA 2FHJA 2CPYA 3KLGA 2VBWA 4FKYA 1RTJB 1PSDA 4NA2A 1TMJA 3EX7B 1ZOTA 1VQYA 2VPZB 2CFXA 3MPWA 1MROA 2C42A 1NB7A 3NG8A 2R7TA 4W98A 2G1DA 4TY8B 3NRBA 4RBVA 4OHXA 5ADZA 1Y0HA 4DL5A 5GVQA 5HANA 5KFHA 4LVNP 5L1JA 3SCLE 2KM8C 3ENAA 1MWYA 4CO3A 5B7WA 2EFNA 4QIWD 2RKIB 1P1LA 5F8NA 2MLXA 2QLFB 4ANDA 3G6ES 5D0RA 1K44A 4WYLA 2K3KA 4KV8B 1OY6A 4KGZB 3JSRA 2FLPA 1S9EB 1XNQF 4ZP8A 4EU0A 3I9V9 1VLOA 3G8TA 1UA1A 3CVKA 3HJVA 1FWPA 1MW7A 3I9ZA 5DM7Q 3J80U 1FFWB 3TOQA 4AQYJ 2HRUA 3M6XA 4KAIA 3LP1B 3T6BA 2U2FA 1RQ0A 1HNIB 1QAJA 1KVIA 3HFKA 1REVA 1YZ7A 3UN3A 5KFDA 3B82A 2CXEA 4ECUA 4ZJQA 3K7RA 2MQPA 4LBHA 1APSA 3KMQA 2MLYA 3D4JA 1OYDA 4B02A 1GH8A 1EZZB 2CPXA 3J7YU 4LFBJ 3SSRA 5T14A 5KG6A 4H54A 2OPSB 4FKXA 4JI3F 2KXHA 2QLXA 3JSMB 1GAOA 4F36A 4LF5F 1UVKA 2DEJA 2OLWA 3LP0A 3WIVA 4NXNJ 1T9XA 4XDCA 4E8UA 1X4EA 2R7SA 1H74A 1U2RA 5F0WA 5CH7B 2GIQA 4O3RA 2GV1A 1SKUB 1T0TV 1HBOA 2DJWA 3QAEA 4FZVA 1O0PA 4JI1F 1C2PA 4WPAA 2CJBA 4K4YA 4PR6A 2HGNA 2YWKA 2XMUA 2WW4A 3UN2A 2HFVA 5A76A 3W1YC 3ZTQA 3W9JA 1IBCB 4JI2F 3DOKB 3TNVA 4U6PA 3V6KA 1F60B 1U1QA 4M5KA 4X66J 1FESA 1C1BB 3UWTA 1PJ6A 2CJKA 1WEYA 3G6XA 5DGBA 3S8SA 2XMWA 3CJSA 4ELUA 1Q8KA 5KFFA 4OHWA 4UY8T 4RUCA 3DLKB 4O23A 4LF2A 2VBYA 3ZZ0A 5L46A 2OPRA 2V34A 3H8YA 4ZK7M 3PCOB 4UOCA 4V1Ak 1D9DA 1WF0A 4D3GA 3BKTA 3T3FA 3FFIB 2AT1B 2FIUA 4Q0BB 1I51B 5T7LB 1SPBP 2F7VA 4GMKA 1W2IA 2VICA 1RBOB 3OSPA 1SXLA 4DG1B 2IVYA 1JKHB 4LR9A 3CCWA 4I0WA 3OR2B 4PCQA 1R89A 3FZ2A 4QWEA 4NLSA 1T7PA 1IKVB 1FFGB 4ZVPB 4K4XA 5HL7Q 4X62F 4FYWB 3BGUA 3L4BC 1X7VA 1VI7A 2CKWA 1ZA2B 4OX8A 1JLCB 2Z2YB 2QIFA 2W2MP 2P9EA 4J9KA 4ER8A 4DMZA 2XS5A 4P71A 2R9LA 4C0BA 1C0UA 1NH7A 3W5YA 4B9VA 4NXMF 3CXCR 4MT1A 1HHTP 3MTKA 1M0SA 5M2RA 5CAAA 4OQJA 1C4CA 3T1YJ 2DH9A 4KHPJ 3ZZOA 2BJEA 2NZCA 1S6QB 1X5SA 4C8MA 3M1VB 4ZDNA 1HR0J 1M5OC 3HO1A 3MZIA 4USJC 3PDNA 5AE1A 3D7SB 4ZVQB 4AL5A 3IS9A 4LFCF 3G9CA 3OHBA 2YKMA 4B9LA 4I4BA 2Z2LA 3GQCA 1FRIA 1VRTB 4DLGA 2FVRA 1UVLA 2LVWA 1SQEA 4P7VA 2IVFB 2PA3A 4RZRA 2BOAA 2UXDJ 4CTAB 4U8VA 1ZM3A 1FA0A 2K7JA 4CLLA 3M2RA 3PM9A 2AX0A 2UVVA 3GIIA 2HNZB 2HWIA 2RQCA 1LWFA 1RT5B 4RUHA 5DJBA 3GLJA 3Q2TC 2H3EB 2D3ZA 1UEVA 4UW2A 2R8GA 2MKHA 1X8DA 5H9EK 4KR0B 2HKEA 2J76E 5EGYA 1S6PB 1Y11A 2WB1D 3Q8PB 2QA4G 4DLEA 4CLZA 4RU9A 1H72C 2GQ2A 4PPZA 1VHFA 2ZOMA 3CCMS 2E5HA 1LFWA 1GX6A 4JV5F 4C8NA 1Q5YA 1B4SA 3D68A 4QWCA 1B70B 5JVHQ 1WG4A 1KR4A 3MPVA 2J6SA 4NRTA 2VG5A 3T1AA 2OHDA 1F2GA 3ZO7A 3IG1A 1FDBA 2YNGA 4YR3A 3NNAA 3CPWR 3TQ1A 4L3KA 1XTZA 2DHGA 4JI5F 2W2NP 4F0KA 1N56A 5D6GA 3QLHB 4O3SA 3VGTA 1W7WA 2R8KA 1HPZB 1PAUB 3CCSS 1ROFA 1IM4A 3T5KA 1ITPA 1HWUA 5DLFA 2HQGA 1AA1B 1VQPS 4MIAA 5F41A 3G6VA 3OTDA 4Q2MA 2JL9A 1FCAA 2QFIA 1X9SA 4Q7AA 2C2KB 2DNYA 2HWHA 4I69A 2E1AA 2ZH5A 2C1EB 5KFNA 2Z0GA 4UY85 1T9YA 4USKA 2A18A 3SCJE 2J0WA 2ZZNA 2RF2A 3OVAA 4GVBB 1CBKA 4FPRA 3W2VA 3DGPB 2ZE2B 5KFCA 2XY5A 2UP1A 2BE9B 4LF4J 2W01A 5M2UA 4J9PA 1SH3A 3MGJA 4ECSA 4X4QA 4DHVA 2D9PA 3RAQA 5HROA 4DR4F 5J2PB 4USMA 3QT7A 3PJXA 1GTEA 3ELHA 2LQJA 1RK8A 3ILLA 1T03A 3N4WA 3H25A 3GFHA 4TYBA 4ANCA 3R5CA 1R0BG 1J27A 2UU9J 5KFSA 2NPIA 1RAIB 4FF3A 3CUNA 5FDLA 4X4PA 2AEJA 4J91A 2JOQA 3D0HE 5LL6d 2OTJS 1LFPA 3OL8A 1TR0A 5IM0A 3ZTSA 1S10A 4X4OA 3TX0A 4WP9A 1NSAA 2HZCA 3IO1A 1N0UA 4HL9A 3V6DA 3LANA 5AE2A 1IBMF 4X4TA 5ETMA 2A1BA 4UUXA 4LR8A 4DR3J 3BO2A 5L1LA 3LA0A 4RWWA 1VRQC 4KO0A 3UN5A 2R3VA 5B09A 2E9ZA 2RE1A 3PW5A 3H90A 3MR6A 1VC5A 2FJXA 2PI5A 2YPZA 1B99A 3D1HA 5HMZA 5ETQA 4EI2A 4PYDA 1K1SA 1YIJS 2KM8B 4KKOA 4NLXA 1F9HA 4OMFG 1KDNA 2WW8A 2YNFA 3MMJA 2VA2A 5E3QA 2B4VA 2V5HG 1TUVA 3A3PB 1E6VB 1YHQS 4K4UA 3TEHB 1RT7B 1UVMA 4L74A 1C1CA 3QO9B 1N34F 4MAKA 3IGNA 2KG1A 4QZVB 4WIIA 2EG2A 3GSDA 2XNQA 4KHRA 4WU3A 2N4DA 2WRMA 5I42B 4DU7A 2XMTA 1W2BR 4ZOSA 1PG5B 3H40A 1MMNA 3NWGA 2XLJA 5F8GA 2IRXA 5EX3A 2BKOA 3TJAA 1S1WB 4DR2F 3K5MA 1PC4A 2XLIA 2F9JA 1IQZA 4DQSA 1Y7PA 1HWKA 1PGZA 1YJUA 2VC1A 2CPEA 4ZCMA 4J9SA 4DCPB 2WBMA 2O66A 2HNDB 3TVZA 3KWMA 5GADU 1OYEA 3CJRA 3RW6A 3PFEA 1U6BA 3OQ2A 2D3OR 3NGSA 4IOCQ 2B4UA 1KQGB 1S4EA 4P7TA 4ANEA 4RW4B 1CC8A 1Y3JA 1WC6A 2F8HA 3F56A 4CLTA 1Q7LB 1B7YB 3KHHA 3QSIA 4Y3CA 4MYUA 3PR4A 1TKDA 1VQ9S 3OPKA 3PW4A 2YQ1A 4DV4J 4FF1A 2E1PA 4A8YA 1SL1A 2YKPA 3NMRA 4ECTA 3POTB 2Y3YA 4O0NA 4NZ6A 3QJJA 3H2LA 2BKPA 3GR0A 3UDCA 4UOHA 3MM5B 1JLAA 3AXMA 2RDIA 1VJQA 1UP1A 1NHKL 1IR1A 4P2XA 3MEGA 2W7OA 4HH1A 1S1UB 3RZAA 3EYZA 3K58A 1FFSB 5C24A 1WEXA 3M32B 3MR3A 1L3UA 4F26A 2VOPA 4DL3A 3K5PA 1RWVB 4AD6A 4GKKF 4ILLA 1NSKL 1RZMA 1EARA 2IM1A 3O8WA 3FMWA 2MGZA 2ATLA 2EKYA 1IBKJ 1KOOA 1K9MT 1XQIA 3WZ0A 1JJ4A 1FWLA 4LBPA 3WX8A 4XAKA 3VQTA 1MG7A 4WJBA 2ASJA 1FX4A 2CG8A 3BH7B 5F9LA 4TXSA 2AYBA 5CYQA 2KXNB 5IZHA 1JJHA 2HFZA 4ELVA 1FDNA 2ZBIA 1XR6A 2DR5A 1TL7A 4FS1A 3HLUA 3C14B 4A8XA 5A0YA 2BJDA 3UE2A 4G1PA 3D67A 3PJ9A 1D8ZA 4OYAA 1DTQB 4LRBA 5EX0A 1RA7A 3QZ7A 4NMXA 3C6UB 3PYFA 1AROP 4BBYA 4ZCIA 3SBMA 3M30B 2W8LA 1SI9A 1MU2A 3DRPA 3W8PA 4ZIWA 5F8LA 3N28A 2R7OA 1I3OB 3V2UC 2G2OA 4PUOB 4J9MA 4KY3A 1X0PA 2CPHA 2B7CB 4YB6A 4NLPA 2IMOA 1V6HA 5E33A 5F9NA 4QR2A 4CT8A 4RBTA 3GJQB 3R3TA 4C11B 2JRSA 4NRUA 3LAMA 2CJYB 1FKPA 1NDPA 1RTIB 5IXUA 2ZOFA 2XYGB 5L9XA 2RDJA 1KOHA 3KOAA 3MM6B 1UFLA 3MM8A 3MD1A 3PRBA 2FJVA 2QYGA 1GNKA 2HW3A 2R7QA 3M8PA 1T11A 1B3TA 4CLUA 2FLLA 2EK1A 2W7AA 4H4KA 2XSJB 3Q86A 4LMZA 4X2BA 4IR9A 4P9SA 4AXIA 2LEPA 2WZ1A 5K8PA 4AE5A 1HI8A 1VQSA 2M2BA 4DOZA 1QAIA 4B3SJ 2VPXB 1JQGA 1MN9A 2NYHA 1YBTA 3OR1B 3G71S 2JC0A 3OV7A 3NGTA 3R5BA 5DO2A 4C8LA 3NGUA 1UJ4A 4YP3A 1WI8A 3DFEA 3NGKA 1BC6A 1HNXJ 4YY3J 1O51A 3M8WA 2ZH4A 2KZZA 5KG3A 2HHTA 1RHJB 1S6OA 2MKYA 5HK4A 1S72S 3NS7B 2CVIA 4NCBA 2ATCB 2YKNB 2ZKUA 3PG9A 4PXCA 3HVWA 2LMIA 4R8UA 2DR6A 2XMAA 1TL3A 4TU8A 1W25A 3T1HF 3BR9A 4DV3F 4CM2A 1TKXA 1P27B 2EBGA 4F7VA 2W1BA 4DR5F 4CO2A 1RHMB 3TYTA 4YQWA 1BD6A 4FNHA 4JV1A 5FD1A 2XCPA 1NJZA 4NZ0A 2HMIB 2E9RX 2RU3A 4H4OA 1SIZA 2BABA 2NXJA 2DK2A 4HI1A 2OUGA 2DPIA 4C7QA 5LMUJ 1JLEB 3E51A 1JWWA 3MD3A 5ETVA 4DPUA 1NEEA 2X7IA 4C8OA 2NXNA 5M2PA 3PYGA 5F8HA 1T05A 2DR7A 2ZM6J 1TKTB 3V5RA 2V2VA 3R7BB 2RU9A 1GEHA 4Z37A 3FGVA 2QEXS 1NPPA 3UDEA 2QG9B 1J5OA 3BSAA 2F3JA 1YJ9S 1HD1A 1FDDA 1V5IB 3DLJA 3AT1B 2EFPA 4HLBA 4DX5A 3BPSP 4FP9A 5K14B 1QSLA 5E2QA 5IC6B 5KFYA 2DVIA 2HVDA 3AD9C 5BR8F 1N33F 2ZWPA 2ZUAA 2VONA 1WUUA 4MYTA 4IFYA 3KTQA 2MKIA 2F8EX 2M52A 4DV5J 4A8MP 2YNHB 2YY3A 1FKOA 2CQHA 4QYRA 1RGVA 3I0SA 1QVFR 3R1LA 1HKAA 2FZGB 4UQGA 3W3SA 2LDYA 2QE5A 2ALZA 5BXIA 1ZS6A 4LF9F 5SUHA 2BJ8A 1NK0A 3VAJA 4U8YA 4ED8A 4ILRA 1NLKL 2OPPA 1FKAF 3Q8YA 4ES1A 4HI2A 3MMCB 1QUPA 4YDXA 4DN0A 2H5EA 4OJHA 1S4FA 2MKCA 1GT8A 4B3MF 1P9QC 4NLOA 1ZYQA 1ICEB 1VQKS 1FE4A 2CJXB 3MMAB 2OH2A 4NXNF 1LWCB 2ALYB 3H4BA 3KUEA 2JEGA 1Q4RA 3NGRA 3WC0A 2J6UA 2BE2A 3DYAB 4HR2A 2AU0A 3A8EA 3QGPA 1NHVA 5J1NA 5KT6A 3PW2A 1H38A 5C25A 2CZVC 3QT6A 1CJVB 2XI2A 4HKQA 3LPYA 1ZTWA 3FKBA 1U0HB 2UXBF 1KBRA 1RT4B 1TP7A 3GILA 2H65B 2HYIB 4XPCA 2C2MB 2IA6A 1FK9A 2FTRA 4CP5A 1WC4A 1NO8A 1H2TZ 2Z57B 3J7ZT 1UTAA 2JHEA 3M2UA 3NBPB 1CQNA 2NXUA 4B3TF 5HO4A 3DLGB 1YBAA 2F1FA 1JXEA 1DRZA 2F63A 2ZHAA 3Q8SB 4L75A 5KG2A 1HW9A 4LF6F 4RKUC 4ZLLA 2HBQB 3QZ8A 4LBIA 3IAM9 3IWLA 1AUSL 1WOSA 4MH8A 2Q1LA 1RU2A 3WQPA 3PV8A 1JLFB 1R27B 3TZYA 3DM2B 3QGIA 1DQAA 4ECVA 1XNQJ 3TAQA 1FRMA 2OSRA 2YNIB 4I6YA 5I4MA 2K06A 3DRRA 4XPEA 3MCMA 4KE5A 3IM9A 3C6TB 2RAQA 3IWXA 3CNQP 3MM7A 5B08A 3JQJA 5A8WB 4Q8FA 4IOAQ 1R6YA 1SC1B 3K57A 2UXCF 1BE4A 4WIQA 2CDQA 5D4LA 1K0TA 2L3MA 3H59A 2DGQA 3FBEA 1PILA 4TYAA 1K0VA 2OKQA 3BSOA 2JJ4D 2BRLA 2E5GA 4HTIA 1OPZA 2M4MA 1F0XA 1ZAXA 5KFLA 1BQXA 4PG8A 4JI3J 9ATCB 4F3QA 1CJUB 3UFCX 1P1TA 4LF5J 4A8QA 1H73A 3I0RA 4KRWA 1EETB 2EC2A 2QFJA 2AZ1A 2ZUGA 4OZ3A 3FEYB 2CQDA 5BYQA 1K1QA 2BR0A 2EPIA 1URRA 1NCLA 2DIUA 3A3NB 2WONA 5E3RA 1H3DA 2V8HA 4IFVB 2MKKA 4PWDA 2M8DB 2V2QA 4JI1J 4IG3B 4LSNB 3I5AA 4FVMA 2HHUA 2DGUA 2VPWB 3QYYA 2JX2A 1QAYA 1HBNB 1NSQA 1Q7YT 4I1TA 4F04B 3SDEB 5GAGI 3ISNC 5CZVA 2CQGA 2RRAA 3ISND 2HQ3A 2LYVA 4DR6F 2ROEA 4JI2J 2HHSA 1VFJA 3D6MB 1WHVA 1TQLA 2ZVIA 1FD2A 4DSKA 4ED0A 5IFMA 1FVQA 4GVLA 4WWSA 4X4VA 3SSSA 3QQCD 2HVEA 2NCKL 3FQLA 1VC0A 1RCXB 3TA2A 3MCOA 2P6TA 5GAHI 2VFSA 2C2NA 2R8IA 5JJBA 1ZZFA 4XK8C 2BE7D 3DRYA 2HVZA 4MJKA 3D6TB 4B17A 4F4KA 4NL5A 5B0AA 5IT0A 1JK9B 4TLQA 4WE1A 3ZFVA 4RW8B 2UUWA 3TUIC 2GC8A 3R5GA 3D5MA 3MM9B 1VQ4S 3CDEA 2JEJA 1YWXA 2EFQA 2V63A 5BJRA 1VHIA 4U67Q 1F3FA 5K14A 1IJEB 3PNIA 2HS0A 2GIFA 3PO5A 6AT1B 1FVSA 4NA3A 4LRCA 3H0PA 1SKWA 1MN7A 1QDUB 1D3WA 3OD2A 4LSZB 2DRBA 2VFRA 4OZ1A 2YQ3A 4DX6A 4X62J 4B08A 2RHQB 4M5JA 3C16A 4LRAA 1IKXA 3TX8A 2AW0A 3TAMA 3TZZA 4FYVB 3EGVA 2POKA 3R6GB 2E7XA 4KPYA 3BGOP 3KK2A 2MZ1A 1CJTB 4F2RA 1UZDA 4DUZF 4USUA 4QYZK 2CJQA 2VG7B 2ZBQA 2X1AA 1H7WA 3J7Z5 4R5PA 5E3CA 3W5ZA 4ZJOA 5I3QA 2DNQA 2VIHA 3PFOA 1KQFB 5A8RA 4FBTA 2CA9A 3WIUA 3D6FB 3GMGA 4FYYB 4Y65A 4ICLA 2Y8WA 3IR5B 2M0GB 1JLGB 1XR7A 2DGXA 3PRDA 3VGUA 3L09A 2NSBA 4WTYA 3L7UA 1YRXA 1X60A 2IAJB 4LFCJ 2B6AA 2F5GA 1Q16B 2QSFA 3VHQA 2VODA 1OIAA 4QWBA 1PO6A 1TMMA 4IQMA 4N8NA 1T94A 1T9TA 3QFHA 3BGLA 1RADB 4OJGA 2CQPA 3OLBA 2GO8A 1HI0P 4Y2AA 4KPCA 4P75A 2VDIA 4A4JA 2HLUA 4L76A 4P2MA 2Y1JA 3RAXA 4NEZA 1Q81T 1OMSA 2NXCA 2Q43A 3AJDA 1TVRB 2LQ8A 3Q89A 3EWGA 4PXDA 1QTNB 5E41A 3AOCA 2MXYA 3BYRA 2CQBA 1RBAA 3UI3A 3Q8UA 1YQHA 2X3GA 2HIQA 2Q6CA 5G0RA 3M05A 2I5JA 2ZC3A 4TQSA 4K2XA 8ATCB 5KG1A 4MK7A 2BMBA 1KEKA 2CQ4A 4JV5J 3T5JA 3GV8B 3QIPB 3P3DA 2QMXA 2FVPA 5GMEA 5IT9U 1MWZA 2RQ4A 1X4DA 3MCNA 2QGFB 1YGYA 1BHNA 3RB3A 2OEKA 1RHUB 2PEHA 2B9EA 2Y8YA 4JI5J 3W5XA 4HVZA 4ZPBA 4KTQA 1OS5A 4ZVHA 2JLGA 4N8OA 1SJRA 4YB7A 5FLXY 1HL6A 2W9BA 2Q66A 1NH8A 4N5SA 1U2FA 1UVIA 4IG0A 2AQ4A 2KHCA 5KFUA 4OJ3A 4NLTA 1EQMA 4NLWA 2EKNA 1BXNA 4WK3A 3NS5A 3HPOA 2GO9A 2YVSA 2V9WA 1MWQA 2YKQA 1BY9A 3CCUS 3CJ3A 3MOZA 3PX0A 3QAUA 2ZEJA 4DUYF 2MQLA 3FEXB 1TV6B 4P72A 5A8KB 2YKOA 3PR5B 3IR6B 2FDNA 4ZPWR 3J7AN 4EK2A 2QT7A 4OHVA 3LGHA 2H5JB 4ECYA 1H2UX 2XNRA 1BMQB 4YUDA 4P2SA 4LSLA 1BGXT 3EDRB 2HNYB 4A8OA 3DCAA 5ETRA 1FI4A 4DR4J 1SUQB 2W24A 1X5TA 1JLBA 1YJNS 2ZJRQ 3MUVP 3VAKA 1HWJA 1RBLA 1OSDA 3GIJA 4NLRA 2VOOA 3LWMA 1CJKA 1UMJA 4URQU 1IKWA 2O1PA 3SCKE 2HFOA 3OVSA 3CD0A 4J90A 1CQMA 3UVJA 4NX9A 3CD7A 3JSYA 1F5CA 2VFUA 4DN9A 2FGCA 1X4AA 2WCXA 1UZHA 2KZMA 3CJTA 4NOHA 1LEOA 3EZUA 2FJWA 2NXEA 2V4RA 1SC4B 2E44A 1IBMJ 1WORA 3S01A 1TTHB 5HQ8A 1LKZA 1BUXA 4DV0F 1FX2A 1XK8A 4EMDA 2X1GA 3RBEA 1RTZA 3TVKA 5KFXA 2ERRA 4AL7A 1AW0A 2XQCA 4PQAA 5IC4B 4RWXA 1FJGF 3PHEA 2QMUB 1FHTA 1IKYA 2DEIA 2CIMA 2PT0A 2CNNB 3BZQA 1JNRB 2AJ1A 1ZA1B 2MYFA 3QNWB 1HYSB 5AXKA 2AF6A 1P9YA 1QJHA 2J0QD 4C8ZA 3KG4A 3QJPA 3KLEB 3M8RA 1N34J 4V19X 2LEBA 3S7RA 2WHOA 1R0AA 3O6QA 2V69A 4QQBA 4OX7A 2OGUA 3W60A 4Z7CA 3SIPB 5EDWA 4NI2B 4YDDB 3OTBA 4I2PA 4TNOA 3HJFA 5IV4A 3GR1A 2AZ3A 2QO3A 3NAIA 5GAEI 4PKDB 5KAKA 2JWNA 3OXLA 5DG8A 1FNOA 3ZZZA 4DR2J 1SJQA 5C42A 2CJ9A 3G82A 3SMZA 2VG6B 4PPDA 3CCZA 1HI1A 4V19J 5A6WA 3KLIA 1NB2A 1RT3A 2KT2A 4IH6A 3M6VA 2GAHC 4WFNQ 3CD6S 2CPIA 4CLFA 4KB7A 3ET6A 1VBZA 3KNAA 3PVXA 4ECRA 1HD0A 4RNMA 1CS4A 1RCOB 4C4WA 2DNOA 3RW7A 3CULA 3H20A 2JSXA 3LP2A 1QLNA 3H4DA 3D3BJ 1HARA 3IP0A 2FC8A 3HI9A 2F4FA 3DRSA 1HNZF 3UD5A 1I5OB 3EMTA 3V81B 2GMJA 2VHGA 3AQOA 4K59A 4YHHF 4EZ9A 3FSXA 3WC2A 4UZBA 5ETOA 4QJVA 4OYOA 5D15A 3GV7B 1JIHA 5L8RC 3CWJA 2EW9A 1DQ8A 3I4HX 1RTHA 1PC5A 1RHRB 2GFFA 2BOPA 1HIYA 5CQGA 3JTNA 1FF2A 1R8AA 1N36F 1F2HA 2BYCA 2R4FA 1LW2A 2WVDA 3U02A 3LTOA 3K17A 4FBUA 4O44A 1S1XA 1U02A 1RISA 4W4MA 3TZXA 1LWXA 2DITA 2J9DA 1RT6B 2EFOA 1TZ0A 3AJ1A 2LQBA 3PEJA 4ZLJA 1FRJA 3SQGB 5F3ZA 4GKKJ 3K5NA 3KUHA 2BJ7A 2MMYA 2DTJA 4M5GA 5K8NA 5MAOA 2H51B 2GNKA 2B56A 4RW7A 3HT3A 3RBDA 2YX4A 1HQUB 5EUHA 3Q0AA 4IH5A 4I7FA 5HLFB 1N6QB 3GONA 1SBRA 2DT9A 3VAGA 2WAQD 3ZZUA 1LW0A 2Z2MA 2Z8QA 4GO7X 1Y9OA 4NWBA 1YJTA 2E1RA 4CO0A 3R5DA 2XGQA 3MECB 1FD8A 5HSPA 1VQNS 5T41A 1T3NA 1RAGB 3NMAA 2QX0A 4MFBB 4PQUA 2D7SA 5JUMA 1U47A 4ILMA 3NLCA 3BBFA 3M8QA 1AXQA 3RGIA 3T19A 1ZM9A 4NYOA 3JAMU 2FJBB 2R8JA 1QTMA 5HBMA 2CRLA 2HZAA 4HACA 3BSNA 5KFQA 4ZP7A 2NYIA 3CDWA 1WC1A 4F3MA 4OX6A 2FVSA 2IA0A 4OI0A 2IIHA 2W9CA 1NK6A 3FJ2A 3W65A 3U7JA 1RT2A 2AWZA 2OO4A 1FERA 4B3RF 1NJWA 5KFKA 1N0VC 4IO9Q 2HZVA 3TP2A 1NRKA 1XIQA 1S48A 2XHCA 3IXQA 5CYJA 2W8KA 3HHLC 2WSEC 4NE9C 3HHLD 1KQKA 5CHCB 5LSOA 3SXLA 5LJ5Y 2KB2A 3PW7A 2AP6A 5THWA 1SC6A 4I64A 4DPYA 1J5EF 4KH1B 4CO4A 3DHXA 1SH2A 1NHUA 2O5DA 1Z2LA 1SQGA 1QY7A 4LREA 3HHLA 3SQOP 3AH6A 5FIIA 3ILIA 1YRTA 3I56S 1TKZA 1S9GA 5J2NA 3OXGA 1HQEA 1VRUA 2UV8A 2OD6A 2C3UA 2I2YA 1Q5VA 5GMKa 3PRVA 3OHAA 5DQIA 3MFIA 2IM2A 3RAMA 3BGRB 3JTOA 1S1TB 4KFBB 4EWTA 2HS4A 4OYPA 1SL2A 3TQEA 3T6JA 4Z7YA 1P8GA 2MJUA 2XB2D 3O3LA 3DDNA 3BV8A 5H1SV 3GWCA 3EVWA 5I3PA 2H54B 3O1LA 3N01A 4JOUA 2IJRA 2COLA 3T1HJ 1SJ1A 1UAWA 4DV3J 3PIOQ 1NDKA 5KFAA 2LQ9A 2MSSA 4UOFA 3Q23A 4ZPVR 4DR5J 5I3UA 1CVJA 3MEDA 1X4BA 1EX8A 2J8AA 4USHA 1NZ8A 4RO0A 4A8FA 2PMZD 1KLMA 8RUCA 3M4XA 1S0OA 4DV1F 2ZHOA 2X51A 2ACYA 1LNQA 3DOLB 3F44A 1TU0B 4ZN1A 4IDKA 1YZ6A 4U96A 4EBEA 4B9SA 3DMJB 3B4DA 3LH2S 3HZGA 1X4CA 1XERA 2IM0A 2ROPA 2BW7A 1JLQB 3PO4A 2HHWA 4ZVOB 1EP4B 2DNGA 4O0IA 2HK2A 2ZHBA 3KK3A 1U25A 4AL6A 3BO3A 2RB7A 3Q8QB 5GAGU 4MMOA 1DTTB 5D0EA 1HBUB 4EFAC 2ZD1A 3GJRB 3A8KA 2KFYA 1R31A 3MHYA 1WF1A 2GA7A 1EB0A 1WDTA 2KU7A 1UKUA 2P9CA 5BR8J 1N33J 2HQFA 3RTVA 5GAHU 1CULA 1WKJA 5LSRA 1N5YA 4URGA 2DNHA 3H5SA 2CJAA 5CYMB 1AB8A 3J7YI 1NDLA 1WHYA 3KLHB 2V4JA 2PDAA 1EKSA 2XWYA 3KJVB 3DLEB 1PYTA 4Y2CA 4ZP6A 4ETXA 1KRPA 4LF9J 1N5QA 4BC7A 2YWWA 2WSFC 2DNLA 3MF5A 5D4NA 1XR5A 3B78A 4P52A 3D66A 3ITHB 3P96A 4XO0A 1RP5A 4B3MJ 1HQUA 1Y00A 2QV6A 4EBCA 3AFGA 5E0OA 3R9LA 4OX9F 3K89A 3TEGA 3PZPA 2MEWA 2HS3A 4YMEA 5HP1B 5EN1A 5ETSA 4X64F 4DF4A 2KFNA 4O3OA 4ED7A 4DR7F 3GIRA 3PKYA 2MZJA 1UJ6A 3DOMB 3OJUA 2J0XA 3GZ7A 3MMBA 2R2RA 2DHAA 4PG4A 4CH0S 2FHOB 1HBMB 4F25A 3H98A 6FDRA 3UDLA 4HHJA 3VF0B 2R2SA 4WFAQ 1QSSA 2B8PA 1O8BA 3KDOA 2BDPA 1YK9A 4JYAF 2A6MA 2UXBJ 4OHYA 4CO1A 2IHR1 4BWJA 1IXKA 1Q79A 2HVHA 4ZPAA 3ZZPA 1R43A 1SJ4P 2QSWA 4OZJA 3HCXA 1NPKA 2OPQB 4ALZA 4CM0A 2XBPA 4NLVA 1TUGB 4OZNA 2OJ3A 7FDRA 5KTQA 1U6FA 5AXLA 2IJFA 4DX8H 3W9IA 4B3TJ 2RRBA 5C2CA 4ZS6A 3LOUA 2F4VF 1TL1A 1TELA 3M8ZA 5HMXA 2FVQA 1LWEA 2AMCB 1QSYA 4RW6B 4WFYA 4LF6J 2GW8A 3KDNA 4WKRA 1CG2A 5ETLA 5D8HB 1DURA 1REGX 3W2WB 1Q82T 4ED4A 2VV5A 3KYLA 1RSCA 3NXZA 5D0HA 4O4GA 2GHWA 4TN2A 1FNMA 2IM3A 3E01B 4M5DA 4TQRA 1UETA 2BQRA 2BANA 3C15A 4MKAA 1Y5NB 4LIWA 3JAMY 4F0MA 5IOLA 4CYUB 1DFDA 4LJMA 4O4RA 2CAJA 1QE1B 2PI4A 1G1XA 1BQMB 2OFHX 2H4WB 2W7PA 3PY8A 1LK5A 2ZJQQ 4DS5A 5K20B 1S97A 2N82B 2GGPB 1A0OB 1BQNB 3VVTA 3JYTB 3GCXP 4YS2A 2UXCJ 3HVTA 4H4MB 1SL0A 1D09B 3V6JA 3FC9A 5JXSA 2K1RA 1R8BA 4DR1F 1VBKA 2BKNA 2ZH2A 1AZSA 1RTDA 3AXKA 4ID5B 5DQHA 3UW1A 5D3GA 4OYWA 3RB6A 1DARA 4Y34A 4RL1A 3CJKB 4KHMA 2E1CA 3ZZYA 2QA1A 3TUJC 5KFIA 4C0HA 2P9GA 1Q95G 1WSVA 5KG4A 3V4IB 5J2MA 4I2QA 4G1QA 3E2EA 1WNEA 3HFVA 1DLOA 4DF8A 4NASA 1E6YB 3N6LA 3X1LB 2OELA 2HQDA 3AA9A 4NEYA 2PN6A 3Q8RB 5BYSA 2RVJA 2F40A 2B5JA 1RWKB 2UVRA 3HKWA 1UEKA 1UWBB 3MAAB 3PX4A 1C0TB 2XGPA 1U0SA 1NZAA 4RBUA 3QMQA 4RUAA 3C3LA 4DR6J 5HQLA 4EYHB 1RTJA 3PXGa 1TAUA 1VC6A 1S1VB 1U7LA 4PZVA 4B3OB 1VJWA 4B9MA 2E5JA 1LOUA 2UV8G 1JLQA 2RIJA 4TY8A 3OSNA 5AXNA 2B4OA 3NOCA 3RB0A 4DPOA 2B4PA 4B9UA 1IUJA 3R2CJ 3ENVA 3IM8A 5J1EB 1B64A 1X4HA 2UUTA 2RKIA 1XMBA 2LCWA 1VR6A 4UQTA 4O3PA 1GK8A 3HD2A 2OAUA 4KV8A 2CVEA 4O3QA 2A0FB 1F5BA 2QA4S 2GVDB 4ZHRB 1S9EA 3DNCA 1KHWA 4MKBA 1U48A 4C48A 2UUCF 2VD3A 3IBFB 2F65A 3RU0A 5KFOA 4F2SA 2GIRA 3VAIA 5HAOA 2KG0A 2CDRB 2PD1A 1WKKA 3LP1A 1HNIA 3M2VB 4I6WA 1FRLA 1UW9A 1RACB 4EEYA 5D4PA 5B0EA 3G4SS 1G6BA 1X9WA 1OO0B 2P2CB 5KFVA 3HF5A 2LKZA 2MPUA 1SV5B 3FSYA 2AJ2A 3KXDA 3LW5C 1W26A 4W90B 4LVOP 1VQ8S 1M5SA 1ZPVA 2LECA 2LQ5A 4KGKA 3D28A 5DRKA 4DUZJ 3ETMA 2XCAA 2E66A 3IRXB 2OPSA 2DB1A 4M5IA 4QIGA 4RW9B 3JSMA 3DC2A 1Y5IB 1ZBTA 3V6HA 3FDSA 4BCAA 4U7UK 3MEKA 3GE9A 4DI6A 4NCGB 2LA4A 2JZ5A 5B0GA 2EBEA 2DRAA 1WTBA 1GMUA 3FNNA 2FLOA 3J80Y 2CQ0A 1YX2A 1L5UA 2KJWA 4LF7F 2DH7A 1EJ7L 2APOA 3FRYA 4ZITA 2GHVC 2W4PA 2BXJA 5CABA 2X1FA 5DZ7A 3D2WA 3OUYB 1D9AA 5F8MA 2BJ9A 3CJ8A 2E5LF 4RNFA 3KLFB 4RPFA 3K5OA 1FEHA 1NM2A 5D0GA 2HRTA 2GVZB 4USTA 3TA0A 4LIRA 4WFZA 2KXFA 3KJFB 2C3YA 4ZCKA 3T41A 4PG6A 1NK9A 3DOKA 5KFTA 2LP4A 3KK1B 2ILZA 2WOMB 2OPQA 2IBKA 5J2QB 2IC3B 1C1BA 2K7KA 2ZDPA 1X0FA 2BUNA 2HGMA 4L73A 4KIAA 3IAS9 3VR1A 5HJYA 4ENOA 5DS7A 3DLKA 4WBFA 3QRRA 3BSCA 1KVKA 2N7CA 4RNNA 4ED1A 2L41A 3HULA 3TJ9A 4F67A 2UVWA 4Q44A 1MROB 4DV6F 2ASLA 3FFIA 2ZH1A 1N88A 2BVZA 2XTJP 4Q0BA 2UUAF 5LXRA 2G0CA 1DQ9A 1KFDA 4KH0B 5T7LA 4F50A 4QR1A 2V8PA 3C2PA 4DG1A 1JKHA 2FHKA 3Q8VA 3OR2A 4QIFA 3AQPA 2GJ2A 1NJXA 1IKVA 2C3PA 3I55S 2DGWA 4JB8B 4DPXA 2HFNA 3VWSA 4R25A 4ECZA 2RS8A 3NP5A 2CZ9A 1F3VA 4WCEQ 1NK5A 1T02A 4J9QA 2JFDA 1KLNA 4E0DA 3UD4P 1AT1B 2QN6B 1HMVB 2Q79A 3THVA 2CZ4A 4WP3A 1JLCA 2CNLB 4N41A 1XNRF 4WU2A 2WVEA 3CTRA 4HT5A 1U8SA 2OTLS 1REVB 1JJ2R 4WK1A 1DY3A 3IGVA 3CC4S 5KT7A 4URSA 4DL6A 4KJIA 4X84A 3N5BA 3FSIA 3P5TL 4DL7A 1FT8A 1ZPWX 3EDQB 1Q78A 2VDHA 2DGSA 4USIA 3QBCA 1MMDA 2AV5A 1S6QA 4DUYJ 4J7CA 3CJKA 3M1VA 2FZKB 2I1RA 2BBEA 5HI7A 3NCPA 2M9KA 2SXLA 1HNWF 3LP0B 3W64A 3AB4B 1VRTA 2A3JA 3R7SB 2VA3A 3GJTB 5KFBA 3GFYA 1N8RT 4CTAA 1HBOB 2UUBF 2VC0A 3KMSA 1FEEA 3HSZA 2C2EA 2VZ9A 4ZN3A 2FJDB 1ZZNA 1JMTA 2DO4A 1LV5A 1FE0A 2XEXA 2HNZA 1RT5A 2CNKB 4ZPCA 5K9FA 1SKRA 2ZVSA 3VQSA 1KKHA 3U1MA 2KT3A 2NQPA 1M1GA 2L9DA 2E29A 2UVUA 1FWKA 1YI2S 3A8JA 1N5SA 2QL7B 1S6PA 4O3NA 1U6ZA 2BA9A 5KT5A 3B54A 5J1EA 4XIUA 2G2YA 3EGZA 1L3TA 1IM6A 2PC6A 2C2DA 3RBXA 1V9OA 4QOTA 5CZXA 3GJSB 2RRNA 3CCRS 1KVJA 3ETOA 4C3MA 4X4UA 2MB0B 1OY9A 1IQTA 4OV6A 5ETNA 3WDOA 2OPRB 4GC6A 2VFVA 1UVJA 4DV0J 2XY6A 2GQCA 5IS2A 3JS9A 1S12A 5IQQA 1U24A 3CMAS 2WB4A 1QAXA 3K0JA 2PE8A 1WHWA 2Y1IA 3RJMB 1UFWA 4F4ZA 4IYQA 4DSLA 1RA6A 1FJGJ 3QLHA 1L3KA 1HPZA 1TK5A 2LEAA 3P6YC 3EXYA 2WVBA 1OWXA 2OP5A 1G3OA 3IWNC 4ZMMA 2BEFA 4DSFA 5D4OA 1M90T 1UPMB 1WSRA 3S6EA 3F0NA 3ZTRA 1URNA 3M9MB 3T9ZA 2LA6A 3EPGA 3A12A 2B9YA 2ZFHA 2R7VA 4OFZA 4KYZA 1KTQA 4RU2A 4MKVA 3IC1A 2CQCA 4J9RA 4L72B 5HMYA 2EXUA 1KFSA 1C0UB 4ITSA 1V3RA 1KTVA 3L9ZA 4GVBA 3DGPA 2ZE2A 4F02A 3SCIE 4USWA 1VQMS 1PYOB 5JMNA 1U09A 3OFFA 4A46A 4OYIA 3VALA 1MLAA 3KLFA 4GC7A 1RAHB 1U2CA 1N48A 3I96A 3BN4A 5J2PA 2QC3A 4C6AA 1QVGR 3IS9B 4G1IA 3TARA 3CDAA 4C8YA 3EXCX 2YKMB 3C19A 3FQKA 2CWXA 3VTIA 1S0NA 5B0FA 3SSQA 3MCSA 2E5IA 2CQ2A 4ERDA 4BC9A 3RRHA 2JEFA 4P73A 3CF5Q 4NMLA 2LXFA 3EVMA 1S7IA 2HBRB 4C97A 3EZ5A 3M2RB 3C66A 3G2XA 1TK8A 1HNZJ 1VQLS 5KFGA 2PIIA 4DSIA 2VPYB 1LWFB 1TAQA 2J9CA 4YHHJ 3BM7A 3VVUA 3BDEA 3CCTA 3RB4A 2ZBCA 2YX1A 2PEBA 1WJ9A 4H4KC 2MSTA 2DNZA 4ZVEA 2ZOGA 1FRHA 4ES2A 3US5A 5RUBA 4G6VB 1N36J 3MR2A 2D74B 3GYGA 3CB4A 8AT1B 2J7WA 4AYBD 1KD1T 5C7PA 3DU6A 2B3TB 1GMVA 3F73A 2DNMA 4CCHA 1F1BB 2EFVA 3HFZB 3R5JB 4ZA1A 2KVQE 5G4DA 2JEIA 2VG5B 2DISA 1YJ7A 1N5TA 1XWLA 3IG1B 2YNGB 1HMVA 1MNEA 2RUGA 1U1KA 1E6VA 3NWRA 2RHSB 1RT7A 5ETKA 2EWHA 3QO9A 3DKDA 2LLZA 2GCFA 2G4BA 2ZWOA 2RUSA 4CNYA 3HHNB 1BWEA 5HJXA 2IPOB 5I42A 4QWDA 1WG1A 2MQOA 3OTOF 1SJFA 4FXVA 5KFRA 2HK3A 3R5AA 1M5KC 1EAYC 1WEZA 1NKBA 2JFKA 1H2VZ 1S1WA 2KT5A 2B43A 2Q3PA 3BYPA 4Y28C 2JVRA 5H9EJ 2W2PP 2ZKTA 1PKUA 2HHQA 4P10A 2V2KA 4EO8A 3BQ0A 1JB0C 1V5VA 4OI4A 3O44A 1HA1A 4F4WA 3NAHA 5B0CA 2RF2B 2HNDA 3W2VB 1HNVB 1D8YA 1H0HB 1UWAA 2XYHB 1U1MA 4MK9A 3PW0A 2C2RA 4Q8EA 5HROB 4DPTA 2VUGA 4ECQA 4FXDA 4RW4A 5B0BA 3D0GE 2AEMA 4MTPA 1T03B 4NLGA 3LWLA 3TANA 2ZBRA 1NU4A 2CADA 4UTGA 5LMNF 2IYGA 4OZ0A 4K0KJ 1WWHA 4DU8A 2J7UA 3POTA 5FDLB 2C2ZB 4XTTA 1FXRA 2BM0A 4B3RJ 1FJ7A 2EVZA 4A48A 1VIXA 3UDVA 5DG7A 3G8QA 4HHUA 3BPDA 5IM0B 4CLSA 2HIYA 5F8IA 2O3DA 3FRZA 3MM5A 2JVOA 4JP8A 1WELA 3TZWA 3V6DB 2K2PA 2JLFA 2K8GA 1S1UA 5KOXA 4USVA 4KBIA 5IWAF 3GSIA 4IRKA 2DRDA 2I8EA 3M32A 1J5EJ 4K5SA 1IWAA 2A2DA 1HHSA 2PFDA 4KO0B 2DBBA 5KFMA 4WTOB 1RAEB 3TUPA 1FNXH 4OHZA 3HHKA 3LO3A 3M7VA 2A2CA 2N3OA 4WFXA 2CPJA 1F5AA 4LQ3A 1PJ7A 1ULRA 2RQMA 4KKOB 4RNHA 2YNFB 2OSQA 4AFFA 1LXJA 4M1KA 1C1CB 4U9RA 3NOGA 3M9NB 5HATA 4FYXB 3VZIA 2DNNA 1VYAA 3LALA 2AD9A 3C14A 2K3IA 3K5LA 2NS1B 2FJEB 1AYEA 4LFAF 1DTQA 2HFSA 4NA1A 5E3PA 2D9OA 3C6UA 2DGOA 1K73T 4JI4F 3M30A 4BHQA 5KFPA 1RKIA 3OTEA 4K4SA 3AHPA 2XMMA 4DV1J 4DQPA 4NYZA 4PUOA 2RMLA 3PYEA 3CC2S 4DQRA 1NNDA 2M70A 2L48A 4Y00A 4UZCA 5EWGA 1UCNA 3JXOA 2KHDA 3A4TA 3QFWA 4TKTA 3OVBA 2HURA 1KNZA 2CPFA 2V9KA 5F3TA 3M8SA 3MUMP 3DDIA 1SIWB 1OPIA 3FUYA 4C11A 2J8SA 4J9VA 3KHRA 4M5HA 5BYRA 4Y0FA 1PBUA 1IR2A 3KHGA 4W92B 2FZCB 2MQNA 4DJBA 4DV2F 4GKJF 1A7GE 1RYRA 4DFMA 1RTIA 3HKZD 1CEZA 4E2FB 4HDHA 3BB5A 5EWFA 3UD3P 3MM6A 4CO5A 1Y10A 4BDPA 2Y0SD 3BN7A 2DGTA 5B0DA 1YVFA 2MY7A 1SC3B 3HT0A 2XSJA 4B9NA 1ZAWA 1JLAB 2WSCC 3W63A 2DY1A 1KSPA 1N32F 2G1HA 3T5HA 3G96A 3QATA 3MEGB 4ZVTB 1S0MA 3QGHA 4ED2A 1OJ4A 3OR1A 3OL6A 2A6OA 4DFKA 4RNOA 4WXOA 4ED3A 2AGPA 2FGOA 5C24B 3PIPQ 3SI8A 2EFGA 1RWOB 3IMQJ 1NK8A 1RWUA 1RXOB 2GZOA 2R7XA 4DL0C 4X4SA 2XY7A 2B7BB 2MGZB 3NL0A 4N77A 1SQFA 4CRJA 1I94F 3UCUP 3DRXA 2O67A 3IA0A 3PTWA 3OL9A 1XMOF 2W9AA 3SZ2A 4OX9J 2H5IB 3P45B 3UO0A 3BH6B 4DSJA 1I1GA 2YKNA 1R8PA 1U1LA 3R27A 4X64J 3CO0P 1S7HA 2DIVA 4DR7J 3G8SA 4KQZA 3W61A 1DJ0A 5CYQB 1U1PA 3KHLA 3HHEA 4OJ1A 3DHWC 2IVMA 1TL7B 2KFZA 4JV0A 2HMIA 1HWIA 2LXIA 3VGSA 5A0YB 2KJVA 4TU9A 1HNVA 3CGIA 2HAFA 4OYBA 2JH3A 2BM1A 4JYAJ 2B9WA 3JQMA 3UCZP 3GYNA 2BZ2A 3M9OB 3TUZC 2C3MA 1VISA 1JLEA 1NKEA 5L9NA 1MU2B 3DRPB 3H7HB 4PXEA 3I6PA 1YG0A 2BJ1A 2V68A 5LJ3Y 1R8HA 2M7SA 1DHMA 2ZNZA 7AT1B 2ZZMA 4NYPA 2MHEA 4E98A 1TKTA 2MKSA 1T9UA 4K50A 4WZMA 2V6AA 3FBBA 4ZVGA 2ASDA 2BV3A 3B4MA 4G65A 2F4VJ 1BLUA 4DV7F 1RDRA 4JI0F 4MKYA 4DFPA 2HHXA 1F9FA 4ZLNA 3UQSA 4KSEB 2W4DA 1KONA 3HD1A 2KTQA 4ZVUB 3WHIA 1PBAA 4IQXA 1FKPB 4QBUA 4JUZA 4Q5VA 2V50A
chains in the Genus database with same CATH topology
1P27B 2EBGA 2A10A 1R8CA 2D1CA 2YNHA 3LUYA 3PACA 4DR5F 4CO2A 3TYTA 4YQWA 1BD6A 3ITHB 4G3IA 1GTHA 3P96A 4FNHA 4QR0A 4JV1A 1B0TA 1RP5A 5FD1A 4XO0A 2XCPA 1NJZA 3MM8B 1HQUA 1Y00A 1XN9A 2QV6A 4EBCA 5E0OA 4RW6A 4NZ0A 2HMIB 2E9RX 2RU3A 3KK3B 4WF9Q 1RYSA 4H4OA 4OX9F 3M8PB 1SIZA 2BABA 3PZPA 1VBXA 4OIXA 4ZVFA 2DK2A 2OMLA 4IUFA 3W2WA 4HI1A 2CQ1A 2HS3A 4J37A 3TW0A 4YMEA 5HP1B 1RKJA 5EN1A 1UA0A 4B9TA 2V8VA 4X64F 4DF4A 2DPIA 2KFNA 4O3OA 3ZZRA 4YR2A 3E01A 4ED7A 2NREA 4DR7F 3MMCA 3EUNA 4C7QA 2ZD1B 1RJJA 3PKYA 2MZJA 1JLEB 4NLDA 1UJ6A 1CLFA 3E51A 4OZLA 3OJUA 2J0XA 1JWWA 1GXLA 3GZ7A 3MD3A 3MMBA 2R2RA 4OI1A 4IRCA 2XULA 4IOBA 2DHAA 1NEEA 3L7OA 4PG4A 4CH0S 2FHOB 1HBMB 4F25A 3H98A 4J9LA 3L3CA 6FDRA 5HMWA 4C8OA 3UDLA 5M2PA 4HHJA 3VF0B 5F8HA 1T05A 2R2SA 3MMAA 4X4RA 2DR7A 1QE1A 4NCAA 1BQMA 4QIVA 4WFAQ 1QSSA 1TKTB 1O8BA 3V5RA 2FJAB 1LWCA 2BDPA 2GJIA 4JYAF 3SYZA 4YB1P 4ED5A 2RU9A 4WFBQ 5DDOC 2GGPA 3UNGC 2Q6BA 3M6UA 1N5YB 1BQNA 1RAJA 4Z37A 3FGVA 3TVYA 4CO1A 4CZCA 2QEXS 4OHYA 4QCLA 2UZAA 2IHR1 4BWJA 2HHHF 1IXKA 3DYAA 3JYTA 1Q79A 4I68A 2HVHA 4EYIB 1J5OA 3LGMA 3BSAA 4ZPAA 3CCVS 3N6MA 3ZZPA 2F3JA 1R43A 1SJ4P 2QSWA 3OTCA 4OZJA 1YJ9S 1HD1A 3I32A 1FDDA 2V4JB 1B0VA 1WHXA 4H4MA 3DLJA 1S0VA 4B3SF 2EFPA 3I31A 2OPQB 4HLBA 1U1OA 2ABYA 4ALZA 5ITHA 3I5CA 4FP9A 1T3OA 3W7BA 5K14B 4DL2A 1QSLA 2XBPA 4NLVA 5E2QA 5KFYA 2XMJA 2DVIA 5BR8F 1N33F 1P6TA 3CJ4A 2I0XA 1UJ5A 1TFWA 2VONA 1FRXA 4OZNA 3AAWB 4CT9A 4ID5A 4R8UB 3AA8A 4MYTA 1TL3B 2OJ3A 7FDRA 3MURP 4IFYA 3KTQA 1UW4A 5KTQA 1U6FA 1YJVA 5AXLA 4RLEA 2IJFA 4DX8H 2MKIA 2F8EX 3WX4A 1QM9A 2M52A 3ENQA 5D78A 2RRBA 1TKXB 1HNXF 1S6UA 2JDJA 2YWGA 4A8MP 3THTA 4DDFA 2YNHB 2YY3A 1FKOA 2CQHA 1RT4A 3MWBA 4ZS6A 4YY3F 3LOUA 3BEGB 4Z2XA 4J5OA 2F4VF 1TL1A 4AUKA 1FXLA 4QYRA 1RGVA 3I0SA 4FVCA 5HMXA 3GIKA 2PGCA 1DAXA 1QVFR 4K4VA 3R1LA 2FVQA 3HMJG 1LWEA 2YWHA 4UQGA 1QSYA 4JI7F 4RW6B 3OJSA 4WFYA 2KN4A 3L95X 3HXMA 3V4IA 2GW8A 5GADI 4A8WA 1WACA 1GXUA 3W3SA 1CG2A 2LDYA 2QE5A 1WG5A 4H4OB 2ALZA 4WKRA 1DURA 5D8HB 3N5FA 3OL7A 1Z4UA 3W2WB 1Q82T 4LF9F 2VV5A 3E3XA 5SUHA 3KYLA 1E6YA 1NK0A 2XS7A 3VAJA 3HVAA 4ILRA 2AJFE 2L9WA 4ED8A 2OPPA 2YH0A 1KQSR 4O4GA 2GHWA 1FKAF 4TN2A 1FNMA 4ES1A 4ETZA 2IM3A 1D1UA 3E01B 4HI2A 2AJQA 3NBPA 2XSFA 4M5DA 4TQRA 4I67A 3MMCB 1UETA 1QUPA 2BANA 3CT9A 3OBIA 4MKAA 2BQRA 1Y5NB 1VK3A 1R3NA 4LIWA 3JAMY 3DLGA 4YDXA 3MEEA 5FJ4A 3CO9A 4DN0A 1UWBA 1XC9A 2H5EA 3MMBB 1C0TA 4OJHA 2XMKA 1S4FA 2MKCA 2QYCA 1GT8A 1U4BA 1M5HA 1P9QC 4NLOA 1ZYQA 4B3MF 2NUUG 5U47A 5L1IA 1DFDA 1VQKS 1I6JA 4AXJA 4LJMA 1FE4A 4O4RA 1T05B 4CH7A 3MMAB 4QWAA 1VQ7S 1QE1B 2PI4A 1G1XA 1BQMB 3LF0A 4C0OC 2OH2A 3DXSX 2FLNA 3RRGA 4NXNF 4K4WA 2OFHX 3DXBA 2W7PA 3PY8A 1LWCB 1LK5A 2ZJQQ 1HFEL 3H4BA 3SV3A 4DS5A 2AGOA 1S1VA 1S97A 3CCLS 2N82B 2JEGA 2GGPB 3MDFA 1Q4RA 1BQNB 2GQQA 4B3OA 1JLFA 4NLUA 3WC0A 3GG0A 1TL4A 2J6UA 3MOJB 4YB5A 2BE2A 3N79A 3DYAB 1CC7A 3DM2A 2YX7A 1Y4ZB 3JYTB 2M8HA 1J5OB 3HK2A 5IT4A 3FVYA 2AU0A 3A8EA 1R7IA 3OFHA 3HVTA 3QGPA 1NHVA 5J1NA 5KT6A 4CH1A 5LMUF 1D9FA 3NS6A 4H4MB 1SL0A 1YJWS 2YNIA 5SZTA 3V6JA 3PW2A 3L7PA 5L38A 1XEZA 1H38A 5MLCV 3SFGA 2BRKA 3N6NA 5JXSA 2R2UA 2K1RA 1R8BA 4DR1F 2ZH2A 2VQEF 5C25A 4DQQA 2CZVC 2ZM6F 1RTDA 4OLPA 2XI2A 4HKQA 4ID5B 3LPYA 4HTJA 5DQHA 3UW1A 1ZTWA 3GIMA 3C6TA 1JXLA 4IFYB 2UXBF 1TFYA 2RSQA 5D3GA 2VKZG 5A8WA 3RB6A 4ZHRA 1FKOB 1DARA 1RT4B 1TP7A 4Y34A 2E7WA 3GILA 2DCLA 1TL1B 4MK8A 3CJKB 1YTYA 1RT1B 2H9ZA 2ZH9A 4KHMA 4HYKA 2E1CA 1G2EA 3I0SB 3ZZYA 5DQGA 2QA1A 3D1OA 3TUJC 2L08A 5KFIA 1N4LA 1LWEB 4C0HA 2HYIB 2P9GA 3KNGA 4XPCA 2QZ8A 5KG4A 4L3NA 3V4IB 2IA6A 5J2MA 1FK9A 2FTRA 1FJEB 1NO8A 3BO4A 1H2TZ 4I2QA 4G1QA 3E2EA 1WNEA 1DLOA 4F4XA 4DF8A 1E6YB 3J7ZT 4XDDA 4ZPDA 3M2VA 3G6YA 2JHEA 3N6LA 2OPPB 3X1LB 4HH0A 4O4GB 3AA9A 3M2UA 1OSCA 1X9MA 2PN6A 3Q8RB 3NBPB 1CQNA 2B0GA 4M5DB 4OI6A 4JI8F 3TO8A 5BYSA 4N76A 2MHNA 1T95A 2NXUA 2BANB 2RVJA 2F40A 4B3TF 2R7UA 1AFJA 5HO4A 4EBDA 3BDPA 3DLGB 4DV5F 2B5JA 1YBAA 2F1FA 1EETA 5J1PA 1JXEA 2UVRA 4C9DA 2MKJA 3HKWA 5L1KA 2DD8S 2NPFA 1DRZA 1UWBB 3FEZA 2ZHAA 3PX4A 1C0TB 4JI6F 1SV5A 2XGPA 3Q8SB 4DBQA 5KG2A 1HW9A 1SH0A 1NZAA 5AE3A 4RBUA 2MDAA 3QMQA 2CQIA 4RUAA 3C3LA 2DHXA 4LF6F 4RKUC 2AJ0A 1FTRA 4EYHB 2FPHX 1RTJA 4CI0B 3QZ8A 3UR0A 2XWXA 3CIZA 3PXGa 3IAM9 3J7A1 1TAUA 3IWLA 1VC6A 2J9DE 5C5JA 2D41A 4IFVA 1S1VB 2RH3A 1U7LA 2U1AA 3IRXA 2AJ4A 3VAHA 4MH8A 2Q1LA 3R1HA 2KH9A 3PV8A 2PO4A 4B3OB 1JLFB 1VJWA 2E5JA 1LOUA 1R27B 2UV8G 1JLQA 4IG3A 4J9NA 2KO1A 1XBWA 4LSNA 2BE2B 2RIJA 3LGNA 3DM2B 4TY8A 3OSNA 4RW9A 4F4YA 1VQOS 3QGIA 1DQAA 4ECVA 3QWPA 2FC9A 5AXNA 3PJWA 1FXDA 3TAQA 2B4OA 3HVTB 4R0JA 1FRMA 3RB0A 2R8HA 2HWTA 3UR3C 1HBNA 5D77A 4DPOA 5AJ3F 2OSRA 2B4PA 1S77D 4NCGA 4B9UA 1IUJA 2YNIB 1D0EA 4I6YA 3ENVA 2M5YA 5I4MA 1NK7A 2V94A 3SDEA 5J1EB 3DRRA 2K1RB 5KG0A 1B64A 1X4HA 2UUTA 4XPEA 3T9NA 2FY1A 5C25B 2RKIA 1XMBA 1RTDB 2LCWA 4KE5A 1X4GA 2IBOA 2DCUB 4UQTA 4O3PA 2ZH3A 2PFFB 3CD5A 3ULHA 2AYMA 3C6TB 2OAUA 4KV8A 2ADBA 3IWXA 2CVEA 5H9FJ 2WBRA 3MM7A 5B08A 4O3QA 5D3GB 1F5BA 2QA4S 5A8WB 4WXWA 4ZHRB 1S9EA 4Q8FA 4IOAQ 1R6YA 3DNCA 1KHWA 2WTFA 4MKBA 3K57A 3OUYA 3MAQA 3CSKA 1U48A 2UXCF 2UUCF 2CDQA 5D4LA 2VD3A 4M94A 1K0TA 2L3MA 3H59A 1YSJA 4C2MA 4K5RA 3RU0A 2DGQA 4Q45A 1VQ6S 5KFOA 4F2SA 2GIRA 1PILA 3VAIA 4TYAA 1K0VA 2KG0A 2EK6A 2HAIA 1IR0A 2OKQA 2JJ4D 3BSOA 5J2MB 1FK9B 1IJFB 3IR7B 1U49A 2PD1A 2BRLA 2E5GA 2FHJD 4HTIA 1OPZA 1S9FA 4WYWA 2M4MA 1CSJA 1F0XA 1ZAXA 2N4CA 3LP1A 4G1QB 4I2QB 1VGYA 1DLOB 5KFLA 4QIEA 1BQXA 3K59A 4ED6A 1HNIA 3M2VB 4I6WA 1FRKA 1FRLA 1X5PA 3RYLA 1Q8IA 3WBZA 4PG8A 3PEHA 3M2UB 1VBYA 4F3QA 2IFXA 4EEYA 4RW8A 5D4PA 3KK1A 3UFCX 1P1TA 2WOMA 3MM9A 2YWFA 5B0EA 2V8GA 3G4SS 4A8QA 1G6BA 2RS2A 2RJZA 1OO0B 3I0RA 1X9WA 1FJCA 4KRWA 3VCDA 5DG9A 2Y1RI 2PA8D 5J2QA 2B5JB 2IC3A 1EETB 2QFJA 4C3LA 2ZUGA 5KFVA 3HF5A 3FEYB 2ZH7A 4OL8A 2CQDA 2LKZA 2MPUA 1SV5B 2MQQA 4QPXA 4TLRA 3CJ0A 1H98A 3T5LA 1A6LA 3E8OA 3FSYA 5BYQA 5E5NA 3NCQA 1K1QA 2FHJA 1OQ3A 2BR0A 4PRFA 2EPIA 2EG1A 2CPYA 3LW5C 1URRA 4W90B 2DIUA 3KLGA 4LVOP 3GG1A 2LECA 2DGVA 2VBWA 1YRUA 2WONA 1VQ8S 5E3RA 1RTJB 1PSDA 1M5SA 1H3DA 1ZPVA 2CG4A 2LQ5A 2HQIA 2V8HA 3D28A 4KGKA 4NA2A 5DRKA 3S1TA 3EX7B 1ZOTA 1VQYA 4ZKAA 4IFVB 2VPZB 2MKKA 4X65F 2XCAA 2E66A 2M8DB 3IRXB 1SJ3P 4PWDA 3JSBA 2OPSA 2CFXA 2DB1A 3MPWA 1MROA 4IG3B 2C42A 4LSNB 3NG8A 4QIGA 1NB7A 2R7TA 2G1DA 4TY8B 2IMWP 4RW9B 3JSMA 3NRBA 4RBVA 3DC2A 1Y5IB 3I5AA 1ZBTA 2VFTA 4FVMA 3V6HA 3FDSA 2HHUA 4OHXA 4BCAA 5ADZA 2DGUA 1Y0HA 3HP6A 4DL5A 2VPWB 3QYYA 5GVQA 2JX2A 1QAYA 1HBNB 4U7UK 5KFHA 3MEKA 3GE9A 5DETA 4Q2LA 4NCGB 4LVNP 4I1TA 1Q7YT 5L1JA 2LA4A 3SCLE 3G86A 3SDEB 2KM8C 5GAGI 3ISNC 2JZ5A 3DRRB 3QIDA 5CZVA 5B0GA 2EBEA 2DRAA 1MWYA 1WTBA 4CO3A 2CQGA 5B7WA 4NLYA 2RRAA 2EFNA 3ISND 3FNNA 2FLOA 2HQ3A 2LYVA 4QW9A 3J80Y 4DR6F 2CQ0A 2RKIB 1P1LA 4QIWD 5F8NA 2ROEA 1L5UA 2HHSA 2KJWA 3G6ES 1VFJA 4LF7F 1WHVA 1TQLA 2DH7A 3CDBA 2APOA 1FD2A 3FRYA 4WYLA 1XMQF 4DSKA 2K3KA 4KV8B 4ED0A 5IFMA 1FVQA 1X4FA 4X4VA 3JSRA 2GHVC 2W4PA 3MM7B 2FLPA 5LSLA 1ZAVA 1MSWD 2BXJA 3SSSA 2X1FA 2VG7A 1S9EB 1Q1KA 3FQLA 3D2WA 3OUYB 1D9AA 3TA2A 1VC0A 1XNQF 2RT3A 5F8MA