2BYCA

Blrb - a bluf protein, dark state structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSRGDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bacterial Bluf Photoreceptor: Insights Into Blue Light-Mediated Signal Transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
molecule keywords BLUE-LIGHT RECEPTOR OF THE BLUF-FAMILY
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bycA00
3HX9A 3BR8A 1X0PA 1LQ9A 3QMQA 2GGPB 2JDJA 1Y3JA 4FNIA 1TR0A 2KT3A 3KG1A 3QGPA 2KKHA 2L3MA 1YJUA 2LQBA 2ASYA 2QLXA 2BJEA 1FESA 4HL9A 2IYIA 2K2PA 2VH7A 2XMJA 2QLWA 1TZ0A 2KYZA 1OQ6A 1OQ3A 1YJRA 2BYCA 4DPOA 2OD6A 3KG0A 2K1RA 3FGVA 2LXFA 1Y9OA 5IXUA 1S6UA 3KKFA 5F0UA 3BM7A 1YRXA 2HFNA 5B0FA 2OD4A 3FRYA 2OAUA 4F67A 4OJHA 1MWZA 2QIFA 3CJKA 1Q4RA 1YG0A 4NPOA 3WDOA 1CC7A 2AJ1A 2ZDPA 3HHLA 3KNGA 1ULRA 2GGPA 3HFKA 4DN9A 3BF4A 1KVJA 2GO8A 3HDSA 2XMWA 3HHLD 5K9FA 2RMLA 1P8GA 4OJ1A 2VV5A 5F0WA 2Q3PA 1MWYA 1N5SA 4YDXA 4DL0C 3FMBA 3E8OA 3MZIA 5B0EA 2HIQA 3HHLB 3MCSA 2ROEA 2LQ9A 2W4PA 1FE4A 3TOQA 1FE0A 2OKQA 5B0BA 1URRA 4HI1A 2XMUA 3LGNA 4A46A 1AFIA 2G9OA 4ZA1A 5T7LB 1Y0HA 1Y3KA 4NL5A 2OP5A 2OFHX 3CJKB 2GFFA 3GZ7A 2N7YA 1VQYA 2W4DA 3I9ZA 2N4CA 1TUVA 1Q53A 5B0GA 3IWXA 1VQSA 4YEAA 1RJJA 1R6YA 1OPZA 2KT2A 2ROPA 3LGMA 4Y2MA 2BUNA 2FB0A 1FD8A 5A6WA 2RU9A 2AW0A 4Y2IA 2HFOA 2W4CA 1X7VA 3TRGA 1S6OA 3BDEA 3HF5A 4Y2KA 2HLUA 3T9NA 1FEEA 2FTRA 2HQIA 3BB5A 2RSQA 2GA7A 1XBWA 1YJTA 2LDIA 2ROGA 2GV1A 4HH0A 5B0AA 2K1RB 4Q2MA 2HLTA 2OMOA 3F44A 3UDCA 2OFGX 1P6TA 1TL4A 2K7KA 2ZDOA 3BGUA 4FNHA 1APSA 2AP6A 5KAKA 4HH1A 5B0DA 3BN7A 1GXUA 2RILA 4Q2LA 5B09A 3LO3A 1U7LA 3TNVA 1IUJA 4OJGA 1QUPA 2FHMA 2K7JA 2AJ0A 5T7LA 4QOTA 5A6PA 1SB6A 2XMVA 3DXSX 3K7RA 1SQEA 2IFXA 1KQKA 1N5TA 2BBEA 5B08A 2IYGA 4EFAC 5B0CA 4OIXA 1K0VA 2N4DA 1CPZA 4U9RA 4A48A 2CRLA 2XMKA 3DCAA 2PD1A 4HI2A 4ZOSA 1JWWA 1Q8BA 1YJVA 1AW0A 2GCFA 2QYCA 3VTIA 1V3ZA 1OSDA 2XMMA 2XMTA 1X8DA 2PGCA 4OJ3A 2BJDA 1TL5A 2EW9A 1KVIA 1W2IA 1SI9A 2ACYA 4A47A 3IWLA 1FVSA 1N5VA 1WD6A 1AFJA 1N5QA 2FIUA 1GXTA 4A4JA 3HHLC 1CC8A 1FVQA 1JK9B 1Q8LA
chains in the Genus database with same CATH superfamily
3R6GB 1HPZA 2GVDB 2YWHA 2OSQA 1SQFA 1U1KA 4DL3A 4JI1F 2KYXA 2B3TB 2KKHA 5E33A 1RWVB 1RTDB 4DQQA 3TAMA 4DS5A 4QZVB 4B08A 5KFSA 1L3SA 1I5OB 1PYOB 5KFOA 2FQQB 2YKNA 2AQ4A 3MMBA 3TVZA 3MPUB 5DDQC 5KFNA 4I56A 4X4RA 3M8PB 4U96A 5CCMA 4BHQA 1FNXH 4DV7F 2B4PA 2YQ0A 4ETZA 1WOSA 1HLWA 4H4MA 4N47A 3EVOA 3KJVA 1YRXA 3HSJA 3GV7B 4DV5J 3V81B 1HNIB 2KZZA 1JLBB 4B9VA 1CJUB 4B3RF 3W2VA 2ZHBA 4F04B 2ZOGA 4AYBD 5KFEA 1BLUA 1RWNB 5HK4A 1T7PA 3RR7A 1F5BA 4P2SA 4C0HA 2Q6CA 3OFEA 1K9MT 1NSAA 3BREA 3D0GE 5KFTA 1HNWJ 4DR1F 4HTIA 2QLJB 4L3NA 3GQCA 1F9EB 1GMUA 1FKPA 3CIZA 3Q89A 2MGZB 4NI2B 4RBVA 3UVJA 3QBCA 5IC4B 1HWLA 5E3QA 3THPA 1Q5YA 3HKWA 3RB3A 2RKIA 1U24A 3TA0A 4B3OA 1NXIA 1UMJA 1CJUA 3QFWA 1VFJA 2HSEB 5KFHA 4DV7J 1JNZB 3CWJA 3RR8A 1AROP 1WSVA 3C66A 4IH7A 2GFFA 1UZHA 4C0OC 3CCZA 3I9ZA 2ZJRQ 3V6HA 1S99A 1HQUA 5E3AA 4P71A 1N8RT 3L7UA 4C3KA 2HW3A 1LFWA 1EETA 4PXDA 2QTWA 4K7QA 4P74A 3BSOA 3FQKA 1TL1B 3P3DA 1VDHA 5HMZA 2X3DA 4CLUA 1RWMB 1IN0A 2CPJA 2F7VA 3MMBB 3VWSA 2XLKA 5KOWA 3R3TA 3SYZA 2DPJA 1FEEA 2M88A 4ECQA 5F8GA 2F63A 3O44A 4DV0F 2ROGA 3C3LA 5ETOA 2VASA 2N82B 1M0SA 1LKZA 3K57A 3EX7B 3OFGA 3MURP 5BYSA 3NNAA 1S0OA 2ZDOA 3ETMA 3A3PB 4AL5A 4OL8A 4U95A 1T0TV 2Z2MA 4M5GA 5L9NA 4Q2LA 1QY7A 4KGZB 4Z7YA 2F5GA 1U09A 1U1PA 3DOLB 1HR0J 4ZJLA 1XQIA 3U1NA 4WFAQ 2G0IA 3N6NA 2ZD1B 1H0HB 1Z4UA 2AJ2A 5G4DA 4C97A 5HQLA 2F40A 4CTAA 1VQNS 1TP7A 4FN5A 3BH7B 2HURA 1WJ9A 3I55S 1HD1A 5B0CA 4OIXA 2HHXA 2Z0GA 2JC1A 3FZBA 2HQGA 2YBVA 4HI2A 1TU0B 4N41A 4B3RJ 3KLEB 3K5OA 1WEXA 1UVKA 4MTPA 4YR2A 1RLDA 4MIAA 1OY9A 4QYRA 3GYNA 5SZTA 3H90A 5K14A 1X8DA 1LEOA 1VMBA 2JZ5A 1D9FA 3QZ8A 4JI4J 3BZQA 3KFWX 1T3NA 2OEJA 3OFHA 1W2IA 1SI9A 2J5AA 3ZNUA 2AV5A 4IG0A 4NLXA 2J0WA 1CC8A 1U2CA 3AXMA 1UZDA 3O1LA 2C3YA 1N0UA 4J7CA 3Q2TC 2R8GA 4ZLPA 4K4YA 4EZ6A 1EARA 3F0NA 3MHYA 4QWCA 3WX4A 4DV4J 4PCQA 1R8AA 2AJFE 3G6XA 2MB0B 3MM8A 2WB4A 3QGPA 2KVQE 1AB8A 5DS7A 5HBMA 3SXLA 2VFVA 4DLEA 2HHWA 1JKHA 5F3ZA 1SH3A 3DLGA 2XM3A 5HL7Q 3DU6A 2K2PA 4OX7A 3QO9B 2W9BB 2F9JA 3HI9A 4CO4A 2EBGA 1WOPA 3FFIB 2R2SA 1XMQF 1G1XA 4OX9J 3EPIA 2JEFA 2K1RA 4KPYA 1KKHA 4DR4F 2BQ3A 4RNFA 1XMOJ 4NXNJ 5IOLA 5DG9A 5JMNA 5HQ8A 1PAEX 4ZVRB 1NJZA 4C7QA 2HFUA 1BD6A 4OV6A 4LFCJ 3FRYA 2VJUA 5F8MA 1AUSL 2KT5A 3ILOA 5HSPA 2EKNA 3UW1A 1TVRA 2AZ1A 1RTJB 3JB9k 2CPXA 5F8JA 5E0OA 3FUYA 2LU1A 3UCGA 4B9UA 2E7XA 1K47A 2FDNA 2GO8A 2VKRA 1DFDA 2AGPA 3QRQA 1Z2ZA 4R5PA 3MXHP 1XR7A 1VLYA 5KFLA 4AUKA 2R2UA 2IHR1 3K17A 4GKKJ 3FNNA 1RP5A 1LXNA 4ZJOA 4YY3J 2LQ9A 3BBBA 2CYYA 3I82A 4ICLB 3TOQA 3QZ7A 2O01C 1B3TA 2VBZA 3A13A 5B0BA 4DQRA 4CCHA 2VZ9A 3TYTA 3WC0A 4NRTA 1QSSA 4C11B 2ERRA 1QAYA 2PO4A 5E41A 4I1TA 1F3VA 4NA1A 4DR6J 4KQZA 5C25B 1SC6A 2DIVA 3RB4A 2G1HA 3GWCA 3G96A 1MU2A 3B82A 2W4DA 3HD2A 4H54A 2N4CA 1TUVA 4LFCF 2YY3A 3SV4A 2QMXA 2QJ3A 4OLPA 2WCXA 2F8HA 4R0EA 4USTA 4NA3A 3DC2A 3M30A 3NBPA 5F41A 1NK8A 1R6YA 4USVA 2FLLA 1ZETA 1GTEA 2IM3A 3T6JA 2YKMA 2QA1A 2MHEA 1B4SA 4OHXA 1PCAA 4TU9A 3C8YA 1XNRF 3G9CA 1X7VA 2F9DA 4K2XA 1D1UA 2CPYA 4ZMMA 5CH7B 3EVMA 1IKXA 1S9EB 1Q0NA 4LREA 3WZ0A 4D3GA 1KR4A 1CJTB 1FTRA 2BRLA 2O67A 3GIKA 1YJTA 1VOMA 1TV6A 2BJ9A 2WVDA 3N5FA 6AT1B 5IM0A 4DFJA 1IBKF 4QU6A 1LK7A 3R1HA 1YLXA 2J6SA 3TA2A 4ZVOB 4C4WA 2V68A 2ZUAA 1HKAA 1TL4A 5SUHA 3V2UC 5GAHU 3NMAA 1R0BG 2PC6A 3ZC4A 2GVZA 5ETPA 4EO6A 4HH1A 2XBPA 2RQCA 1QUVA 4PKDB 2W7OA 2MTLA 3CCVS 2XS7A 2LEAA 1IVZA 2DR8A 2NUHA 4LQ9A 3DN9A 4F3QA 3P6YC 3H5XA 1UVNA 5HJYA 2GW8A 3IA0A 2J9EA 4IO9Q 3DXSX 2DJWA 1YBAA 2GQQA 3IM9A 4JBCA 1I6JA 4P2MA 1IKWB 4QR2A 4DL7A 2MQPA 1K0VA 4FF4A 2HKEA 4XDDA 1P9YA 1HW8A 2GZOA 2XMKA 4URQU 4ZVGA 5FLXY 1KLMB 3MMAA 4NCGB 1H72C 4USUA 4B3SJ 1RACB 3M4XA 4K5RA 1HBOB 1XK8A 5DDRC 4RWXA 2DRDA 1KQFB 3LH2S 4FBUA 2CPZA 2LXIA 2QT7A 3UN5A 4DZ6A 5CA5A 2R4FA 1UCNA 2HVHA 2F4VJ 4L3KA 2BJ7A 1TMMA 4LRAA 3H98A 1TKTB 1X5PA 2FHOB 3RU0A 1J5OB 1OS5A 3MDFA 5KG7A 1AUDA 4QIWD 2MDAA 2C28A 1H74A 1NB7A 2KRRA 4DL6A 4CM0A 1SJQA 3DHXA 4ZPBA 3OFFA 1RBLA 3GIIA 2LQBA 2XI2A 3G2XA 3POTA 3VF0B 2HIYA 3I5CA 3OW2R 3FSIA 5GVQA 3RTVA 3GR0A 2IYIA 4P73A 4NX9A 1VQOS 4ZPVR 3L3CA 2VFTA 3BKFA 2J0XA 4DX7A 3FCHA 2LEBA 4LIRA 2ZJQQ 3T19A 4DSLA 3SSQA 3LAKA 5F0UA 2MQMA 4J5OA 1F2GA 2ZWPA 5LMNF 5B0FA 2ILZA 3PY8A 2A2DA 4WIQA 4B9NA 1NK5A 4F26A 2QIFA 3CJKA 2DXEA 1Q4RA 3QWUA 3MEGB 1XNRJ 4Q5VA 4YS2A 2MXYA 2CAJA 3KJQB 2BX6A 4RW7A 2YWWA 4DSEA 1S57A 1P8GA 2V69A 1IBCB 4NOHA 2KFZA 4DG1B 3CE8A 4IH6A 1NJIT 4RW7B 3HHLB 4YDDB 2QA4S 5L1JA 2WHOA 4QWEA 1XNQJ 2BM0A 3QLHA 1FK9B 5HO4A 1IKXB 1S9EA 2DVIA 1R89A 1DARA 3HLUA 2KO1A 3ZTRA 3WBZA 2V9KA 4ED0A 4LBIA 2V34A 3L9ZA 1Y0HA 4YB6A 4IOCQ 2GJIA 4FYWB 3TAMB 3R8YA 1DLOB 1QM9A 3IGNA 3MUTP 4TN2A 5M2PA 4B17A 3KLGB 3RZAA 3NG8A 1KOOA 1OYEA 3ZTPA 3D2WA 5CZVA 2KTQA 2D9PA 2XYGB 4YHHF 3QJLA 2GAGC 5MLCV 3DLLQ 1HW9A 2BA9A 3CJSA 3HHNB 2HQDA 1KP6A 2VDIA 2YKPA 1B99A 1R43A 3DRXA 3PYDA 3QFHA 2FB0A 2VUGA 2HNDB 4ZCLA 3OL6A 2JEJA 2A6OA 3C6TA 1ZZFA 4MKVA 2BM1A 2XGQA 3CCQS 1KN6A 4CLSA 2F8MA 1FWKA 4I4BA 3N79A 4Y2KA 4DMZA 2Q43A 2ZE2A 4FXVA 4KV8A 4UQGA 2PI4A 2AYMA 4F2RA 4JV1A 3QRPA 3SZ2A 1LV5A 3M32B 4DDFA 4QYZK 2DGUA 1SQGA 3BB5A 3HVWA 5A8WA 4EUVA 3FBCA 3PG9A 4GVBB 1WTFA 4K4TA 1JLQB 3H8YA 2Z2YB 4FPIA 1FNMA 2UVWA 5KFQA 4JI7J 1QD1A 1CQNA 2P9GA 1RHJB 1F0XA 4RW4A 4P75A 1YQHA 5LSOA 3H40A 1S76D 3AAWB 1SV5B 5I42B 1O5JA 1QSYA 2FJXA 3AODA 2RF2A 3AXKA 1N4LA 1WF1A 4KH0B 3WC2A 3ZZRA 3EVWA 4DR2F 3SBMA 4WE1A 3BSCA 4IFYA 2B51A 2K3KA 1BQNA 3R97A 2CQHA 4P10A 5CD4H 1URNA 2EFVA 3Q23A 3EDRB 2W01A 2ASDA 1XC9A 4PWDB 1K1SA 2XNQA 4PXBA 4PYAA 1ZYQA 1A7GE 4M5NA 5KFUA 2DK2A 4KGVB 1Q8BA 3CCLS 1WWHA 4DFKA 4R25A 1VBKA 1OSDA 1N5YB 3H59A 1NNDA 4M1KA 2YXLA 4UOHA 5EWFA 1ZS6A 3VALA 4IRDA 1RTZA 4L75A 4KPCA 3FQLA 2QL9B 2B4UA 3B8HA 2IVYA 3DYAB 3OTEA 1NK6A 2A10A 2YWKA 3BGRA 3I9V9 4DU8A 2OSRA 2RHQB 3LGHA 1NK4A 1AZSB 1S79A 2BR0A 1SJFA 1O8BA 4OYXA 3BR8A 5A8RB 1XTZA 2FY1A 3DDIA 4OHVA 4X4NA 5J1PA 3CO9A 1S7IA 1X5OA 5DDOC 1OSCA 1EQ0A 2ZH7A 1PO6A 3KXDA 2LYVA 1QVGR 4OMFG 4HHUA 1UWAA 3G8QA 1IBMF 2DO4A 3FK4A 1S6PB 3CB4A 4JV2A 3LP1B 1PYTA 2YPZA 3D6MB 2XMJA 4XPEA 1SJ1A 2Y3YA 2RIJA 3D6TB 3OTCA 4UF4A 2D74B 2R7RA 2DHXA 2HGMA 4YY3F 4Y0FA 1E6VA 5IQQA 4ZVTB 3KKFA 4L73A 5DJBA 2DR5A 3EM1A 3P4UB 5KOXA 1REGX 4MAKA 3C14A 4TYAA 1D8ZA 6FDRA 2MGZA 4NLVA 3OTOJ 3QPIA 3PZPA 1NU4A 4IG3B 2J7WA 2AGOA 4DV4F 4FXDA 1X60A 2IRXA 4ICLA 4XTTA 5M2UA 2V8VA 3CJ4A 5A2QY 3OSNA 1KOHA 1HNXF 4JYAF 2B43A 2VC0A 1YBUA 2I6WA 4BS2A 5CYJA 1REVB 2R2TA 3P96A 1TKTA 5JJBA 1RT7B 2CPIA 3KLFB 4J9LA 2FVCA 1KONA 2DPIA 5C24A 2W4PA 2G1DA 1KHVA 3KDNA 1IWGA 4FKYA 1AFIA 3UR0A 3GR1A 5HI7A 2AX1A 5L38A 2L08A 3W9JA 4KO0B 2OHDA 5T7LB 5DQGA 5J2MA 3FZ2A 4OYMA 1RGVA 4RJVA 2B8PA 1BGXT 1O0PA 1VRUA 3CD6S 1ZBTA 4HHJA 1Y11A 2JEGA 1XERA 4KHPJ 1HWIA 2CADA 3PTWA 3S6EA 4OZ1A 1S77D 3FFIA 2V94A 1JLEA 1HQUB 1TKZB 3ZZUA 1ZTTA 3IWXA 3PW0A 3CD0A 3GFYA 2LKZA 3RAXA 1S1VB 2VA3A 3PACA 2ZZTA 4YN3B 2W2PP 2YPYA 2POKA 1NKBA 1U0HB 1NKCA 2GNKA 3H4BA 5JUMA 1S0VA 1RE1B 1GEHA 1T9UA 4MJKA 3AD8C 3T9NA 1X4DA 1MMLA 2F3JA 2GA7A 2RSQA 3AOAA 1S48A 2YNFA 4HH0A 4PEOA 4Y28C 4YFUA 3I56S 4K4WA 1KD1T 2E5LF 1N33J 2HLTA 1BWEA 1WKKA 3FRZA 3OUYB 1WG1A 1ICEB 2NYHA 4F0MA 2RU3A 4ECVA 2DXDA 4JI3J 1GMVA 1S1TA 1OIAA 5A0YA 3DNCA 2XSFA 3G71S 2JLGA 1VBZA 1QAJA 5AXLA 4LSNB 1APSA 2HAFA 2W2QP 3ITHB 4IOBA 4ANCA 3CC2S 3S8SA 2GQ2A 1WHWA 2AEJA 2M4MA 3GSIA 4OZJA 5LSRA 2VHGA 4V19J 4KHPF 2GMJA 3RRKA 2CJBA 4DUYJ 2XG8A 2WBRA 4EEYA 1TAUA 1BWVA 3J80Y 1M5PC 2OH2A 1H2TZ 3M6UA 3GONA 3X1LB 2PD1A 5ADZA 1TK0A 1NDKA 1SCJB 1V3ZA 3M6XA 4DCOB 3K5PA 1JLFA 4UOCA 2X3GA 4EGLA 5LT5A 2KM8C 2PGCA 1A6LA 1RZMA 1TL5A 1KQSR 1FTCA 2XMAA 2UVVA 3I0RB 4LF9F 4DPTA 4LF7F 3D1OA 3HPOA 1X0FA 2Q79A 1WG4A 1FEHA 1YJWS 3CCRS 1TQLA 4UZBA 4DR1J 4X4SA 2I0XA 2VH7A 3TRGA 4DXLA 2Z57B 1BUXA 3KMSA 2CJKA 2FJBB 2VOPA 1JLCB 2WVFA 2LDYA 2KDOA 3I5AA 1QJHA 2ALZA 4JB8B 3TZZA 1N34F 2Y8WA 3R5AA 4FNIA 2W2OP 2KT3A 4HLBA 3CCES 5H9EK 1YJUA 4LR9A 4BC7A 1P1TA 2GJ2A 4RW4B 3LF0A 2ZM6F 4K59A 4PUOA 2ZZMA 4QR1A 3MR2A 4LFBJ 5AE2A 4GKJJ 4DF8A 5IT9Y 5AT1B 1JLFB 2J76E 4H4OA 1CS4B 2DNYA 3QLHB 2E9RX 1WC4A 3FEYB 2L41A 1HBNA 1LOUA 3GSDA 1EETB 3NS7B 4X66F 1LWFA 1K73T 4LBHA 4O44B 4PWUA 1DQAA 2BACA 2VBYA 3B6BA 1RSCA 3SFUA 2UXDF 1M1HA 1QAIA 2AJQA 1JKHB 1T9YA 3ETOA 4UOFA 4A8KA 2VB6A 3KWMA 4AFFA 1YRTA 4UW2A 3BO2A 3BYRA 3GP9A 3CMAS 3KNGA 4JP8A 4XPCA 1VIXA 3A4TA 3B78A 3ITHA 4WBFA 2DGXA 4DN9A 4ZCIA 1RT6B 3HSZA 3S1TA 5T14A 4J9MA 1T05B 5FJ4A 1FWLA 1GX6A 1I3OB 1HI0P 2Q3PA 2E7VA 2CQIA 3RBDA 1YI2S 2HHTA 3CD7A 1NBEB 4USHA 5I3UB 2XS2A 1NH7A 2LEPA 2IC3A 2EWHA 3NGSA 1MMDA 3AFGA 2KG1A 3JS9A 2HIQA 1RKJA 4IQMA 4ZLLA 3ENQA 2YNHA 3OJSA 1ZM9A 4PWWA 1CG2A 3OVAA 5L46A 2AMCB 3SIPB 4NWBA 3VGUA 4B3MJ 4B9SA 2Y0BB 3TUPA 3M2VA 3V81A 1JLQA 2C2MB 3W9IA 4DF4A 1WDTA 3NWGA 1UW9A 3CT9A 1M1KT 1IQZA 3IM8A 2MZQA 2V9WA 3TEHB 2OTLS 3M8PA 3QQCD 2E7WA 3BBFA 5B0GA 3DFEA 3OXLA 5LSLA 4JI5J 3OBIA 2KG0A 2NXCA 2PE8A 5IS2A 1OPZA 3Q2SC 3T41A 3RRGA 5A6WA 3NEKA 2AW0A 2ZNZA 1SUQB 3G87A 1NSKL 2Q6BA 3CW2C 5DGBA 4KIAA 2Z30B 2R8KA 3K0JA 3OVBA 1RKIA 2HLUA 1T9WA 3SMZA 4DEZA 1V6HA 1N0VC 2FGCA 1U8WA 1OO0B 2HQIA 3IO1A 4AQYF 4N7TA 3FC9A 1SKWA 2C3UA 3C16A 3EGWB 3VQTA 3GJRB 5H9FK 2R7OA 4JI1J 2GC8A 1RT5A 2N3LA 1C1CA 1DQ8A 4ZVUB 2FVQA 1X4GA 3BSAA 1RQ0A 3TNVA 1TKDA 1IUJA 2D3ZA 2DCUB 4WJBA 1S4FA 4DV1F 4GKJF 4MK7A 3LUYA 3OTBA 5A6PA 5L39A 1HQ2A 2D9OA 3IG1A 1RT1B 4X66J 1Q8KA 1UEVA 4G1QB 1XEZA 4EFAC 3T1YF 1S97A 3JQKA 5GAEI 3KHHA 1EP4B 1IM6A 1FRHA 4A48A 4ZOSA 4EBDA 4IRCA 2JFDA 1FJGJ 1WC3A 3DRSB 2BE7D 4LRFA 3NGUA 4R5PB 3MCOA 4N77A 3M2UA 1UTAA 5C2CA 1EKRA 2YNGA 2IM0A 4YQWA 1HNWF 2M3DA 4PG8A 4NCGA 3C6UA 3DLBA 4GMKA 1R8BA 1HI1A 2G0JA 3E01A 1RA6A 1WD6A 3N6LA 4ITSA 4O3OA 1R0CB 2YH1A 2K06A 1LW0B 4I6YA 2GQCA 3MMJA 2V2ZA 3D3BJ 2AEMA 3NY0A 4RW6A 2JWNA 4RW9A 1HWJA 3S01A 5DG7A 4ED4A 2CJQA 4DSJA 2DNQA 3R5CA 1IBLF 5D3GB 1RHKB 3MMCA 4GKKF 1R8HA 2IM2A 2FVRA 1FD2A 5DGAA 1YITS 1YZ7A 4G1PA 4LSLA 5KG0A 3W2VB 3T3FA 2DO0A 1U45A 4LF8J 4O3RA 1WORA 1ZH5A 1RK8A 2GHWA 1BMQB 3MAAB 2ADCA 4U7CA 2XSJA 4YB5A 2CDRB 3P8BB 4WFNQ 1JX4A 1T03B 4IOAQ 1G3OA 1HQEA 3C15B 4O3QA 3BM7A 5LJ5Y 2IAJA 3VCDA 1K8AT 4FP9A 2WW8A 1FJEB 2E5JA 2M52A 4ES1A 2L48A 2WW4A 3Q8PB 1DAXA 2R7WA 3UD3P 4L72B 5EX0A 3DLKB 2NZCA 4M95A 1BQMB 3IXQA 4NYPA 1IKYA 4ECXA 1SJRA 1SV5A 3TO8A 2MYFA 5I42A 1R27B 2GAHC 3HFKA 4YP3A 2DITA 4NZ0A 1X4CA 4C8ZA 1REVA 1SL2A 1N32F 2VV5A 3M8WA 1RAFB 3IRXB 3KJFB 3VGVA 5F8LA 3KK3A 4A8SA 3J7A1 3T1AA 3HHEA 4WZQA 3I96A 5D4NA 2WOMA 3FMBA 4DL0C 2JRSA 4DPXA 1CJKA 1O6XA 3MCSA 3ENWA 1FE4A 2QMWA 2UXCJ 2BOPA 2DXFA 4X4TA 2OEMA 3H42A 2CQ0A 4U8YA 4B3TF 2HBRB 2RT3A 4ZA1A 4ZLJA 2E5LJ 4WFYA 2RHSB 3W63A 1ELOA 4ED5A 4KSEB 3MAHA 2CPEA 4IDKB 3UCZP 1CJTA 3N0VA 4F4KA 4ZP8A 1U4BA 3NS5A 1N6QB 3K89A 2APOA 1VQSA 2EFQA 3EE3A 4PYDA 4DSIA 4NCBA 3LGMA 5EX3A 1SXLA 3GJQB 3MD1A 4CLFA 3MECB 5KG2A 1I94F 2F4FA 1J27A 2GJFA 3C6UB 5LXRA 3DXBA 1BE4A 4RL1A 1KBRA 2X7IA 2HFOA 5E5NA 5LMUF 4LSNA 2DISA 2RVJA 2A18A 3PRDA 4Z7CA 4FZVA 3FBEA 5DLGA 5HVFA 3V6KA 1OWXA 1EAYC 1EKSA 1S6PA 3MFIA 2LECA 3C15A 4DR7F 1UW4A 3JTNA 1B0PA 3G82A 4MKYA 2E9TA 2VG5A 4G3IA 1HARA 4KJIA 2IMOA 2QLFB 4PRFA 2IY5B 2HMIA 2CQ4A 2HFVA 2KFNA 1MSWD 1FO1A 4ELVA 1C1BB 4CTAB 4CNYA 2M8DB 4OZ2A 1UVJA 5B0DA 1Z2LA 5HROA 3BN7A 4F4YA 2XNRA 3HJFA 1LK5A 1WDDA 3AJ1A 3PIOQ 1NZ8A 3MM5B 1S1VA 3Q8VA 4X62J 1TKXB 3KHLA 4B3OB 1H6KX 5L1KA 4HEA9 1Q86T 1N5YA 1DTTB 4GRSA 3PO4A 4RNMA 4NXNF 4O3PA 2N4DA 4IG0B 1FI4A 3W5XA 4KC5A 1NKEA 2UXBJ 2JX2A 3BGOP 1GT8A 3R9LA 2XWYA 4ZHRA 5FD1A 1NJWA 3KOAA 1UAWA 4K4SA 2HFZA 3CEDA 3DRPB 3PHEA 2XMTA 3V5RA 2IPOB 5LMNJ 4FS1A 1UL3A 2CPFA 2OUGA 5KG5A 2ZJPQ 5DLFA 3NRBA 3KUEA 4ELTA 2QGFB 2EXUA 2YNIA 1NRKA 3R27A 3NNCA 2IAJB 2JC0A 2WTFA 2FIUA 1F1BB 5KG6A 3EDQB 5IWAF 4ZJQA 4DV5F 3M6WA 4V19X 2DNZA 1U47A 1YWXA 1JB0C 1JK9B 1Q8LA 2V8HA 2J7KA 2ZBRA 5C2GA 4QW9A 1KSPA 4DL5A 2J0QD 2B6AB 3R2CJ 2RRAA 3KUGA 2GGPB 2ZC4A 2R9LA 1TR0A 2OELA 3O2IA 3R6LB 1TAQA 2VQFJ 4NXMJ 2VFRA 2LCWA 4B02A 4DUZF 1FRXA 2DNMA 5ETKA 2HEKA 3ELHA 4NYOA 3CJ8A 3TZWA 2ZOFA 2CXEA 4KYZA 3AH6A 4UUXA 1G2EA 1MNEA 3V6DB 3MM9B 3VVTA 4OHYA 4F3MA 2OPQB 5F9NA 3SSRA 3KG0A 4RZRA 1RTDA 2RUSA 4DV6F 4B3SF 1WELA 5D77A 2Q66A 1F9HA 2MY8A 2DIUA 3OXGA 2D3O1 1VQ8S 3W8PA 3UI3A 4CO3A 2OD4A 4WTOB 4X65F 5HMXA 4C2MA 3OR1B 3ZZPA 2QZ8A 1UJ5A 2ZZNA 3NCRA 2BW2A 3H5SA 3CCJS 4ED6A 3CO0P 1C4CA 5KT7A 1M1GA 3DRRB 5AJ3J 1HBUA 2DRBA 2FJVA 5G0RA 1U25A 3ZFVA 2D1CA 2MQNA 1VGYA 4PG6A 3TVYA 2IJNA 3FEXB 4KFBA 2OPRA 2W8KA 4NLDA 2C3PA 4LRDA 4OJ1A 4ZP6A 2X1AA 1WG5A 2CIMA 2XTJP 1UFWA 2KH9A 1I1GA 4EBEA 3PX4A 4Q0BA 3ADAC 2OMLA 2XI3A 3FMWA 2OI2A 2BJ1A 5B0EA 2ALYB 3TQEA 1CSJA 1YZ6A 1UWBA 1HIYA 2GMLA 2V2QA 3OJUA 3THVA 1SBRA 4N8OA 2VL1A 4M5DB 5I3PA 3FCWA 1VC6A 2YKNB 2RKIB 2DCLA 3WX8A 4UOGA 1RTIB 3GPAA 4MYUA 2EBEA 3W5ZA 5CD4A 3H25A 4NL5A 5IT9U 2YKMB 3CMES 1U02A 2H48B 3GZ7A 1KHWA 1E6YB 3N6MA 4CI0B 4UQTA 4L6V3 1FXLA 2J8SA 3TUIC 2VJVA 1X9MA 4AT1B 1NHUA 2IA0A 2MHNA 4LVOP 4O23A 4DV1J 1T8EA 1TL1A 1YJNS 4I7FB 3TZXA 4I0WA 4DQIA 2FJWA 3U1LA 1FXRA 4JI0J 2WAQD 2C22A 2DH9A 4X64J 4NYZA 3O6QA 5J2QB 2BVZA 1VI7A 2I38A 3GYXB 3MR3A 3C46A 2JNJA 1AT1B 1U1RA 1FDNA 1GQEA 1HHQA 2BJ3A 3ONQA 4P7VA 2HQCA 1WC5A 1VBYA 1YIJS 3OVSA 2D3OR 1U1OA 3B4MA 3CCMS 1FDDA 2HYIB 3F44A 2HK3A 2V50A 1HNZJ 2EC0A 2HWHA 3DMJA 1KQGB 2K7KA 2CQDA 2VPYB 3H2LA 3MOZA 4J90A 4TVAB 3I87A 5D4LA 3VAKA 1X4FA 3UNGC 1J5EF 1UPMB 1K1QA 1A9NB 2AGQA 1KEKA 1PJ5A 1RWUA 2QL5B 3SEOA 1Q82T 4XIUA 3RGIA 3A8KA 3BN4A 3PEHA 3PFOA 1RLCL 2O5DA 4Q7AA 4QQBA 2CDQA 2BANB 5KFZA 4A8YA 1XJWB 4MMOA 3T6BA 4DBQA 1H98A 3EYZA 4F3OA 3GFZA 4MFBA 1IJEB 1VS3A 3FSXA 5J2MB 3OUYA 1IBLJ 4JI2J 2DNGA 4AQYJ 1VHIA 3MR5A 1RDRA 2AF6A 4OHWA 1KFSA 1MN9A 1Q7LB 2JVRA 3I31A 3IBWA 4J9UE 3DDKA 3SQGB 3TX8A 2IDEA 3O8WA 4OJ3A 2XY7A 1Y5NB 2HHPA 2IJFA 1PGZA 4LR7A 4RU2A 3BYPA 5ITHA 2E1RA 3CDEA 2ASJA 2HMIB 4DR4J 3KJVB 3V6JA 1FFSB 2B56A 3MMCB 3G6VA 1RWWB 2NCKL 4NLUA 4OX9F 4DL2A 1HR0F 2IRUA 3MEEA 5CXTA 4YUDA 4JYAJ 2P9CA 1M5OC 2VPZB 1KWMA 2AKWB 4OI4A 1FWPA 1HYSB 3QMQA 2QO3A 4MT1A 2H9ZA 4OZ5A 4OYIA 4DZDA 1HBUB 3U02A 3T1YJ 5CYQA 2DGTA 4ECUA 3PJ9A 1SC3B 3CULA 1S1XB 2ZUGA 3R5BA 1V5IB 4DX8H 2BQRA 3E2EA 4PQAA 3UWTA 3Q8SB 3M1VB 3HZEA 3KK2A 3ZZYA 1NM2A 2C2EA 2HS4A 4YR3A 2LVWA 1Y9OA 5HVHA 2QG9B 2DGVA 2AHOB 2WSFC 4CLWA 4J9QA 1FFWB 5E3CA 1U8SA 5C7PA 2DGWA 3TW0A 3W8GA 3PW2A 2VC1A 4UZCA 3D3CJ 4F67A 5H1SV 2GHPA 1S6QB 1X4AA 2JVOA 2YX4A 1AZSA 1JJ4A 1UEKA 4IDKA 4JI6J 2KZMA 1YG0A 2MY7A 1GXLA 4NPOA 3QSYB 3JXOA 4EMDA 3DYAA 4MYTA 4M5IA 2FVPA 1RBAA 2GGPA 3HK2A 2DT9A 4OI6A 3GTYX 2HVIA 4E8UA 4W98A 5M2RA 3W3SA 3TJ9A 4NA2A 4OYAA 3R5GA 5F0WA 3H7HB 1YKWA 2E44A 3MUMP 4C8NA 1LW2A 3KNAA 2YVSA 3MEKA 1WUUA 2MLZA 4MKAA 1NZAA 6FD1A 2CPDA 4ZPDA 3HT0A 4DQSA 3A8JA 3HFVA 1J5EJ 4KBIA 2B7CB 1NPRA 4EBCA 2ABYA 1DY3A 1HD0A 3CDBA 1UETA 3LGNA 4WFBQ 3AQPA 2ZH5A 4A8MP 1UA0A 2HZAA 3LP1A 2G9OA 5HATA 2ZM6J 2YX7A 1LXJA 3VAIA 4KTQA 1NDLA 2H5EA 4XO0A 2FVSA 3MEDB 2ZBCA 2PMWA 4TKTA 3Q8QB 2QA4G 4J91A 3SFGA 2VPXB 4TYBA 3QGHA 3R7NB 2MQOA 5E2QA 1IBKJ 2HVZA 5AE3A 2Y1JA 3PR5B 3A3NB 4NLWA 4DS4A 1VQLS 3B4DA 1RWKB 3FBBA 4I2QB 1U1MA 2BUNA 1BY9A 2ZWOA 2RU9A 3R7BB 4UUWA 5C42A 1QAXA 2ILYA 3LTOA 2CQ2A 5HROB 3SCIE 1S6OA 2YTCA 1VBXA 2ASLA 1KLNA 1PJ6A 5KFXA 4OX6A 5HLFB 2Y8YA 4F2SA 1A0OB 4DN0A 2FD2A 1TV6B 5IM0B 2B9EA 1HMVA 3GE9A 4NI2A 4Q2MA 4R8UB 4ZP7A 4TQRA 3KK2B 3BO4A 3U7JA 3UDLA 4I69A 2AP6A 3LPYA 4YR0A 1E6YA 2VDHA 4J37A 2RILA 1OJ4A 2DYAA 2B9WA 3OTDA 2XWXA 3B54A 3M8QB 2D41A 5C24B 1TK5A 4F4AA 2CJXB 2MZJA 2ZVIA 3TP2A 4AE5A 1QUPA 1RTIA 2VFSA 4EYIB 3WIVA 2C2DA 4QOTA 3IN5A 3LALA 3HSGA 5IWAJ 3HM9A 3RBXA 5EN1A 3PHTA 2DNHA 3HVTB 1T94A 2IYGA 1MROA 1H38A 2RRNA 1TFYA 4W92B 1R31A 3ISZA 2UVUA 1QTNB 2IBKA 2DBBA 3Q8UA 1C0TA 4ZPCA 2QYCA 4GO5X 3IR7B 3PM9A 4H4OB 2XMMA 3WQPA 1IJFB 3KLHA 4U7UK 3SV3A 1PG5B 2DB1A 2HNDA 2RQ4A 4CM2A 4ZIVA 3KYLA 2HHSA 3EGNA 2ZBQA 1N5QA 4I6WA 1MLAA 3IRWP 2HHHF 1C4AA 1X4BA 4WFXA 4U6PA 3TR5A 3TWZA 3BDPA 3HX9A 4X62F 1H7XA 3DLJA 3GIJA 3K58A 2CWXA 4UY85 5DZ7A 1W2BR 1R8PA 4Q45A 2LP4A 2NREA 4F4ZA 2B4VA 5AJ3F 1DLOA 4OV1A 2Z8QA 1C0UA 4IUFA 1U48A 4FVMA 3VGTA 2FJDB 2VOOA 1U1LA 1KFDA 3K8WA 2OEKA 2QV6A 3R5DA 1TZ0A 2KYZA 3HHKA 5AE1A 3IR6B 4IFVB 5IV4A 1SUQA 4KH1B 4USWA 2KN4A 1D3WA 1Y10A 2HNZB 3POTB 5EUHA 3HO1A 2YKAA 4AXIA 4FS2A 1PSDA 5D15A 5A8WB 4OYZA 4FXWA 4WKRA 3D9BA 3MAQA 5KT3A 3IS9B 3VR1A 2MSTA 3HT3A 2QL7B 1CVJA 4WK3A 1D9AA 3G86A 3MPVA 2IJRA 4Y6IA 2DH7A 5ETTA 4HDHA 3G8SA 3DRRA 1FNOA 4JI4F 3GG1A 4LF7J 2DNRA 2ZDPA 4RWWA 3VV2B 2XYHB 3NKYA 4PQUB 3M2VB 2XCAA 2B9YA 3NP5A 4KGMA 3ZO7A 4QCLA 5HP1B 3BSNA 5DO2A 1N33F 2ZHAA 2WB1D 4YDXA 2BW7A 2BE2A 1WEYA 5D78A 4X4OA 4O0IA 3K5NA 3R1LA 2RF2B 3RAQA 2ROEA 1NPKA 3TQ1A 4ZPTR 1FE0A 2B5JB 2FHJD 2RQMA 3JQMA 1WKLA 2Y1RI 4CT9A 4A46A 1T05A 2BDPA 1FRLA 1FKOB 1QE1A 2VQEF 2DD8S 1W26A 3ENAA 1Y3KA 4KRWA 4P52A 1KTVA 2FGOA 2OFHX 3M8YA 4B9MA 1EP4A 4GVLA 3ISNC 2FJAB 1TK8A 3OPKA 1PILA 3TZYA 4Y2AA 1Q53A 1ACMB 4FYYB 2YWEA 4I64A 3DLHA 4O44A 2E9ZA 3H5YA 4K0KJ 2ROPA 3QGIA 3UCUP 3T5LA 2Z2LA 2ZKUA 2RJZA 1WI8A 5ETSA 1S0MA 1V5VA 2HFSA 1RWOB 4URSA 1Q16B 3AY0A 2ZHOA 5D0HA 3NOCA 4HT5A 3OR1A 5GAHI 3TANA 2BRKA 4ANEA 1HBOA 3LWMA 4E0DA 5CZXA 3SCLE 5KFMA 1FRIA 4DR2J 5CYMA 3IC1A 4PABA 4A8XA 2F1FA 2CJ9A 2HZCA 5IQ6A 2HHHJ 2RB7A 4DCPB 5GADU 4AD6A 2MMYA 4JI8F 4JV0A 3Q8YA 3E3XA 5ETQA 5KFRA 1LW2B 2EFOA 4DV3J 1DTQB 3ENVA 5ETMA 2CZ4A 1XR5A 3PYEA 2H65B 2RE1A 4RU9A 1RCXB 2RQKA 1S1WB 3PFEA 2DR6A 3D1HA 4KKOB 2DH8A 4K4ZA 5DRKA 2E1MC 2FLNA 3RG6A 1PYSB 4Q0BB 2K7JA 2WSEC 3S7RA 4JV5J 2V63A 4P6QA 4DV2F 3F56A 4C6AA 5A2QU 4GC6A 4TLQA 5D6GA 3L4BC 3CPWR 5B08A 2QX0A 4ZK7M 1VRQC 4IQXA 3LQVA 4NMLA 4LMZA 4S0MA 2UUWA 4ZVPB 3DKDA 3KK3B 2CUYA 1JXEA 2NXJA 3DGPB 4PZVA 2B9XA 4TU8A 4WXWA 3TJAA 2Z4PA 4UTGA 4CDIA 2XEXA 4JUZA 2KL8A 4DI6A 4HYKA 3CTRA 3P45B 3Q86A 2UU9F 1GNKA 4C0BA 4EO8A 2DKOB 2BE2B 2CJAA 3NCPA 4FKXA 2UP1A 1H2UX 2V4JB 2UV8A 3HSDA 4CLKA 3O3LA 2RRBA 1JJCB 1DQ9A 1FKPB 5DETA 4N56A 2C3MA 2DNOA 1NUEA 3A12A 4GO7X 4ECWA 1NJYA 4R8UA 1IM4A 1YRUA 2DTJA 2EFNA 3GJSB 4WP3A 3J81j 3JSMA 2A2CA 2DHHA 3PRBA 1HNXJ 2AYBA 3IBFB 2R7QA 4FDFA 1YK9A 2GVZB 2MJUA 2QLWA 2V2VA 3CJ2A 2VICA 1TKZA 3SI8A 3A3OB 2C1EB 3KDOA 3KLIB 3M6VA 3IGVA 3QIPB 4WKYA 1CEZA 3ISND 1LWFB 1Y7PA 2A0FB 2LXFA 4CT8A 2I2YA 1LNQA 1RAHB 2NPIA 3LP2A 1L3VA 1R0AA 2ZBPA 1SKUB 1LW0A 2H1YA 3G6ES 1U26A 2WRMA 3W64A 2V8DA 2MLYA 2VD3A 4QU7A 2RDDA 1K44A 4Y00A 1FX2A 1KLMA 1W7WA 3MMAB 4C3MA 4RNNA 2XHWA 3EWGA 2B4OA 4JOUA 4QYZJ 2QYGA 1T9TA 3K5MA 1IKWA 3HHLD 2C2OB 3MPYA 3M9MB 1MWYA 3T1HF 4LF4J 3CC7S 4FF1A 1RXOB 3CCSS 4OZ0A 3T9ZA 3RB6A 1Y00A 3MFHA 2DNPA 2RDJA 3IWNC 2Q1LA 2ZEJA 1RTHB 1PC5A 3MM5A 3ZNJ1 2UVRA 4DR5F 5D4OA 2DGOA 4HI1A 5KT5A 2NQPA 4OYBA 1KTQA 5ETNA 3W61A 1DBDA 4ID8A 2CG4A 2EK1A 3ET6A 3NCQA 2UU9J 3KJNB 5KG3A 1FXDA 4HACB 4LSZB 2UUAJ 7AT1B 2CNKB 4C9DA 2MQQA 1Q7YT 4JI3F 1FCAA 4YEAA 3J7YU 5KFIA 1X5SA 2NLWA 4P2FA 2AX0A 3N01A 4EYHB 4MIBA 4ZVSB 1BQMA 5CYQB 2JL9A 3GG0A 3SCJE 3JSBA 4X2BA 4D3HA 4LF4F 1RWXB 4M5DA 4CO2A 3OL9A 2FC9A 5IFMA 1FK9A 1DZ5A 1S9GA 3PNIA 1LWEA 5GAGI 1VRTA 3H2VE 2YNFB 4XK8C 3Q24A 1FT8A 2K1RB 3GJTB 4C3LA 3UDCA 2UUBF 4IH5A 1GAOA 4WXOA 5A8RA 3IG1B 2ZVSA 3R5JB 2EEYA 1GXUA 3DLGB 3PXGa 4KB7A 2J9DE 2JLEA 4WU3A 3PKYA 3NGKA 3P5TL 5KT6A 2XZTB 4TY8A 3KLVA 1CJKB 5J2NB 5BR8F 4QWDA 1L3KA 4AXJA 2AJ0A 2P6TA 2W2NP 3AD9C 4IO1A 3ZTSA 1S0NA 4LF9J 4O3SA 1WC0A 1IXKA 4GC7A 2XB2D 1JLEB 4JI5F 2BJ8A 2LA6A 3IMQJ 3GMGA 4M94A 1FKAF 4U9RA 1YX2A 5BJRA 1CPZA 3EMTA 1NDPA 2F8EX 4CIOA 3MCMA 2WZ1A 4X84A 4M5JA 3SQOP 2GCFA 4J9KA 4CYUA 2RDIA 4LR8A 3MM9A 3R7SB 1VLOA 3MTJA 4NASA 2BJDA 3M2UB 3QAUA 4ZVFA 3N4WA 1KVIA 2HVEA 4Q44A 2DY1A 3GIRA 2PFFB 1AFJA 3I32A 3QSIA 5F8IA 2HHVA 3QATA 2FUG9 1S12A 3LOUA 4NLRA 2VG6B 2C2RA 2KVIA 5IC6B 4DUYF 4DPYA 4WWSA 5EWGA 1Q5VA 1S9FA 4UY8T 5F8HA 1EHWA 3MD3A 1U0SA 3BPSP 3BKUA 4CLTA 1Q78A 3D54A 1AXQA 1PJ7A 3PYFA 3C6TB 1MG7A 3UD5A 1QTMA 2I1RA 1WC6A 1HFEL 2BJEA 2QSWA 3X3UA 5F9LA 4NMXA 3TUZC 3W9HA 1PBUA 2ZE2B 4KV8B 1IR1A 2D69A 4MKBA 1RT5B 3AB4B 4NEYA 1OMSA 1UJ6A 4C8MA 1EQMA 3THTA 4DL4A 2M0GB 1OQ6A 4RW9B 4E2FB 2YKOA 3PKMA 1FF2A 5IT0A 2R7XA 1ZAVA 3ILJA 4OHZA 3OLBA 2JJ4D 4OI2A 5K8MA 1NK0A 2O3DA 1GH8A 1WHVA 1VC5A 1F60B 2K3IA 2BKPA 2HWTA 4YMEA 1X4HA 4ED2A 1UVLA 3EGZA 4PR6A 4ELUA 1WI6A 2JEIA 5B7WA 3GCXP 1XNQF 3CMQA 3DRSA 1S4EA 1CC7A 3NAHA 3UN3A 3DM2B 4LF2A 2UUTA 3WDOA 1HBMA 2CNOB 3LPEA 1R3NA 2ZKTA 4KGKA 2PN6A 4QBUA 1UA1A 3KMQA 3J80U 2MJNA 3HDSA 4NZ7A 4WK1A 4U7UD 1VQ4S 1UJ4A 2V5HG 3CDAA 1C0TB 5DDPC 2UV8G 4USMA 3MOJB 3WHIA 1N52B 2DGSA 2WVEA 1G6BA 1ROFA 3D67A 3ZTOA 3BQ2A 1VQ6S 2LA4A 3NAIA 2BXJA 2HHQA 4CH0S 2OKQA 2C2KB 1HNZF 4YOEA 1FKOA 1QE1B 2HWIA 2O1PA 2OPRB 3EJMA 2LXUA 3TAPA 1IBMJ 4X4VA 4W90B 1JJ2R 3A8IA 2ZNYA 3MGJA 2PT0A 4DV0J 4J9SA 1RYSA 2LLZA 4OYOA 1M5KC 4C8LA 1NB2A 3AOBA 1U2RA 2GMHA 2QE5A 3PRVA 4ED3A 5I3UA 2OPQA 3PYGA 3V6DA 2EFPA 2R2RA 1VQMS 2IVFB 2EG2A 3OTOF 2KT2A 1UPPA 4C8OA 2ZH3A 1WKJA 2WVCA 3W5YA 2Y1LB 1TTHB 3QJJA 3BDEA 2NZ4A 3H0PA 4I2PA 2MZRA 4QJVA 4RUCA 4DV2J 2BEFA 1T11A 2WBMA 3A8EA 4KHRA 1WC1A 1YJ7A 2GX8A 5C42B 4TQSA 4Q8EA 2LDIA 2GV1A 2OMOA 2JFKA 4KHMA 5HVGA 2OFGX 2M8HA 3IRXA 4K0KF 3MWBA 4NEZA 2HGNA 4DJBA 3MPWA 2WSCC 4WCEQ 3D1QA 3V4MA 4BBYA 1J5OA 3CDWA 1C0UB 2MKJA 4ZHRB 4N5SA 3VAMA 2R7SA 3NMRA 4K5SA 4OYPA 2WONB 4KO0A 5T7LA 3LA0A 4ZCKA 2OJ3A 1SB6A 1UKUA 2DGQA 2OGUA 2DHSA 1DTTA 1HI8A 4RR5A 3BH6B 4YHHJ 1SQEA 2IFXA 5LOQA 1N5TA 2XLJA 5J2PA 4JI8J 5HP1A 1S7HA 3ULHA 1Y5IB 1SL0A 1HQEB 2EFGA 4NLTA 4PG7A 4DR3F 2M7SA 4RW8A 3M2RA 4O0NA 4LRCA 3DLEB 4PXEA 4X65J 3NGDA 2AZ3A 3QNWB 5H9EJ 2OPSB 2E1CA 4LF8F 2P2CB 4OQJA 4QPTA 3BKTA 2R7TA 1TKXA 1YJ9S 3OHAA 4I6AA 2EW9A 2HG4A 2FPHX 3CGIA 3NLCA 1D8YA 4Q8FA 2IA6A 1BXNA 3QJPA 1TFWA 2FHKA 1FJ7A 2R8HA 1SC1B 3T5JA 3MM8B 5HBMB 2CQCA 4O3NA 1MROB 1S6QA 1NK7A 1WTBA 4FVCA 3Q8RB 1NHKL 4JV5F 5I4MA 1RB0A 1B0VA 3L7OA 5D4PA 4F7VA 3FKBA 3D5MA 4ZP9A 1ZAWA 1HBMB 2XZDB 3G82B 1VRTB 2L3MA 1FRMA 1MW7A 3D68A 3MEDA 3TEGA 2H3EB 4DX5A 1VK8A 2H4YB 2ADBA 3JYTB 3GILA 1LFPA 4NLYA 4RPFA 5K8NA 2GVDA 4DOZA 4J9VA 2KJVA 5ETRA 1OQ3A 1CULB 1N6QA 1HPZB 1NAQA 4DPOA 4ZKAA 5JVHQ 1U2FA 3CXCR 4DLGA 3FGVA 4LF5J 2H5JB 4E98A 1S6UA 1JLAB 1KNZA 2NYIA 3OXFA 1WACA 4TNOA 4PPDA 4TXSA 3DI6A 4C11A 5FDLB 3W2WA 1K0TA 3UN2A 4ECRA 3MM6A 1S10A 2YQ3A 1VJWA 1JLGA 2BMBA 3QT8A 1VISA 3SDEB 4ILLA 1RTHA 2AJ1A 2R8JA 2XC9A 4X64F 1F2HA 3A1YG 3BF4A 3MM6B 4PXCA 2XMWA 3SQGA 5ETVA 3EGVA 2HAIA 2V2KA 1U6FA 2KHDA 3MTKA 4C48A 1N5SA 2LQJA 1HNVA 2KRBA 4RW8B 2K8GA 2WOMB 3E8OA 3MZIA 4RBUA 5KFJA 2ZH9A 4K50A 3M8QA 1RISA 4F8RA 1RT2B 5HANA 1JQGA 1RAEB 1ZPWX 1S1UA 1XIQA 1YGYA 2D7SA 3DDNA 3DRPA 2BOAA 3NOGA 2CA9A 2EI5A 2NXNA 3GCWP 4Z37A 4B9LA 4NZ6A 4CH1A 3CC4S 4RNOA 3DLKA 1T03A 2N3OA 5J1EB 2R7VA 1SC4B 2HZVA 3PW4A 1WHXA 1PAUB 3C19A 3GIMA 4XAKA 2IIHA 4BWMA 1EX8A 2BE9B 9RUBA 1WNEA 3LANA 2Y1IA 2WVBA 3DU5A 1NEEA 4QIVA 3TI0A 3QIPA 1EZZB 3JSMB 2DRAA 2Y9HA 1RT4B 4NLGA 3H5UA 3IR5B 2MKKA 2MLXA 1SH0A 1FERA 3GFHA 3GV5B 3PW7A 3NL0A 1JIHA 3QRRA 2RUGA 3AT1B 3W1YC 2FTRA 1CJVA 3ZZOA 3DLEA 4DU7A 1RA7A 1VCTA 2XHCA 1RBOB 2H5IB 3EICA 3PDNA 4ID5A 2QN6B 3CCUS 2IC3B 4P72A 4F0HA 4QW8A 1IKVB 3KHRA 5U47A 1FA0A 3BGUA 3VZHA 2YNGB 5CAAA 2BANA 3MR6A 1I94J 4R0JA 2BZ2A 3I4HX 3TARA 2V0NA 3HD1A 1YTYA 2CVEA 5EHHA 4X4UA 4ILMA 5JXSA 4CO1A 3IBCB 3DRYA 1UFKA 1KC8T 1VIOA 4NLQA 2GHVC 5L8RC 2PEHA 3KTQA 4HTJA 3M7VA 2ZFHA 3IS9A 1KQKA 3PO5A 4M5HA 1D9DA 4EU0A 4EZ9A 4CLYA 3QT7A 5GMEA 4H4MB 1GFWB 2CRLA 2DHAA 3DCAA 4NXMF 3DOLA 4L74A 3GLJA 1N32J 2CNLB 1M90T 4IFVA 3HULA 2U2FA 4FBTA 4KFBB 4EI2A 2MZTA 1L3UA 5LXYA 4TY9A 1FRKA 2XO7A 5BR8J 5T41A 3KG4A 3BQ0A 4AL6A 5GMDA 3V4IA 1QDUB 3ILIA 4DV6J 5KFBA 3T5HA 4OLOA 4F0KA 2JLFA 4RUHA 4OZ3A 4ZVEA 2NR0A 5AXNA 2YH0A 1NMEB 3OHBA 2XS5A 1J2VA 3P49B 1X9WA 2JOQA 3M1VA 1X5TA 2UUCJ 4KGXB 1JXVA 1R6VA 3KHGA 3D7SB 2CQPA 4F02A 2OPPA 3NWRA 4HR2A 2QLXA 1MWQA 2CQBA 2EVZA 2ASYA 4QWAA 4LFBF 4RO0A 2YWFA 5GAEU 3OL8A 2KB2A 2FC8A 4DX6A 2XLIA 1VK3A 3SSSA 3GB0A 2ZH4A 2FLOA 2ZBIA 1ZM2A 3LP2B 1YJRA 1RHRB 3J7YI 2VQEJ 2PSZA 1HYSA 3MM7A 2OIHA 2HNYB 2MQLA 2J8AA 4KY3A 2F65A 1SKSA 2R7UA 2OO4A 4G6VB 4DG1A 5IT4A 3KLIA 4RKUC 2GO9A 3QO9A 2W9BA 3BBCA 3MI7X 4OJHA 4K4VA 1NDCA 1ZM4A 1MWZA 4LFAF 2COLA 2ACMA 2XCPA 2OPSA 3CDUA 1BHNA 4I7FA 3I4PA 3CJTA 3RUBL 2NXUA 3M2RB 1KRPA 4DQPA 2E29A 1IR0A 1Q8IA 3OLAA 4J9OA 2GS8A 1RT3A 5A0YB 3DOKB 4WPAA 1SIWB 3DOKA 2JSXA 5GMKa 2HS3A 2MKHA 2KHCA 3DGVA 3M05A 2VBXA 1D09B 3U1MA 8RUCA 5IZHA 2KM8B 2HBZB 1PBAA 1RABB 3MUVP 3W60A 1R7IA 3G6YA 4A8FA 4PQUA 1O51A 1X9SA 3W7BA 4JI0F 2E66A 3KLGA 4DSKA 2PI5A 1URRA 2V4QA 2J9CA 1WF2A 2IBOA 1JLBA 3NGRA 4ANDA 5J2NA 4BCAA 4NE9C 3L09A 2ZOMA 4L76A 5K20B 2H51B 4J9NA 1SJ4P 4M5KA 1B64A 5CABA 4IYQA 4OZNA 3EPGA 2HNZA 2IDLA 3QT6A 3TJ8A 5K8PA 2AEFA 4DPUA 1RYRA 2P9EA 3I5BA 3EXYA 4WTYA 3SCKE 4URGA 2E1AA 4PPZA 1FD8A 3BEGB 3MEGA 5J1NA 2ZH1A 1UVMA 1S1WA 5FLXU 1N88A 3UNYA 2OPPB 4ES2A 1C1CB 1VQPS 1TMJA 4U8VA 1GTHA 4PUOB 1JLCA 1RAIB 5DQIA 4KR0B 2J7UA 1V9OA 4IRKA 1V3RA 3PIPQ 1N36J 3T1HJ 2MSSA 5KT2A 3PJWA 1HWKA 1ZA2B 2RNEA 2PMHA 1DRZA 2J6UA 4LIWA 1RI7A 3AA8A 2G2YA 2XGPA 1P27B 3V4IB 1SKRA 5HMWA 5KAKA 2UXCF 3BV8A 2IMWP 2L9WA 2HGLA 2NXEA 3LO3A 5KFKA 5K5MA 2XY5A 3KUHA 4TY8B 3HHDA 2BKOA 2LMIA 2FHMA 5CHCB 4F36A 1NLKL 4PAAA 4F25A 2ZH2A 2B6AA 3Q0AA 1PC4A 3DHWC 4LVNP 4OYWA 2E5IA 2L9NA 2XYPB 2Z2ZA 1E6VB 4QR0A 4CLLA 1B70B 2W9CA 2VG7B 1LWEB 1OY6A 1VC0A 2UXDJ 2DNNA 3RBEA 3HXMA 3FBFA 4CZCA 1AW0A 1ITPA 1Y5LB 5LM7E 3AOCA 4NCAA 5EWEA 2DNKA 3CJQA 3TA1A 3GV8B 2RS8A 3AQOA 4O4RA 4A47A 2DNLA 3VAHA 1S49A 4DR6F 1N5VA 1IR2A 1FHTA 3UE2A 1H2VZ 1GXTA 3HHLC 3FDSA 2HK2A 1T3OA 4ZS6A 1T9VA 4BC9A 4ATNA 1M5SA 1T02A 4DR7J 1S1TB 1Q1KA 1RT3B 2AJ4A 2CZ9A 1VHFA 3O5TB 5LJ3Y 3LW5C 3PX6A 2DY9A 3QWPA 4G65A 1NPPA 1Y3JA 5KFFA 1EIYB 2YWGA 3KG1A 4ID5B 1M5HA 3HZGA 5HN0A 3HVRA 2XY6A 4TLRA 3D6HB 1Q81T 4BDPA 2FZGB 1N48A 1FESA 1LWCA 1TL3A 4P7TA 1H3DA 5CQGA 5BYRA 1HNIA 4WF9Q 1H7WA 2FLPA 2VG6A 3NXZA 2VG5B 5JVGQ 2UZAA 4I2QA 5EDWA 1U1NA 1HBNB 1ZM3A 1VRUB 4LBPA 3MF5A 3L7PA 4LF6J 3BGLA 1RWPB 5KTQA 1TL7A 2CKWA 1RAGB 1KVKA 2CPHA 2V4JA 2ZITA 4FF2A 4QIEA 2EK6A 2FZKB 4HDGA 3UFCX 3J81Y 2MKSA 2G4BA 4LUBA 1RT7A 1ULRA 4WIIA 3KLFA 3M30B 4DFPA 3BPDA 1OYDA 1DJ0A 3ZZTA 1CLFA 3RJMB 3ZZ0A 4C8KA 2EPIA 4H4KC 1RUSA 1FDAA 3FVYA 2RH3A 3PR4A 2AD9A 2VONA 3GU0A 1NJXA 1RU1A 2GIFA 5C25A 2N7CA 2XQCA 2X1BA 1GMWA 3LAMA 4ZPWR 4ZDNA 2KXNB 3G4SS 4OI1A 3QGGA 2VQFF 3QAEA 3QIDA 4C8YA 4HKQA 4XDCA 2R42A 2P8IA 2YX1A 2ATLA 1PKUA 2HVDA 3OV7A 2H4WB 3FEZA 5ETLA 1G7CB 4DUTA 4WP9A 3SDEA 4G1IA 1F3FA 3CJRA 1EB0A 2HQFA 4QIGA 1VQYA 1S9GB 4RX6A 3G8TA 2QFJA 4J9RA 4AL7A 1Q95G 1CULA 2QA2A 2HRUA 2P5VA 2QSFA 3C14B 4IKAA 5DM7Q 4P9SA 1CBKA 4QPXA 4H4KA 2E5GA 1JNRB 4Y2CA 5F3TA 5HMYA 3IAS9 1NO8A 5I3QA 1TVRB 2BABA 2AIRB 4ILRA 3BQ1A 4I67A 2UXBF 2BKNA 2D3UA 2QLBB 2W7AA 3MECA 4Y2IA 3PEJA 4Y34A 1T95A 3UPFA 4KAIA 1U6BA 4ECTA 1B7FA 4K4UA 1SVDA 3HF5A 3JTOA 7FD1A 1ZTWA 1WEZA 2MPUA 5KFCA 4Y3CA 1UVIA 5DG8A 1DURA 4LJMA 3IAM9 4ECZA 2HBYB 2X1FA 1ZAXA 2B7BB 3AA9A 3MAAA 1RAAB 4DR5J 2HBQB 1VR6A 2G13A 2W24A 3ET6B 5RUBA 4F50A 2NS1B 1U49A 2XZWA 2R8IA 4LSLB 4ZVHA 1X31C 3TX0A 3CUNA 4B3TJ 3EXCX 2M5YA 2I5JA 3RRHA 1KDNA 4KE5A 2V67A 1XWLA 2M2BA 2MEWA 4Y65A 3M9NB 2C42A 1UP1A 5H9FJ 4W4MA 3KK1B 3UQSA 3VAGA 2HHUA 3BS9A 3HMJG 2UUAF 1VQ9S 4X4QA 2PEBA 2MKIA 9ATCB 1V3SA 1DTQA 1BQNB 2YNHB 4FYVB 1W25A 4OI0A 3C16B 3HFZB 4IR9A 1OPIA 5J1EA 2WONA 3H2UB 3TAQA 1L5UA 1JWWA 1IKYB 3F41A 3MPDA 4A8WA 3JSYA 3VTIA 3NGTA 1TUGB 2GIQA 2LU2A 2A6MA 4MK9A 2KJWA 3RYLA 4ER8A 1N54B 4PG4A 1SJ3P 3E51A 3GYGA 3HKZD 1TL7B 4WE1B 4MK8A 2M9KA 2MQ8A 2CJYB 1Q79A 4WFZA 1VQKS 3KLEA 4RLEA 1FVSA 5KFPA 4USIA 2OLWA 2W9CB 3VAJA 1QVFR 2FZCB 2PDAA 5DQHA 2XMUA 3OL7A 1SIZA 2FYXA 3OR2A 4LF1A 4F4WA 2XULA 4A8QA 1U1QA 1LQ9A 2VF3A 3DMJB 3EUNA 2NUUG 2X51A 4M5LA 4OX8A 3Q22A 4M5MA 2HNYA 2VODA 1AYEA 2QC3A 5FIIA 2QFIA 5KFYA 4ECYA 3K5LA 4M63A 4WYLA 4A8OA 4IG3A 4ZLNA 4LQ3A 3K8VA 3P5BP 3Q83A 2G2ZA 2PMZD 4NLOA 3M8RA 1L3TA 2J0SD 1HWUA 3DI6B 2A3JA 3VZIA 2BYCA 2FJEB 4CYUB 3BO3A 4ED7A 4RW6B 1BQXA 3R2DJ 2ZC3A 5C5JA 3W66A 5IXUA 3D28A 3PCOB 2GIRA 2L9DA 2H54B 1NK9A 3E01B 2C2ZB 1X4EA 1N34J 1QLNA 3BR9A 2HFNA 1ZZNA 1NCLA 3MR7A 3QT5A 1RT6A 4P2XA 4DCJB 2UUCF 2KFYA 5LMUJ 1UWBB 1RU2A 4N76A 2VG7A 3I0RA 3HHLA 5THWA 1HHSA 3I0SB 3J7ZT 3M8SA 4ZCMA 2I5JB 2V8GA 2YQ1A 4YB7A 5KFVA 7FDRA 5CCLA 2RS2A 2V6AA 2ATCB 2RMLA 4RUBA 1C1BA 5E3PA 2B0GA 2MKYA 4YB1P 3FSYA 2EKYA 3EZUA 2OTJS 2KI2A 3MEEB 3OT9A 2ZD1A 1FRJA 1YBTA 3QYYA 1HHTP 1C2PA 1RHMB 3DM2A 2CVIA 3MM7B 3CJ3A 3HVTA 4BLGA 5HJXA 3CD5A 3DOMB 4OI3A 1JJHA 1TELA 5L1IA 3JQJA 3WIUA 4V1Ak 2JH3A 2CQGA 2OP5A 4X4PA 3CJKB 2J9DA 3GFXA 2PIIA 1XR6A 1RHQB 2N7YA 3AHPA 1KS2A 2Z58B 2HS0A 3CSKA 4MH8A 3M9OB 4LF5F 4PWDA 3TVKA 4ZN3A 4HACA 4ZPAA 3US5A 1GMWD 1HL6A 3JAMU 3CF5Q 3N9UC 4CNZA 3J81U 3RB0A 1SL1A 1RJJA 4FYXB 4CLZA 5IV3A 5EGYA 3CNQP 1SPBP 1CJVB 4PG5A 4CLPA 4ZITA 2VU5A 4DR3J 4B3MF 4RBTA 5D0GA 3FCVA 4ERDA 2FY8A 2EC2A 1XMBA 4N8NA 3BJYA 3VHQA 2CFXA 4FF3A 1T9XA 2F4VF 5GADI 1FJGF 3EZOA 5BXIA 2VKZG 2DR7A 5B0AA 2MZSA 5BYQA 1F6TA 4ALZA 2U1AA 4FNHA 3OR2B 5E7OB 2M70A 5KFWA 1S5ZA 2PA8D 5K8OA 3RW7A 5B09A 8AT1B 1N56A 1JMTA 1U7LA 4NLPA 1NSPA 2NSCA 5D0EA 2V4RA 1HA1A 4OJGA 3NNHA 4ZN1A 1WF0A 2AYGA 1YVFA 1FJCA 3VVUA 4KT0C 5D0RA 5KG1A 1F5CA 5KFDA 2MKCA 3K7RA 2AT1B 5AXKA 2BBEA 4HHHA 4DHVA 2IVMA 5MAOA 4HT7A 1IKVA 3PVXA 1ZA1B 1VJQA 2CQ1A 1YSJA 3ZZZA 4WYWA 1GK8A 2AYEA 1N36F 1R8CA 3LP0B 3CJ5A 4O4GB 3LWLA 3JSRA 2DEJA 2W7PA 4DV3F 2DHGA 3RAMA 2XO6A 1YHQS 2FHJA 3UDVA 2KXFA 1TUWA 2WK4A 4HVZA 2NPFA 2P6SA 4Z2XA 3OD2A 5L9XA 4RUAA 3UDEA 2W25A 3UD4P 4IR1A 5D3GA 4K8RA 1RHUB 1S59A 3I6PA 4JI6F 5KG4A 4J9PA 1CS4A 4QIFA 1X0PA 2PFDA 4LF6F 2Z56B 1JLAA 4DSFA 4FPRA 2QRRA 2JDJA 3HVAA 3ILLA 3I0SA 3K2YA 3N28A 3JTPA 5G0RB 1S72S 1FFGB 4CH7A 2G0CA 2ZH6A 4WP8A 3D0IE 1B7YB 1VQ5S 2A1BA 4HL9A 3J7AN 1DHMA 1FDBA 2HQ3A 1S1UB 1RADB 4CP5A 2J6TA 4WU2A 4ES3A 3DGPA 3H4DA 2ZH8A 2QEXS 1M5VC 4JI2F 1JXLA 2OD6A 1HMVB 3NS6A 1AA1B 1P1LA 4OFZA 4USJC 4CWBA 1ZPVA 5F8NA 3HP6A 1VQ7S 5A8KA 1HNVB 1I51B 1RCOB 3L95X 3JAMY 2DR9A 3PW5A 2X1GA 3C2PA 4FYDA 2B8QA 1LWXA 1RT1A 2OAUA 2R3VA 2BQUA 1RT4A 3CJ0A 1GX5A 3TUJC 3KLHB 4ETXA 4C98A 1U0HA 2VIHA 3BGRB 1WSRA 4ZIWA 2W8LA 4B9TA 1NH8A 5KFGA 3W65A 2O66A 2SXLA 2I8EA 3CCWA 3D66A 4KKOA 2IRYA 1XMQJ 1KVJA 4OZLA 4K4XA 5K9FA 5D8HB 8ATCB 2LFVA 5FDLA 4ECSA 1XMOF 2NSBA 3D0HE 2E5HA 3T5KA 1RTJA 3VQSA 3PJXA 1RAOA 4TU7A 2YNIB 2DEIA 1ZOTA 4JI7F 2IM1A 5CYMB 4RNHA 2V8PA 4I68A 2RD5C 1B0TA 4ED1A 3F73A 3JYTA 5DM6Q 2RAQA 3AJDA 2YKQA 5DZ6A 2VPWB 2CQ3A 3J7Z5 5KT4A 3D6FB 2XSJB 3VAFA 2UUBJ 2VBWA 1FX4A 4ENOA 2W1BA 2CWKA 5HLFA 4ED8A 1G4CA 1R0AB 3UO0A 1BC6A 4GVBA 2W9AA 4M8LA 5L1LA 3KK1A 3CCTA 4MIWA 4NLSA 3K59A 5LL6d 2I9SA 4Y2MA 3PV8A 3ICLA 3ZTQA 5A76A 3M32A 3HJVA 1Y4ZB 3H20A 1JLGB 1NHVA 2W4CA 2HPUA 3OQ2A 4I2PB 4LRBA 4CO5A 2BV3A 2HRYA 3W2WB 5HQMA 3U27A 2AU0A 1LWCB 1TL3B 3CVKA 3FJ2A 4NRUA 2MZ1A 3OSPA 2B5JA 3LP0A 4O4GA 2CG8A 5GAGU 1XBWA 2HRTA 2CNNB 1NSQA 3UVJB 3ZXWA 3W62A 1IWAA 1P9QC 1MN7A 3AJ2A 2KXHA 1P6TA 3N5BA 5J2PB 4ZVQB 1D0EA 2CZVC 4IFYB 1UEUA 1WOOA 3IFEA 4LT6A 1S1XA 3HCXA 3RBZA 5KFAA 4CO0A 4K2JA 1RT2A 1Z1ZA 1H73A 3AD7C 3D4JA 3EZ5A 1U6ZA 1VYAA 4WZMA 2VFUA 2JHEA 3NBPB 2G2OA 2EG1A 4USKA 5AXMA 3VGSA 2XMVA 2QMUB 3DOMA 5K14B 4G1QA 1OY8A 2C3OA 2AWZA 2LQ5A 2LQ8A 2W2MP 4EK2A 1CQMA 1UFLA 1MU2B 1IQTA 4UT4A 4EWTA 4CRJA 1XN9A 4DWIA 4BWJA 3UR3C 1SH2A 3AB2B 3RW6A 1YJVA 1F5AA 1PIEA 2Y0SD 3BGFA 3PX0A 4F4XA 1RAJA 1QSLA 3IP0A 4QWBA 1F9FA 4DUZJ 5J2QA 3CIMA 4U67Q 4CQ1A 4DFMA 1YDLA 5HAOA 2VA2A 1WHYA 3MCNA 1MMNA 2ACYA 2E1PA 5E3RA 4LFAJ 1EJ7L 3IWLA 4DPWA 5A8KB 2C2NA 2PA3A 4A4JA 4Q43A 3M8ZA 4MFBB 1FVQA 2KU7A
chains in the Genus database with same CATH topology
1HPZA 2YWHA 2OSQA 1U1KA 4DL3A 4JI1F 2KYXA 2B3TB 2KKHA 5E33A 1RTDB 4DQQA 3TAMA 4DS5A 4QZVB 4B08A 5KFSA 1L3SA 5KFOA 2YKNA 2AQ4A 3MMBA 3TVZA 5DDQC 5KFNA 4I56A 4X4RA 3M8PB 5CCMA 4BHQA 1FNXH 4DV7F 2B4PA 4ETZA 4H4MA 4N47A 3KJVA 1YRXA 3GV7B 3V81B 1HNIB 2KZZA 1JLBB 4B9VA 4B3RF 3W2VA 2ZOGA 4AYBD 5KFEA 1BLUA 1T7PA 3RR7A 1F5BA 4P2SA 4C0HA 2Q6CA 3OFEA 1K9MT 5KFTA 3BREA 3D0GE 4DR1F 4HTIA 3GQCA 4L3NA 1FKPA 3CIZA 2MGZB 4RBVA 1HWLA 5E3QA 3THPA 3HKWA 3RB3A 2RKIA 1U24A 3TA0A 4B3OA 1UMJA 1VFJA 5KFHA 1JNZB 3CWJA 3RR8A 1AROP 3C66A 4IH7A 2GFFA 4C0OC 3CCZA 3I9ZA 2ZJRQ 3V6HA 1S99A 1HQUA 5E3AA 1N8RT 4C3KA 2HW3A 1LFWA 1EETA 4PXDA 3BSOA 3FQKA 1TL1B 3P3DA 5HMZA 2CPJA 1IN0A 2F7VA 3MMBB 3VWSA 2XLKA 5KOWA 3R3TA 3SYZA 2DPJA 1FEEA 2M88A 4ECQA 5F8GA 3O44A 4DV0F 2ROGA 3C3LA 2VASA 2N82B 1M0SA 1LKZA 3K57A 3EX7B 3OFGA 3MURP 5BYSA 3NNAA 1S0OA 2ZDOA 4AL5A 4OL8A 5L9NA 2Z2MA 4Q2LA 1QY7A 1U09A 1U1PA 3DOLB 3U1NA 4WFAQ 5G4DA 3N6NA 2ZD1B 1H0HB 1Z4UA 4C97A 2F40A 4CTAA 1VQNS 1TP7A 4FN5A 3I55S 5B0CA 4OIXA 2HHXA 2Z0GA 2JC1A 3FZBA 4HI2A 4N41A 3KLEB 3K5OA 1WEXA 1UVKA 4MTPA 4YR2A 4MIAA 4QYRA 5SZTA 3GYNA 5K14A 1X8DA 2JZ5A 1VMBA 1D9FA 3QZ8A 3BZQA 3KFWX 1T3NA 3OFHA 1W2IA 1SI9A 2J5AA 2AV5A 4IG0A 4NLXA 2J0WA 1CC8A 3O1LA 2C3YA 1N0UA 3Q2TC 2R8GA 4ZLPA 4K4YA 3MHYA 4QWCA 3WX4A 4PCQA 1R8AA 2AJFE 3G6XA 2MB0B 3MM8A 2WB4A 3QGPA 5HBMA 3SXLA 5DS7A 4DLEA 2VFVA 2HHWA 1JKHA 5F3ZA 1SH3A 3DLGA 5HL7Q 3DU6A 2K2PA 4OX7A 3QO9B 2W9BB 2F9JA 3HI9A 4CO4A 2EBGA 3FFIB 2R2SA 1XMQF 1G1XA 3EPIA 2JEFA 2K1RA 4KPYA 4DR4F 2BQ3A 4RNFA 5DG9A 1NJZA 2NR0A 5HQ8A 4C7QA 1BD6A 3FRYA 5F8MA 2KT5A 3UW1A 1TVRA 1RTJB 3JB9k 2CPXA 5F8JA 5E0OA 3UCGA 2LU1A 4B9UA 2E7XA 2GO8A 2FDNA 2VKRA 1DFDA 2AGPA 1Z2ZA 4R5PA 3MXHP 1XR7A 1VLYA 5KFLA 4AUKA 2R2UA 2IHR1 3FNNA 1RP5A 1LXNA 2LQ9A 2CYYA 3I82A 4ICLB 3TOQA 3QZ7A 2O01C 2VBZA 5B0BA 4DQRA 4CCHA 2VZ9A 3TYTA 3WC0A 4NRTA 1QSSA 4C11B 2ERRA 1QAYA 2PO4A 5E41A 4I1TA 4NA1A 4KQZA 5C25B 1SC6A 2DIVA 3RB4A 3GWCA 3G96A 1MU2A 3B82A 2W4DA 4LFCF 4H54A 2N4CA 1TUVA 2YY3A 3SV4A 2QMXA 4OLPA 2WCXA 2F8HA 4R0EA 4NA3A 3DC2A 3M30A 3NBPA 5F41A 1NK8A 1R6YA 2FLLA 1ZETA 1GTEA 2IM3A 3T6JA 2YKMA 2QA1A 2MHEA 4OHXA 4TU9A 3C8YA 1XNRF 3G9CA 1X7VA 2F9DA 4K2XA 1D1UA 2CPYA 4ZMMA 5CH7B 1IKXA 1S9EB 3WZ0A 4D3GA 1KR4A 1FTRA 2BRLA 2O67A 3GIKA 1YJTA 1VOMA 1TV6A 3N5FA 5IM0A 4QU6A 4DFJA 1IBKF 1LK7A 3R1HA 2J6SA 4C4WA 3TA2A 5SUHA 5GAHU 1TL4A 3V2UC 3NMAA 2PC6A 3ZC4A 4EO6A 4HH1A 2XBPA 3CCVS 1QUVA 4PKDB 2W7OA 2XS7A 2LEAA 2DR8A 2NUHA 4LQ9A 3DN9A 4F3QA 3P6YC 3H5XA 1UVNA 2GW8A 3IA0A 2J9EA 4IO9Q 3DXSX 2DJWA 1YBAA 2GQQA 4JBCA 1I6JA 1IKWB 4QR2A 4DL7A 2MQPA 1K0VA 4FF4A 4XDDA 2XMKA 1HW8A 4ZVGA 5FLXY 4URQU 1KLMB 3MMAA 4NCGB 3M4XA 4K5RA 1HBOB 1XK8A 5DDRC 4RWXA 1KQFB 3LH2S 4FBUA 2CPZA 2LXIA 2QT7A 5CA5A 2R4FA 2HVHA 1J5OB 3H98A 1TKTB 1X5PA 2FHOB 3RU0A 1OS5A 3MDFA 5KG7A 1AUDA 4QIWD 2MDAA 2C28A 1NB7A 2KRRA 4DL6A 1SJQA 3DHXA 4ZPBA 3OFFA 3GIIA 2LQBA 2XI2A 3VF0B 3POTA 3I5CA 3OW2R 3FSIA 5GVQA 3RTVA 3GR0A 2IYIA 4NX9A 4ZPVR 3L3CA 2VFTA 2J0XA 3FCHA 2LEBA 4LIRA 2ZJQQ 3T19A 4DSLA 3SSQA 3LAKA 5F0UA 2MQMA 4J5OA 1F2GA 5LMNF 5B0FA 2ILZA 3PY8A 2A2DA 4B9NA 1NK5A 4F26A 2QIFA 3CJKA 3QWUA 1Q4RA 2ZZNA 3MEGB 4Q5VA 2MXYA 4RW7A 4DSEA 1P8GA 4NOHA 2KFZA 4DG1B 3CE8A 4IH6A 1NJIT 4RW7B 3HHLB 4YDDB 2QA4S 5L1JA 2WHOA 4QWEA 2BM0A 3QLHA 1FK9B 5HO4A 1IKXB 1S9EA 2DVIA 1R89A 1DARA 3HLUA 2KO1A 3WBZA 2V9KA 4ED0A 1Y0HA 4YB6A 4IOCQ 2GJIA 3TAMB 1DLOB 1QM9A 3IGNA 3MUTP 4TN2A 5M2PA 4B17A 3RZAA 3NG8A 1KOOA 3D2WA 5CZVA 2KTQA 2D9PA 4YHHF 3QJLA 5MLCV 3DLLQ 1HW9A 2BA9A 3HHNB 2YKPA 3DRXA 1R43A 2FB0A 2VUGA 2HNDB 4ZCLA 3OL6A 2JEJA 3C6TA 1ZZFA 2XGQA 2BM1A 3CCQS 1KN6A 2F8MA 4Y2KA 4I4BA 3N79A 4DMZA 4UQGA 2Q43A 2ZE2A 4FXVA 4KV8A 2PI4A 4F2RA 2AYMA 4JV1A 4QYZJ 3SZ2A 1LV5A 3M32B 4DDFA 2DGUA 3BB5A 3HVWA 5A8WA 4EUVA 1WTFA 4K4TA 1JLQB 3H8YA 1FNMA 2UVWA 5KFQA 1CQNA 2P9GA 5LSOA 1F0XA 4RW4A 1S76D 1YQHA 3H40A 3AAWB 1SV5B 5I42B 1O5JA 1QSYA 2FJXA 2RF2A 1N4LA 1WF1A 3WC2A 3ZZRA 4DR2F 4WE1A 3BSCA 4IFYA 2B51A 2K3KA 1BQNA 2CQHA 5CD4H 1URNA 2EFVA 3Q23A 2ASDA 1XC9A 4PWDB 1K1SA 2XNQA 4PXBA 1ZYQA 1A7GE 5KFUA 2DK2A 1Q8BA 3CCLS 1WWHA 4DFKA 4R25A 1OSDA 1N5YB 3H59A 1NNDA 4M1KA 5EWFA 4IRDA 3VALA 3FQLA 2B4UA 3B8HA 2IVYA 3DYAB 3OTEA 1NK6A 2A10A 2YWKA 3BGRA 3I9V9 2OSRA 1NK4A 1S79A 1SJFA 2BR0A 1O8BA 3BR8A 5A8RB 1XTZA 2FY1A 4OHVA 4X4NA 5J1PA 3CO9A 5DDOC 1X5OA 1OSCA 2ZH7A 1PO6A 2LYVA 1QVGR 4OMFG 3G8QA 1IBMF 2DO4A 1S6PB 3CB4A 4JV2A 3LP1B 2XMJA 4XPEA 1SJ1A 2RIJA 3OTCA 2D74B 2R7RA 2DHXA 2HGMA 4YY3F 4Y0FA 1E6VA 5IQQA 3KKFA 5DJBA 2DR5A 5KOXA 4MAKA 4TYAA 1D8ZA 6FDRA 3PZPA 4NLVA 3QPIA 1NU4A 4IG3B 2J7WA 2AGOA 4DV4F 4FXDA 2IRXA 4ICLA 5M2UA 2V8VA 3CJ4A 5A2QY 3OSNA 1KOHA 1HNXF 4JYAF 2B43A 2VC0A 4BS2A 5CYJA 1REVB 2R2TA 3P96A 1TKTA 5JJBA 1RT7B 2CPIA 3KLFB 4J9LA 2FVCA 1KONA 2DPIA 5C24A 2W4PA 1KHVA 2G1DA 1AFIA 3UR0A 3GR1A 5HI7A 2AX1A 5L38A 2L08A 4KO0B 5T7LB 5DQGA 5J2MA 3FZ2A 1RGVA 1BGXT 1O0PA 1VRUA 3CD6S 1ZBTA 4HHJA 2JEGA 1XERA 1HWIA 3S6EA 4OZ1A 1S77D 3FFIA 2V94A 1JLEA 1HQUB 1TKZB 3ZZUA 1ZTTA 3IWXA 3PW0A 3CD0A 3GFYA 2LKZA 3RAXA 1S1VB 2VA3A 3PACA 2POKA 1NKBA 1NKCA 2GNKA 3H4BA 5JUMA 1S0VA 4MJKA 3T9NA 1X4DA 1MMLA 2F3JA 2GA7A 2RSQA 4Y28C 1S48A 2YNFA 4HH0A 4YFUA 3I56S 4K4WA 4A8WA 1KD1T 2E5LF 1BWEA 2HLTA 3FRZA 3OUYB 1WG1A 2RU3A 4ECVA 1S1TA 1VBZA 1OIAA 5A0YA 3DNCA 2XSFA 3G71S 2JLGA 1APSA 1QAJA 5AXLA 4LSNB 3ITHB 4IOBA 3CC2S 3S8SA 2GQ2A 1WHWA 2M4MA 4OZJA 5LSRA 4V19J 4KHPF 2GMJA 3RRKA 2CJBA 2XG8A 2WBRA 4EEYA 1TAUA 3J80Y 1M5PC 2OH2A 1H2TZ 3M6UA 3X1LB 2PD1A 5ADZA 1TK0A 3M6XA 1V3ZA 4EGLA 3K5PA 1JLFA 4UOCA 2X3GA 5LT5A 2KM8C 2PGCA 1A6LA 1TL5A 1KQSR 1FTCA 2UVVA 3I0RB 4LF9F 4LF7F 3D1OA 3HPOA 1X0FA 2Q79A 1WG4A 1FEHA 1YJWS 3CCRS 1TQLA 4X4SA 2I0XA 2VH7A 3TRGA 3KMSA 2CJKA 2FJBB 1JLCB 1N34F 2LDYA 2KDOA 3I5AA 1QJHA 2ALZA 3R5AA 4FNIA 3CCES 2KT3A 4HLBA 1YJUA 4BC7A 1P1TA 2GJ2A 4RW4B 3LF0A 2ZM6F 4K59A 4PUOA 2ZZMA 4QR1A 3MR2A 5AE2A 4DF8A 5IT9Y 1JLFB 2J76E 4H4OA 2DNYA 3QLHB 2E9RX 3FEYB 2L41A 1HBNA 1LOUA 3GSDA 1EETB 4X66F 1LWFA 1K73T 4O44B 4PWUA 1DQAA 2BACA 2VBYA 3SFUA 2UXDF 1QAIA 1JKHB 3ETOA 4A8KA 2VB6A 3KWMA 4AFFA 1YRTA 4UW2A 3BO2A 3CMAS 3KNGA 4XPCA 1VIXA 4BDPA 3B78A 3ITHA 4DN9A 2DGXA 4ZCIA 5T14A 1RT6B 3S1TA 4J9MA 1T05B 5FJ4A 1GX6A 1HI0P 2Q3PA 2CQIA 3RBDA 1YI2S 2HHTA 3CD7A 4USHA 5I3UB 2XS2A 1NH7A 2LEPA 2IC3A 2EWHA 1MMDA 2KG1A 1RKJA 2HIQA 4IQMA 3ENQA 2YNHA 3OJSA 1ZM9A 1CG2A 3OVAA 4B9SA 4NWBA 3M2VA 3V81A 1JLQA 4DF4A 3NWGA 3CT9A 1M1KT 1IQZA 2MZQA 2V9WA 2OTLS 3M8PA 2E7WA 5B0GA 3DFEA 3OXLA 5LSLA 3OBIA 2KG0A 2PE8A 5IS2A 1OPZA 3Q2SC 3RRGA 5A6WA 2AW0A 2ZNZA 1SUQB 2Q6BA 5DGBA 4KIAA 2R8KA 3K0JA 3OVBA 1RKIA 2HLUA 4DEZA 3SMZA 1V6HA 1N0VC 2FGCA 2HQIA 1OO0B 3IO1A 4AQYF 1SKWA 2C3UA 3VQTA 3EGWB 2R7OA 2GC8A 1RT5A 2N3LA 1C1CA 1DQ8A 2FVQA 1X4GA 3BSAA 1RQ0A 3TNVA 1TKDA 1IUJA 2D3ZA 2DCUB 4WJBA 1S4FA 4DV1F 4GKJF 4MK7A 3LUYA 3OTBA 5A6PA 5L39A 2D9OA 3IG1A 1RT1B 4G1QB 1UEVA 4EFAC 1XEZA 3T1YF 1S97A 5GAEI 3KHHA 1EP4B 1FRHA 4A48A 4EBDA 4ZOSA 4IRCA 2JFDA 3DRSB 4R5PB 4N77A 3M2UA 2YNGA 2IM0A 4YQWA 1HNWF 2M3DA 4PG8A 4NCGA 3C6UA 3DLBA 4GMKA 1R8BA 1HI1A 3E01A </