2BYCA

Blrb - a bluf protein, dark state structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
b'FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSRGDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BLUE-LIGHT RECEPTOR OF THE BLUF-FAMILY
publication title Structure of a Bacterial Bluf Photoreceptor: Insights Into Blue Light-Mediated Signal Transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 41
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bycA00
5F0WA 5B0EA 2FHMA 3IWXA 1P6TA 4QOTA 2FIUA 3DXSX 3T9NA 1AFJA 4Q2LA 2ROPA 2W4PA 1N5SA 4HH1A 4DN9A 5B0BA 3UDCA 2K7JA 2HFOA 2EW9A 2G9OA 2RU9A 5B0FA 1FEEA 1SQEA 2KT3A 3GZ7A 1MWYA 2XMJA 4HI2A 1Y0HA 3CJKB 1V3ZA 1N5VA 2XMWA 2K2PA 3TRGA 1FVQA 1IUJA 1YRXA 2RILA 2VH7A 4HI1A 5K9FA 1YJUA 3HF5A 4HH0A 5B0DA 2XMVA 1FESA 2L3MA 2LXFA 2OFGX 2QIFA 3KKFA 2K7KA 1YJVA 2K1RB 4A48A 4DL0C 1GXTA 3BF4A 3MCSA 2Q3PA 1Q4RA 1R6YA 1OPZA 3LGMA 5T7LA 2FB0A 2HQIA 1OSDA 2VV5A 4YEAA 2OFHX 5B08A 1Q8LA 1OQ6A 2RMLA 4OJGA 1JK9B 4U9RA 3QGPA 4OJHA 3HX9A 4EFAC 1FE4A 2LQ9A 2W4DA 3BGUA 2AJ1A 4Y2IA 1P8GA 2XMKA 2KYZA 3BB5A 4Y2MA 3IWLA 1VQSA 5IXUA 2HIQA 1RJJA 5B0AA 1TUVA 2IYIA 2XMMA 3HHLC 3LGNA 4FNIA 4Q2MA 2HFNA 1CC8A 3BR8A 1K0VA 2BYCA 2OAUA 2CRLA 2OD6A 1VQYA 1TL4A 2PD1A 2OMOA 2QLWA 3WDOA 2XMTA 1KQKA 4A47A 4OJ3A 1YJRA 4NPOA 4DPOA 1Y9OA 1X0PA 2W4CA 1Q8BA 2IYGA 2OKQA 2GGPA 4HL9A 4ZOSA 1SB6A 2BUNA 1FD8A 1W2IA 4YDXA 2ASYA 1YG0A 4FNHA 4ZA1A 1JWWA 1ULRA 1WD6A 3FMBA 2AP6A 3BDEA 2ZDPA 3F44A 2ROEA 5B0GA 5B09A 2HLTA 5A6WA 1MWZA 2LQBA 2PGCA 3VTIA 2OP5A 1CPZA 2FTRA 1FE0A 5T7LB 1X7VA 2N4DA 1FVSA 1U7LA 3BM7A 3HHLA 1OQ3A 1AW0A 1N5QA 3FRYA 5F0UA 5KAKA 2ZDOA 2KKHA 2ACYA 5B0CA 2GA7A 2ROGA 3HHLD 1S6OA 3CJKA 3TOQA 3BN7A 1KVIA 1YJTA 1AFIA 1TL5A 1SI9A 2IFXA 3KG1A 1LQ9A 2N7YA 1Y3KA 4OJ1A 4F67A 1APSA 1QUPA 3KNGA 2BJDA 2GV1A 5A6PA 3KG0A 3QMQA 3K7RA 4NL5A 2GFFA 3MZIA 1TR0A 3E8OA 3TNVA 3LO3A 2K1RA 3DCAA 1Q53A 3HHLB 2QLXA 2HLUA 3HFKA 2XMUA 4Y2KA 1S6UA 2QYCA 1CC7A 4A4JA 2N4CA 3HDSA 4A46A 2BBEA 1KVJA 1URRA 2RSQA 2LDIA 1N5TA 1TZ0A 1X8DA 2JDJA 2AW0A 2BJEA 3FGVA 3I9ZA 2AJ0A 2GO8A 2GGPB 2KT2A 2OD4A 1GXUA 4OIXA 1Y3JA 2GCFA 1XBWA
chains in the Genus database with same CATH superfamily
2L48A 1Y10A 2IMWP 4Y3CA 4AXJA 3KUEA 2FD2A 3TRGA 3CD7A 4ZJOA 5SZTA 2ASJA 2OPRB 1FCAA 1NXIA 3F41A 1NDPA 4DV1J 4X66J 3D28A 2HQCA 3T1YF 1P9YA 2MZSA 1NSAA 1Z1ZA 4ZLNA 3SCKE 3EZOA 1X4DA 2HRUA 4K4WA 3ISNC 4BCAA 4RNMA 3MR2A 2M3DA 3MR3A 1PG5B 4TY8A 2PN6A 1S6PA 3AODA 2N4DA 4CO0A 3SDEA 1TK5A 4B02A 1LQ9A 4TXSA 2ZVIA 3DGPB 4MT1A 1HD0A 1JJ4A 1PYOB 4EBEA 4Q0BA 1XMOF 2LXIA 3D6FB 3FCWA 1K47A 4WE1A 3D3CJ 3CIZA 3RBEA 2BANB 2VG5A 3GFHA 1FRHA 3RRKA 4USMA 1Y5IB 1BE4A 4N47A 3Q8UA 4WP9A 1VFJA 4J9RA 3CMAS 2CG4A 3MUVP 4KGZB 4W98A 4LF9F 3EUNA 4ZVPB 3ENAA 2HQFA 3KJVB 1XK8A 2H65B 1Q8LA 2G2ZA 3H7HB 4LSLA 2BR0A 2HQDA 3FDSA 4F4XA 1BC6A 2IYIA 5K8PA 1LWCA 3P49B 1S72S 1U4BA 4NPOA 4JI6F 1Z2LA 3K8VA 3OVBA 1QDUB 3KOAA 3WIVA 1KKHA 4HACA 1V5IB 1CJUA 3OXFA 2FHJD 3CD5A 5B0GA 1U2CA 4P73A 1RTDA 5HLFB 2M8HA 3FRYA 5F0UA 2LU2A 2JWNA 3RRHA 3MCMA 4MIAA 4C8YA 1EIYB 3F0NA 1SJ3P 4P52A 3H5XA 2R42A 2GO8A 1FHTA 4GKJF 4C0HA 2ADCA 2CQHA 2KRBA 2DR5A 1W26A 4C97A 1RHJB 3KWMA 5D78A 2UUCJ 1HNIA 1FWPA 5EWFA 1L5UA 3HJVA 2M2BA 5DQHA 1R8HA 3QAUA 4LF4F 1N33F 2XI2A 1Y00A 4DPTA 1PSDA 2ZH1A 1GFWB 2CPJA 3NNAA 2ZHOA 2HIYA 1RWWB 4CLTA 4OLOA 4ZKAA 2BVZA 5HBMB 2HEKA 2J8SA 1UJ6A 2OKQA 4UTGA 1WC1A 3GIRA 1TL7B 2JHEA 1BQNB 5J1EA 4ZHRB 2E1PA 1L3VA 1FJGF 3K89A 2VASA 3TOQA 3CJKA 1N5YB 3K57A 5HQLA 1QUPA 3KNGA 2AKWB 1AXQA 2Z4PA 1UFLA 4DR2J 3BJYA 2NPIA 1RBOB 2E1CA 4O3NA 3QSYB 3E01B 4CO5A 3QGGA 1TVRA 2DGSA 3OHBA 1LW0B 2PEHA 3UN5A 2HNZA 4DPUA 2B5JB 1AROP 2WONA 4WKRA 4F0HA 2OFGX 2E5HA 4EO6A 2BQRA 5HJYA 4ELUA 2IC3B 4NXMJ 4ZPVR 1E6YB 1FKPA 4ANEA 2ZNZA 3AQOA 1VQKS 5BYRA 3B8HA 5DM6Q 2HYIB 4B3SF 2HWHA 3J7A1 3PY8A 4EYIB 1RGVA 3I4HX 1RAIB 2WSCC 2CPIA 3KJQB 1IBMF 2A6OA 2HS0A 3ELHA 2Q66A 2GJFA 3SFGA 3BKFA 2BXJA 3O1LA 1S49A 2Z56B 3PYDA 2QG9B 2MHEA 1T9XA 3LO3A 3DNCA 3UO0A 1VR6A 3BPSP 2CQ4A 1S6UA 1NDCA 1PYTA 3V81A 2AGOA 3P6YC 2YWGA 2V4JB 3JQMA 4ID8A 2FLOA 1S1WB 2BW7A 2F1FA 2C28A 5KFDA 3KLHA 4E2FB 2ZJRQ 3IM9A 2LXUA 4P71A 2XZTB 2VFTA 2FUG9 2MGZA 4J7CA 1ZYQA 4RW7A 4AL7A 3P3DA 2RMLA 3UI3A 1YWXA 4UUWA 1TTHB 1FDAA 3NAIA 3TJ9A 1S6QB 4XPEA 1G4CA 4BWMA 4FPIA 3CJSA 2IYGA 4MAKA 4B3MF 2B8PA 5IOLA 2DGQA 3OD2A 2BKOA 4QW9A 3A8KA 2AP6A 4X65J 2ROEA 3PO5A 2VOPA 5F9NA 4PG5A 2HAFA 4P2SA 4RWXA 4CTAB 1WF1A 1V9OA 2LA6A 1Z2ZA 4U6PA 3V6DA 3MM7A 2FVSA 3LAKA 3RR8A 3FGVA 1XQIA 5L46A 4MFBA 3PHTA 2X1AA 1HWJA 4N77A 3NBPB 3Q89A 3OJSA 4OYMA 5CABA 5G0RB 4H4KA 3S7RA 4DF8A 3CJQA 2XBPA 4QR2A 3OFHA 5H9FJ 3LPEA 2HHHJ 3QFWA 1VLOA 3TJAA 2FVCA 4CLKA 4KPYA 2E5JA 2HFNA 1D8YA 3ZFVA 5SUHA 2W25A 1UEVA 1AZSA 4A47A 1S7IA 4ZVSB 2ALZA 3H2VE 1SQGA 4LVOP 2CPEA 3M8RA 2W7OA 3LA0A 2IA0A 4DSLA 3B4MA 4U7UK 3ISZA 2P8IA 1F5CA 3M1VA 2NCKL 2RKIA 3D7SB 4KJIA 4TU8A 1KQSR 4L75A 1RTDB 2KVQE 2IPOB 5DO2A 3IC1A 3DLKA 3BSCA 2AYMA 4OYPA 3MPYA 4NOHA 3G87A 3CMES 2GGPB 1X4AA 2R9LA 1ZM4A 4I7FA 2OEMA 3FSXA 3T19A 3VAMA 4C11A 5C25A 1AFJA 2CADA 2DBBA 1FDDA 4BS2A 1UEKA 1P27B 2F5GA 3CCSS 3FMWA 3W7BA 1T9YA 5DJBA 2HS3A 2HZAA 4UZBA 4NMXA 4P75A 1CLFA 2UVWA 2NXEA 1F9FA 2DNQA 4PQAA 1HNIB 1JK9B 3JTOA 4V19X 3TZZA 1T9TA 1YI2S 4TYBA 2C2MB 4ED2A 4M5DA 1QTNB 1HI1A 3A1YG 5AE1A 4ZJQA 1HD1A 2IM2A 2ZC3A 4DV1F 4X66F 1TP7A 2BJ7A 3JQKA 5D15A 3R5BA 3TAPA 2YNGA 1U1OA 1F9HA 4PG7A 2CJYB 5L9NA 2BE2B 4KPCA 4ZVUB 1PJ7A 2K8GA 2WB1D 2E29A 2HSEB 3UVJB 3I87A 3W8PA 2MKJA 2EK6A 2PA8D 3UNYA 4ETXA 1CS4A 1SPBP 2RRNA 1TZ0A 1P1TA 4USWA 2GZOA 1QTMA 2YBVA 5C7PA 4BC7A 4FXVA 1VIOA 4EBCA 2FIUA 3D9BA 5CD4A 1BWEA 1NCLA 1TKTA 2D3UA 1VC5A 2MB0B 2WRMA 1X4GA 3IGVA 3TX8A 2HBZB 1FKOB 2QMWA 1V3RA 4NLTA 4KV8A 1KNZA 4U7UD 4ZN1A 2BW2A 5DG8A 1YGYA 3SBMA 4C8OA 1O6XA 4WBFA 2IBOA 4N8OA 4OX6A 4QZVB 1RHKB 1B7YB 4PWDA 3UCUP 5MAOA 1HIYA 5KG1A 1O51A 1WOSA 4M95A 1EETA 4AL5A 2PT0A 3W63A 1RAFB 3HHLA 1U6FA 3DLBA 3THPA 2IFXA 4ZVTB 4P2MA 3BGRB 2Y1IA 3D6TB 2AWZA 3GR0A 3S1TA 3IWNC 5KFXA 3I0SA 4LR9A 3IBWA 1HBOB 3PIOQ 5DLFA 4OI4A 1U1PA 3GV7B 4LF5J 2Z2MA 2HG4A 5HN0A 1U2FA 1WF2A 2O66A 1GEHA 3V81B 1TAUA 1WHXA 4O3QA 2LEBA 3KK2A 4F36A 5EWGA 2KFNA 2KT3A 4CH1A 4IR1A 4HI2A 2ZHBA 3N5FA 3CCJS 2ACMA 4TVAB 1B64A 1H38A 1QSLA 4ZK7M 2M70A 4X4NA 1IBCB 4DL6A 4ZIWA 1FI4A 5T14A 1WI6A 3GYXB 2EC0A 1RT2B 4HTJA 2P6TA 3BBBA 5AJ3F 4AT1B 3MPVA 3Q8RB 1LV5A 1WOOA 2LA4A 2BJ9A 1Y11A 2V5HG 3E51A 1FWKA 4K4VA 4YY3F 5KG3A 2WVCA 4Z37A 4JI2J 1SJ1A 3HZGA 3VR1A 5KOWA 3QJJA 1N56A 4X64F 2H54B 2DH7A 3KK1A 1Q86T 5EWEA 3CDEA 3BKUA 2VHGA 3T6BA 1U7LA 4A8SA 1M5OC 4C8LA 2DVIA 5U47A 1K0TA 4AUKA 3CIMA 1JLGA 3HVTB 1OY9A 2E1MC 4C3KA 1Q79A 3DLGA 1C0UA 2XYPB 1FNMA 3CCLS 3UPFA 3O3LA 3CTRA 2G0IA 4MKYA 3OVSA 4DSIA 2F4FA 2IVFB 1Q95G 2YY3A 4NLUA 3D2WA 3R5CA 4BC9A 4DV2J 4NA1A 1FE4A 4I2PB 2DEIA 1TL1A 3DRSB 1I1GA 1D3WA 4DV0J 4NXMF 1PC4A 2BMBA 6FDRA 2KB2A 5F8IA 2PMZD 1CSJA 3DXBA 3MAQA 2ZH2A 2BABA 2W1BA 2W9BA 1NJWA 1Y5LB 2B9XA 2WVBA 4ERDA 4CI0B 3RBZA 3TZXA 1X5TA 5IM0A 5ETLA 3W2VB 2XEXA 1ROFA 1Q5YA 4DEZA 1FDNA 3ZZUA 4OX7A 4DWIA 1X4FA 1MMLA 3OTEA 2XM3A 3H5SA 3CDAA 3QSIA 1AB8A 5KG2A 2J0SD 2M0GB 3DRRA 1IKYA 5B0FA 4CWBA 4HHHA 4UT4A 1WSRA 2X1BA 4DN0A 4LRFA 2VONA 3W3SA 2YNHA 2CPYA 1YVFA 3K59A 2IJFA 2MKSA 3JAMU 1G2EA 2M5YA 1BLUA 5CD4H 4B3OA 5CZXA 5LMUJ 2CPXA 2EFOA 1WORA 5CHCB 2YXLA 1VOMA 1N34J 1RADB 4L74A 4PEOA 1DARA 1L3TA 3J81j 3P5TL 4L73A 2DT9A 2KXHA 3EICA 4I56A 5DM7Q 3O44A 2F7VA 4YDXA 3BBCA 2LYVA 4NASA 3TAMA 4NYZA 2CDQA 3GWCA 2OP5A 4DCJB 4YB5A 2DITA 2CQCA 4S0MA 1DAXA 2XZWA 1OMSA 1CJKB 2J0WA 4DR1F 3PRDA 4JI3J 5GAHU 3EWGA 1WI8A 2JC0A 3T1HF 4H54A 1N36J 2XS7A 3HFZB 4IG3A 2WBRA 3IWXA 2MHNA 3LUYA 4HH1A 3VV2B 1J5OA 1Q7LB 1JKHA 5E5NA 2V2QA 3NS5A 1TKTB 2C2EA 4OZJA 2K7KA 3GLJA 1RAAB 2MQNA 4LIWA 3RW7A 2ZBQA 2VG7B 2FGCA 4NE9C 4DQIA 2C22A 2WCXA 2IM0A 3AOBA 2HHHF 1WC3A 4R0JA 3MFIA 4JV5J 2XGPA 3F56A 1VDHA 3PV8A 9RUBA 4NCGA 3EDQB 1N52B 5KFEA 4F3QA 4PWDB 2XLKA 5T7LB 4ZPTR 2BEFA 5I42A 3AY0A 2GA7A 2KDOA 4OZ3A 5CZVA 2DNNA 1EZZB 1RT7B 1AFIA 4U67Q 3TX0A 4BBYA 2QZ8A 2K1RA 3HHLB 2MKHA 3W61A 2N4CA 2MQ8A 1KLMB 5F0WA 4JV1A 2FJBB 5MLCV 3LWMA 1Q82T 2ROPA 2XTJP 2H5EA 2EW9A 2DHGA 4GMKA 2QSFA 3N4WA 3MEGA 1ZZFA 2HZCA 4LF7J 3MGJA 1YRXA 4RW9A 3FCHA 3CJ5A 5KTQA 1KFDA 3IP0A 2B7BB 1UAWA 4XDDA 3MD3A 1NHKL 3PRVA 3HPOA 1XR5A 1UZHA 2J5AA 2ZM6J 4J9KA 4WXOA 4DPOA 4DFKA 4OYBA 1J5EJ 2ZBRA 2GMHA 2GMLA 2W24A 1ULRA 1KONA 2B4OA 3FQLA 2SXLA 1VQ4S 3KK1B 3KK3B 3MFHA 3HHLD 2XYHB 1I94J 3DGVA 1RWKB 4RBUA 1OY8A 2XLIA 3I6PA 2DTJA 3ITHB 3LP0B 5BXIA 1U1QA 4USUA 1KSPA 4FN5A 3EGZA 1IR0A 3O8WA 3QAEA 1XEZA 1M5VC 2EFQA 1BXNA 3OXLA 3MMCA 4L76A 3CCTA 5E3AA 1U24A 1U0HB 4BHQA 1YZ7A 1X5SA 2Z2YB 1RHQB 2QA4S 2KO1A 2HBQB 3H4DA 4KGXB 3AAWB 3H20A 2ZFHA 2MPUA 4USVA 5GVQA 3I5CA 3NGUA 3CCWA 4ETZA 2V94A 5KFSA 1IBLJ 4DX8H 1QY7A 1SKUB 2ZITA 5CYJA 5JVHQ 3HSGA 1QLNA 2CXEA 3FFIA 2BJ8A 3EXCX 4NA3A 5D6GA 1TL1B 4OL8A 3IMQJ 4PUOA 1I5OB 1CULA 3SQOP 1M1GA 3G6YA 4ZPDA 5B09A 1KEKA 4YP3A 4YS2A 1U25A 5A6WA 3JSMA 5DZ6A 2NUUG 1RWUA 3NRBA 3GCWP 2HVZA 1IJFB 3MM9A 1U6ZA 3NOCA 3CC4S 2HLUA 1RYSA 1PJ6A 5HP1A 5A8WA 5KFHA 2BJEA 1UP1A 4DSJA 1QVFR 4DG1B 4R5PB 2XY7A 3LANA 1VS3A 2XSJA 1DFDA 3KLFB 4ZLPA 3E2EA 4F04B 3DRRB 1HBMB 5KG4A 4RUBA 2QJ3A 2Y1RI 4LFCJ 1DURA 3SYZA 1RT5B 1UVMA 2D69A 3QJPA 2DGXA 4ZS6A 4ZPWR 3C16B 1YX2A 3UN2A 2BQUA 2MKYA 3OTBA 1YJWS 3FVYA 5I3UB 4UOCA 4RW8B 2UUBJ 1M0SA 3QQCD 5M2PA 3A3PB 2W9AA 4DS5A 1TFWA 1AYEA 4JI2F 2RVJA 3BSNA 3KDOA 5ADZA 1RTZA 5E3PA 4RPFA 2MEWA 3I0RB 2DRDA 4G1QB 2KKHA 3AJDA 1T05A 4FF2A 3TNVA 3DOMA 4UY85 5KT2A 2HWIA 3R3TA 1KVJA 3I82A 3MURP 3SZ2A 2RDIA 3WBZA 1XBWA 2JX2A 2DNRA 1UVJA 1FXRA 2WOMB 5IFMA 5KFQA 3IG1B 1Q0NA 2KFYA 3ENQA 4K4SA 3D4JA 4LSNB 1IR2A 3OTOJ 1NU4A 1S1UA 4L72B 4CH0S 1J5OB 1S1VA 1PBUA 4USIA 3FBFA 3M2VA 3WZ0A 4MK9A 2GIQA 2EG1A 3GG0A 1U1LA 2XCAA 2HNYA 3BN4A 4IQXA 1HMVB 3T5KA 4CLFA 5ETKA 2C2OB 3IA0A 4EO8A 1T03B 5A76A 4K7QA 4IOCQ 4ZP6A 1NDKA 1U1NA 1DZ5A 4CCHA 2CA9A 3FCVA 3TO8A 4DV0F 3M9OB 3ET6A 3CPWR 5E3RA 1YLXA 4F67A 4N5SA 1RWOB 3DC2A 4B17A 3W1YC 1G7CB 1FRXA 1IBKJ 2FGOA 2XMUA 2L41A 1S4FA 2CWXA 1EARA 1SUQA 1TFYA 2HMIB 5H9FK 3CDUA 3PTWA 4PPDA 1KFSA 3M6VA 1OYEA 4O3PA 3NNHA 4ECUA 1GK8A 3HD2A 3R7SB 1NK6A 2KFZA 3U7JA 4LQ9A 5IC4B 2VZ9A 4WXWA 2NXUA 4YQWA 2R8GA 5KFBA 2CJAA 1VQMS 4NRTA 1X5OA 3M8QB 3MI7X 5KG7A 2XMKA 3IR7B 4K4UA 4L6V3 3MEDB 4XIUA 2MQMA 4NI2A 4PZVA 1UFWA 2XMTA 3UR0A 2QL5B 2OJ3A 3RBDA 3EZ5A 2E66A 1H7XA 2J7UA 5LMUF 3Q8VA 4FNHA 1N34F 2UU9J 2HLTA 4RW4B 4NMLA 5F8LA 4TLRA 2W9CA 3GG1A 3LF0A 2ZWOA 5A8RA 2CQIA 4ZVHA 1YJ9S 3HFKA 3HDSA 1R8CA 4RLEA 2CVIA 2Y0BB 3MPDA 4NEYA 1XMQJ 3GFZA 2CYYA 2MDAA 3MWBA 1SC6A 1ZBTA 3M9MB 4UZCA 1TV6B 2NXCA 2RNEA 1PCAA 5D77A 1VRTA 3FKBA 3QATA 5CYQB 2OEKA 4N56A 2H5JB 1WTBA 1PAEX 4DV5J 1H73A 1ZZNA 2HBYB 2HFSA 2Q6CA 3W2WA 3SV4A 3KLGB 1JX4A 1S76D 3CJ8A 1NHVA 3C2PA 1F3VA 3QNWB 2WK4A 2YKAA 4CLPA 1G6BA 1Q8IA 2AJQA 5K14B 4YFUA 3BGLA 1OY6A 3LGHA 4G6VB 1M5PC 2W4CA 4FKXA 4OHVA 3L3CA 4LF1A 2QSWA 2XWXA 2RHQB 2DPJA 2D9PA 4CM0A 2HQ3A 1HQEA 4JV5F 3D66A 1JLFB 2ZZTA 3CDWA 4LSZB 3MZIA 4ECYA 3TI0A 3PEHA 3ZZRA 1NJIT 5DGAA 4B9VA 4ECRA 3WQPA 5HP1B 2H4WB 2P5VA 1DQ9A 5L1IA 3QIPA 1F60B 4GO5X 2AZ3A 3OSNA 3CT9A 3BSAA 4LREA 2GAHC 1RA7A 2HPUA 1WUUA 1GX5A 1HPZB 5KFAA 2HFVA 3CW2C 4DL3A 5LM7E 1JMTA 2JEFA 4FZVA 3J7YI 4LF7F 2VBZA 4Y2IA 1LNQA 4LF8J 4KGVB 1WHYA 3FBBA 4N7TA 3BH6B 4RU2A 1WNEA 2HFUA 1SIWB 3BO4A 2KXNB 3ZNUA 2XG8A 4PWWA 1CG2A 1XWLA 1J5EF 3QO9A 1TR0A 3A3NB 3T3FA 4NLYA 1RT4B 4PXDA 2DB1A 1H74A 1RAGB 3RBXA 1E6VB 1F6TA 1A7GE 3SCIE 1I94F 2H48B 2CFXA 2OD4A 1YJNS 4IQMA 3NGDA 1FD2A 3N9UC 3PR4A 3KHRA 3LWLA 3T9ZA 4OX9J 1BQXA 3TR5A 3DM2A 4URQU 4EGLA 3MPWA 3UN3A 3IRXA 3ILIA 2V0NA 2C2RA 3GJSB 3EVWA 2CUYA 2R4FA 4I2QB 2DGOA 4KY3A 4DX6A 3OL6A 2IM3A 2KYZA 3JYTA 5KFVA 3T5LA 2KU7A 3GJQB 4JB8B 2FZCB 1B99A 1JLEB 1IBLF 1X0PA 3CD6S 3PHEA 3P45B 5AXMA 3FEXB 2IAJA 4QWAA 1YRTA 3WIUA 5HMWA 2DR8A 1CPZA 3G8QA 1RWXB 1S0NA 3D1QA 2G1HA 2GJ2A 2HNDB 2Y1LB 4WP3A 3E8OA 4J9PA 3BH7B 3TUIC 3AHPA 4UY8T 1DQ8A 2HRTA 1RYRA 1HNXJ 2RHSB 3I96A 4EU0A 1J27A 2JVRA 3M7VA 1D1UA 2V50A 4QR1A 3KJFB 5C24A 1T02A 3N79A 3KLIB 2NR0A 3RUBL 4Y65A 4NZ7A 4I6AA 4LBIA 1C0TB 1WHVA 3NCPA 1LW2B 3H2UB 2QIFA 4BWJA 1HNVA 1Q78A 3KNAA 3RG6A 2NSBA 2HWTA 4KGKA 4OJGA 4IG0A 1HQUB 1LWEA 3GTYX 4CO1A 1B3TA 4I68A 1TUVA 2ZD1B 1R0CB 1BY9A 4QU7A 2ZOFA 1YJRA 3PZPA 2V2KA 4CO4A 1UJ5A 2B4UA 3R2DJ 1DBDA 4O3OA 2VJVA 3OQ2A 1REGX 1UW4A 1JLCA 3OR1A 1ZETA 2MSTA 2UUBF 2BJDA 2W9CB 3MM8A 2G2YA 2XNQA 1HYSB 2RIJA 3C6UB 2DNGA 5A8RB 4N8NA 3UDEA 4K5RA 2R7SA 1SH0A 3OLBA 1GX6A 1TMJA 4W92B 3N0VA 2G0CA 2UVVA 2IRXA 2V8PA 4H4OB 3KKFA 3U02A 2ZH4A 2AD9A 5F41A 1FO1A 2EVZA 1QAYA 1RQ0A 4PKDB 3FSIA 1XMOJ 1T0TV 2DD8S 1REVB 4IRCA 3K5LA 4JUZA 1XTZA 2ZHAA 1NLKL 4ZVRB 3K58A 1R43A 2DO0A 5DGBA 1FRKA 3RB4A 1X4CA 1WF0A 3PFOA 2MLYA 1PC5A 3UD3P 4F0MA 2V34A 5K8NA 3CMQA 3OUYB 2G13A 2EKNA 1VBZA 1MROA 4LF9J 3KJNB 3C15B 3OV7A 1T3NA 4C4WA 2H4YB 2MQOA 1GMVA 1VBKA 1MW7A 3R5AA 1QSSA 2CNLB 2LEPA 2AJ2A 1RISA 1JXEA 4HR2A 3PJ9A 1OO0B 1RP5A 4Z7CA 3GV8B 3TA1A 1RT3A 2Y3YA 1IR1A 2NXNA 1S79A 1H0HB 2KRRA 2VJUA 3WC0A 1RAHB 1DTTA 1CJVB 1EP4A 6FD1A 2RH3A 2DGVA 4O44A 2K3KA 3GIIA 1XMBA 4M5GA 4CYUA 4P7TA 4B9MA 4A48A 4HTIA 4DQRA 1H2VZ 1R8PA 2HQGA 4NLPA 3TQ1A 4P74A 4IH5A 3I56S 1T11A 2ZZNA 4Y2MA 1C1CA 2R2TA 1YSJA 1RT1A 2VD3A 4EEYA 2YKNB 1TL3B 3WDOA 2JLGA 1LWFB 3DYAA 1YBTA 4KHRA 3AD8C 3HJFA 3A13A 5KFTA 3HSZA 1U1MA 3D68A 3HZEA 1C2PA 2CKWA 1SJFA 4LFBJ 3FEZA 2HVEA 1VGYA 1UVLA 2ABYA 4L3KA 4NEZA 5ETRA 3L9ZA 2OPRA 3GFYA 5T41A 4IFVB 1N33J 3MAHA 2YPZA 4IKAA 3CCES 1KHVA 3KUGA 2VKZG 1YIJS 3IS9B 3M8PB 4QWBA 1HHTP 1QAIA 3PVXA 4QWEA 3DHWC 2GQ2A 2J7KA 5LT5A 1XMQF 3DLLQ 1S9GB 1SL1A 2DHXA 2MZRA 2K2PA 2UVUA 1NK7A 1SJRA 4A8XA 2V68A 2DR6A 4DS4A 1FJGJ 4RBTA 3DM2B 2GAGC 3HO1A 2M4MA 3VF0B 4ID5A 2CQGA 2DNZA 5C2CA 3IRXB 3DGPA 4DV7J 2M88A 5KFZA 4R8UB 3GSIA 4DV5F 3MCNA 4F4WA 4USHA 4UUXA 3EPIA 5AXLA 2BANA 4OYOA 1M5KC 2F4VJ 4DR6J 1WEZA 2Q43A 5BJRA 2DNOA 4KGMA 1GMWA 2YVSA 5ETQA 1HI0P 3GYGA 3HCXA 3HP6A 5A2QU 4K5SA 1N0VC 3A4TA 2IAJB 5ETOA 3AXKA 4CP5A 3ZZTA 4UOFA 4OZNA 1D8ZA 4WIQA 3D67A 1NK5A 1U02A 2YKOA 1JNRB 1S97A 1N5TA 4DPWA 4B3SJ 1IQTA 1GAOA 2R8HA 3NMAA 4F4YA 4FXWA 2AV5A 5ETPA 5KFUA 5HQMA 2ILZA 5KFPA 4K0KJ 5GADU 1B0PA 5HLFA 4J9SA 4OV1A 3X3UA 4F8RA 3MHYA 2DXEA 3EX7B 5L1JA 2I6WA 1LOUA 1DRZA 4R0EA 3SCJE 3QLHB 5AXKA 3THVA 1KQFB 1C4AA 1S7HA 4ZOSA 2XQCA 5E7OB 1CJTB 5KFYA 4ZP9A 2ASYA 3NGSA 3PW5A 4A8OA 3IR6B 2UV8G 4ELTA 1AUDA 4RX6A 2ZDOA 2XB2D 3CJ3A 4PG4A 3EVOA 2Z8QA 3EVMA 2J9CA 2WAQD 4CT8A 3EE3A 3W9IA 4A4JA 2C3PA 4M5MA 4EBDA 2KZMA 2AHOB 2DJWA 3I9ZA 4W90B 5HANA 4RNFA 5LJ5Y 2KM8B 4NX9A 5ETSA 5J1NA 4B3MJ 2JJ4D 4QIFA 2OIHA 1IWAA 1UTAA 4CLUA 1TL7A 1BQNA 3ZZPA 4ZHRA 4WKYA 4OX9F 1EKSA 1UVIA 1FDBA 4XK8C 4IFYA 5LMNJ 2HAIA 1N5YA 4X62J 3IBFB 1SXLA 4PPZA 4ED7A 3IWLA 3PYFA 2AIRB 3FEYB 3DLHA 4M5HA 2X1FA 1FJCA 3AOCA 3E01A 4Y34A 2MXYA 2YNIB 4TY9A 1U2RA 1NAQA 4I6WA 1IKWB 1LW0A 2PGCA 2F40A 5F8HA 2VDIA 2UV8A 1R27B 2DYAA 2ZC4A 4HDHA 6AT1B 4MIWA 5AT1B 4ZPCA 2IC3A 4RNNA 2O67A 1E6YA 2JDJA 2DHAA 2R7QA 4DF4A 1MG7A 4O4GB 4WFNQ 4MIBA 4LIRA 1WG5A 2DGTA 4KO0B 1YHQS 4CLLA 1IWGA 1UCNA 3MAAB 4E8UA 1HNXF 5L1LA 1WDDA 4ICLB 2RILA 2YNFB 3NLCA 3K5OA 2LXFA 3LTOA 3PRBA 4X4VA 4IOAQ 4K59A 4DJBA 2V8DA 3KFWX 2VC1A 2HFZA 3A8IA 3HX9A 1ITPA 1T94A 3PKYA 1R0BG 4CQ1A 2XI3A 3TW0A 1DTQB 1LK7A 4ED5A 2OPSB 3PYGA 3ZTQA 3HFVA 4USTA 2R7XA 3QIDA 4OI3A 5HROB 2OUGA 4F3MA 2BACA 1FJEB 4GKKF 3JXOA 2NZ4A 5LXYA 1NK8A 1RZMA 5J1PA 4FYWB 2HGMA 3GCXP 3PW7A 1FNOA 1R31A 5BYQA 1T9WA 4ZCLA 3H42A 1S6QA 4TN2A 4EK2A 2HVDA 3Q23A 5GAGI 2DHSA 5J2MA 1Y4ZB 1WTFA 4WFAQ 3PCOB 3M30B 4NCBA 3DU5A 4B3TJ 2LDYA 5A0YB 2HHTA 1RAOA 3VZHA 4CTAA 2RF2B 4TLQA 5IXUA 2HRYA 3MM6A 2UUAJ 4DCPB 2OD6A 4ID5B 3AD9C 1RACB 4OJ3A 1RWPB 4NCAA 2CNOB 2PIIA 2QT7A 2BDPA 2Y1JA 4DL7A 4J9NA 2HW3A 3NBPA 4DQPA 5G0RA 1N8RT 1N5QA 2XCPA 2CPFA 4KKOA 4DUYJ 4NL5A 3VHQA 1HHSA 4OZ1A 2VQEJ 1HHQA 4XO0A 2PO4A 5D8HB 3BGOP 2R8KA 1F5BA 5CH7B 4UQGA 4I0WA 3M32B 2PI4A 2PFFB 2NYHA 4C7QA 5F8NA 4P72A 1JXVA 1T7PA 3CO0P 4MTPA 3JSBA 1BGXT 5KG6A 1FESA 2F3JA 4NLDA 1Q4RA 1ZM9A 4TYAA 3MTKA 1VJQA 2LEAA 1JJCB 2ZH9A 4C3LA 2QLBB 2KXFA 1RSCA 1TL4A 1UVNA 3M2RB 2GGPA 2X51A 4OZ0A 4GC6A 4X4SA 3DDNA 3UFCX 3KLVA 3J80Y 1GMWD 2I8EA 3BR9A 3LP2B 4M1KA 4QU6A 2ZH6A 4DR3J 2ZJQQ 4Y2KA 3RAMA 1EHWA 5B7WA 4F26A 3B54A 4Q45A 2LDIA 5AJ3J 4LFBF 1Y7PA 4WYWA 2AW0A 2E7VA 4YY3J 3CO9A 1QSYA 1VK8A 2D3ZA 2LP4A 3OLAA 4X64J 5GMKa 1RTHB 4C2MA 4ZCIA 4OHWA 3PW4A 2BE2A 4IH7A 2A6MA 2E1AA 1MN7A 1NBEB 3ZTSA 1ZAWA 3BQ2A 2JH3A 2A18A 4RNOA 3MR7A 2F9JA 3UVJA 1MNEA 1HWLA 1RI7A 3UE2A 1EAYC 2V69A 1U1KA 4IFYB 4Y2AA 2IA6A 2ZOMA 2I2YA 5AE2A 5BR8F 3PNIA 4DLGA 4MH8A 5H1SV 4DV7F 2V6AA 1FRJA 4J9MA 2BE7D 1U6BA 2CPDA 2EG2A 4CH7A 1W2BR 1M5SA 2WVDA 2OELA 1LKZA 1YDLA 1S12A 1TELA 2F4VF 1SI9A 4DR6F 2LKZA 2UVRA 1FKOA 4JP8A 1R3NA 4JYAJ 3US5A 2FHKA 2RDJA 1KOHA 3WC2A 1S1TA 4YDDB 1RTJB 3GMGA 4MK7A 2CVEA 4ILLA 3OL8A 1UWBB 4J37A 2K7JA 1PYSB 1DLOB 1MWYA 4OX8A 1K73T 1S1XB 2KG0A 1WSVA 2X7IA 2PC6A 4DV3J 2XO6A 3N5BA 3BF4A 2V8HA 4MKAA 3AXMA 2UXBF 2VV5A 4HYKA 5B08A 4HEA9 2OSQA 2GW8A 1X9WA 2GQQA 3P96A 3NS7B 4K0KF 3BGRA 5D3GB 2MMYA 2DY1A 4JV0A 2PMWA 3R6GB 2FQQB 2XS2A 1IKVB 3MF5A 2UUWA 2GMJA 1HBOA 5CYMB 4IO9Q 2ASDA 4B3RF 1YG0A 2BX6A 3VZIA 2R3VA 2E9TA 2GIRA 3RB3A 3H8YA 4ZVOB 2VBXA 2Z30B 4D3HA 2DPIA 1X0FA 2GFFA 2P9CA 1S10A 2FY1A 2MKCA 5E3QA 2DHHA 2AMCB 3RR7A 3H0PA 2B8QA 5D0RA 1RT2A 4DFPA 4OZLA 4J91A 1FTCA 4FF1A 3POTB 3CJ2A 3JS9A 3BDPA 3E3XA 5KG5A 2N82B 2N3LA 3NGTA 3UR3C 3P5BP 3CDBA 2NLWA 3J7Z5 4ITSA 2FC9A 1R6YA 4ZDNA 4X4RA 5J2MB 2J9DE 1N0UA 3TANA 2HK3A 1YITS 4O0IA 4DR1J 3HT3A 4DR7J 2HHXA 3HVTA 3T1HJ 5LMNF 3EGWB 5CXTA 2UXDJ 1XERA 2QYGA 3MM6B 4X62F 3ZXWA 5DG9A 2BKNA 4ZA1A 1FFWB 3R7NB 3ONQA 3CVKA 2B6AB 3C3LA 4YR2A 1OQ3A 1Q8KA 2RUGA 2ZVSA 3C66A 1SC3B 1S9EA 4B9LA 5FD1A 3RAXA 2FZGB 1T9VA 2VDHA 4KKOB 1SL0A 1D0EA 2V9WA 4B08A 4NLGA 4I2PA 3DRSA 2QMXA 1OSCA 4I4BA 3KHGA 4OI0A 4LF6F 3T9NA 2W7AA 3D0GE 2VBYA 3UDVA 1OWXA 4CLSA 2XMJA 2ZH8A 4DR4J 1NSPA 3HKZD 2JVOA 3GFXA 1FWLA 4JBCA 1BHNA 3OFGA 3MECB 2IRUA 1PAUB 2YX7A 2U2FA 1JLQA 5HK4A 3W2VA 2V2VA 1UETA 5AXNA 3KLEB 2AQ4A 2AYGA 3LP1B 4J90A 1JB0C 3QFHA 5EGYA 1RCXB 3PKMA 1NK0A 4FVMA 4HL9A 1FD8A 2J9DA 3THTA 2WBMA 4B9NA 3KG4A 2FY8A 3GE9A 1D09B 1AUSL 3TP2A 3G8SA 2V4QA 1OS5A 3UQSA 1FRLA 4P7VA 2BZ2A 3W65A 4DL5A 3C6TA 3N28A 1NZ8A 4IR9A 2CPZA 1S59A 3FBEA 3AD7C 5HVHA 2AJ0A 3ULHA 3UCZP 1A9NB 1TAQA 1BQMB 2B9YA 3M6WA 2EBGA 3VGSA 5I4MA 1NKBA 4KB7A 2HGLA 2EKYA 3TUZC 4NXNF 4A8QA 4RW6B 2MSSA 1JLBB 1SQFA 2GHPA 3L95X 3IRWP 3RYLA 1GH8A 4C8NA 5IT4A 1YKWA 2D3O1 3BEGB 3RB0A 2B51A 2DKOB 5H9EJ 1CJKA 4B3TF 4ED0A 5LJ3Y 3FBCA 2AT1B 2C2ZB 1Q81T 3VAHA 3R2CJ 1S0VA 2EC2A 3M8YA 4WP8A 2EI5A 3F73A 2UUAF 3HT0A 1BUXA 3H59A 3QGIA 3R5DA 4CO2A 2C3YA 2EFPA 2F65A 4CRJA 2CDRB 5KFRA 3Q0AA 1FKAF 4J9QA 4JI8F 3ZC4A 2MQLA 3IAS9 2FJDB 5L8RC 2JEGA 1G1XA 2E9ZA 4YHHJ 4DUYF 2VG7A 1S1TB 5LSLA 2VQEF 4V19J 3A12A 5HI7A 3VCDA 1RU2A 5HVGA 3W64A 4DR5F 5GAEI 1OYDA 1RABB 1HNZF 5KT5A 5T7LA 2J0XA 2NUHA 2DEJA 1RWVB 2Q6BA 1RT7A 4I1TA 4HHJA 4KHPJ 1KWMA 3KYLA 5KT7A 3OHAA 4P2FA 3SIPB 3H2LA 5DETA 3PW0A 2OMOA 2QLWA 4OYIA 5KFGA 4F25A 3ILOA 1HW8A 1KLMA 3KDNA 1FRMA 1K44A 5ETNA 3VQSA 4K4YA 2MY7A 1C1BB 1RUSA 4O3SA 2VA3A 4LFAF 1NO8A 4URSA 3CB4A 3NG8A 3L7PA 1KRPA 1F5AA 3D0IE 3T41A 1V3SA 4KYZA 4LF2A 5A6PA 1ZAXA 2XHCA 2FDNA 3I32A 4DX7A 3ICLA 4NLRA 2VOOA 4RL1A 3W62A 2Q79A 4DR3F 3AJ2A 5LXRA 1VQ7S 4I6YA 1LXJA 1KTVA 2QE5A 4X4PA 5BYSA 3DRPB 1LFWA 2FJXA 1LXNA 3TJ8A 2HHVA 2IHR1 3DI6B 1HBNB 2GVDA 4HKQA 4X4UA 1DY3A 3KK3A 3HD1A 4Y00A 3BBFA 3QWPA 2Z2LA 2BA9A 1C4CA 3U1LA 5B0AA 3ITHA 3LP0A 2DNYA 1NH7A 4BLGA 4JI4F 3S8SA 1RU1A 3QT6A 4V1Ak 2GVZB 2PD1A 2ZBPA 3G8TA 4ANCA 4WIIA 4FDFA 2IY5B 4ZMMA 5IZHA 3H98A 1VQLS 3FMBA 2ZDPA 1SV5B 4FS2A 4J9UE 1U0HA 2BJ3A 5I3PA 3PX0A 1GTEA 2VIHA 5ETMA 2O1PA 1VQ5S 4WFZA 2GV1A 4OHXA 3SEOA 4LRDA 5HATA 2IVMA 3HVAA 2BBEA 2EWHA 4CLWA 3H90A 3HULA 4DV6J 1X8DA 4OYXA 3PIPQ 3JTPA 1S9EB 1MMDA 1HBUB 1SJ4P 4JYAF 5A8KB 4OHZA 1Y0HA 3TVYA 1VQPS 4ILMA 1Q7YT 2L3MA 3LOUA 1VHIA 3J7ZT 4X84A 2KZZA 5KOXA 4DPYA 1JNZB 1OQ6A 4NZ0A 2KYXA 4MK8A 2I5JB 2LQ9A 2AJ1A 1N6QB 4DV3F 4LQ3A 3OL9A 1JLQB 3A3OB 1TKDA 1B70B 1H72C 1GXLA 4IYQA 3RGIA 3O2IA 3C14B 2EBEA 1EQMA 4DG1A 4R5PA 1JWWA 1WD6A 2R2RA 3RRGA 2R2SA 7FD1A 1X7VA 3KLFA 2W8KA 2P9EA 1KN6A 2CZVC 5J2NB 1RAJA 2CQBA 4KTQA 2BE9B 4O23A 4K4TA 3K7RA 3GIMA 3LAMA 3QPIA 1HBMA 3W60A 2DIVA 2QLXA 3OR2B 1EX8A 1EKRA 2H5IB 2CJBA 3VGUA 4A8YA 1WC4A 3EGVA 4XDCA 1TKZB 1RT5A 4ALZA 5KFKA 4DU7A 5F8MA 3CCUS 4OIXA 3C6TB 3M2UB 1OIAA 1DHMA 1N5SA 3C16A 2XO7A 2AX1A 4M5KA 4JI5F 2RRBA 2W2PP 1KHWA 1VISA 4FS1A 4ECXA 4WK1A 1IXKA 4RUHA 5I3UA 3AFGA 4RW8A 4WFBQ 2JFDA 4IOBA 4EWTA 3MCSA 4HHUA 2AEFA 1NRKA 3GP9A 3I0RA 1W7WA 4G1QA 2ILYA 2ZE2B 3MMAA 3ENWA 5JVGQ 1RBAA 1K0VA 3QGHA 3MEEB 4QPXA 2VQFJ 1Y9OA 4YN3B 3K0JA 4DR7F 3FZ2A 3T5HA 3MM5A 2CJKA 4Y0FA 1NEEA 3ZZYA 1R0AB 2WOMA 3IG1A 4DQQA 3TZWA 2UXDF 2DISA 4LSNA 3BN7A 1YJTA 4Q7AA 4TKTA 1Y3KA 2U1AA 4OJ1A 3HHKA 2KJWA 3KG0A 3QRPA 2F8MA 3L7OA 3OW2R 3H5YA 2VG6B 4CNZA 3R97A 1UA0A 3NCRA 1UW9A 3HLUA 2FHMA 1HMVA 4N76A 4QR0A 4Q2LA 4DN9A 3JQJA 5IQ6A 4QBUA 1D9AA 3J81U 4PYDA 3H4BA 1FK9B 1T03A 4OYAA 3ILJA 3CCQS 4PYAA 2RB7A 3UDLA 4ZVGA 3BYPA 2KI2A 3CJ4A 3RTVA 3VAKA 2WW8A 1RAEB 5IV4A 1OSDA 3UW1A 3SQGB 4QWDA 4DR4F 2KM8C 4ES2A 1S77D 2XY5A 3V4MA 3CCVS 1RJJA 3QRRA 4ECZA 1WELA 3OPKA 1VQYA 1N88A 3IR5B 4OZ5A 3G6VA 1JXLA 2OPPB 3O6QA 2HMIA 2E1RA 1BD6A 4QYZJ 1SJQA 4Y6IA 3RW6A 2CZ9A 3BDEA 5GMDA 2BM1A 1GTHA 2AJFE 2YWHA 5KAKA 3NMRA 4QPTA 2B9EA 1FX2A 1MU2B 2A0FB 3OJUA 3M4XA 1Y5NB 3RU0A 5IV3A 3FZBA 3D1HA 3ZTPA 1CQMA 2E7WA 3M8QA 4DUZJ 4Q5VA 2OGUA 2J6TA 3R1LA 1RCOB 3PO4A 1QJHA 3MEDA 1N32J 4H4MA 4PXEA 3L7UA 2JLFA 1TUWA 4NLOA 3BSOA 3BZQA 3CJRA 4FYXB 1WHWA 5IT9Y 2N7CA 2CIMA 2FC8A 3NXZA 4RW4A 2FVQA 3ENVA 4F3OA 4CO3A 3Q8QB 2F63A 5HQ8A 4GVBA 2R7VA 4YOEA 2GVDB 3W5YA 1KDNA 1NB7A 1NSQA 5A2QY 3KMSA 2CRLA 1VQ8S 5C42B 3GJRB 3K5PA 2R8IA 1FXLA 2KG1A 2YH1A 2HGNA 3DOKB 4O0NA 2E7XA 4C48A 5HJXA 3J80U 4C6AA 1TV6A 3CGIA 1F9EB 3B6BA 5CYQA 1YQHA 4KFBB 5EN1A 1PIEA 4PR6A 5C2GA 4IRKA 3CJ0A 5CQGA 3KLGA 1JLAB 2YKMB 1AA1B 2D1CA 3MUMP 1ZAVA 3P4UB 5GAGU 3K5MA 5K14A 3HHNB 2PMHA 5EX0A 4YHHF 3DMJA 1DJ0A 3R5JB 3G2XA 2D9OA 1T8EA 1VIXA 4DL0C 2CQ3A 2Q3PA 2JLEA 3DOLA 1JLFA 2GS8A 3G71S 2DXDA 2VICA 4CLZA 4WZMA 2G0JA 3VAGA 2PA3A 4HDGA 2NYIA 1RT6B 2L08A 2OTJS 2A2DA 1Q5VA 1M90T 4FPRA 1W2IA 2CQ0A 4KHPF 5FLXU 2FTRA 4X4TA 1FVSA 3PFEA 3GJTB 2B7CB 2B43A 4LBPA 2MTLA 3HMJG 1YBUA 2UXCJ 2HHUA 1U8WA 4ENOA 2WW4A 1HPZA 1FXDA 3VQTA 2ZH7A 1OJ4A 5LOQA 2KT2A 3D3BJ 4FKYA 3N6LA 4HT7A 3DXSX 1RTIA 3NKYA 4ECVA 2VPXB 2VL1A 4CZCA 2BQ3A 1T95A 4FYYB 4NLVA 3QRQA 2C1EB 3EXYA 4OQJA 3TVZA 3GQCA 1EJ7L 3M9NB 3D0HE 4C8MA 1HI8A 4PQUB 2B3TB 5KFOA 4UOGA 3W9JA 4WFXA 4RZRA 1TK8A 2K3IA 3K5NA 3IFEA 1K1QA 3W5XA 1RT4A 1J2VA 4C0OC 3MMAB 1E6VA 3ISND 1ICEB 4KQZA 2MZTA 1MSWD 4I69A 2XULA 1HLWA 3PXGa 3Q83A 2ROGA 1KQGB 3MM5B 5F9LA 2ZEJA 2DNKA 3HSJA 2LECA 3MOJB 3IGNA 4I2QA 1MMNA 2HZVA 3D54A 2DH8A 5DQIA 3HK2A 1G3OA 1D9FA 1WEXA 2D74B 2PEBA 2JL9A 4TY8B 4NRUA 1S6PB 4LJMA 1H98A 1FEEA 4RBVA 3SDEB 1JLEA 4DV6F 4RWWA 5DDQC 4PAAA 4JI1J 5B0DA 2H3EB 3T5JA 4Q0BB 4J9VA 5DS7A 3SI8A 4WE1B 2HQIA 2HURA 4OMFG 3DU6A 2VG5B 3EPGA 2HNDA 4O3RA 2BM0A 2LFVA 1PKUA 2AX0A 2APOA 4Q43A 2NSCA 3BYRA 3NAHA 3TAQA 2E5LF 1UPMB 1SVDA 3SSRA 5KFMA 1QD1A 2RS8A 4Y28C 5J2PA 2EEYA 3F44A 3KLIA 2LLZA 3QBCA 2XNRA 2FVRA 1C0TA 4LSLB 2G1DA 1U1RA 1LW2A 2MQQA 4Q44A 2CJXB 2FJVA 4RR5A 1XC9A 1LWCB 4WU3A 1HQUA 2YH0A 3HM9A 1VBYA 4HACB 4ZP7A 4QOTA 1CJUB 2ZD1A 4PG8A 1IM4A 1UJ4A 3MXHP 3NEKA 2AGPA 3ETMA 2VKRA 1F2HA 3M8WA 4G3IA 2F9DA 3DKDA 1NDLA 4F02A 4H4MB 1VMBA 3SSQA 2KJVA 2RD5C 2CJ9A 4DHVA 3LW5C 3O5TB 1OPZA 1HR0J 3R27A 5E33A 2Z58B 4AYBD 5L1KA 3I55S 4AFFA 2KTQA 3N01A 2VA2A 3AQPA 4ED3A 2L9DA 3Q8SB 1HYSA 2NZCA 3IBCB 4GVBB 2Y0SD 1KD1T 1A6LA 4KH0B 3OBIA 3C6UA 4PXCA 1XJWB 2YQ1A 3PX4A 2HHSA 3LH2S 1VLYA 2XSFA 3OVAA 3BS9A 2VQFF 4DV4J 2WSFC 3GIJA 1APSA 4QIGA 2VUGA 2HHWA 4H4OA 4K2XA 2OPQA 1CC7A 3HSDA 4Z7YA 1VYAA 4KE5A 2ERRA 1REVA 1NJZA 4QIWD 4DFJA 2H9ZA 2J6SA 5J1EB 1EQ0A 3AH6A 1FEHA 3AT1B 2WTFA 2MY8A 3D6MB 3C46A 2HBRB 3CJKB 5H9EK 4U95A 2BOAA 4ZPAA 2R7TA 2FLPA 1CQNA 4C0BA 3OT9A 3OUYA 2B56A 3KHLA 1VQ9S 2JEJA 1O5JA 3DMJB 3QGPA 4UW2A 2M7SA 4M5JA 3GONA 3C15A 4I64A 4QJVA 1TVRB 3DOLB 3M8ZA 1P1LA 4CNYA 1VC0A 1H2TZ 3EZUA 3VVTA 2HNZB 3K17A 2DGUA 2WONB 4K8RA 7FDRA 1S57A 1CJVA 2VU5A 4HVZA 1FKPB 2FJAB 1OPIA 3CXCR 3DCAA 2DNPA 4ZIVA 3QJLA 2ADBA 3Q86A 3CUNA 4MJKA 2RQKA 1H2UX 2XZDB 4LT6A 2ATCB 1L3SA 2YKNA 1TL3A 2MLXA 1LWFA 1ZA2B 2J8AA 2OHDA 3CC2S 2V8VA 2A10A 4DUZF 5AE3A 5JXSA 3D6HB 3EMTA 1RTIB 2PI5A 3B78A 1N32F 1TMMA 3VWSA 4KT0C 4EYHB 2V9KA 4O4RA 3L09A 2W2OP 2OO4A 3VAIA 2D7SA 4WWSA 1CC8A 1S99A 4IFVA 2RS2A 3NOGA 5DLGA 5D4OA 1YK9A 4ZLJA 3NS6A 3KLHB 1NPPA 1Q8BA 4JI0J 3IS9A 2I1RA 2YQ0A 3M8PA 5KFJA 3EGNA 3KHHA 2UUCF 3JSYA 2HK2A 2MGZB 3TARA 3QYYA 1I3OB 4RW7B 1U8SA 2WVEA 1S9GA 2J9EA 4EI2A 4YB6A 4IUFA 3ZO7A 4KIAA 4ED8A 3X1LB 2NREA 3M6XA 2KN4A 1ZA1B 5CCMA 1WWHA 1NM2A 3TWZA 1WKLA 1Y3JA 1H6KX 2GCFA 3Q24A 4PRFA 4R8UA 1RHUB 5B0BA 4RO0A 2I0XA 2JOQA 2DY9A 2YWWA 2GQCA 2Z0GA 2PDAA 2RT3A 4W4MA 2J6UA 2H1YA 2RUSA 2YPYA 2HHPA 1PILA 3R6LB 3ZNJ1 3AB2B 4DR2F 2QGFB 3V6DB 2QC3A 4KSEB 4U9RA 3MM7B 3M8SA 4IRDA 3QT8A 4MFBB 4J9OA 4DU8A 2MJNA 4DBQA 1SH2A 3DFEA 2W7PA 3DDKA 3BO2A 4DLEA 4QW8A 2DXFA 5C5JA 1PJ5A 2POKA 2ZH5A 2FYXA 3PEJA 4TQSA 1ZH5A 1MWZA 3MEKA 1SKSA 2UZAA 1FE0A 2JNJA 1V6HA 4Z2XA 4WU2A 4OI6A 3G9CA 2ACYA 3MOZA 5J2PB 1VK3A 1FJ7A 2RJZA 1NK4A 2YTCA 3NWRA 1RWNB 2QTWA 3AA9A 1AZSB 3N6NA 5M2RA 4ES3A 3DLEA 4GVLA 4WCEQ 2UXCF 3PYEA 5GAEU 4P9SA 1CBKA 3Q8YA 2W4PA 1WKJA 3C8YA 3QLHA 5RUBA 4D3GA 2AU0A 2AF6A 4PCQA 2XC9A 3RZAA 3M1VB 1VHFA 1CJTA 1UFKA 2RKIB 1WJ9A 1S0MA 3MD1A 3HVWA 1X4BA 3DLKB 4ELVA 3DHXA 5LSOA 2QMUB 3FJ2A 2ZUGA 2RAQA 4I7FB 4ZP8A 4GKKJ 4K2JA 4C11B 5C25B 2UUTA 4DDFA 2XLJA 2OTLS 1X9MA 1S9FA 1SC4B 4NLXA 4KHMA 5CAAA 2GHVC 5GMEA 4WZQA 1S48A 2MJUA 5KFNA 1IJEB 1VRUA 2RQMA 1HFEL 1NB2A 2HS4A 3TA0A 4ANDA 5HAOA 4M5DB 2FLNA 1Q53A 2CZ4A 3G4SS 3EYZA 2ZOGA 1QAJA 1ELOA 5DZ7A 1RLDA 1N4LA 2OPQB 1ZOTA 2DH9A 3BGFA 2O01C 2YNGB 3G82A 3LPYA 3T6JA 1U48A 1NPKA 4F0KA 4ATNA 4X65F 3GZ7A 5D4PA 1NJXA 2YNIA 5ETTA 5K5MA 1IKWA 2EFGA 3MMBA 1CS4B 2AZ1A 4MKBA 1NH8A 2BRKA 1YBAA 2AEJA 2EXUA 5D0EA 5L9XA 2RQCA 1R8BA 4JI1F 3C19A 3UNGC 1NJYA 1VCTA 4OI2A 3W8GA 3BR8A 4Q8FA 2OAUA 2QL9B 2FHOB 2IDEA 5HL7Q 2AJ4A 3R9LA 1X5PA 5KT6A 2JFKA 4O4GA 3V4IA 4KO0A 5GADI 3MAAA 3KXDA 4KV8B 3VTIA 3LALA 1GMUA 5FJ4A 4ICLA 3BPDA 1ZM2A 1F0XA 3I4PA 4M94A 2YNFA 1I51B 4K4ZA 3H25A 4RKUC 1N48A 4DI6A 1XIQA 4A46A 1URRA 3HKWA 1N54B 1IKXA 1RK8A 3CWJA 2JEIA 1K1SA 4F2RA 2YWKA 5F3TA 1EETB 3VALA 1DTQA 3J7AN 2WSEC 2OPSA 4NLWA 1UZDA 2CQDA 4TU7A 2GX8A 3PJXA 2IBKA 3ETOA 5HROA 3I0SB 1SKWA 4DSKA 2DCLA 3SSSA 4QYZK 4FBUA 4PXBA 2ZBIA 1XR7A 2JC1A 3I5AA 2J76E 1HR0F 1R7IA 3KK2B 2W2QP 3I5BA 5D4LA 3OSPA 3D5MA 5KT4A 1WOPA 4ZCKA 3Q2SC 4F7VA 1NKEA 3BV8A 3KUHA 2QV6A 2ZKTA 1SBRA 2DNMA 2QFIA 1WDTA 3M30A 5A0YA 1TQLA 4B9UA 2VPZB 3SCLE 4DV4F 3NL0A 2RF2A 5K8OA 5D0HA 5HMZA 4DSFA 4JV2A 5BR8J 2WZ1A 5EHHA 3FUYA 4DMZA 4A8FA 4DL4A 2L9NA 1V3ZA 2CNNB 2YWEA 2C3OA 1YJUA 3HF5A 5ITHA 5IT9U 4F4ZA 5CCLA 4PWUA 3DLJA 3GILA 2J0QD 2P6SA 1JLGB 1MWQA 4YEAA 3DRYA 4J5OA 3DLGB 1FA0A 3TZYA 1C0UB 4YMEA 1T9UA 1NUEA 3GIKA 1JQGA 4B9TA 2E9RX 3BQ0A 3TVKA 3NWGA 2YQ3A 4KR0B 3A8EA 3CE8A 4ZLLA 3M32A 4AXIA 1PBAA 3TUPA 3I31A 5FIIA 1YJ7A 1HNWJ 3A8JA 3CCMS 1V5VA 2GO9A 5DG7A 5JJBA 4WPAA 2UXBJ 2QLFB 1QE1A 4DFMA 2WVFA 1GQEA 2VODA 3GB0A 2CWKA 2YKPA 1RWMB 1IM6A 3V6KA 4ZVQB 2ZKUA 4B9SA 2W9BB 3IN5A 2M9KA 2RU9A 3TA2A 1YZ6A 3DLEB 3M05A 4LMZA 3FC9A 4B3RJ 3M2RA 4PG6A 4E98A 3PM9A 5IM0B 2XMVA 2VPYB 1U26A 1Q1KA 2FB0A 3LP2A 3OTDA 1FFSB 2QEXS 1UA1A 1VQSA 1LFPA 4LF5F 4WK3A 2XYGB 1IKYB 3ADAC 4CM2A 1KR4A 3IAM9 4M63A 5J2QA 1XN9A 2C2DA 3U1MA 2CQ2A 1WC0A 2HVHA 2YNHB 1RTHA 3QT5A 3MCOA 1XNQJ 4JI0F 4B3OB 1SH3A 4RU9A 1VRUB 4QYRA 4FP9A 3CCRS 2DRAA 3FRZA 2OH2A 3D1OA 1IQZA 1O8BA 4C98A 3PX6A 1B4SA 3TAMB 2O3DA 4LR7A 4LR8A 2G9OA 4YUDA 3Q22A 1BMQB 3G82B 1TUGB 4HH0A 2QFJA 1YJVA 3LGMA 2V4RA 4F4KA 5KFCA 2VF3A 2IJNA 1U09A 3R8YA 3MMBB 4IG3B 1RHRB 1YRUA 1RTJA 3N6MA 1CEZA 3AJ1A 5HMXA 1JKHB 2JSXA 2QN6B 1SC1B 3MR6A 4LF6J 2AYEA 5IS2A 4ECQA 3HHDA 1UWBA 3NGRA 4PABA 1TKXA 4NLQA 1DLOA 3RB6A 4ED6A 3B4DA 1S1XA 3V4IB 4ZN3A 4USJC 1SKRA 4DV2F 2DCUB 4J9LA 1WKKA 2GNKA 1RA6A 1XNRJ 4NCGB 5D3GA 4MKVA 2X3DA 5IQQA 1IKXB 1IKVA 1R89A 3GSDA 3SV3A 5I42B 3ZTRA 5CYMA 1MLAA 2I38A 2B9WA 3ILLA 2K1RB 2OSRA 3KMQA 4LRAA 3VVUA 4DUTA 3SXLA 1HA1A 3BB5A 3SMZA 2KH9A 5KFFA 4DX5A 3BREA 5KG0A 4EUVA 3FQKA 3MEGB 2B0GA 3VAJA 2C2NA 2KVIA 2FPHX 3W5ZA 4RW9B 2Z2ZA 3WX4A 4NXNJ 4U8YA 3POTA 5E2QA 4X4QA 4QCLA 1YTYA 2QO3A 3J81Y 3H40A 3HXMA 1R6VA 1ZM3A 4C9DA 4L3NA 3U27A 2LQ5A 4ED1A 1GXUA 3PR5B 4KH1B 1UL3A 4LVNP 4OYWA 1U47A 2NQPA 3OXGA 5KFWA 1TK0A 1FFGB 4OHYA 4ZPBA 3L4BC 1RKJA 4IDKA 2FLLA 2HKEA 2B6AA 4LRBA 3QZ8A 4AD6A 1EB0A 4JI3F 4JI7J 5EDWA 8RUCA 5HSPA 1JIHA 2KL8A 4DXLA 1LEOA 4JI8J 3MMCB 3TYTA 2HIQA 1N36F 4WFYA 3QZ7A 1NZAA 4R25A 2PSZA 2E5GA 5THWA 2VC0A 1B0VA 2XS5A 2MYFA 2A3JA 4DR5J 2VFSA 2EK1A 4RUAA 1HNZJ 4TQRA 5IWAJ 3JSRA 3MECA 3FFIB 1RE1B 3CNQP 4PUOB 1CULB 3R7BB 4OLPA 4CT9A 1L3UA 1PGZA 2HHQA 1M5HA 1QE1B 3KLEA 1M1HA 3PW2A 3LP1A 3JSMB 1SQEA 2AYBA 4IH6A 5L38A 2H51B 4TU9A 1UEUA 2W2MP 5K9FA 1F1BB 4A8MP 2C3UA 3MM9B 4LFAJ 5DRKA 1M1KT 4G65A 2GHWA 4ZITA 2OFHX 5A8WB 2YX1A 4F50A 2QA1A 1NK9A 4WTOB 2CAJA 3BGUA 1HWKA 1Q16B 5KFIA 4G1IA 4HT5A 1NSKL 2XSJB 5DDPC 3MPUB 2FVPA 2ZJPQ 1NHUA 2DO4A 4MMOA 3NCQA 1BQMA 2ALYB 4RJVA 3GV5B 4C3MA 3OFFA 1AW0A 4RW6A 4K50A 5E3CA 1JLBA 1VI7A 2BRLA 5J2QB 4I67A 4P2XA 3PDNA 4IO1A 3S01A 4UQTA 2OMLA 3LQVA 3W9HA 2ZM6F 2MQPA 4JI4J 1RLCL 1P6TA 2ZH3A 3TEGA 1X31C 5DDOC 4FXDA 2ZWPA 5HVFA 4BDPA 1T05B 3I9V9 1S5ZA 3DOMB 2G2OA 2VFVA 1KP6A 3NP5A 2IIHA 8ATCB 4EZ6A 5FLXY 1FF2A 2R7OA 1S0OA 2XMMA 4FNIA 1D9DA 3GR1A 2X1GA 2LQ8A 2VPWB 2DRBA 3KTQA 3M6UA 1S1UB 2XMAA 3R5GA 3AB4B 1S1VB 3M2VB 2WHOA 1KTQA 3UWTA 1WEYA 2HNYB 2R7RA 4OI1A 1TKXB 1HNWF 3R1HA 3BQ1A 2LU1A 1RXOB 2RU3A 3UCGA 2DIUA 1L3KA 2W01A 4DL2A 1QM9A 5KFLA 3WHIA 4KC5A 3VGVA 2OEJA 2A2CA 5IT0A 3OFEA 5L39A 3ET6B 5FDLA 2KHDA 1FVQA 2MZ1A 1C1BA 2DK2A 3IO1A 3BO3A 3GPAA 1SUQB 3HI9A 4EZ9A 4EFAC 2P2CB 2M52A 1UMJA 2EFVA 4AL6A 4AQYJ 3S6EA 3WX8A 1KQKA 2C3MA 5JMNA 1RBLA 2BUNA 3ZTOA 3QT7A 4JI5J 1HWUA 1NNDA 3DRPA 4LFCF 4ECSA 3QMQA 1LWXA 3DI6A 1SL2A 1HBNA 2QYCA 4NI2B 1QVGR 1U49A 2CPHA 1XNQF 2G4BA 3J7YU 1TU0B 1O0PA 2LMIA 4C8KA 2P9GA 1P9QC 4M5IA 2GVZA 2HFOA 3CEDA 3GYNA 4NYOA 4FBTA 5KT3A 3T1YJ 1PO6A 4HI1A 3TUJC 3ZZ0A 4ER8A 1SV5A 1GXTA 4M5LA 4K4XA 5JUMA 2CQ1A 3MTJA 1B7FA 4P6QA 2FZKB 4QQBA 3G96A 1HL6A 3PJWA 4IDKB 3OTCA 2F8HA 2CNKB 2QA4G 3B82A 3V2UC 2LVWA 1VRTB 1ZPVA 3RJMB 1BWVA 1HBUA 4Y2CA 4ECTA 2JRSA 3OTOF 5A8KA 3CD0A 2Q1LA 1HARA 2XGQA 4N41A 3W2WB 1KC8T 5EX3A 3DRXA 1I6JA 3K2YA 1IVZA 2ZBCA 9ATCB 4OZ2A 5E0OA 4GC7A 1VBXA 1KS2A 1GNKA 3TQEA 4F2SA 2O5DA 2AEMA 2OLWA 4LRCA 2IJRA 2I5JA 4ZVEA 2E44A 4XAKA 1N6QA 2QLJB 1U45A 1H7WA 1ACMB 3MUTP 4DPXA 1HQEB 5F3ZA 3CC7S 1XNRF 4FYVB 2QRRA 3HHEA 4F4AA 3C14A 5DDRC 4UF4A 5HO4A 2VH7A 5D4NA 1UWAA 3T1AA 4U96A 5E41A 5I3QA 2IDLA 4TNOA 4LBHA 1HQ2A 1IBKF 4KAIA 1UVKA 4JI6J 5J2NA 1NMEB 1F3FA 2I9SA 3OR2A 2BYCA 5DQGA 3QIPB 2BJ1A 1TKZA 1FX4A 2D3OR 3VAFA 2PFDA 1SB6A 3IXQA 4OYZA 5F8GA 2C42A 3GU0A 3M2UA 2V63A 3EJMA 2LCWA 2KHCA 4YR3A 2MKIA 1KBRA 2C2KB 1TL5A 3KG1A 2MZJA 3FSYA 4CLYA 4GKJJ 3CF5Q 3CCZA 4H4KC 2YKQA 2XWYA 5LL6d 3IM8A 2GIFA 2DNLA 2UP1A 2MKKA 1Z4UA 4M8LA 2ZE2A 2RE1A 4ZVFA 2GC8A 1FT8A 2Z57B 2DR7A 4YR0A 2UU9F 3MEEA 4LF4J 2N3OA 1ZTWA 2VFRA 3CULA 3DDIA 1HW9A 4FVCA 3QO9B 4NLSA 1R0AA 2MZQA 3ZZOA 4EMDA 3H5UA 7AT1B 4OJHA 3P8BB 3PACA 5D0GA 3G6XA 2R7WA 1QUVA 3NGKA 4YB7A 1RHMB 4Q2MA 2VG6A 4JI7F 5G4DA 1S4EA 4NYPA 1WACA 1RKIA 1T3OA 2FHJA 4GO7X 2KT5A 4XTTA 2NXJA 1FK9A 2M8DB 3W66A 5B0CA 1KVIA 4MYTA 4DOZA 5CA5A 2N7YA 3K8WA 4HLBA 1AT1B 4USKA 3JYTB 1VQOS 4C8ZA 1A0OB 3SFUA 3MR5A 4FF4A 3SQGA 4CIOA 3VGTA 4KRWA 2V67A 4U8VA 2K06A 3PG9A 4KBIA 5IWAF 3QWUA 1B0TA 2GJIA 2BOPA 4QIEA 2R8JA 2OPPA 4OV6A 4WJBA 3KJVA 1X60A 5EUHA 4FYDA 4ECWA 1KOOA 5M2UA 3MMJA 1VRQC 4E0DA 2IM1A 2QA2A 5FDLB 3FK4A 1MU2A 4ES1A 4QWCA 3NNCA 2BKPA 3UDCA 3LGNA 5C24B 2AGQA 1IBMJ 5HMYA 1FRIA 3CSKA 1XR6A 3RAQA 3AA8A 4P10A 3MDFA 1MN9A 1HNVB 2VFUA 3V6JA 2CQPA 2HVIA 2Y8WA 4Q8EA 2FJWA 4X2BA 2R7UA 4IG0B 3Q8PB 1S6OA 1LWEB 4ZCMA 3BKTA 4NA2A 4ED4A 1GT8A 4WF9Q 1HKAA 4DSEA 1SCJB 1ZTTA 4LF8F 1KLNA 2IMOA 4LUBA 2NS1B 2Y8YA 5F8JA 1VC6A 4OFZA 4U7CA 4YB1P 4RUCA 4M5NA 5GAHI 2RRAA 4G1PA 4NZ6A 4DCOB 2BV3A 5C42A 5IC6B 3OL7A 2IRYA 3V5RA 3AOAA 4DQSA 1JLCB 3OR1B 1N5VA 1U0SA 2MLZA 2DNHA 2F8EX 3DOKA 4UOHA 1NKCA 2VB6A 4A8WA 1WG4A 3MM8B 3EM1A 2B4VA 2OI2A 2YWFA 1F2GA 3TEHB 2QL7B 1FTRA 5HBMA 2RQ4A 2W4DA 4KFBA 5K20B 1UPPA 2V2ZA 4A8KA 2FJEB 3HHLC 1SIZA 3V6HA 1JLAA 2E5IA 1QAXA 4WTYA 4ZJLA 4DZ6A 2YKMA 1W25A 2DR9A 2LQJA 2PE8A 1LK5A 4RNHA 4XPCA 2ZUAA 2LQBA 2COLA 4URGA 3HVRA 3UD4P 3NY0A 5LSRA 4ILRA 1X4EA 4X4OA 2W8LA 2XHWA 2J7WA 2ATLA 1FNXH 1K8AT 3G86A 4AE5A 1K9MT 2RSQA 1VJWA 2JZ5A 2QX0A 1ZS6A 4CDIA 2B5JA 5B0EA 2A1BA 1X4HA 2DGWA 3UD5A 1URNA 2E5LJ 1NPRA 2CJQA 4MYUA 5K8MA 1JJ2R 1RT6A 1DQAA 2D41A 1MROB 2W2NP 1R8AA 2XMWA 8AT1B 1IUJA 1WC6A 2XY6A 1WG1A 2WB4A 2VBWA 2ZZMA 2ASLA 3JTNA 3JAMY 1RB0A 5ETVA 1P8GA 2V8GA 1RDRA 1RT3B 3FNNA 3DN9A 1WC5A 3G6ES 2ZNYA 2EFNA 2B4PA 1DTTB 1EP4B 4DZDA 3Q2TC 4O44B 4CYUB 1X9SA 1VQNS 3EDRB 2L9WA 4AQYF 2YX4A 4GRSA 3BM7A 1CVJA 1UKUA 1IN0A 3CJTA 3JB9k 2RDDA 1C1CB 4PQUA 2R2UA 1H3DA 2V4JA 1ZPWX 2CG8A 2X3GA 4JOUA 4NWBA 1RT1B 1S1WA 4QIVA 3U1NA 2EPIA 1VQ6S 2Y9HA 4FF3A 3ZZZA 1HWIA 3DYAB 2NPFA 2IVYA 1KVKA 1FERA 1JJHA 4WYLA
chains in the Genus database with same CATH topology
2L48A 2DH9A 1OSCA 3BGFA 2O01C 2YNGB 4I4BA 3KHGA 4PPDA 2IMWP 1KFSA 3LPYA 3M6VA 3T9NA 3T6JA 2W7AA 1U48A 4LF6F 3D0GE 4O3PA 3NNHA 2VBYA 4ATNA 4Y3CA 4X65F 4AXJA 1OWXA 4ECUA 3GZ7A 5D4PA 2XMJA 2ZH8A 1NJXA 1NK6A 2KFZA 2YNIA 5K5MA 2FD2A 3TRGA 3U7JA 3HKZD 2JVOA 3CD7A 3GFXA 4LQ9A 5SZTA 2ASJA 2VZ9A 4WXWA 4JBCA 1IKWA 2OPRB 1FCAA 2EFGA 2NXUA 3MECB 2IRUA 3MMBA 3OFGA 4YQWA 3F41A 2R8GA 4MKBA 1NH8A 2YX7A 2BRKA 1YBAA 2U2FA 3D28A 2CJAA 5KFBA 1VQMS 4NRTA 1X5OA 5L9XA 3M8QB 2RQCA 1JLQA 2MZSA 3T1YF 1R8BA 3MI7X 5KG7A 3W2VA 4JI1F 1UETA 1Z1ZA 2XMKA 5AXNA 3IR7B 4K4UA 3UNGC 3KLEB 4L6V3 2AQ4A 1NJYA 3MEDB 3SCKE 4XIUA 1X4DA 4OI2A 2HRUA 3BR8A 4Q8FA 2AYGA 3LP1B 2OAUA 2MQMA 2FHOB 5HL7Q 1JB0C 4K4WA 3ISNC 2AJ4A 5EGYA 4BCAA 1UFWA 1X5PA 5KT6A 2XMTA 4RNMA 3MR2A 2M3DA 3UR0A 2JFKA 2OJ3A 3RBDA 3EZ5A 3PKMA 1NK0A 2E66A 1H7XA 4FVMA 2J7UA 4HL9A 4O4GA 3MR3A 5LMUF 1FD8A 3V4IA 4FNHA 1N34F 4KO0A 5GADI 4TY8A 2HLTA 2PN6A 4KV8B 1S6PA 3LALA 3VTIA 2J9DA 4RW4B 4NMLA 5F8LA 4TLRA 3THTA 2W9CA 2N4DA 3GG1A 2WBMA 5FJ4A 4CO0A 4B9NA 3SDEA 3KG4A 1TK5A 4B02A 3GE9A 3TP2A 3G8SA 1LQ9A 4TXSA 2V4QA 4ICLA 1ZM2A 1F0XA 3LF0A 3I4PA 4M94A 1OS5A 1HD0A 2YNFA 1JJ4A 4EBEA 5A8RA 3UQSA 4K4ZA 3H25A 2LXIA 1XMOF 4Q0BA 2CQIA 1FRLA 4P7VA 2BZ2A 4RKUC 4ZVHA 4DL5A 1YJ9S 1N48A 3HFKA 4WE1A 3C6TA 3N28A 3HDSA 1R8CA 4A46A 4IR9A 2CPZA 1URRA 4RLEA 2CVIA 3HKWA 1N54B 3CIZA 1IKXA 3RBEA 2BANB 2VG5A 3GFZA 2AJ0A 2CYYA 2MDAA 3GFHA 1FRHA 3ULHA 3MWBA 1SC6A 1RK8A 3CWJA 3UCZP 1A9NB 2JEIA 1TAQA 1K1SA 4F2RA 2YWKA 1BQMB 1ZBTA 2B9YA 5F3TA 3RRKA 3M6WA 3M9MB 1EETB 1Y5IB 2EBGA 4N47A 5I4MA 1NKBA 4KB7A 1TV6B 2HGLA 3VALA 2RNEA 2EKYA 5D77A 3TUZC 4NXNF 1VRTA 4RW6B 4A8QA 5CYQB 1DTQA 2MSSA 1VFJA 4J9RA 3CMAS 2CG4A 2WSEC 1JLBB 4N56A 4OI0A 2GHPA 3L95X 2OPSA 3MUVP 4LF9F 3EUNA 4NLWA 3IRWP 1WTBA 3RYLA 1GH8A 2CQDA 1ZZNA 3KJVB 4TU7A 2GX8A 3PJXA 4C8NA 5IT4A 2IBKA 3ETOA 1XK8A 2Q6CA 3W2WA 5HROA 3I0SB 1Q8LA 1SKWA 3SV4A 4DSKA 3KLGB 1JX4A 1S76D 3BEGB 2DCLA 3RB0A 2B51A 3SSSA 1NHVA 4LSLA 4FBUA 4PXBA 5H9EJ 2BR0A 3C2PA 2WK4A 2YKAA 3FDSA 2ZBIA 4F4XA 1BC6A 2IYIA 1XR7A 5K8PA 1G6BA 4B3TF 1Q8IA 2JC1A 3I5AA 2AJQA 4ED0A 2J76E 1HR0F 5K14B 1LWCA 3P49B 1S72S 1R7IA 4YFUA 3BGLA 1U4BA 3KK2B 5LJ3Y 4G6VB 4NPOA 4JI6F 1Z2LA 1M5PC 2W4CA 3K8VA 3OVBA 3I5BA 4OHVA 3L3CA 1Q81T 3KOAA 3VAHA 2QSWA 1S0VA 2XWXA 2DPJA 2EI5A 3OXFA 5D4LA 2FHJD 3CD5A 3D5MA 3F73A 3OSPA 2UUAF 5B0GA 2D9PA 2HQ3A 3H59A 5KT4A 1HQEA 4ZCKA 5HLFB 2M8HA 1RTDA 4JV5F 3QGIA 3Q2SC 3R5DA 4CO2A 1NKEA 3FRYA 5F0UA 2C3YA 1JLFB 2QV6A 2LU2A 2ZKTA 2EFPA 3CDWA 2JWNA 3RRHA 1SBRA 2DNMA 5KFRA 3MZIA 3Q0AA 4ECYA 4MIAA 3TI0A 3M30A 1FKAF 3PEHA 3ZZRA 4J9QA 5A0YA 1TQLA 4JI8F 1NJIT 4C8YA 3ZC4A 5DGAA 2MQLA 3IAS9 2FJDB 5L8RC 4B9UA 4B9VA 4ECRA 2JEGA 2VPZB 3SCLE 4DV4F 3NL0A 1SJ3P 1G1XA 3H5XA 2E9ZA 2RF2A 2GO8A 4DUYF 2VG7A 1FHTA 4GKJF 5K8OA 1S1TB 5HMZA 4C0HA 5LSLA 5HP1B 2P5VA 4DSFA 4JV2A 1DQ9A 5L1IA 2VQEF 2ADCA 5EHHA 4V19J 3QIPA 1F60B 2CQHA 5HI7A 4DMZA 2KRBA 3VCDA 4A8FA 4GO5X 4DL4A 2DR5A 2L9NA 4C97A 3OSNA 3CT9A 3BSAA 3KWMA 5GAEI 1V3ZA 4DR5F 2YWEA 2C3OA 5D78A 1HNIA 1RA7A 2HPUA 1YJUA 3HF5A 5EWFA 5ITHA 4F4ZA 1HNZF 1L5UA 5CCLA 4PWUA 5KT5A 2M2BA 3DLJA 3GILA 1GX5A 5DQHA 2J0QD 1HPZB 2P6SA 1JLGB 1R8HA 5T7LA 3QAUA 5KFAA 2J0XA 2NUHA 4LF4F 4YEAA 3DRYA 1N33F 2XI2A 1Y00A 4J5OA 2Q6BA 4DL3A 1RT7A 1JMTA 1PSDA 2JEFA 4FZVA 3J7YI 3DLGB 1FA0A 2VBZA 4I1TA 4LF7F 2ZH1A 1C0UB 2CPJA 4Y2IA 4HHJA 3NNAA 4YMEA 2ZHOA 3GIKA 4B9TA 2E9RX 1WHYA 3BQ0A 3TVKA 3KYLA 3NWGA 2YQ3A 5KT7A 3OHAA 4OLOA 3H2LA 4ZKAA 2BVZA 5DETA 2OMOA 2QLWA 5KFGA 5HBMB 4F25A 3PW0A 4KR0B 1UJ6A 3A8EA 3CE8A 1HW8A 4RU2A 1KLMA 2OKQA 1WNEA 1FRMA 3M32A 4AXIA 1SIWB 3VQSA 4K4YA 3I31A 2MY7A 5FIIA 1C1BB 3BO4A 2KXNB 4O3SA 2VA3A 2JHEA 1BQNB 5J1EA 2XG8A 4ZHRB 4LFAF 3CCMS 1NO8A 4URSA 1L3VA 1CG2A 3CB4A 1XWLA 1FJGF 3NG8A 2VASA 3TOQA 3L7PA 3CJKA 1KRPA 1N5YB 1F5AA 3D0IE 3QO9A 3K57A 1J5EF 1V3SA 2GO9A 5DG7A 1QUPA 3KNGA 5JJBA 5A6PA 1AXQA 2Z4PA 1UFLA 1TR0A 1ZAXA 3BJYA 3T3FA 2NPIA 2FDNA 4NLYA 1RT4B 3I32A 1QE1A 4PXDA 2DB1A 1E6VB 4DFMA 2E1CA 1GQEA 3ICLA 2VODA 1A7GE 4NLRA 4O3NA 3SCIE 2VOOA 3GB0A 3E01B 1I94F 2YKPA 2CFXA 2OD4A 4CO5A 3QGGA 1YJNS 4IQMA 1TVRA 3NGDA 3V6KA 2Q79A 2DGSA 3OHBA 2ZKUA 1FD2A 4B9SA 4DR3F 3AJ2A 3N9UC 3PR4A 1LW0B 3KHRA 3LWLA 3T9ZA 5LXRA 2W9BB 3IN5A 2M9KA 2RU9A 1VQ7S 1BQXA 4I6YA 2PEHA 3TA2A 1LXJA 3DLEB 2HNZA 3M05A 4LMZA 1KTVA 2QE5A 2B5JB 3TR5A 3DM2A 5BYSA 4X4PA 1AROP 3DRPB 1LFWA 3M2RA 4URQU 2FJXA 4PG6A 4E98A 2WONA 4EGLA 1LXNA 3PM9A 3MPWA 5IM0B 4WKRA 2XMVA 2HHVA 2OFGX 2IHR1 3DI6B 2E5HA 4EO6A 3IRXA 1HBNB 2VPYB 2V0NA 2BQRA 2C2RA 4HKQA 1U26A 4ELUA 4X4UA 1Q1KA 2FB0A 2IC3B 2R4FA 4I2QB 2DGOA 3KK3A 3LP2A 4ZPVR 1E6YB 1FKPA 3OL6A 4Y00A 3QWPA 2Z2LA 3OTDA 2ZNZA 3AQOA 1VQKS 2QEXS 2BA9A 1UA1A 2IM3A 1C4CA 2KYZA 1VQSA 3U1LA 5B0AA 3ITHA 1LFPA 3B8HA 3LP0A 5BYRA 5DM6Q 5KFVA 2DNYA 1NH7A 3JYTA 4LF5F 3T5LA 1ZOTA 2HYIB 4JI4F 3S8SA 4WK3A 2KU7A 4B3SF 1IKYB 2HWHA 2PD1A 3PY8A 3J7A1 4EYIB 3G8TA 1RGVA 4WIIA 1KR4A 1JLEB 3I4HX 1IBLF 1X0PA 3CD6S 3PHEA 3IAM9 4ZMMA 5AXMA 3FEXB 5IZHA 2IAJA 3H98A 4QWAA 1YRTA 1VQLS 4M63A 5J2QA 5HMWA 3FMBA 2ZDPA 1SV5B 4FS2A 1XN9A 2C2DA 2WSCC 2CPIA 3U1MA 2DR8A 3G8QA 1CPZA 2CQ2A 5I3PA 3PX0A 1IBMF 1GTEA 2HVHA 2HS0A 2YNHB 1RTHA 1S0NA 2Q66A 3SFGA 4JI0F 2O1PA 3D1QA 4B3OB 1SH3A 2BXJA 1S49A 3O1LA 1VQ5S 4WFZA 2GJ2A 2GV1A 2HNDB 2MHEA 4RU9A 1VRUB 4OHXA 3E8OA 4QYRA 4J9PA 3TUIC 4FP9A 3LO3A 3SEOA 3AHPA 3CCRS 2DRAA 3DNCA 2CQ4A 1S6UA 2IVMA 3FRZA 4UY8T 1DQ8A 3HVAA 2OH2A 2BBEA 3V81A 2EWHA 2AGOA 3D1OA 1RYRA 1IQZA 1X8DA 3P6YC 1O8BA 2YWGA 3PIPQ 3JTPA 1S9EB 2V4JB 1MMDA 4C98A 3I96A 4ID8A 4EU0A 1HBUB 3PX6A 2FLOA 1S1WB 1SJ4P 4JYAF 2JVRA 1D1UA 3TAMB 5A8KB 2O3DA 4QR1A 5C24A 1T02A 2G9OA 3N79A 4OHZA 4YUDA 3KLIB 2NR0A 2F1FA 3Q22A 5KFDA 3KLHA 2C28A 2ZJRQ 4Y65A 1Y0HA 4NZ7A 4I6AA 3TVYA 1C0TB 1WHVA 1VQPS 3NCPA 4ILMA 2LXUA 1LW2B 1Q7YT 3H2UB 4HH0A 2VFTA 2L3MA 2FUG9 2QIFA 3LOUA 4BWJA 2QFJA 2MGZA 1HNVA 1YJVA 1ZYQA 1Q78A 3J7ZT 4X84A 4RW7A 2KZZA 4AL7A 3P3DA 3LGMA 3KNAA 2V4RA 4F4KA 5KFCA 2NSBA 5KOXA 2HWTA 4KGKA 1JNZB 1OQ6A 2IJNA 2RMLA 4OJGA 4NZ0A 4IG0A 2KYXA 4MK8A 3UI3A 1HQUB 1LWEA 2I5JB 1YWXA 2LQ9A 1U09A 4CO1A 2AJ1A 4UUWA 1N6QB 3MMBB 4I68A 4DV3F 4IG3B 4LQ3A 1TUVA 2ZD1B 1FDAA 3NAIA 1YRUA 1BY9A 4QU7A 3OL9A 1S6QB 1RTJA 1JLQB 4XPEA 1TKDA 2ZOFA 3N6MA 1CEZA 3AJ1A 4BWMA 5HMXA 1JKHB 1GXLA 1YJRA 4IYQA 2JSXA 2IYGA 4MAKA 3O2IA 4B3MF 3MR6A 3PZPA 2DGQA 2AYEA 5IS2A 2EBEA 4QW9A 4ECQA 4DG1A 4R5PA 1JWWA 3HHDA 1WD6A 1UWBA 2V2KA 2AP6A 2ROEA 3PO5A 4CO4A 1UJ5A 2R2RA 2VOPA 2B4UA 3RRGA 2R2SA 7FD1A 1DBDA 1X7VA 4O3OA 5F9NA 3KLFA 1TKXA 4NLQA 4PG5A 1DLOA 4P2SA 4ED6A 3OQ2A 3RB6A 1UW4A 2W8KA 1JLCA 2P9EA 3B4DA 1KN6A 2CZVC 1S1XA 5J2NB 3OR1A 4RWXA 4CTAB 3V4IB 1ZETA 1RAJA 2CQBA 2MSTA 1WF1A 4USJC 4KTQA 1SKRA 4O23A 2UUBF 2BJDA 4K4TA 1V9OA 3K7RA 2W9CB 3GIMA 4DV2F 3LAMA 3QPIA 2DCUB 3MM8A 4J9LA 1HBMA 2DIVA 2QLXA 2XNQA 3OR2B 2GNKA 1HYSB 1RA6A 2LA6A 2RIJA 1Z2ZA 2CJBA 4A8YA 4U6PA 3V6DA 4XDCA 1TKZB 3C6UB 3MM7A 1RT5A 4ALZA 3LAKA 2FVSA 5KFKA 3RR8A 2DNGA 3FGVA 5A8RB 5F8MA 3CCUS 4N8NA 4OIXA 4NCGB 4K5RA 5D3GA 2R7SA 3C6TB 4MFBA 3M2UB 1OIAA 1SH0A 1DHMA 1GX6A