2BYFA

Nmr solution structure of phospholipase c epsilon ra 2 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
b'SSEEESFFVQVHDVSPEQPLTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C, EPSILON 1
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipase
total genus 20
structure length 116
sequence length 116
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2byfA01
4WJOA 4ZYNA 2B3AA 5D94A 1AARA 4FHJA 5CHWA 2R2QA 4G50A 1XT9B 4FN2A 4W9CA 2ZVNA 2YLMA 5FR6A 2JY6A 3QAQA 3U8ZA 4JL9A 3R66C 3KVFB 3ML9A 1HE8A 3A9JB 3UQAA 3RZWC 4A3OA 3VXWA 2J7QB 2MSED 3QQ8B 4EZJA 3L10B 4MH0E 2LUEA 2XBBC 1TTNA 1WXAA 4F8CB 3PHWB 2NPTB 2KDBA 2KDFB 1ZKHA 2MA9B 1YQBA 2JRIB 2PE6B 5LLIA 2BKFA 2DZIA 2FCNA 3IBEA 3L16A 1XQQA 4GXBA 2PE9A 2LGXA 3QK0A 3DVGX 2V3SA 3JSVA 4TKNA 5J18A 3OJ4B 2K8HA 3GZNI 2CHXA 2NBUA 4YL8A 5EDSA 4MSQB 1J0GA 2K6DB 4AP4C 2QHOA 3VHTC 2G45B 2ZPYA 5C23A 1CMXB 4LJOB 4URKA 2M4NA 4EKUA 2Z0DB 1UELA 1E7UA 4HLEA 2DYBA 2C60A 4WWNA 5C1ZA 2D3GA 3ONSA 2KC2A 1WGHA 2W9NA 2GBMA 3RD2A 2IO0B 3JW0X 5DPRA 1WX7A 1WH3A 3R7QA 3H7PA 3ZTCA 2RGFA 1E5WA 3PV1A 1FXTB 1MG8A 1SGHA 2KD0A 3VDZA 3UQBA 3C0RB 4BKSD 2EKEC 4W9JA 3ZRCA 5KHQA 2MBHA 1VD2A 1WM2A 2N9PC 3PZDA 4XZ4A 2K25A 2DYOA 2JUOA 1NI2A 2KTFA 4DXAB 2NR2A 3APFA 4FBJB 2MWSB 1WXVA 2MP2B 1T0YA 2KANA 3EC8A 1Z2MA 2O6VD 2XK5B 5CHVC 4EUTA 2D2QA 2O2VA 3QX1A 3VUWA 2BPSA 2MRPA 3MTNB 4ANWA 3APDA 2PEAA 1V5OA 3PGEA 2L0TA 2RR9A 3KYDD 4NJ6A 1NDDA 2K6QA 3QWZB 1WGRA 2KTRA 2WX0A 3OJ3A 4IWOA 2KOXA 2VRRB 1WMHB 2ZNVC 3VQIA 4K7UA 4AWJA 1D3ZA 4IG7B 1P1AA 4NQKE 3DPDA 3UGBB 2LRWA 4CYEA 2M1MA 2BWFA 2NS5A 4PS8A 3ZNHB 1GJZA 3A33B 5TR5A 2JPHA 4W9IA 3ALBA 4AJYB 2KDIA 2CHWA 1WJ6A 1KOTA 3KUDB 4DWFA 4M0WB 2MLBA 3V60A 2OOBB 2D11A 1JRUA 2L8JA 4E3CA 3ZRFA 4RMAA 5HKHA 4XC2A 2I1JA 1WFYA 3RT3B 1WM3A 4KZ0A 2BWES 4FJZA 4OVVA 4DK5A 4LDTB 4NJ7A 3VTWA 4IM3A 2LVOA 4TV3A 4DDID 4MJSB 4E74A 2L00B 3DBHI 3AU5A 2ZCBA 3HM3A 2DZJA 3V61A 3KH0A 1S1QB 4JGHB 4LCDE 4NNJB 3JVZX 4PYUA 4PS7A 2IY1B 2Z59B 5AZGA 4DDGD 3OAWA 3IFWB 2LRUA 1R4NI 3Q3JA 4CHKA 2DAFA 3U7DA 2N7EA 2J0MA 3PSEB 5JZEB 1H4RA 3A9JA 1P0RA 4HDOA 3CF6E 2MBBB 4MGKE 4BKTA 4FADA 1GC6A 1LQBA 2IO1B 4KDIC 1SIFA 3DOWA 1H8CA 5J17A 5D6JB 3UF8A 2NPTA 3DQVA 2C5LC 2C7MB 3ZVVA 2KX3A 3TMPB 3MHSD 1E8XA 4BBNF 1EF5A 3ZDTA 1UBQA 5JH5C 1V6EA 2KK8A 2MBEA 5IA7A 1GC7A 2IBIB 5AZHA 3PHXB 3UIPB 4K7SA 2I1KA 2N1VA 4KDLB 1VCBA 4I6PA 2K8CA 2CKHB 3ENEA 2L76A 4WQOB 3ZKJC 4FA6A 5G2NA 3TL5A 1P9DU 3ZIMA 3NZUA 1E8YA 4I6LB 4HJKA 1UD7A 4K1RB 1GG3A 3DVNV 2KWCA 3L17A 1PQSA 4MDKE 2ZJDA 4IW0A 3PT2B 4WJNA 2JZZA 2BYFA 4ZRJA 2K1FA 4RM8A 4NAWB 1UGMA 2ZPNA 2UYZB 5GMVA 3KUZA 2KXJA 1V80A 3WAPA 3PLUA 4MGYE 2KLCA 2MP2A 2HTHA 3N3KB 5DCNA 1LM8B 3JYUA 5G55A 3X23A 2XK5A 2GOWA 4GDKB 2WWZA 1WZ0A 4KVGB 5AEKB 4IWQA 3UINB 2D10A 3AXCA 3PRMB 1WGDA 3DDCB 1R4MI 4KSKC 1WJNA 3AI5A 4OVUA 3VH3B 5L95C 2MW5A 1WJ4A 2DHZA 2KFKB 1WMHA 1V81A 1K8RB 2NBVB 2K39A 1WYWB 2ZEQA 2NBWB 1EF1A 1RAXA 2CU1A 3PS6A 2MQJA 2ASQA 1G6JA 4WAAA 4MM3A 4AOFA 4I6NB 4RM9A 2FCQA 3K9OB 2K8BA 5CX3A 4AJWA 1V49A 2O6VB 4F7ZA 3DBSA 1E7VA 4ICUA 4KIKB 3VTVA 4M8NA 4HWIB 1IPGA 5JHAA 4ZDVA 3A1QB 2KMCA 3QCAA 2DZKA 4GDLB 3APCA 4CO7A 4HCNB 2GBKA 3RUIB 3T8MA 4EOYA 2ZVOA 2GBNA 3H1UA 1IP9A 1QZEA 2J0JA 2N4FA 2FAZA 3CMMB 3IG3A 4MJSA 4NPNA 3RULA 2N1WA 2KC1A 3U30A 1Q0WB 1J19A 1KJTA 1M94A 3ZDMC 3H9DA 3TCAA 1IYFA 4A20A 3M3JA 4W9FA 3L13A 4IC7B 4IM2A 1LFDA 1WR6E 1V9JA 1BT0A 2C9WB 2ZCCA 2NVUI 3H7PB 1NBFC 3MJWA 2AWTA 4PS3A 4B6WA 4BBNC 3PLVA 4GMVA 4GN1A 2MBQA 2KVRA 2GMIC 2WDTB 2D07B 4HXDA 4ASWC 3VUYA 4NQLB 2IY0B 4ICVA 2JVCA 4TQ0A 2N7DA 4BOSC 2KWUB 1I35A 2CHZA 2Y5BB 3W1YA 2C7HA 4DHJD 2KQ7A 2AEHA 2EMTA 5CHFA 2WYQA 4GOCA 3NHEB 1LXDA 2KJRA 4W9EA 1SE9A 3K9PB 1YD8U 4JIOU 5JHBA 3VTUA 1A5RA 4N9F4 1WX9A 1ZGUB 3M62B 1YX5B 2LJ5A 3H6NA 3PTFC 1WF9A 3ECIA 2L05A 4MSMB 3S2AA 1J8CA 3M63B 5DPSA 3ZTDA 3BINA 4AUQC 4HVBA 1WGGA 4GSWA 2M17A 2AL3A 3RYTA 1GNUA 5AZFA 2AYOB 4BOZB 1TGZB 4GB9A 1TBEA 5E6NA 4KV2A 1XD3B 4G3XB 4ANVA 2KKCA 4E71A 1WR1A 2BYVE 2DAJA 4NY0A 1L2NA 4HPLB 4IWPA 3WALA 1WXSA 1X1MA 2NCNA 3L0WB 3CSTA 3WIMA 2KDEB 3A4SC 4X57B 3N32A 2BKRB 5KHOA 2BGFA 2KWVB 3KW5B 4TQ1A 3X0WA 3W1SC 5BO4B 2ZNVB 3ZNGC 2UWQA 3ZNID 2V1YA 4GU2A 1S3SG 3KUCB 4GGQA 2C7NB 4K7WA 4NAWA 2J0KA 2V4LA 4IUMB 3A9KB 2M0XA 2LGYA 3D32A 1WE7A 1RLFA 4WJPA 2KFJA 1OEYJ 2JXXA 1C1YB 5E6OA 2LI5A 3NS8A 3RCZA 2DENB 2FCSA 4GDKA 3ZNZB 2PPHA 2FNJB 5DPWA 1U4AA 4EZKA 4FJYA 3W1SA 3AU4A 1YIWA 4F1SA 2KFKA 2KJHB 4HK2A 2KMAA 2ZZPB 4JLCA 1OTRB 3R3MA 3UIOB 2OJRA 3SDLC 4BKSA 2IYDB 3A4RA 2LWPA 3B0AA 4WJQA 4FJVB 4II2B 4W9HA 3WA0A 5E6PA 3B08A 2IO2B 2Z0EB 3QARA 2BF8B 3VVWB 3I3TB 5L83A 1UZXB 2FIDA 2IZVB 2YVCA 3RZFA 4HPMB 4P7IA 4MELA 2N9EB 4FLHA 4W9DA 2O6VA 5IAAC 1KLVA 3NOBA 1WIAA 4ZRKA 4KIKA 3WAOA 1P3QU 1I42A 5DPTA 1UH6A 3A1QA 2LZ6A 3HHMA 3SHQA 3QA8A 2JT4B 2RD0A 4GDLA 3QC8B 3ZLZA 4FULA 3TBLD 1WY8A 4JQWC 4PYZA 3LDZE 4ZRIA 2LASA 3WAMA 2KZRA 2LXCA 3VAWA 3VFKA 3O65B 4A3PA 1ZW7A 1E90A 3V62A 2KN5A 3ZW3A 3DBLI 3EECA 3H7SA 4II3B 3T9LA 3CSFA 3VH4B 2L3ZA 4G11A 2LD9A 3M95A 5LXHA 4EEWA 2M8SA 4HCPB 2LVQA 3L08A 4HDQA 3JSVB 2A4ZA 2G3QB 4GIVA 2MX2A 1V86A 2FIFA 2BYEA 5CTRC 1P98A 3ZO5B 4DBGA 2JZ3B 3R7RA 1C3TA 2KLGA 1E8WA 1Q1OA 3ZUNA 1F9JA 1EO6A 4KZCA 2REXA 4DHZB 3AULA 5D2MB 2LGDA 2MBOA 4W9LA 1YX6B 4B95A 3NY5A 4DHZE 1WX8A 2A5UA 2FUHB 2WX1A 2JWZA 2KX0A 4B9KA 3PRZA 4EFOA 3SU8X 2N9XA 4K81A 2IO3B 3ML8A 4W9GA 3PPAA 4J6IA 3QIJA 1ISNA 2CS4A 1WRDB 2KQSA 4MGZE 4XX5A 1V2YA 3GOEA 2GBRA 4M8MA 2RPQA 4MEMA 4ANUA 2LVPA 5J2RA 1RFAA 4TUUA 2DX5B 2L0FA 3HIZA 4BVUC 3PREA 3DBRI 4DHJB 1Q5WB 2DYMA 3HK0A 2O2VB 2G4DB 2PJHA 1OEYA 1WXMA 2KNBA 3PRPB 3QHTA 2AL6A 2DZMA 3N30A 5LXIB 3IVFA 1KM7A 2G4SA 2KTRB 1WE6A 1WZ3A 3OLMD 1RRBA 1V5TA 3BY4B 4LDTD 4ANXA 2HD5B 2XEWA 4WWOA 2R2OA 1Z5SB 3A9KA 3V6CB 3WANA 5D7GA 2FCMA 3DVNU 3LJ3A 2EMSA 2RSUA 3QJZA 4IM0A 4BKGA 4BFRA 4KSLC 2HJ8A 3DCGA 3SD5A 2L7RA 3PVLA 4EZLA 1E8ZA 2KO3A 3DVGY 3IHPC 4LJPB 3HM6X 1EUVB 1OQYA 2CR5A 3L54A 3VUXA 4FHKA 1GUAB 2MCNB 3TJPA 2KJ6A 1Y8RC 3KYCD 3B1LX 2HE7A 2JF5A 3EHVA 3V6EB 1OGWA 1TZ1A 1UBIA 2GBJA 4MGIE 3P2BA 3NZSA 3TIXA 1WJUA 1WGYA 1L7YA 4W9KA 2LXAA 1YJ1A 3Q3FA 4WWPA 2JRHA 3EFUA 2KHWB 4G0NB 1WI0A
chains in the Genus database with same CATH superfamily
3FC4A 5CHWA 4FN2A 4LTUA 3KVFB 3ML9A 3UQAA 4A3OA 2KT7A 3GE3C 4ARIA 2JZPA 1N60A 1HA5A 4O1NA 5G5GA 4F8CB 3I57A 2NPTB 2KDFB 1F2RC 2MA9B 1PGBA 5LLIA 2DZIA 2PE9A 5J18A 3OJ4B 2D3CA 2K6DB 4US9A 2QHOA 2G45B 2K5PA 1CMXB 5C23A 1KLGD 2Z0DB 1UELA 1E7UA 4HLEA 2AQ2B 2C60A 4WWNA 2KC2A 3RD2A 1ZP0B 1QOBA 4HJGE 2BT6A 1FXTB 1VJKA 2GRIA 3BVMA 2QIEB 1KFYB 3BVGA 2WXQA 1WM2A 2RDBC 4XZ4A 1AN8A 2B76B 2G9HD 1WXVA 2MWSB 3RNBC 2WXMA 4REZA 4EUTA 2O2VA 2BPSA 2MJ3A 3APDA 2BB5A 3R8BA 4WQMA 2K6QA 2KTRA 2WX0A 4IDIA 3FILA 2KOXA 1ESFA 1CK1A 4IG7B 4ZOHC 2LRWA 2M1MA 3LXFA 5TR5A 4W9IA 3KUDB 4B0EA 4TMAB 1RYJA 1PGXA 1ZDXA 2I1JA 3RT3B 2BWES 3EUB2 3BK2A 4MJSB 2L00B 1TY0A 2IY1B 4D2KA 2J0MA 5EE3A 1P0RA 3CF6E 4MGKE 4BKTA 2MJEA 1GC6A 2IO1B 1SIFA 3DOWA 1H8CA 3C19A 5J17A 3UF8A 2NPTA 3P4QB 3TMPB 3MHSD 1YQ3B 1EF5A 5GXGB 5JH5C 1E0ZA 1GC7A 2GI9A 5AZHA 3UIPB 1J7AA 1FFUA 4XE0A 4C7ZA 1SE4A 3ZKJC 3GP7A 1E8YA 4K1RB 3DHGC 3DVNV 1DYQA 1PFDA 1C4AA 2ZPNA 4WH4A 3KUZA 2AX5A 2KXJA 1V80A 2OJWA 4IOIE 4MGYE 1STEA 3N3KB 1LM8B 5G55A 5H92C 1C77A 1TJEA 4KVGB 1UUPA 1FIQA 3UINB 1ET9A 4N58A 2KFKB 3AB5A 1K8RB 2NBWB 4PT5A 3PS6A 4WAAA 1JALA 2XNAC 4RM9A 1V49A 4F7ZA 3DBSA 4ICUA 3IAS1 2PLPA 4HWIB 1RM6C 2DZKA 2WNMA 4EOYA 2J0JA 2N4FA 2FAZA 3RULA 4MJSA 1KJTA 2JXTA 2WXPA 3H9DA 4JX1C 1L0YB 4A20A 4IM2A 3MC9A 1BT0A 1KLUD 2VZKB 4B6WA 4GN1A 4GLSC 1T0SC 3URYA 1E10A 2GMIC 4RGMA 1F77A 2BS2B 1VZ6A 2N7DA 4BOSC 2Y5BB 1FD6A 1SE2A 4GOCA 3NHEB 1LXDA 2KJRA 3VR8B 4N9F4 2PTLA 1J8CA 3S2AA 4DXGA 3RN9C 3Q8FA 3AE7B 4C56C 4XYCA 4GSWA 3RYTA 4M01A 1GNUA 1TT5B 4GB9A 4KV2A 4G3XB 2YEPF 1L6UA 2BYVE 1PDXA 4HPLB 3V3XA 1OQRA 1VZ7A 2QEJC 3OWEB 4X57B 3N32A 3P42A 3W1SC 2RMMA 3EFCA 3KUCB 4OZAA 3DWMA 1WXQA 1RLFA 3NS8A 3ZNZB 1MJDA 4ITKA 1NI3A 1QF6A 1KH0A 4MACA 4EZKA 4F1SA 1CJEA 2KFKA 4HK2A 3TEZA 2KMAA 2LHEA 3R3MA 4BKSA 1MPEA 3B0AA 1UNSA 1VRAB 2J53A 3VVWB 2NTSA 1TKGA 4HPMB 4M00A 4NAMA 3N1ZC 5BYSA 3HHMA 5FK9C 3LDZE 3PZ8A 2LXCA 1MG4A 3O65B 5D3DA 1GOZA 3GZNB 3AECB 2JU6X 3CSFA 2LD9A 5LXHA 4EEWA 4HCPB 3MFGA 3JSVB 3Q69A 4GIVA 1VLBA 3RNCC 5CTRC 1P98A 2KLGA 1E8WA 1Q1OA 5D2MB 3MHZA 4W9LA 2KACA 1N62A 2FUHB 2WX1A 4EFOA 1GB4A 3SU8X 2N9XA 3IT6B 1K52A 1YN4A 4J6IA 1ISNA 2CS4A 1WRDB 2KQSA 4MGZE 3GOEA 5IOIA 4M8MA 4ANUA 1QOFA 1FXAA 3HIZA 3PREA 1XLQA 3DBRI 1FFVA 1OEYA 2KNBA 2KWDA 3PRPB 4YXDB 1KM7A 2BYTA 1V5TA 3ZJTA 1IGCA 3U7ZA 2ACZB 1I4GA 4BFRA 2WS3B 2RSUA 1NYQA 3PVLA 3TUOA 1E8ZA 2NTTA 1TKYA 5C2TB 2CR5A 4P1BC 2K9XA 1FRDA 2Z8LA 2KJ6A 2K22A 4JWSC 5BYRA 5JXVA 1TZ1A 1UBIA 1FO4A 3TIXA 1WGYA 1YJ1A 2LHDA 2JRHA 2KHWB 3DHHC 3AEBB 4MT5A 4WJOA 4ZYNA 2B3AA 1AARA 4OZBA 2JY6A 1KTKA 3QAQA 3V05A 1TS2A 2HJ1A 3VXWA 2QILA 4FXCA 3QQ8B 3L10B 1SIJA 3B2GA 1WXAA 2H89B 3PHWB 2KDBA 5HHDG 2PMVA 2FCNA 1XQQA 1FNWA 3JSVA 5EDSA 4MSQB 1J0GA 4LJOB 1M4VA 2BB6A 1WWTA 2WXOA 1EWCA 2LGSA 1WGHA 2GBMA 1WX7A 1WH3A 4YT0B 3H7PA 1E5WA 1D4BA 2KD0A 3UQBA 3C0RB 4BKSD 1N5XA 2EKEC 1R4MB 1F0ZA 4DXAB 2MP2B 1T0YA 2KANA 3EC8A 2INNE 2NMQA 4JWUC 3MTNB 1T5XD 4P1CC 4NJ6A 1JWBD 2DBYA 3QWZB 1C9FA 3OJ3A 4K7UA 3UGBB 1TS5A 4CYEA 2BWFA 3Q3OC 2I2YA 3ZNHB 3A33B 3GE8C 2JPHA 3ALBA 4AJYB 2KDIA 2VZKD 4DWFA 3V60A 1AW7A 3E56A 4XC2A 1UF0A 1FPYA 4DK5A 4K3BA 2N9LA 3VTWA 2L83A 4E74A 3DBHI 3KH0A 1VZ8A 1S1QB 4NNJB 1JCKB 2Z59B 3IFWB 2ICIA 1R4NI 3U7DA 3PSEB 1ZE3D 4LNNA 4HDOA 2WU5B 2LGIA 4KKIA 1V8CA 2PIAA 3ZJUA 5E6JA 2C5LC 4H2AA 4KGSA 2JSVX 3NZ3A 4BBNF 3IXSA 1JWSD 4BAXA 1UBQA 1L4ZB 1V6EA 2KK8A 2MBEA 5IA7A 4HKQA 1IBXA 4K7SA 3T3OA 2I1KA 4KDLB 1VCBA 2K8CA 2CKHB 1XLOA 2L76A 4WQOB 5G2NA 4I6LB 4HJKA 2KWCA 3L17A 3BYTB 3PT2B 4ZRJA 2JZZA 2BYFA 3L4PA 4RM8A 1P7FA 1R7SA 1UGMA 3WAPA 4L23A 2W55A 2QSDA 2MP2A 2RDGA 1C79A 3PO0A 4RFBA 3HVDA 4RF1A 1JQ4A 1WZ0A 1YOVB 5AEKB 4IWQA 3PRMB 4AS1A 4OVUA 2MW5A 2DHZA 1EWYC 1VDVA 2K39A 4YTMB 2D3AA 1EF1A 1G6JA 2MQJA 3KWVA 1OQQA 1FNVA 4HRSA 3K9OB 4AJWA 2PKOA 2PVGC 3RNFC 4KKJA 3VTVA 2M0AA 1DOXA 1IPGA 5JHAA 4L2YA 4ZDVA 3DBLB 2KMCA 3UI3A 3APCA 3RUIB 2WGSA 4JPSA 2WDRB 2GBNA 3CMMB 3IG3A 3BWUD 1LGRA 2KC1A 3U30A 1M94A 3RNEC 3Q8CA 1LFDA 1V9JA 3AEDB 2ZW1A 2NVUI 3J9CA 1NBFC 4PS3A 4GMVA 2FUG1 2KVRA 4ASWC 1SBBB 1EU4A 2KWUB 2AEHA 2EMTA 2WYQA 2KN4A 1JRPA 3AE4B 2IJ0A 3VTUA 4A90A 1WX9A 4R3DA 3H6NA 4KX6B 3ECIA 1YNTE 5DPSA 3ZTDA 4AUQC 3NJTA 1WGGA 2GLSA 2AYOB 5E6NA 3HVZA 1WR1A 1ZOYB 1L2NA 2NCNA 2MJDA 3CSTA 5EE0A 4A9AA 3N9YC 1YQ4B 2BGFA 2KWVB 3AEFB 3ZNGC 2ZNVB 2IGGA 2V9HA 2V4LA 4RH6A 2M0XA 3Q14C 1C1YB 5E6OA 3TEYA 2LI5A 1MHHE 4ZRPA 2XN9C 2X8XX 1L0VB 2OHFA 1K53A 2FNJB 1FMAD 1U4AA 3W1SA 3AU4A 1HTOA 2KJHB 3TEXA 3NVWA 1HTQA 4JLCA 3IAM1 3B9JA 2PVOD 2IYDB 2LWPA 5H8YE 4W9HA 5E6PA 3B08A 2IO2B 2Z0EB 2MH7A 3QARA 3I3TB 1VR9A 1QILA 4P7IA 4MELA 4W9DA 1KLVA 1WIAA 3MC8A 4ZRKA 1P3QU 3HUIA 4RGNA 3OG5A 3Q3NC 2IDYA 1UH6A 2LZ6A 2JT4B 2RD0A 3QC8B 1ZXIA 1MVKA 2V3PA 3WAMA 2LUMA 4A3PA 1ZW7A 1GB1A 1E90A 2KN5A 1AWDA 1T6BX 4XWTA 1ZDVA 4G11A 3M95A 2M8SA 1BMLC 2LVQA 1C76A 2MX2A 1F2RI 1V86A 1C3TA 3ZUNA 2EKIA 1F9JA 4KZCA 3P4PB 1YX6B 2WQYB 3T3NA 4DQOC 3NY5A 3TSSA 1N5WA 2JWZA 2KX0A 4B9KA 5TSSA 4K81A 2IO3B 2M56B 3ML8A 3Q3MC 2ON8A 3QIJA 3KLSX 5D3IB 2QDFA 2GBRA 2RPQA 4TUUA 2L0FA 4BVUC 3FAHA 4DHJB 1FXIA 1C78A 3HK0A 2G4DB 1WXMA 2DZMA 4OZCA 2G4SA 5HFYA 2Q5WD 1Q10A 1WZ3A 1RRBA 3BY4B 4RGOS 2HD5B 4WWOA 2R2OA 3V6CB 4TSSA 3U52E 3WANA 5D7GA 3AE9B 3DVNU 3QJZA 4KSLC 3SR6A 2WXJA 3IHPC 4J3OD 1DGJA 2IGHA 3IT4B 3BK1A 3L54A 1QKZA 3KYCD 3B1LX 2HE7A 3EHVA 3V6EB 1FCCC 2E6XA 2GBJA 4MGIE 3NZSA 1L7YA 4WWPA 3EFUA 5D94A 4FHJA 2R2QA 4G50A 1XT9B 4W9CA 1JWMD 2ZVNA 2YLMA 1EU3A 1D5XC 3R66C 1JW9D 1HE8A 1ZXHA 4ZRQA 2X38A 3RZWC 2MSED 4MH0E 2LUEA 3LB8C 2XBBC 1TTNA 3NVVA 1ZKHA 2PE6B 2BKFA 3L16A 5BMGA 3AE2B 4GXBA 3QK0A 3DVGX 2V3SA 2K8HA 2CHXA 2NBUA 1C4PA 4YL8A 4AP4C 4URKA 4EKUA 1KRHA 2DYBA 5C1ZA 2KDMA 2D3GA 3E9SA 2W9NA 3JW0X 2RDHA 1CQVA 1WSPA 3H8HA 3R2TA 4LK0M 3ZTCA 1MI0A 3VDZA 1L6VA 1VD2A 3PZDA 1MFWA 2KTFA 3APFA 3P63A 3NVZA 2XK5B 5CHVC 2MRPA 4L1BA 4ANWA 1L4DB 3TEWA 3PGEA 2L0TA 2N9KA 2RR9A 1QT9A 2ZNVC 1WMHB 2KQ4X 3VQIA 4AWJA 1D3ZA 1P1AA 2CU3A 3DPDA 2MHJA 4PS8A 3AH7A 2CHWA 1WJ6A 4MM3B 1KOTA 4M0WB 1J7BA 3RPFC 3Q8BA 2L8JA 1JRUA 4RMAA 5HKHA 1XLNA 1WFYA 4XDCA 4FJZA 4NJ7A 4TV3A 3AU5A 2ZCBA 3HM3A 2DZJA 3C8YA 4LCDE 4YTNB 4PYUA 3OAWA 3Q3JA 2N7EA 5JZEB 1D5ZC 4RGTA 2L32A 2WHIA 4USAA 3AE5B 2MBBB 3U2SC 4KDIC 3N1XC 2SAKA 4RNAA 4OW0A 5D6JB 1XXGA 3RMKC 2YEPB 2C7MB 3ZVVA 2KX3A 2WDVB 3DWGC 2IBIB 4C4VB 1F1HA 1SJED 2N1VA 4I6PA 3SEBA 4OHJA 3TL5A 1P9DU 3NZUA 5T8IA 3I5JC 1UD7A 1DOYA 1GG3A 1PQSA 4MDKE 1FM0D 5G5HA 4NAWB 2AQ1B 2UYZB 1T0QC 1WGKA 3PLUA 4WURA 2Y3AA 2KLCA 2K0PA 2BQQA 2HTHA 3W2DA 5DCNA 1N6ZA 3X23A 2XK5A 2GOWA 4A8XC 4ZHPA 2D10A 1WGDA 4KSKC 1UWXA 1SB3C 1WJNA 2BS3B 3AI5A 2WXHA 5L95C 1WJ4A 1WMHA 1V81A 2NBVB 1ENFA 1WYWB 2RPVA 1JWAD 1RAXA 2CU1A 2ASQA 1SEBD 2GB1A 4MM3A 2JQRB 4I6NB 4M0WA 2K8BA 5CX3A 4OVZA 1HZ5A 2O6VB 3WCQA 1HQRD 1K50A 4M8NA 3AE8B 3O13A 3QCAA 4XDDA 1UWMA 4GDLB 4CO7A 4HCNB 2GBKA 1QZEA 3CIRB 2HDEA 1JMLA 2CJOA 1V97A 1Q0WB 1J19A 2V4IB 4LNFA 3ZDMC 3TCAA 3M3JA 4W9FA 3L13A 2IGDA 3PZ7A 2ZCCA 1B1ZA 2AWTA 2N7JA 2MBQA 3BYYB 4LNIA 4UDUC 2D07B 4HXDA 3VUYA 4ICVA 2JVCA 1V1OA 3W1YA 2C7HA 4DHJD 2KQ7A 3VRBB 2LFIA 4W9EA 1SE9A 2LJIA 3K9PB 1YX5B 3PTFC 1WF9A 2L05A 3BINA 3DBRB 4HVBA 4C00A 2V0GA 2M17A 2AL3A 5AZFA 4BOZB 3ZJVA 1TBEA 2KKCA 4LNKA 1YN5A 3NVYA 3L0WB 3CWIA 3WIMA 2FE8A 2BKRB 5KHOA 5AUKA 3AM9A 3KW5B 4TQ1A 3X0WA 5BO4B 5IKCM 1XLPA 2UWQA 3ZNID 4GU2A 2V1YA 1S3SG 3GB1A 4K7WA 4NAWA 1C4CA 2BW2A 4AQ7A 2KMMA 1OEYJ 3Q6BA 3RCZA 2MEKA 2WXGA 3NRZA 3SFDB 3W5VB 2PPHA 1QOGA 5DPWA 3KQ4A 1SE3A 1YMHE 1XF5L 1YIWA 3ZQ4A 1JWUD 1OTRB 2DNFA 1YN3A 3SDLC 1KF6B 3A4RA 2SEBD 3WA0A 2BF8B 1I7HA 5L83A 2FIDA 2IZVB 4YSXB 2N9EB 2O6VA 3NOBA 3WAOA 5DPTA 5BMHA 2BBCA 1MHXA 2Y5CA 2JYEA 4GDLA 2BVCA 1WY8A 4JQWC 2KVZA 3Q8EA 2JYTA 3VAWA 1TS3A 2L1AA 2R61A 2M19A 4P16A 3LYYA 2LEKA 1T0RC 4LLGM 4HDQA 1HZ6A 2A4ZA 2G3QB 4DBGA 1UGJA 2TSSA 3AULA 1B9RA 4M02A 1HEZE 4YTPB 2LGDA 3Q8AA 2VH2A 4B95A 1T3QA 3MJ5A 4DHZE 3PRZA 4W9GA 3PPAA 1V2YA 4WIPA 5AUIA 5J2RA 1QOAA 1Q5WB 2PJHA 4XGAB 2AL6A 4KGRA 2EELA 5LXIB 1NVID 3IVFA 1TKEA 1WYGA 1E6EB 1D6EC 2XEWA 1I4PA 1Z5SB 5HG2A 4HEA1 4C7YA 3LJ3A 4BKGA 1NYRA 3DCGA 2L7RA 3ZXRA 4EZLA 3DVGY 3ETRA 4LJPB 5LNK1 3HM6X 1XCTL 1EUVB 5BYQA 1OQYA 3DBHB 3VUXA 2WDQB 4FHKA 2W54A 2JF5A 4LNOA 1I4HA 1OGWA 2AQ3B 1E7PB 1R4NB 3P2BA 4S17A 1WJUA 4W9KA 4S0RA 3Q3FA 1TIFA 1NEKB 5FKAC 4A55A 1WI0A 4MSMB 4QAYA 1PYWD 5FR6A 3U8ZA 4JL9A 1ZUD2 3A9JB 1JROA 4NZLB 2J7QB 4EZJA 3AMZA 2WXFA 2WXKA 4BZAA 3RNAC 1YQBA 2JRIB 5I4DA 3ZYYX 1XEEA 3IBEA 2LGXA 1J7CA 4TKNA 3GZNI 1QLBB 2INCC 1DOIA 3VHTC 2ZPYA 3HRDD 4US8A 2M4NA 4EE2A 1F52A 2W82A 3ONSA 1PUTA 1AYFA 4A6QA 2IO0B 5DPRA 3R7QA 2RGFA 3PV1A 3AV8A 1MG8A 1SGHA 3ABVB 4W9JA 3ZRCA 5KHQA 2MBHA 2WXNA 2WXLA 2N9PC 3AE6B 3KWLA 2K25A 2DYOA 2JUOA 1NI2A 4FBJB 2NR2A 4RCOA 1Z2MA 2O6VD 3ZGZA 2D2QA 4B0MA 3QX1A 3P4RB 2DLBA 3VUWA 1I4RA 2PEAA 1V5OA 3KYDD 1NDDA 2JWUA 1WGRA 4IWOA 2VRRB 3MP9A 4NQKE 4ZHOA 1EM7A 4ARCA 3W9CB 2NS5A 1GJZA 2MLBA 5EE1A 2OOBB 2D11A 4E3CA 3Q2AC 3ZRFA 2D5GA 1WM3A 4KZ0A 4OVVA 4LDTB 2LMCA 4IM3A 2LVOA 4DDID 3I9V1 2ONQA 3V61A 4CHKA 4JGHB 3JVZX 4PS7A 5AZGA 4DDGD 2LRUA 2VH1A 2DAFA 1ACCA 1H4RA 1L0XB 3A9JA 1WRIA 4N6EB 4FADA 1LQBA 1QQRA 1IGDA 3EGRA 1XO3A 1ZPSA 4Q2JA 3BZDB 4CQNA 3DQVA 2W3SA 4JE3B 1LO5D 3GS2A 3RFZB 1E8XA 5BMIA 3ZDTA 2PW9A 2WP9B 1XCQL 5C3JB 2N0SB 3EA6A 3PHXB 2J52A 5EE9A 4YSZB 4P6VF 4FA6A 3ENEA 3N20C 3P1MA 3ZIMA 3P4SB 4YSYB 3FKYA 2ZJDA 4IW0A 4WJNA 2K1FA 2ZW0A 1FCLA 5GMVA 2QMTA 1K51A 5IP4D 4C80A 3JYUA 4GDKB 2D3BA 2WWZA 3W5UB 3AXCA 3DDCB 1R4MI 1ROEA 3VH3B 1GPXA 1SJHD 2ZEQA 4AOFA 2BTEA 3AE3B 2FCQA 2WU2B 2INDC 1E7VA 4KIKB 1FEHA 1SSNA 3A1QB 1BUIC 1RFKA 1YJIA 5HI1A 3T8MA 4ACFA 2ZVOA 3H1UA 1IP9A 2INPE 1GAQB 4NPNA 4DXFA 2N1WA 1CZPA 1TY2A 4YWGG 1IYFA 2QCZA 4IC7B 1WR6E 1SF0A 2C9WB 3H7PB 3MJWA 4BBNC 1P7EA 3PLVA 1E9MA 2WDTB 4NQLB 2IY0B 4TQ0A 5FR3A 1I35A 2CHZA 2H88B 3AN1A 5CHFA 3RNGC 4KGTA 1YD8U 2L52A 4JIOU 5JHBA 1A5RA 1ZGUB 4HKZE 3M62B 2LJ5A 2IPKD 1A70A 1D5MC 3M63B 5IO9A 2JX5A 3VR9B 1L5PA 1TGZB 1XD3B 3B2FA 4ANVA 4E71A 2DAJA 2HTME 4NY0A 4IWPA 3WALA 1WXSA 2I38A 1X1MA 3U4EG 3DHIC 5MPOA 3NG0A 2KDEB 3A4SC 3I63C 4GGQA 1TS4A 2C7NB 3BIID 1Y56A 2J0KA 4IUMB 3A9KB 2LGYA 3D32A 1WE7A 4WJPA 2CJNA 2KFJA 1SXTA 2JXXA 2DENB 2FCSA 4GDKA 3SFEB 1ET6A 3MC0B 2J4XA 4FJYA 3AEAB 2QJLA 1FRRA 2ZZPB 3UIOB 2OJRA 4WJQA 1V1PB 1YJJA 4FJVB 4II2B 2E3TA 1UZXB 2YVCA 4MH8A 3RZFA 3AEGB 3RI7C 4FLHA 5IAAC 3VRAB 2DWQA 4KIKA 3R2IA 4WAFA 1I42A 4ZYSA 3A1QA 2OEDA 3SHQA 3QA8A 3ZLZA 2KYWA 4FULA 3TBLD 1IBXB 4PYZA 4ZRIA 2LASA 2KZRA 3VFKA 4PK1A 3V62A 3ZW3A 1HXYD 3DBLI 3EECA 3H7SA 4II3B 4RF0A 3T9LA 4N59A 3VH4B 2L3ZA 3L08A 2FIFA 3AEEB 2BYEA 3NUHB 3ZO5B 2JZ3B 3R7RA 2W3RA 1EO6A 1FNUA 2REXA 3AE1B 4DHZB 2MBOA 1I4XA 1BXTA 2V3NA 1WX8A 2A5UA 2BS4B 1NENB 2FBWB 4XX5A 4MEMA 2LVPA 1RFAA 2G1EA 2DX5B 4HROA 2DYMA 1PGAA 2O2VB 2UU7A 3QHTA 2WXIA 3N30A 4IKGA 2KTRB 1WE6A 3OLMD 4HPPA 4C4VA 3FILB 4LDTD 4ANXA 2Y5PA 3NS1A 3A9KA 3BVZA 2FCMA 1N63A 2WXRA 2QC8A 2EMSA 4IM0A 1N61A 2HJ8A 3SD5A 2KO3A 2WLBA 3N1YC 1OFFA 4K3CA 1RWSA 1IUEA 1TYGB 1GUAB 2MCNB 3TJPA 1TZOA 4WWMA 1Y8RC 5IN7A 2K3UA 1I4QA 1V1PA 2KAJA 3ZXVA 4NJCA 2J42A 2LXAA 4XWWA 4G0NB
chains in the Genus database with same CATH topology
4WJOA 4ZYNA 2B3AA 5D94A 1AARA 4FHJA 5CHWA 2R2QA 4G50A 1XT9B 4FN2A 4W9CA 2ZVNA 2YLMA 5FR6A 2JY6A 3QAQA 3U8ZA 4JL9A 3R66C 3KVFB 3ML9A 1HE8A 3A9JB 3UQAA 3RZWC 4A3OA 3VXWA 2J7QB 2MSED 3QQ8B 4EZJA 3L10B 4MH0E 2LUEA 2XBBC 1TTNA 1WXAA 4F8CB 3PHWB 2NPTB 2KDBA 2KDFB 1ZKHA 2MA9B 1YQBA 2JRIB 2PE6B 5LLIA 2BKFA 2DZIA 2FCNA 3IBEA 3L16A 1XQQA 4GXBA 2PE9A 2LGXA 3QK0A 3DVGX 2V3SA 3JSVA 4TKNA 5J18A 3OJ4B 2K8HA 3GZNI 2CHXA 2NBUA 4YL8A 5EDSA 4MSQB 1J0GA 2K6DB 4AP4C 2QHOA 3VHTC 2G45B 2ZPYA 5C23A 1CMXB 4LJOB 4URKA 2M4NA 4EKUA 2Z0DB 1UELA 1E7UA 4HLEA 2DYBA 2C60A 4WWNA 5C1ZA 2D3GA 3ONSA 2KC2A 1WGHA 2W9NA 2GBMA 3RD2A 2IO0B 3JW0X 5DPRA 1WX7A 1WH3A 3R7QA 3H7PA 3ZTCA 2RGFA 1E5WA 3PV1A 1FXTB 1MG8A 1SGHA 2KD0A 3VDZA 3UQBA 3C0RB 4BKSD 2EKEC 4W9JA 3ZRCA 5KHQA 2MBHA 1VD2A 1WM2A 2N9PC 3PZDA 4XZ4A 2K25A 2DYOA 2JUOA 1NI2A 2KTFA 4DXAB 2NR2A 3APFA 4FBJB 2MWSB 1WXVA 2MP2B 1T0YA 2KANA 3EC8A 1Z2MA 2O6VD 2XK5B 5CHVC 4EUTA 2D2QA 2O2VA 3QX1A 3VUWA 2BPSA 2MRPA 3MTNB 4ANWA 3APDA 2PEAA 1V5OA 3PGEA 2L0TA 2RR9A 3KYDD 4NJ6A 1NDDA 2K6QA 3QWZB 1WGRA 2KTRA 2WX0A 3OJ3A 4IWOA 2KOXA 2VRRB 1WMHB 2ZNVC 3VQIA 4K7UA 4AWJA 1D3ZA 4IG7B 1P1AA 4NQKE 3DPDA 3UGBB 2LRWA 4CYEA 2M1MA 2BWFA 2NS5A 4PS8A 3ZNHB 1GJZA 3A33B 5TR5A 2JPHA 4W9IA 3ALBA 4AJYB 2KDIA 2CHWA 1WJ6A 1KOTA 3KUDB 4DWFA 4M0WB 2MLBA 3V60A 2OOBB 2D11A 1JRUA 2L8JA 4E3CA 3ZRFA 4RMAA 5HKHA 4XC2A 2I1JA 1WFYA 3RT3B 1WM3A 4KZ0A 2BWES 4FJZA 4OVVA 4DK5A 4LDTB 4NJ7A 3VTWA 4IM3A 2LVOA 4TV3A 4DDID 4MJSB 4E74A 2L00B 3DBHI 3AU5A 2ZCBA 3HM3A 2DZJA 3V61A 3KH0A 1S1QB 4JGHB 4LCDE 4NNJB 3JVZX 4PYUA 4PS7A 2IY1B 2Z59B 5AZGA 4DDGD 3OAWA 3IFWB 2LRUA 1R4NI 3Q3JA 4CHKA 2DAFA 3U7DA 2N7EA 2J0MA 3PSEB 5JZEB 1H4RA 3A9JA 1P0RA 4HDOA 3CF6E 2MBBB 4MGKE 4BKTA 4FADA 1GC6A 1LQBA 2IO1B 4KDIC 1SIFA 3DOWA 1H8CA 5J17A 5D6JB 3UF8A 2NPTA 3DQVA 2C5LC 2C7MB 3ZVVA 2KX3A 3TMPB 3MHSD 1E8XA 4BBNF 1EF5A 3ZDTA 1UBQA 5JH5C 1V6EA 2KK8A 2MBEA 5IA7A 1GC7A 2IBIB 5AZHA 3PHXB 3UIPB 4K7SA 2I1KA 2N1VA 4KDLB 1VCBA 4I6PA 2K8CA 2CKHB 3ENEA 2L76A 4WQOB 3ZKJC 4FA6A 5G2NA 3TL5A 1P9DU 3ZIMA 3NZUA 1E8YA 4I6LB 4HJKA 1UD7A 4K1RB 1GG3A 3DVNV 2KWCA 3L17A 1PQSA 4MDKE 2ZJDA 4IW0A 3PT2B 4WJNA 2JZZA 2BYFA 4ZRJA 2K1FA 4RM8A 4NAWB 1UGMA 2ZPNA 2UYZB 5GMVA 3KUZA 2KXJA 1V80A 3WAPA 3PLUA 4MGYE 2KLCA 2MP2A 2HTHA 3N3KB 5DCNA 1LM8B 3JYUA 5G55A 3X23A 2XK5A 2GOWA 4GDKB 2WWZA 1WZ0A 4KVGB 5AEKB 4IWQA 3UINB 2D10A 3AXCA 3PRMB 1WGDA 3DDCB 1R4MI 4KSKC 1WJNA 3AI5A 4OVUA 3VH3B 5L95C 2MW5A 1WJ4A 2DHZA 2KFKB 1WMHA 1V81A 1K8RB 2NBVB 2K39A 1WYWB 2ZEQA 2NBWB 1EF1A 1RAXA 2CU1A 3PS6A 2MQJA 2ASQA 1G6JA 4WAAA 4MM3A 4AOFA 4I6NB 4RM9A 2FCQA 3K9OB 2K8BA 5CX3A 4AJWA 1V49A 2O6VB 4F7ZA 3DBSA 1E7VA 4ICUA 4KIKB 3VTVA 4M8NA 4HWIB 1IPGA 5JHAA 4ZDVA 3A1QB 2KMCA 3QCAA 2DZKA 4GDLB 3APCA 4CO7A 4HCNB 2GBKA 3RUIB 3T8MA 4EOYA 2ZVOA 2GBNA 3H1UA 1IP9A 1QZEA 2J0JA 2N4FA 2FAZA 3CMMB 3IG3A 4MJSA 4NPNA 3RULA 2N1WA 2KC1A 3U30A 1Q0WB 1J19A 1KJTA 1M94A 3ZDMC 3H9DA 3TCAA 1IYFA 4A20A 3M3JA 4W9FA 3L13A 4IC7B 4IM2A 1LFDA 1WR6E 1V9JA 1BT0A 2C9WB 2ZCCA 2NVUI 3H7PB 1NBFC 3MJWA 2AWTA 4PS3A 4B6WA 4BBNC 3PLVA 4GMVA 4GN1A 2MBQA 2KVRA 2GMIC 2WDTB 2D07B 4HXDA 4ASWC 3VUYA 4NQLB 2IY0B 4ICVA 2JVCA 4TQ0A 2N7DA 4BOSC 2KWUB 1I35A 2CHZA 2Y5BB 3W1YA 2C7HA 4DHJD 2KQ7A 2AEHA 2EMTA 5CHFA 2WYQA 4GOCA 3NHEB 1LXDA 2KJRA 4W9EA 1SE9A 3K9PB 1YD8U 4JIOU 5JHBA 3VTUA 1A5RA 4N9F4 1WX9A 1ZGUB 3M62B 1YX5B 2LJ5A 3H6NA 3PTFC 1WF9A 3ECIA 2L05A 4MSMB 3S2AA 1J8CA 3M63B 5DPSA 3ZTDA 3BINA 4AUQC 4HVBA 1WGGA 4GSWA 2M17A 2AL3A 3RYTA 1GNUA 5AZFA 2AYOB 4BOZB 1TGZB 4GB9A 1TBEA 5E6NA 4KV2A 1XD3B 4G3XB 4ANVA 2KKCA 4E71A 1WR1A 2BYVE 2DAJA 4NY0A 1L2NA 4HPLB 4IWPA 3WALA 1WXSA 1X1MA 2NCNA 3L0WB 3CSTA 3WIMA 2KDEB 3A4SC 4X57B 3N32A 2BKRB 5KHOA 2BGFA 2KWVB 3KW5B 4TQ1A 3X0WA 3W1SC 5BO4B 2ZNVB 3ZNGC 2UWQA 3ZNID 2V1YA 4GU2A 1S3SG 3KUCB 4GGQA 2C7NB 4K7WA 4NAWA 2J0KA 2V4LA 4IUMB 3A9KB 2M0XA 2LGYA 3D32A 1WE7A 1RLFA 4WJPA 2KFJA 1OEYJ 2JXXA 1C1YB 5E6OA 2LI5A 3NS8A 3RCZA 2DENB 2FCSA 4GDKA 3ZNZB 2PPHA 2FNJB 5DPWA 1U4AA 4EZKA 4FJYA 3W1SA 3AU4A 1YIWA 4F1SA 2KFKA 2KJHB 4HK2A 2KMAA 2ZZPB 4JLCA 1OTRB 3R3MA 3UIOB 2OJRA 3SDLC 4BKSA 2IYDB 3A4RA 2LWPA 3B0AA 4WJQA 4FJVB 4II2B 4W9HA 3WA0A 5E6PA 3B08A 2IO2B 2Z0EB 3QARA 2BF8B 3VVWB 3I3TB 5L83A 1UZXB 2FIDA 2IZVB 2YVCA 3RZFA 4HPMB 4P7IA 4MELA 2N9EB 4FLHA 4W9DA 2O6VA 5IAAC 1KLVA 3NOBA 1WIAA 4ZRKA 4KIKA 3WAOA 1P3QU 1I42A 5DPTA 1UH6A 3A1QA 2LZ6A 3HHMA 3SHQA 3QA8A 2JT4B 2RD0A 4GDLA 3QC8B 3ZLZA 4FULA 3TBLD 1WY8A 4JQWC 4PYZA 3LDZE 4ZRIA 2LASA 3WAMA 2KZRA 2LXCA 3VAWA 3VFKA 3O65B 4A3PA 1ZW7A 1E90A 3V62A 2KN5A 3ZW3A 3DBLI 3EECA 3H7SA 4II3B 3T9LA 3CSFA 3VH4B 2L3ZA 4G11A 2LD9A 3M95A 5LXHA 4EEWA 2M8SA 4HCPB 2LVQA 3L08A 4HDQA 3JSVB 2A4ZA 2G3QB 4GIVA 2MX2A 1V86A 2FIFA 2BYEA 5CTRC 1P98A 3ZO5B 4DBGA 2JZ3B 3R7RA 1C3TA 2KLGA 1E8WA 1Q1OA 3ZUNA 1F9JA 1EO6A 4KZCA 2REXA 4DHZB 3AULA 5D2MB 2LGDA 2MBOA 4W9LA 1YX6B 4B95A 3NY5A 4DHZE 1WX8A 2A5UA 2FUHB 2WX1A 2JWZA 2KX0A 4B9KA 3PRZA 4EFOA 3SU8X 2N9XA 4K81A 2IO3B 3ML8A 4W9GA 3PPAA 4J6IA 3QIJA 1ISNA 2CS4A 1WRDB 2KQSA 4MGZE 4XX5A 1V2YA 3GOEA 2GBRA 4M8MA 2RPQA 4MEMA 4ANUA 2LVPA 5J2RA 1RFAA 4TUUA 2DX5B 2L0FA 3HIZA 4BVUC 3PREA 3DBRI 4DHJB 1Q5WB 2DYMA 3HK0A 2O2VB 2G4DB 2PJHA 1OEYA 1WXMA 2KNBA 3PRPB 3QHTA 2AL6A 2DZMA 3N30A 5LXIB 3IVFA 1KM7A 2G4SA 2KTRB 1WE6A 1WZ3A 3OLMD 1RRBA 1V5TA 3BY4B 4LDTD 4ANXA 2HD5B 2XEWA 4WWOA 2R2OA 1Z5SB 3A9KA 3V6CB 3WANA 5D7GA 2FCMA 3DVNU 3LJ3A 2EMSA 2RSUA 3QJZA 4IM0A 4BKGA 4BFRA 4KSLC 2HJ8A 3DCGA 3SD5A 2L7RA 3PVLA 4EZLA 1E8ZA 2KO3A 3DVGY 3IHPC 4LJPB 3HM6X 1EUVB 1OQYA 2CR5A 3L54A 3VUXA 4FHKA 1GUAB 2MCNB 3TJPA 2KJ6A 1Y8RC 3KYCD 3B1LX 2HE7A 2JF5A 3EHVA 3V6EB 1OGWA 1TZ1A 1UBIA 2GBJA 4MGIE 3P2BA 3NZSA 3TIXA 1WJUA 1WGYA 1L7YA 4W9KA 2LXAA 1YJ1A 3Q3FA 4WWPA 2JRHA 3EFUA 2KHWB 4G0NB 1WI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJO A;  4ZYN A;  2B3A A;  5D94 A;  1AAR A;  4FHJ A;  5CHW A;  2R2Q A;  4G50 A;  1XT9 B;  4FN2 A;  4W9C A;  2ZVN A;  2YLM A;  5FR6 A;  2JY6 A;  3QAQ A;  3U8Z A;  4JL9 A;  3R66 C;  3KVF B;  3ML9 A;  1HE8 A;  3A9J B;  3UQA A;  3RZW C;  4A3O A;  3VXW A;  2J7Q B;  2MSE D;  3QQ8 B;  4EZJ A;  3L10 B;  4MH0 E;  2LUE A;  2XBB C;  1TTN A;  1WXA A;  4F8C B;  3PHW B;  2NPT B;  2KDB A;  2KDF B;  1ZKH A;  2MA9 B;  1YQB A;  2JRI B;  2PE6 B;  5LLI A;  2BKF A;  2DZI A;  2FCN A;  3IBE A;  3L16 A;  1XQQ A;  4GXB A;  2PE9 A;  2LGX A;  3QK0 A;  3DVG X;  2V3S A;  3JSV A;  4TKN A;  5J18 A;  3OJ4 B;  2K8H A;  3GZN I;  2CHX A;  2NBU A;  4YL8 A;  5EDS A;  4MSQ B;  1J0G A;  2K6D B;  4AP4 C;  2QHO A;  3VHT C;  2G45 B;  2ZPY A;  5C23 A;  1CMX B;  4LJO B;  4URK A;  2M4N A;  4EKU A;  2Z0D B;  1UEL A;  1E7U A;  4HLE A;  2DYB A;  2C60 A;  4WWN A;  5C1Z A;  2D3G A;  3ONS A;  2KC2 A;  1WGH A;  2W9N A;  2GBM A;  3RD2 A;  2IO0 B;  3JW0 X;  5DPR A;  1WX7 A;  1WH3 A;  3R7Q A;  3H7P A;  3ZTC A;  2RGF A;  1E5W A;  3PV1 A;  1FXT B;  1MG8 A;  1SGH A;  2KD0 A;  3VDZ A;  3UQB A;  3C0R B;  4BKS D;  2EKE C;  4W9J A;  3ZRC A;  5KHQ A;  2MBH A;  1VD2 A;  1WM2 A;  2N9P C;  3PZD A;  4XZ4 A;  2K25 A;  2DYO A;  2JUO A;  1NI2 A;  2KTF A;  4DXA B;  2NR2 A;  3APF A;  4FBJ B;  2MWS B;  1WXV A;  2MP2 B;  1T0Y A;  2KAN A;  3EC8 A;  1Z2M A;  2O6V D;  2XK5 B;  5CHV C;  4EUT A;  2D2Q A;  2O2V A;  3QX1 A;  3VUW A;  2BPS A;  2MRP A;  3MTN B;  4ANW A;  3APD A;  2PEA A;  1V5O A;  3PGE A;  2L0T A;  2RR9 A;  3KYD D;  4NJ6 A;  1NDD A;  2K6Q A;  3QWZ B;  1WGR A;  2KTR A;  2WX0 A;  3OJ3 A;  4IWO A;  2KOX A;  2VRR B;  1WMH B;  2ZNV C;  3VQI A;  4K7U A;  4AWJ A;  1D3Z A;  4IG7 B;  1P1A A;  4NQK E;  3DPD A;  3UGB B;  2LRW A;  4CYE A;  2M1M A;  2BWF A;  2NS5 A;  4PS8 A;  3ZNH B;  1GJZ A;  3A33 B;  5TR5 A;  2JPH A;  4W9I A;  3ALB A;  4AJY B;  2KDI A;  2CHW A;  1WJ6 A;  1KOT A;  3KUD B;  4DWF A;  4M0W B;  2MLB A;  3V60 A;  2OOB B;  2D11 A;  1JRU A;  2L8J A;  4E3C A;  3ZRF A;  4RMA A;  5HKH A;  4XC2 A;  2I1J A;  1WFY A;  3RT3 B;  1WM3 A;  4KZ0 A;  2BWE S;  4FJZ A;  4OVV A;  4DK5 A;  4LDT B;  4NJ7 A;  3VTW A;  4IM3 A;  2LVO A;  4TV3 A;  4DDI D;  4MJS B;  4E74 A;  2L00 B;  3DBH I;  3AU5 A;  2ZCB A;  3HM3 A;  2DZJ A;  3V61 A;  3KH0 A;  1S1Q B;  4JGH B;  4LCD E;  4NNJ B;  3JVZ X;  4PYU A;  4PS7 A;  2IY1 B;  2Z59 B;  5AZG A;  4DDG D;  3OAW A;  3IFW B;  2LRU A;  1R4N I;  3Q3J A;  4CHK A;  2DAF A;  3U7D A;  2N7E A;  2J0M A;  3PSE B;  5JZE B;  1H4R A;  3A9J A;  1P0R A;  4HDO A;  3CF6 E;  2MBB B;  4MGK E;  4BKT A;  4FAD A;  1GC6 A;  1LQB A;  2IO1 B;  4KDI C;  1SIF A;  3DOW A;  1H8C A;  5J17 A;  5D6J B;  3UF8 A;  2NPT A;  3DQV A;  2C5L C;  2C7M B;  3ZVV A;  2KX3 A;  3TMP B;  3MHS D;  1E8X A;  4BBN F;  1EF5 A;  3ZDT A;  1UBQ A;  5JH5 C;  1V6E A;  2KK8 A;  2MBE A;  5IA7 A;  1GC7 A;  2IBI B;  5AZH A;  3PHX B;  3UIP B;  4K7S A;  2I1K A;  2N1V A;  4KDL B;  1VCB A;  4I6P A;  2K8C A;  2CKH B;  3ENE A;  2L76 A;  4WQO B;  3ZKJ C;  4FA6 A;  5G2N A;  3TL5 A;  1P9D U;  3ZIM A;  3NZU A;  1E8Y A;  4I6L B;  4HJK A;  1UD7 A;  4K1R B;  1GG3 A;  3DVN V;  2KWC A;  3L17 A;  1PQS A;  4MDK E;  2ZJD A;  4IW0 A;  3PT2 B;  4WJN A;  2JZZ A;  2BYF A;  4ZRJ A;  2K1F A;  4RM8 A;  4NAW B;  1UGM A;  2ZPN A;  2UYZ B;  5GMV A;  3KUZ A;  2KXJ A;  1V80 A;  3WAP A;  3PLU A;  4MGY E;  2KLC A;  2MP2 A;  2HTH A;  3N3K B;  5DCN A;  1LM8 B;  3JYU A;  5G55 A;  3X23 A;  2XK5 A;  2GOW A;  4GDK B;  2WWZ A;  1WZ0 A;  4KVG B;  5AEK B;  4IWQ A;  3UIN B;  2D10 A;  3AXC A;  3PRM B;  1WGD A;  3DDC B;  1R4M I;  4KSK C;  1WJN A;  3AI5 A;  4OVU A;  3VH3 B;  5L95 C;  2MW5 A;  1WJ4 A;  2DHZ A;  2KFK B;  1WMH A;  1V81 A;  1K8R B;  2NBV B;  2K39 A;  1WYW B;  2ZEQ A;  2NBW B;  1EF1 A;  1RAX A;  2CU1 A;  3PS6 A;  2MQJ A;  2ASQ A;  1G6J A;  4WAA A;  4MM3 A;  4AOF A;  4I6N B;  4RM9 A;  2FCQ A;  3K9O B;  2K8B A;  5CX3 A;  4AJW A;  1V49 A;  2O6V B;  4F7Z A;  3DBS A;  1E7V A;  4ICU A;  4KIK B;  3VTV A;  4M8N A;  4HWI B;  1IPG A;  5JHA A;  4ZDV A;  3A1Q B;  2KMC A;  3QCA A;  2DZK A;  4GDL B;  3APC A;  4CO7 A;  4HCN B;  2GBK A;  3RUI B;  3T8M A;  4EOY A;  2ZVO A;  2GBN A;  3H1U A;  1IP9 A;  1QZE A;  2J0J A;  2N4F A;  2FAZ A;  3CMM B;  3IG3 A;  4MJS A;  4NPN A;  3RUL A;  2N1W A;  2KC1 A;  3U30 A;  1Q0W B;  1J19 A;  1KJT A;  1M94 A;  3ZDM C;  3H9D A;  3TCA A;  1IYF A;  4A20 A;  3M3J A;  4W9F A;  3L13 A;  4IC7 B;  4IM2 A;  1LFD A;  1WR6 E;  1V9J A;  1BT0 A;  2C9W B;  2ZCC A;  2NVU I;  3H7P B;  1NBF C;  3MJW A;  2AWT A;  4PS3 A;  4B6W A;  4BBN C;  3PLV A;  4GMV A;  4GN1 A;  2MBQ A;  2KVR A;  2GMI C;  2WDT B;  2D07 B;  4HXD A;  4ASW C;  3VUY A;  4NQL B;  2IY0 B;  4ICV A;  2JVC A;  4TQ0 A;  2N7D A;  4BOS C;  2KWU B;  1I35 A;  2CHZ A;  2Y5B B;  3W1Y A;  2C7H A;  4DHJ D;  2KQ7 A;  2AEH A;  2EMT A;  5CHF A;  2WYQ A;  4GOC A;  3NHE B;  1LXD A;  2KJR A;  4W9E A;  1SE9 A;  3K9P B;  1YD8 U;  4JIO U;  5JHB A;  3VTU A;  1A5R A;  4N9F 4;  1WX9 A;  1ZGU B;  3M62 B;  1YX5 B;  2LJ5 A;  3H6N A;  3PTF C;  1WF9 A;  3ECI A;  2L05 A;  4MSM B;  3S2A A;  1J8C A;  3M63 B;  5DPS A;  3ZTD A;  3BIN A;  4AUQ C;  4HVB A;  1WGG A;  4GSW A;  2M17 A;  2AL3 A;  3RYT A;  1GNU A;  5AZF A;  2AYO B;  4BOZ B;  1TGZ B;  4GB9 A;  1TBE A;  5E6N A;  4KV2 A;  1XD3 B;  4G3X B;  4ANV A;  2KKC A;  4E71 A;  1WR1 A;  2BYV E;  2DAJ A;  4NY0 A;  1L2N A;  4HPL B;  4IWP A;  3WAL A;  1WXS A;  1X1M A;  2NCN A;  3L0W B;  3CST A;  3WIM A;  2KDE B;  3A4S C;  4X57 B;  3N32 A;  2BKR B;  5KHO A;  2BGF A;  2KWV B;  3KW5 B;  4TQ1 A;  3X0W A;  3W1S C;  5BO4 B;  2ZNV B;  3ZNG C;  2UWQ A;  3ZNI D;  2V1Y A;  4GU2 A;  1S3S G;  3KUC B;  4GGQ A;  2C7N B;  4K7W A;  4NAW A;  2J0K A;  2V4L A;  4IUM B;  3A9K B;  2M0X A;  2LGY A;  3D32 A;  1WE7 A;  1RLF A;  4WJP A;  2KFJ A;  1OEY J;  2JXX A;  1C1Y B;  5E6O A;  2LI5 A;  3NS8 A;  3RCZ A;  2DEN B;  2FCS A;  4GDK A;  3ZNZ B;  2PPH A;  2FNJ B;  5DPW A;  1U4A A;  4EZK A;  4FJY A;  3W1S A;  3AU4 A;  1YIW A;  4F1S A;  2KFK A;  2KJH B;  4HK2 A;  2KMA A;  2ZZP B;  4JLC A;  1OTR B;  3R3M A;  3UIO B;  2OJR A;  3SDL C;  4BKS A;  2IYD B;  3A4R A;  2LWP A;  3B0A A;  4WJQ A;  4FJV B;  4II2 B;  4W9H A;  3WA0 A;  5E6P A;  3B08 A;  2IO2 B;  2Z0E B;  3QAR A;  2BF8 B;  3VVW B;  3I3T B;  5L83 A;  1UZX B;  2FID A;  2IZV B;  2YVC A;  3RZF A;  4HPM B;  4P7I A;  4MEL A;  2N9E B;  4FLH A;  4W9D A;  2O6V A;  5IAA C;  1KLV A;  3NOB A;  1WIA A;  4ZRK A;  4KIK A;  3WAO A;  1P3Q U;  1I42 A;  5DPT A;  1UH6 A;  3A1Q A;  2LZ6 A;  3HHM A;  3SHQ A;  3QA8 A;  2JT4 B;  2RD0 A;  4GDL A;  3QC8 B;  3ZLZ A;  4FUL A;  3TBL D;  1WY8 A;  4JQW C;  4PYZ A;  3LDZ E;  4ZRI A;  2LAS A;  3WAM A;  2KZR A;  2LXC A;  3VAW A;  3VFK A;  3O65 B;  4A3P A;  1ZW7 A;  1E90 A;  3V62 A;  2KN5 A;  3ZW3 A;  3DBL I;  3EEC A;  3H7S A;  4II3 B;  3T9L A;  3CSF A;  3VH4 B;  2L3Z A;  4G11 A;  2LD9 A;  3M95 A;  5LXH A;  4EEW A;  2M8S A;  4HCP B;  2LVQ A;  3L08 A;  4HDQ A;  3JSV B;  2A4Z A;  2G3Q B;  4GIV A;  2MX2 A;  1V86 A;  2FIF A;  2BYE A;  5CTR C;  1P98 A;  3ZO5 B;  4DBG A;  2JZ3 B;  3R7R A;  1C3T A;  2KLG A;  1E8W A;  1Q1O A;  3ZUN A;  1F9J A;  1EO6 A;  4KZC A;  2REX A;  4DHZ B;  3AUL A;  5D2M B;  2LGD A;  2MBO A;  4W9L A;  1YX6 B;  4B95 A;  3NY5 A;  4DHZ E;  1WX8 A;  2A5U A;  2FUH B;  2WX1 A;  2JWZ A;  2KX0 A;  4B9K A;  3PRZ A;  4EFO A;  3SU8 X;  2N9X A;  4K81 A;  2IO3 B;  3ML8 A;  4W9G A;  3PPA A;  4J6I A;  3QIJ A;  1ISN A;  2CS4 A;  1WRD B;  2KQS A;  4MGZ E;  4XX5 A;  1V2Y A;  3GOE A;  2GBR A;  4M8M A;  2RPQ A;  4MEM A;  4ANU A;  2LVP A;  5J2R A;  1RFA A;  4TUU A;  2DX5 B;  2L0F A;  3HIZ A;  4BVU C;  3PRE A;  3DBR I;  4DHJ B;  1Q5W B;  2DYM A;  3HK0 A;  2O2V B;  2G4D B;  2PJH A;  1OEY A;  1WXM A;  2KNB A;  3PRP B;  3QHT A;  2AL6 A;  2DZM A;  3N30 A;  5LXI B;  3IVF A;  1KM7 A;  2G4S A;  2KTR B;  1WE6 A;  1WZ3 A;  3OLM D;  1RRB A;  1V5T A;  3BY4 B;  4LDT D;  4ANX A;  2HD5 B;  2XEW A;  4WWO A;  2R2O A;  1Z5S B;  3A9K A;  3V6C B;  3WAN A;  5D7G A;  2FCM A;  3DVN U;  3LJ3 A;  2EMS A;  2RSU A;  3QJZ A;  4IM0 A;  4BKG A;  4BFR A;  4KSL C;  2HJ8 A;  3DCG A;  3SD5 A;  2L7R A;  3PVL A;  4EZL A;  1E8Z A;  2KO3 A;  3DVG Y;  3IHP C;  4LJP B;  3HM6 X;  1EUV B;  1OQY A;  2CR5 A;  3L54 A;  3VUX A;  4FHK A;  1GUA B;  2MCN B;  3TJP A;  2KJ6 A;  1Y8R C;  3KYC D;  3B1L X;  2HE7 A;  2JF5 A;  3EHV A;  3V6E B;  1OGW A;  1TZ1 A;  1UBI A;  2GBJ A;  4MGI E;  3P2B A;  3NZS A;  3TIX A;  1WJU A;  1WGY A;  1L7Y A;  4W9K A;  2LXA A;  1YJ1 A;  3Q3F A;  4WWP A;  2JRH A;  3EFU A;  2KHW B;  4G0N B;  1WI0 A; 
#chains in the Genus database with same CATH topology
 3FC4 A;  5CHW A;  4FN2 A;  4LTU A;  3KVF B;  3ML9 A;  3UQA A;  4A3O A;  2KT7 A;  3GE3 C;  4ARI A;  2JZP A;  1N60 A;  1HA5 A;  4O1N A;  5G5G A;  4F8C B;  3I57 A;  2NPT B;  2KDF B;  1F2R C;  2MA9 B;  1PGB A;  5LLI A;  2DZI A;  2PE9 A;  5J18 A;  3OJ4 B;  2D3C A;  2K6D B;  4US9 A;  2QHO A;  2G45 B;  2K5P A;  1CMX B;  5C23 A;  1KLG D;  2Z0D B;  1UEL A;  1E7U A;  4HLE A;  2AQ2 B;  2C60 A;  4WWN A;  2KC2 A;  3RD2 A;  1ZP0 B;  1QOB A;  4HJG E;  2BT6 A;  1FXT B;  1VJK A;  2GRI A;  3BVM A;  2QIE B;  1KFY B;  3BVG A;  2WXQ A;  1WM2 A;  2RDB C;  4XZ4 A;  1AN8 A;  2B76 B;  2G9H D;  1WXV A;  2MWS B;  3RNB C;  2WXM A;  4REZ A;  4EUT A;  2O2V A;  2BPS A;  2MJ3 A;  3APD A;  2BB5 A;  3R8B A;  4WQM A;  2K6Q A;  2KTR A;  2WX0 A;  4IDI A;  3FIL A;  2KOX A;  1ESF A;  1CK1 A;  4IG7 B;  4ZOH C;  2LRW A;  2M1M A;  3LXF A;  5TR5 A;  4W9I A;  3KUD B;  4B0E A;  4TMA B;  1RYJ A;  1PGX A;  1ZDX A;  2I1J A;  3RT3 B;  2BWE S;  3EUB 2;  3BK2 A;  4MJS B;  2L00 B;  1TY0 A;  2IY1 B;  4D2K A;  2J0M A;  5EE3 A;  1P0R A;  3CF6 E;  4MGK E;  4BKT A;  2MJE A;  1GC6 A;  2IO1 B;  1SIF A;  3DOW A;  1H8C A;  3C19 A;  5J17 A;  3UF8 A;  2NPT A;  3P4Q B;  3TMP B;  3MHS D;  1YQ3 B;  1EF5 A;  5GXG B;  5JH5 C;  1E0Z A;  1GC7 A;  2GI9 A;  5AZH A;  3UIP B;  1J7A A;  1FFU A;  4XE0 A;  4C7Z A;  1SE4 A;  3ZKJ C;  3GP7 A;  1E8Y A;  4K1R B;  3DHG C;  3DVN V;  1DYQ A;  1PFD A;  1C4A A;  2ZPN A;  4WH4 A;  3KUZ A;  2AX5 A;  2KXJ A;  1V80 A;  2OJW A;  4IOI E;  4MGY E;  1STE A;  3N3K B;  1LM8 B;  5G55 A;  5H92 C;  1C77 A;  1TJE A;  4KVG B;  1UUP A;  1FIQ A;  3UIN B;  1ET9 A;  4N58 A;  2KFK B;  3AB5 A;  1K8R B;  2NBW B;  4PT5 A;  3PS6 A;  4WAA A;  1JAL A;  2XNA C;  4RM9 A;  1V49 A;  4F7Z A;  3DBS A;  4ICU A;  3IAS 1;  2PLP A;  4HWI B;  1RM6 C;  2DZK A;  2WNM A;  4EOY A;  2J0J A;  2N4F A;  2FAZ A;  3RUL A;  4MJS A;  1KJT A;  2JXT A;  2WXP A;  3H9D A;  4JX1 C;  1L0Y B;  4A20 A;  4IM2 A;  3MC9 A;  1BT0 A;  1KLU D;  2VZK B;  4B6W A;  4GN1 A;  4GLS C;  1T0S C;  3URY A;  1E10 A;  2GMI C;  4RGM A;  1F77 A;  2BS2 B;  1VZ6 A;  2N7D A;  4BOS C;  2Y5B B;  1FD6 A;  1SE2 A;  4GOC A;  3NHE B;  1LXD A;  2KJR A;  3VR8 B;  4N9F 4;  2PTL A;  1J8C A;  3S2A A;  4DXG A;  3RN9 C;  3Q8F A;  3AE7 B;  4C56 C;  4XYC A;  4GSW A;  3RYT A;  4M01 A;  1GNU A;  1TT5 B;  4GB9 A;  4KV2 A;  4G3X B;  2YEP F;  1L6U A;  2BYV E;  1PDX A;  4HPL B;  3V3X A;  1OQR A;  1VZ7 A;  2QEJ C;  3OWE B;  4X57 B;  3N32 A;  3P42 A;  3W1S C;  2RMM A;  3EFC A;  3KUC B;  4OZA A;  3DWM A;  1WXQ A;  1RLF A;  3NS8 A;  3ZNZ B;  1MJD A;  4ITK A;  1NI3 A;  1QF6 A;  1KH0 A;  4MAC A;  4EZK A;  4F1S A;  1CJE A;  2KFK A;  4HK2 A;  3TEZ A;  2KMA A;  2LHE A;  3R3M A;  4BKS A;  1MPE A;  3B0A A;  1UNS A;  1VRA B;  2J53 A;  3VVW B;  2NTS A;  1TKG A;  4HPM B;  4M00 A;  4NAM A;  3N1Z C;  5BYS A;  3HHM A;  5FK9 C;  3LDZ E;  3PZ8 A;  2LXC A;  1MG4 A;  3O65 B;  5D3D A;  1GOZ A;  3GZN B;  3AEC B;  2JU6 X;  3CSF A;  2LD9 A;  5LXH A;  4EEW A;  4HCP B;  3MFG A;  3JSV B;  3Q69 A;  4GIV A;  1VLB A;  3RNC C;  5CTR C;  1P98 A;  2KLG A;  1E8W A;  1Q1O A;  5D2M B;  3MHZ A;  4W9L A;  2KAC A;  1N62 A;  2FUH B;  2WX1 A;  4EFO A;  1GB4 A;  3SU8 X;  2N9X A;  3IT6 B;  1K52 A;  1YN4 A;  4J6I A;  1ISN A;  2CS4 A;  1WRD B;  2KQS A;  4MGZ E;  3GOE A;  5IOI A;  4M8M A;  4ANU A;  1QOF A;  1FXA A;  3HIZ A;  3PRE A;  1XLQ A;  3DBR I;  1FFV A;  1OEY A;  2KNB A;  2KWD A;  3PRP B;  4YXD B;  1KM7 A;  2BYT A;  1V5T A;  3ZJT A;  1IGC A;  3U7Z A;  2ACZ B;  1I4G A;  4BFR A;  2WS3 B;  2RSU A;  1NYQ A;  3PVL A;  3TUO A;  1E8Z A;  2NTT A;  1TKY A;  5C2T B;  2CR5 A;  4P1B C;  2K9X A;  1FRD A;  2Z8L A;  2KJ6 A;  2K22 A;  4JWS C;  5BYR A;  5JXV A;  1TZ1 A;  1UBI A;  1FO4 A;  3TIX A;  1WGY A;  1YJ1 A;  2LHD A;  2JRH A;  2KHW B;  3DHH C;  3AEB B;  4MT5 A;  4WJO A;  4ZYN A;  2B3A A;  1AAR A;  4OZB A;  2JY6 A;  1KTK A;  3QAQ A;  3V05 A;  1TS2 A;  2HJ1 A;  3VXW A;  2QIL A;  4FXC A;  3QQ8 B;  3L10 B;  1SIJ A;  3B2G A;  1WXA A;  2H89 B;  3PHW B;  2KDB A;  5HHD G;  2PMV A;  2FCN A;  1XQQ A;  1FNW A;  3JSV A;  5EDS A;  4MSQ B;  1J0G A;  4LJO B;  1M4V A;  2BB6 A;  1WWT A;  2WXO A;  1EWC A;  2LGS A;  1WGH A;  2GBM A;  1WX7 A;  1WH3 A;  4YT0 B;  3H7P A;  1E5W A;  1D4B A;  2KD0 A;  3UQB A;  3C0R B;  4BKS D;  1N5X A;  2EKE C;  1R4M B;  1F0Z A;  4DXA B;  2MP2 B;  1T0Y A;  2KAN A;  3EC8 A;  2INN E;  2NMQ A;  4JWU C;  3MTN B;  1T5X D;  4P1C C;  4NJ6 A;  1JWB D;  2DBY A;  3QWZ B;  1C9F A;  3OJ3 A;  4K7U A;  3UGB B;  1TS5 A;  4CYE A;  2BWF A;  3Q3O C;  2I2Y A;  3ZNH B;  3A33 B;  3GE8 C;  2JPH A;  3ALB A;  4AJY B;  2KDI A;  2VZK D;  4DWF A;  3V60 A;  1AW7 A;  3E56 A;  4XC2 A;  1UF0 A;  1FPY A;  4DK5 A;  4K3B A;  2N9L A;  3VTW A;  2L83 A;  4E74 A;  3DBH I;  3KH0 A;  1VZ8 A;  1S1Q B;  4NNJ B;  1JCK B;  2Z59 B;  3IFW B;  2ICI A;  1R4N I;  3U7D A;  3PSE B;  1ZE3 D;  4LNN A;  4HDO A;  2WU5 B;  2LGI A;  4KKI A;  1V8C A;  2PIA A;  3ZJU A;  5E6J A;  2C5L C;  4H2A A;  4KGS A;  2JSV X;  3NZ3 A;  4BBN F;  3IXS A;  1JWS D;  4BAX A;  1UBQ A;  1L4Z B;  1V6E A;  2KK8 A;  2MBE A;  5IA7 A;  4HKQ A;  1IBX A;  4K7S A;  3T3O A;  2I1K A;  4KDL B;  1VCB A;  2K8C A;  2CKH B;  1XLO A;  2L76 A;  4WQO B;  5G2N A;  4I6L B;  4HJK A;  2KWC A;  3L17 A;  3BYT B;  3PT2 B;  4ZRJ A;  2JZZ A;  2BYF A;  3L4P A;  4RM8 A;  1P7F A;  1R7S A;  1UGM A;  3WAP A;  4L23 A;  2W55 A;  2QSD A;  2MP2 A;  2RDG A;  1C79 A;  3PO0 A;  4RFB A;  3HVD A;  4RF1 A;  1JQ4 A;  1WZ0 A;  1YOV B;  5AEK B;  4IWQ A;  3PRM B;  4AS1 A;  4OVU A;  2MW5 A;  2DHZ A;  1EWY C;  1VDV A;  2K39 A;  4YTM B;  2D3A A;  1EF1 A;  1G6J A;  2MQJ A;  3KWV A;  1OQQ A;  1FNV A;  4HRS A;  3K9O B;  4AJW A;  2PKO A;  2PVG C;  3RNF C;  4KKJ A;  3VTV A;  2M0A A;  1DOX A;  1IPG A;  5JHA A;  4L2Y A;  4ZDV A;  3DBL B;  2KMC A;  3UI3 A;  3APC A;  3RUI B;  2WGS A;  4JPS A;  2WDR B;  2GBN A;  3CMM B;  3IG3 A;  3BWU D;  1LGR A;  2KC1 A;  3U30 A;  1M94 A;  3RNE C;  3Q8C A;  1LFD A;  1V9J A;  3AED B;  2ZW1 A;  2NVU I;  3J9C A;  1NBF C;  4PS3 A;  4GMV A;  2FUG 1;  2KVR A;  4ASW C;  1SBB B;  1EU4 A;  2KWU B;  2AEH A;  2EMT A;  2WYQ A;  2KN4 A;  1JRP A;  3AE4 B;  2IJ0 A;  3VTU A;  4A90 A;  1WX9 A;  4R3D A;  3H6N A;  4KX6 B;  3ECI A;  1YNT E;  5DPS A;  3ZTD A;  4AUQ C;  3NJT A;  1WGG A;  2GLS A;  2AYO B;  5E6N A;  3HVZ A;  1WR1 A;  1ZOY B;  1L2N A;  2NCN A;  2MJD A;  3CST A;  5EE0 A;  4A9A A;  3N9Y C;  1YQ4 B;  2BGF A;  2KWV B;  3AEF B;  3ZNG C;  2ZNV B;  2IGG A;  2V9H A;  2V4L A;  4RH6 A;  2M0X A;  3Q14 C;  1C1Y B;  5E6O A;  3TEY A;  2LI5 A;  1MHH E;  4ZRP A;  2XN9 C;  2X8X X;  1L0V B;  2OHF A;  1K53 A;  2FNJ B;  1FMA D;  1U4A A;  3W1S A;  3AU4 A;  1HTO A;  2KJH B;  3TEX A;  3NVW A;  1HTQ A;  4JLC A;  3IAM 1;  3B9J A;  2PVO D;  2IYD B;  2LWP A;  5H8Y E;  4W9H A;  5E6P A;  3B08 A;  2IO2 B;  2Z0E B;  2MH7 A;  3QAR A;  3I3T B;  1VR9 A;  1QIL A;  4P7I A;  4MEL A;  4W9D A;  1KLV A;  1WIA A;  3MC8 A;  4ZRK A;  1P3Q U;  3HUI A;  4RGN A;  3OG5 A;  3Q3N C;  2IDY A;  1UH6 A;  2LZ6 A;  2JT4 B;  2RD0 A;  3QC8 B;  1ZXI A;  1MVK A;  2V3P A;  3WAM A;  2LUM A;  4A3P A;  1ZW7 A;  1GB1 A;  1E90 A;  2KN5 A;  1AWD A;  1T6B X;  4XWT A;  1ZDV A;  4G11 A;  3M95 A;  2M8S A;  1BML C;  2LVQ A;  1C76 A;  2MX2 A;  1F2R I;  1V86 A;  1C3T A;  3ZUN A;  2EKI A;  1F9J A;  4KZC A;  3P4P B;  1YX6 B;  2WQY B;  3T3N A;  4DQO C;  3NY5 A;  3TSS A;  1N5W A;  2JWZ A;  2KX0 A;  4B9K A;  5TSS A;  4K81 A;  2IO3 B;  2M56 B;  3ML8 A;  3Q3M C;  2ON8 A;  3QIJ A;  3KLS X;  5D3I B;  2QDF A;  2GBR A;  2RPQ A;  4TUU A;  2L0F A;  4BVU C;  3FAH A;  4DHJ B;  1FXI A;  1C78 A;  3HK0 A;  2G4D B;  1WXM A;  2DZM A;  4OZC A;  2G4S A;  5HFY A;  2Q5W D;  1Q10 A;  1WZ3 A;  1RRB A;  3BY4 B;  4RGO S;  2HD5 B;  4WWO A;  2R2O A;  3V6C B;  4TSS A;  3U52 E;  3WAN A;  5D7G A;  3AE9 B;  3DVN U;  3QJZ A;  4KSL C;  3SR6 A;  2WXJ A;  3IHP C;  4J3O D;  1DGJ A;  2IGH A;  3IT4 B;  3BK1 A;  3L54 A;  1QKZ A;  3KYC D;  3B1L X;  2HE7 A;  3EHV A;  3V6E B;  1FCC C;  2E6X A;  2GBJ A;  4MGI E;  3NZS A;  1L7Y A;  4WWP A;  3EFU A;  5D94 A;  4FHJ A;  2R2Q A;  4G50 A;  1XT9 B;  4W9C A;  1JWM D;  2ZVN A;  2YLM A;  1EU3 A;  1D5X C;  3R66 C;  1JW9 D;  1HE8 A;  1ZXH A;  4ZRQ A;  2X38 A;  3RZW C;  2MSE D;  4MH0 E;  2LUE A;  3LB8 C;  2XBB C;  1TTN A;  3NVV A;  1ZKH A;  2PE6 B;  2BKF A;  3L16 A;  5BMG A;  3AE2 B;  4GXB A;  3QK0 A;  3DVG X;  2V3S A;  2K8H A;  2CHX A;  2NBU A;  1C4P A;  4YL8 A;  4AP4 C;  4URK A;  4EKU A;  1KRH A;  2DYB A;  5C1Z A;  2KDM A;  2D3G A;  3E9S A;  2W9N A;  3JW0 X;  2RDH A;  1CQV A;  1WSP A;  3H8H A;  3R2T A;  4LK0 M;  3ZTC A;  1MI0 A;  3VDZ A;  1L6V A;  1VD2 A;  3PZD A;  1MFW A;  2KTF A;  3APF A;  3P63 A;  3NVZ A;  2XK5 B;  5CHV C;  2MRP A;  4L1B A;  4ANW A;  1L4D B;  3TEW A;  3PGE A;  2L0T A;  2N9K A;  2RR9 A;  1QT9 A;  2ZNV C;  1WMH B;  2KQ4 X;  3VQI A;  4AWJ A;  1D3Z A;  1P1A A;  2CU3 A;  3DPD A;  2MHJ A;  4PS8 A;  3AH7 A;  2CHW A;  1WJ6 A;  4MM3 B;  1KOT A;  4M0W B;  1J7B A;  3RPF C;  3Q8B A;  2L8J A;  1JRU A;  4RMA A;  5HKH A;  1XLN A;  1WFY A;  4XDC A;  4FJZ A;  4NJ7 A;  4TV3 A;  3AU5 A;  2ZCB A;  3HM3 A;  2DZJ A;  3C8Y A;  4LCD E;  4YTN B;  4PYU A;  3OAW A;  3Q3J A;  2N7E A;  5JZE B;  1D5Z C;  4RGT A;  2L32 A;  2WHI A;  4USA A;  3AE5 B;  2MBB B;  3U2S C;  4KDI C;  3N1X C;  2SAK A;  4RNA A;  4OW0 A;  5D6J B;  1XXG A;  3RMK C;  2YEP B;  2C7M B;  3ZVV A;  2KX3 A;  2WDV B;  3DWG C;  2IBI B;  4C4V B;  1F1H A;  1SJE D;  2N1V A;  4I6P A;  3SEB A;  4OHJ A;  3TL5 A;  1P9D U;  3NZU A;  5T8I A;  3I5J C;  1UD7 A;  1DOY A;  1GG3 A;  1PQS A;  4MDK E;  1FM0 D;  5G5H A;  4NAW B;  2AQ1 B;  2UYZ B;  1T0Q C;  1WGK A;  3PLU A;  4WUR A;  2Y3A A;  2KLC A;  2K0P A;  2BQQ A;  2HTH A;  3W2D A;  5DCN A;  1N6Z A;  3X23 A;  2XK5 A;  2GOW A;  4A8X C;  4ZHP A;  2D10 A;  1WGD A;  4KSK C;  1UWX A;  1SB3 C;  1WJN A;  2BS3 B;  3AI5 A;  2WXH A;  5L95 C;  1WJ4 A;  1WMH A;  1V81 A;  2NBV B;  1ENF A;  1WYW B;  2RPV A;  1JWA D;  1RAX A;  2CU1 A;  2ASQ A;  1SEB D;  2GB1 A;  4MM3 A;  2JQR B;  4I6N B;  4M0W A;  2K8B A;  5CX3 A;  4OVZ A;  1HZ5 A;  2O6V B;  3WCQ A;  1HQR D;  1K50 A;  4M8N A;  3AE8 B;  3O13 A;  3QCA A;  4XDD A;  1UWM A;  4GDL B;  4CO7 A;  4HCN B;  2GBK A;  1QZE A;  3CIR B;  2HDE A;  1JML A;  2CJO A;  1V97 A;  1Q0W B;  1J19 A;  2V4I B;  4LNF A;  3ZDM C;  3TCA A;  3M3J A;  4W9F A;  3L13 A;  2IGD A;  3PZ7 A;  2ZCC A;  1B1Z A;  2AWT A;  2N7J A;  2MBQ A;  3BYY B;  4LNI A;  4UDU C;  2D07 B;  4HXD A;  3VUY A;  4ICV A;  2JVC A;  1V1O A;  3W1Y A;  2C7H A;  4DHJ D;  2KQ7 A;  3VRB B;  2LFI A;  4W9E A;  1SE9 A;  2LJI A;  3K9P B;  1YX5 B;  3PTF C;  1WF9 A;  2L05 A;  3BIN A;  3DBR B;  4HVB A;  4C00 A;  2V0G A;  2M17 A;  2AL3 A;  5AZF A;  4BOZ B;  3ZJV A;  1TBE A;  2KKC A;  4LNK A;  1YN5 A;  3NVY A;  3L0W B;  3CWI A;  3WIM A;  2FE8 A;  2BKR B;  5KHO A;  5AUK A;  3AM9 A;  3KW5 B;  4TQ1 A;  3X0W A;  5BO4 B;  5IKC M;  1XLP A;  2UWQ A;  3ZNI D;  4GU2 A;  2V1Y A;  1S3S G;  3GB1 A;  4K7W A;  4NAW A;  1C4C A;  2BW2 A;  4AQ7 A;  2KMM A;  1OEY J;  3Q6B A;  3RCZ A;  2MEK A;  2WXG A;  3NRZ A;  3SFD B;  3W5V B;  2PPH A;  1QOG A;  5DPW A;  3KQ4 A;  1SE3 A;  1YMH E;  1XF5 L;  1YIW A;  3ZQ4 A;  1JWU D;  1OTR B;  2DNF A;  1YN3 A;  3SDL C;  1KF6 B;  3A4R A;  2SEB D;  3WA0 A;  2BF8 B;  1I7H A;  5L83 A;  2FID A;  2IZV B;  4YSX B;  2N9E B;  2O6V A;  3NOB A;  3WAO A;  5DPT A;  5BMH A;  2BBC A;  1MHX A;  2Y5C A;  2JYE A;  4GDL A;  2BVC A;  1WY8 A;  4JQW C;  2KVZ A;  3Q8E A;  2JYT A;  3VAW A;  1TS3 A;  2L1A A;  2R61 A;  2M19 A;  4P16 A;  3LYY A;  2LEK A;  1T0R C;  4LLG M;  4HDQ A;  1HZ6 A;  2A4Z A;  2G3Q B;  4DBG A;  1UGJ A;  2TSS A;  3AUL A;  1B9R A;  4M02 A;  1HEZ E;  4YTP B;  2LGD A;  3Q8A A;  2VH2 A;  4B95 A;  1T3Q A;  3MJ5 A;  4DHZ E;  3PRZ A;  4W9G A;  3PPA A;  1V2Y A;  4WIP A;  5AUI A;  5J2R A;  1QOA A;  1Q5W B;  2PJH A;  4XGA B;  2AL6 A;  4KGR A;  2EEL A;  5LXI B;  1NVI D;  3IVF A;  1TKE A;  1WYG A;  1E6E B;  1D6E C;  2XEW A;  1I4P A;  1Z5S B;  5HG2 A;  4HEA 1;  4C7Y A;  3LJ3 A;  4BKG A;  1NYR A;  3DCG A;  2L7R A;  3ZXR A;  4EZL A;  3DVG Y;  3ETR A;  4LJP B;  5LNK 1;  3HM6 X;  1XCT L;  1EUV B;  5BYQ A;  1OQY A;  3DBH B;  3VUX A;  2WDQ B;  4FHK A;  2W54 A;  2JF5 A;  4LNO A;  1I4H A;  1OGW A;  2AQ3 B;  1E7P B;  1R4N B;  3P2B A;  4S17 A;  1WJU A;  4W9K A;  4S0R A;  3Q3F A;  1TIF A;  1NEK B;  5FKA C;  4A55 A;  1WI0 A;  4MSM B;  4QAY A;  1PYW D;  5FR6 A;  3U8Z A;  4JL9 A;  1ZUD 2;  3A9J B;  1JRO A;  4NZL B;  2J7Q B;  4EZJ A;  3AMZ A;  2WXF A;  2WXK A;  4BZA A;  3RNA C;  1YQB A;  2JRI B;  5I4D A;  3ZYY X;  1XEE A;  3IBE A;  2LGX A;  1J7C A;  4TKN A;  3GZN I;  1QLB B;  2INC C;  1DOI A;  3VHT C;  2ZPY A;  3HRD D;  4US8 A;  2M4N A;  4EE2 A;  1F52 A;  2W82 A;  3ONS A;  1PUT A;  1AYF A;  4A6Q A;  2IO0 B;  5DPR A;  3R7Q A;  2RGF A;  3PV1 A;  3AV8 A;  1MG8 A;  1SGH A;  3ABV B;  4W9J A;  3ZRC A;  5KHQ A;  2MBH A;  2WXN A;  2WXL A;  2N9P C;  3AE6 B;  3KWL A;  2K25 A;  2DYO A;  2JUO A;  1NI2 A;  4FBJ B;  2NR2 A;  4RCO A;  1Z2M A;  2O6V D;  3ZGZ A;  2D2Q A;  4B0M A;  3QX1 A;  3P4R B;  2DLB A;  3VUW A;  1I4R A;  2PEA A;  1V5O A;  3KYD D;  1NDD A;  2JWU A;  1WGR A;  4IWO A;  2VRR B;  3MP9 A;  4NQK E;  4ZHO A;  1EM7 A;  4ARC A;  3W9C B;  2NS5 A;  1GJZ A;  2MLB A;  5EE1 A;  2OOB B;  2D11 A;  4E3C A;  3Q2A C;  3ZRF A;  2D5G A;  1WM3 A;  4KZ0 A;  4OVV A;  4LDT B;  2LMC A;  4IM3 A;  2LVO A;  4DDI D;  3I9V 1;  2ONQ A;  3V61 A;  4CHK A;  4JGH B;  3JVZ X;  4PS7 A;  5AZG A;  4DDG D;  2LRU A;  2VH1 A;  2DAF A;  1ACC A;  1H4R A;  1L0X B;  3A9J A;  1WRI A;  4N6E B;  4FAD A;  1LQB A;  1QQR A;  1IGD A;  3EGR A;  1XO3 A;  1ZPS A;  4Q2J A;  3BZD B;  4CQN A;  3DQV A;  2W3S A;  4JE3 B;  1LO5 D;  3GS2 A;  3RFZ B;  1E8X A;  5BMI A;  3ZDT A;  2PW9 A;  2WP9 B;  1XCQ L;  5C3J B;  2N0S B;  3EA6 A;  3PHX B;  2J52 A;  5EE9 A;  4YSZ B;  4P6V F;  4FA6 A;  3ENE A;  3N20 C;  3P1M A;  3ZIM A;  3P4S B;  4YSY B;  3FKY A;  2ZJD A;  4IW0 A;  4WJN A;  2K1F A;  2ZW0 A;  1FCL A;  5GMV A;  2QMT A;  1K51 A;  5IP4 D;  4C80 A;  3JYU A;  4GDK B;  2D3B A;  2WWZ A;  3W5U B;  3AXC A;  3DDC B;  1R4M I;  1ROE A;  3VH3 B;  1GPX A;  1SJH D;  2ZEQ A;  4AOF A;  2BTE A;  3AE3 B;  2FCQ A;  2WU2 B;  2IND C;  1E7V A;  4KIK B;  1FEH A;  1SSN A;  3A1Q B;  1BUI C;  1RFK A;  1YJI A;  5HI1 A;  3T8M A;  4ACF A;  2ZVO A;  3H1U A;  1IP9 A;  2INP E;  1GAQ B;  4NPN A;  4DXF A;  2N1W A;  1CZP A;  1TY2 A;  4YWG G;  1IYF A;  2QCZ A;  4IC7 B;  1WR6 E;  1SF0 A;  2C9W B;  3H7P B;  3MJW A;  4BBN C;  1P7E A;  3PLV A;  1E9M A;  2WDT B;  4NQL B;  2IY0 B;  4TQ0 A;  5FR3 A;  1I35 A;  2CHZ A;  2H88 B;  3AN1 A;  5CHF A;  3RNG C;  4KGT A;  1YD8 U;  2L52 A;  4JIO U;  5JHB A;  1A5R A;  1ZGU B;  4HKZ E;  3M62 B;  2LJ5 A;  2IPK D;  1A70 A;  1D5M C;  3M63 B;  5IO9 A;  2JX5 A;  3VR9 B;  1L5P A;  1TGZ B;  1XD3 B;  3B2F A;  4ANV A;  4E71 A;  2DAJ A;  2HTM E;  4NY0 A;  4IWP A;  3WAL A;  1WXS A;  2I38 A;  1X1M A;  3U4E G;  3DHI C;  5MPO A;  3NG0 A;  2KDE B;  3A4S C;  3I63 C;  4GGQ A;  1TS4 A;  2C7N B;  3BII D;  1Y56 A;  2J0K A;  4IUM B;  3A9K B;  2LGY A;  3D32 A;  1WE7 A;  4WJP A;  2CJN A;  2KFJ A;  1SXT A;  2JXX A;  2DEN B;  2FCS A;  4GDK A;  3SFE B;  1ET6 A;  3MC0 B;  2J4X A;  4FJY A;  3AEA B;  2QJL A;  1FRR A;  2ZZP B;  3UIO B;  2OJR A;  4WJQ A;  1V1P B;  1YJJ A;  4FJV B;  4II2 B;  2E3T A;  1UZX B;  2YVC A;  4MH8 A;  3RZF A;  3AEG B;  3RI7 C;  4FLH A;  5IAA C;  3VRA B;  2DWQ A;  4KIK A;  3R2I A;  4WAF A;  1I42 A;  4ZYS A;  3A1Q A;  2OED A;  3SHQ A;  3QA8 A;  3ZLZ A;  2KYW A;  4FUL A;  3TBL D;  1IBX B;  4PYZ A;  4ZRI A;  2LAS A;  2KZR A;  3VFK A;  4PK1 A;  3V62 A;  3ZW3 A;  1HXY D;  3DBL I;  3EEC A;  3H7S A;  4II3 B;  4RF0 A;  3T9L A;  4N59 A;  3VH4 B;  2L3Z A;  3L08 A;  2FIF A;  3AEE B;  2BYE A;  3NUH B;  3ZO5 B;  2JZ3 B;  3R7R A;  2W3R A;  1EO6 A;  1FNU A;  2REX A;  3AE1 B;  4DHZ B;  2MBO A;  1I4X A;  1BXT A;  2V3N A;  1WX8 A;  2A5U A;  2BS4 B;  1NEN B;  2FBW B;  4XX5 A;  4MEM A;  2LVP A;  1RFA A;  2G1E A;  2DX5 B;  4HRO A;  2DYM A;  1PGA A;  2O2V B;  2UU7 A;  3QHT A;  2WXI A;  3N30 A;  4IKG A;  2KTR B;  1WE6 A;  3OLM D;  4HPP A;  4C4V A;  3FIL B;  4LDT D;  4ANX A;  2Y5P A;  3NS1 A;  3A9K A;  3BVZ A;  2FCM A;  1N63 A;  2WXR A;  2QC8 A;  2EMS A;  4IM0 A;  1N61 A;  2HJ8 A;  3SD5 A;  2KO3 A;  2WLB A;  3N1Y C;  1OFF A;  4K3C A;  1RWS A;  1IUE A;  1TYG B;  1GUA B;  2MCN B;  3TJP A;  1TZO A;  4WWM A;  1Y8R C;  5IN7 A;  2K3U A;  1I4Q A;  1V1P A;  2KAJ A;  3ZXV A;  4NJC A;  2J42 A;  2LXA A;  4XWW A;  4G0N B; 
#chains in the Genus database with same CATH homology
 4WJO A;  4ZYN A;  2B3A A;  5D94 A;  1AAR A;  4FHJ A;  5CHW A;  2R2Q A;  4G50 A;  1XT9 B;  4FN2 A;  4W9C A;  2ZVN A;  2YLM A;  5FR6 A;  2JY6 A;  3QAQ A;  3U8Z A;  4JL9 A;  3R66 C;  3KVF B;  3ML9 A;  1HE8 A;  3A9J B;  3UQA A;  3RZW C;  4A3O A;  3VXW A;  2J7Q B;  2MSE D;  3QQ8 B;  4EZJ A;  3L10 B;  4MH0 E;  2LUE A;  2XBB C;  1TTN A;  1WXA A;  4F8C B;  3PHW B;  2NPT B;  2KDB A;  2KDF B;  1ZKH A;  2MA9 B;  1YQB A;  2JRI B;  2PE6 B;  5LLI A;  2BKF A;  2DZI A;  2FCN A;  3IBE A;  3L16 A;  1XQQ A;  4GXB A;  2PE9 A;  2LGX A;  3QK0 A;  3DVG X;  2V3S A;  3JSV A;  4TKN A;  5J18 A;  3OJ4 B;  2K8H A;  3GZN I;  2CHX A;  2NBU A;  4YL8 A;  5EDS A;  4MSQ B;  1J0G A;  2K6D B;  4AP4 C;  2QHO A;  3VHT C;  2G45 B;  2ZPY A;  5C23 A;  1CMX B;  4LJO B;  4URK A;  2M4N A;  4EKU A;  2Z0D B;  1UEL A;  1E7U A;  4HLE A;  2DYB A;  2C60 A;  4WWN A;  5C1Z A;  2D3G A;  3ONS A;  2KC2 A;  1WGH A;  2W9N A;  2GBM A;  3RD2 A;  2IO0 B;  3JW0 X;  5DPR A;  1WX7 A;  1WH3 A;  3R7Q A;  3H7P A;  3ZTC A;  2RGF A;  1E5W A;  3PV1 A;  1FXT B;  1MG8 A;  1SGH A;  2KD0 A;  3VDZ A;  3UQB A;  3C0R B;  4BKS D;  2EKE C;  4W9J A;  3ZRC A;  5KHQ A;  2MBH A;  1VD2 A;  1WM2 A;  2N9P C;  3PZD A;  4XZ4 A;  2K25 A;  2DYO A;  2JUO A;  1NI2 A;  2KTF A;  4DXA B;  2NR2 A;  3APF A;  4FBJ B;  2MWS B;  1WXV A;  2MP2 B;  1T0Y A;  2KAN A;  3EC8 A;  1Z2M A;  2O6V D;  2XK5 B;  5CHV C;  4EUT A;  2D2Q A;  2O2V A;  3QX1 A;  3VUW A;  2BPS A;  2MRP A;  3MTN B;  4ANW A;  3APD A;  2PEA A;  1V5O A;  3PGE A;  2L0T A;  2RR9 A;  3KYD D;  4NJ6 A;  1NDD A;  2K6Q A;  3QWZ B;  1WGR A;  2KTR A;  2WX0 A;  3OJ3 A;  4IWO A;  2KOX A;  2VRR B;  1WMH B;  2ZNV C;  3VQI A;  4K7U A;  4AWJ A;  1D3Z A;  4IG7 B;  1P1A A;  4NQK E;  3DPD A;  3UGB B;  2LRW A;  4CYE A;  2M1M A;  2BWF A;  2NS5 A;  4PS8 A;  3ZNH B;  1GJZ A;  3A33 B;  5TR5 A;  2JPH A;  4W9I A;  3ALB A;  4AJY B;  2KDI A;  2CHW A;  1WJ6 A;  1KOT A;  3KUD B;  4DWF A;  4M0W B;  2MLB A;  3V60 A;  2OOB B;  2D11 A;  1JRU A;  2L8J A;  4E3C A;  3ZRF A;  4RMA A;  5HKH A;  4XC2 A;  2I1J A;  1WFY A;  3RT3 B;  1WM3 A;  4KZ0 A;  2BWE S;  4FJZ A;  4OVV A;  4DK5 A;  4LDT B;  4NJ7 A;  3VTW A;  4IM3 A;  2LVO A;  4TV3 A;  4DDI D;  4MJS B;  4E74 A;  2L00 B;  3DBH I;  3AU5 A;  2ZCB A;  3HM3 A;  2DZJ A;  3V61 A;  3KH0 A;  1S1Q B;  4JGH B;  4LCD E;  4NNJ B;  3JVZ X;  4PYU A;  4PS7 A;  2IY1 B;  2Z59 B;  5AZG A;  4DDG D;  3OAW A;  3IFW B;  2LRU A;  1R4N I;  3Q3J A;  4CHK A;  2DAF A;  3U7D A;  2N7E A;  2J0M A;  3PSE B;  5JZE B;  1H4R A;  3A9J A;  1P0R A;  4HDO A;  3CF6 E;  2MBB B;  4MGK E;  4BKT A;  4FAD A;  1GC6 A;  1LQB A;  2IO1 B;  4KDI C;  1SIF A;  3DOW A;  1H8C A;  5J17 A;  5D6J B;  3UF8 A;  2NPT A;  3DQV A;  2C5L C;  2C7M B;  3ZVV A;  2KX3 A;  3TMP B;  3MHS D;  1E8X A;  4BBN F;  1EF5 A;  3ZDT A;  1UBQ A;  5JH5 C;  1V6E A;  2KK8 A;  2MBE A;  5IA7 A;  1GC7 A;  2IBI B;  5AZH A;  3PHX B;  3UIP B;  4K7S A;  2I1K A;  2N1V A;  4KDL B;  1VCB A;  4I6P A;  2K8C A;  2CKH B;  3ENE A;  2L76 A;  4WQO B;  3ZKJ C;  4FA6 A;  5G2N A;  3TL5 A;  1P9D U;  3ZIM A;  3NZU A;  1E8Y A;  4I6L B;  4HJK A;  1UD7 A;  4K1R B;  1GG3 A;  3DVN V;  2KWC A;  3L17 A;  1PQS A;  4MDK E;  2ZJD A;  4IW0 A;  3PT2 B;  4WJN A;  2JZZ A;  2BYF A;  4ZRJ A;  2K1F A;  4RM8 A;  4NAW B;  1UGM A;  2ZPN A;  2UYZ B;  5GMV A;  3KUZ A;  2KXJ A;  1V80 A;  3WAP A;  3PLU A;  4MGY E;  2KLC A;  2MP2 A;  2HTH A;  3N3K B;  5DCN A;  1LM8 B;  3JYU A;  5G55 A;  3X23 A;  2XK5 A;  2GOW A;  4GDK B;  2WWZ A;  1WZ0 A;  4KVG B;  5AEK B;  4IWQ A;  3UIN B;  2D10 A;  3AXC A;  3PRM B;  1WGD A;  3DDC B;  1R4M I;  4KSK C;  1WJN A;  3AI5 A;  4OVU A;  3VH3 B;  5L95 C;  2MW5 A;  1WJ4 A;  2DHZ A;  2KFK B;  1WMH A;  1V81 A;  1K8R B;  2NBV B;  2K39 A;  1WYW B;  2ZEQ A;  2NBW B;  1EF1 A;  1RAX A;  2CU1 A;  3PS6 A;  2MQJ A;  2ASQ A;  1G6J A;  4WAA A;  4MM3 A;  4AOF A;  4I6N B;  4RM9 A;  2FCQ A;  3K9O B;  2K8B A;  5CX3 A;  4AJW A;  1V49 A;  2O6V B;  4F7Z A;  3DBS A;  1E7V A;  4ICU A;  4KIK B;  3VTV A;  4M8N A;  4HWI B;  1IPG A;  5JHA A;  4ZDV A;  3A1Q B;  2KMC A;  3QCA A;  2DZK A;  4GDL B;  3APC A;  4CO7 A;  4HCN B;  2GBK A;  3RUI B;  3T8M A;  4EOY A;  2ZVO A;  2GBN A;  3H1U A;  1IP9 A;  1QZE A;  2J0J A;  2N4F A;  2FAZ A;  3CMM B;  3IG3 A;  4MJS A;  4NPN A;  3RUL A;  2N1W A;  2KC1 A;  3U30 A;  1Q0W B;  1J19 A;  1KJT A;  1M94 A;  3ZDM C;  3H9D A;  3TCA A;  1IYF A;  4A20 A;  3M3J A;  4W9F A;  3L13 A;  4IC7 B;  4IM2 A;  1LFD A;  1WR6 E;  1V9J A;  1BT0 A;  2C9W B;  2ZCC A;  2NVU I;  3H7P B;  1NBF C;  3MJW A;  2AWT A;  4PS3 A;  4B6W A;  4BBN C;  3PLV A;  4GMV A;  4GN1 A;  2MBQ A;  2KVR A;  2GMI C;  2WDT B;  2D07 B;  4HXD A;  4ASW C;  3VUY A;  4NQL B;  2IY0 B;  4ICV A;  2JVC A;  4TQ0 A;  2N7D A;  4BOS C;  2KWU B;  1I35 A;  2CHZ A;  2Y5B B;  3W1Y A;  2C7H A;  4DHJ D;  2KQ7 A;  2AEH A;  2EMT A;  5CHF A;  2WYQ A;  4GOC A;  3NHE B;  1LXD A;  2KJR A;  4W9E A;  1SE9 A;  3K9P B;  1YD8 U;  4JIO U;  5JHB A;  3VTU A;  1A5R A;  4N9F 4;  1WX9 A;  1ZGU B;  3M62 B;  1YX5 B;  2LJ5 A;  3H6N A;  3PTF C;  1WF9 A;  3ECI A;  2L05 A;  4MSM B;  3S2A A;  1J8C A;  3M63 B;  5DPS A;  3ZTD A;  3BIN A;  4AUQ C;  4HVB A;  1WGG A;  4GSW A;  2M17 A;  2AL3 A;  3RYT A;  1GNU A;  5AZF A;  2AYO B;  4BOZ B;  1TGZ B;  4GB9 A;  1TBE A;  5E6N A;  4KV2 A;  1XD3 B;  4G3X B;  4ANV A;  2KKC A;  4E71 A;  1WR1 A;  2BYV E;  2DAJ A;  4NY0 A;  1L2N A;  4HPL B;  4IWP A;  3WAL A;  1WXS A;  1X1M A;  2NCN A;  3L0W B;  3CST A;  3WIM A;  2KDE B;  3A4S C;  4X57 B;  3N32 A;  2BKR B;  5KHO A;  2BGF A;  2KWV B;  3KW5 B;  4TQ1 A;  3X0W A;  3W1S C;  5BO4 B;  2ZNV B;  3ZNG C;  2UWQ A;  3ZNI D;  2V1Y A;  4GU2 A;  1S3S G;  3KUC B;  4GGQ A;  2C7N B;  4K7W A;  4NAW A;  2J0K A;  2V4L A;  4IUM B;  3A9K B;  2M0X A;  2LGY A;  3D32 A;  1WE7 A;  1RLF A;  4WJP A;  2KFJ A;  1OEY J;  2JXX A;  1C1Y B;  5E6O A;  2LI5 A;  3NS8 A;  3RCZ A;  2DEN B;  2FCS A;  4GDK A;  3ZNZ B;  2PPH A;  2FNJ B;  5DPW A;  1U4A A;  4EZK A;  4FJY A;  3W1S A;  3AU4 A;  1YIW A;  4F1S A;  2KFK A;  2KJH B;  4HK2 A;  2KMA A;  2ZZP B;  4JLC A;  1OTR B;  3R3M A;  3UIO B;  2OJR A;  3SDL C;  4BKS A;  2IYD B;  3A4R A;  2LWP A;  3B0A A;  4WJQ A;  4FJV B;  4II2 B;  4W9H A;  3WA0 A;  5E6P A;  3B08 A;  2IO2 B;  2Z0E B;  3QAR A;  2BF8 B;  3VVW B;  3I3T B;  5L83 A;  1UZX B;  2FID A;  2IZV B;  2YVC A;  3RZF A;  4HPM B;  4P7I A;  4MEL A;  2N9E B;  4FLH A;  4W9D A;  2O6V A;  5IAA C;  1KLV A;  3NOB A;  1WIA A;  4ZRK A;  4KIK A;  3WAO A;  1P3Q U;  1I42 A;  5DPT A;  1UH6 A;  3A1Q A;  2LZ6 A;  3HHM A;  3SHQ A;  3QA8 A;  2JT4 B;  2RD0 A;  4GDL A;  3QC8 B;  3ZLZ A;  4FUL A;  3TBL D;  1WY8 A;  4JQW C;  4PYZ A;  3LDZ E;  4ZRI A;  2LAS A;  3WAM A;  2KZR A;  2LXC A;  3VAW A;  3VFK A;  3O65 B;  4A3P A;  1ZW7 A;  1E90 A;  3V62 A;  2KN5 A;  3ZW3 A;  3DBL I;  3EEC A;  3H7S A;  4II3 B;  3T9L A;  3CSF A;  3VH4 B;  2L3Z A;  4G11 A;  2LD9 A;  3M95 A;  5LXH A;  4EEW A;  2M8S A;  4HCP B;  2LVQ A;  3L08 A;  4HDQ A;  3JSV B;  2A4Z A;  2G3Q B;  4GIV A;  2MX2 A;  1V86 A;  2FIF A;  2BYE A;  5CTR C;  1P98 A;  3ZO5 B;  4DBG A;  2JZ3 B;  3R7R A;  1C3T A;  2KLG A;  1E8W A;  1Q1O A;  3ZUN A;  1F9J A;  1EO6 A;  4KZC A;  2REX A;  4DHZ B;  3AUL A;  5D2M B;  2LGD A;  2MBO A;  4W9L A;  1YX6 B;  4B95 A;  3NY5 A;  4DHZ E;  1WX8 A;  2A5U A;  2FUH B;  2WX1 A;  2JWZ A;  2KX0 A;  4B9K A;  3PRZ A;  4EFO A;  3SU8 X;  2N9X A;  4K81 A;  2IO3 B;  3ML8 A;  4W9G A;  3PPA A;  4J6I A;  3QIJ A;  1ISN A;  2CS4 A;  1WRD B;  2KQS A;  4MGZ E;  4XX5 A;  1V2Y A;  3GOE A;  2GBR A;  4M8M A;  2RPQ A;  4MEM A;  4ANU A;  2LVP A;  5J2R A;  1RFA A;  4TUU A;  2DX5 B;  2L0F A;  3HIZ A;  4BVU C;  3PRE A;  3DBR I;  4DHJ B;  1Q5W B;  2DYM A;  3HK0 A;  2O2V B;  2G4D B;  2PJH A;  1OEY A;  1WXM A;  2KNB A;  3PRP B;  3QHT A;  2AL6 A;  2DZM A;  3N30 A;  5LXI B;  3IVF A;  1KM7 A;  2G4S A;  2KTR B;  1WE6 A;  1WZ3 A;  3OLM D;  1RRB A;  1V5T A;  3BY4 B;  4LDT D;  4ANX A;  2HD5 B;  2XEW A;  4WWO A;  2R2O A;  1Z5S B;  3A9K A;  3V6C B;  3WAN A;  5D7G A;  2FCM A;  3DVN U;  3LJ3 A;  2EMS A;  2RSU A;  3QJZ A;  4IM0 A;  4BKG A;  4BFR A;  4KSL C;  2HJ8 A;  3DCG A;  3SD5 A;  2L7R A;  3PVL A;  4EZL A;  1E8Z A;  2KO3 A;  3DVG Y;  3IHP C;  4LJP B;  3HM6 X;  1EUV B;  1OQY A;  2CR5 A;  3L54 A;  3VUX A;  4FHK A;  1GUA B;  2MCN B;  3TJP A;  2KJ6 A;  1Y8R C;  3KYC D;  3B1L X;  2HE7 A;  2JF5 A;  3EHV A;  3V6E B;  1OGW A;  1TZ1 A;  1UBI A;  2GBJ A;  4MGI E;  3P2B A;  3NZS A;  3TIX A;  1WJU A;  1WGY A;  1L7Y A;  4W9K A;  2LXA A;  1YJ1 A;  3Q3F A;  4WWP A;  2JRH A;  3EFU A;  2KHW B;  4G0N B;  1WI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...