2BYFA

Nmr solution structure of phospholipase c epsilon ra 2 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
SSEEESFFVQVHDVSPEQPLTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOLIPASE C, EPSILON 1
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipase
total genus 20
structure length 116
sequence length 116
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2byfA01
1RAXA 3QA8A 3KUZA 4EKUA 2JXXA 1NDDA 3APFA 3IBEA 2W9NA 3UINB 2KFKA 2KDFB 1KJTA 4NAWB 1WXVA 2LI5A 1WE6A 4AJYB 4IWOA 3SD5A 2KNBA 3IHPC 3AULA 4W9LA 2PPHA 2IZVB 2KX0A 2N1VA 4KDIC 2KDBA 5CHWA 1TBEA 1XQQA 3U30A 3WALA 2KJ6A 2KFJA 2CU1A 5CX3A 3PRZA 3WAPA 3IFWB 3WIMA 2MBHA 2K6QA 3VH4B 1WR6E 3K9OB 4KIKA 1LM8B 3CSFA 2L0TA 3ZNZB 4GXBA 5G55A 4DDGD 2RSUA 3QX1A 1IYFA 5DPSA 4FJYA 3KUDB 2IO3B 1K8RB 2BF8B 4HXDA 4IM3A 3OJ3A 4E71A 3QHTA 2LJ5A 2UYZB 3PRMB 2G4DB 4HK2A 2OOBB 2V3SA 1WX8A 1WXMA 3LDZE 3N32A 2AL6A 1IPGA 3PSEB 4G0NB 4HWIB 3LJ3A 2KN5A 1V6EA 4G3XB 2BYEA 2RD0A 5JHBA 1RFAA 4MM3A 1WX7A 1X1MA 2A5UA 2JT4B 4A20A 1WI0A 2KANA 4GN1A 3C0RB 5DCNA 4HVBA 4ZDVA 2AEHA 5JHAA 3HM6X 3QK0A 2FCSA 3DBLI 2JRHA 2KDEB 3H7PA 3PREA 5J18A 4HJKA 2CR5A 2MP2A 2KC1A 3VTWA 2GBRA 2DYOA 3VVWB 4RMAA 2ZJDA 4JL9A 4B6WA 4TKNA 4E3CA 2KLCA 2I1KA 4FHKA 3DVNU 1WXSA 1GJZA 3RZWC 5D7GA 1H4RA 2KQSA 2R2OA 1BT0A 1LXDA 2REXA 4M8MA 4MGZE 3AI5A 4M0WB 4G50A 1P98A 2C7MB 3W1SA 4MDKE 4A3OA 1UH6A 5AZGA 3SHQA 2G3QB 1WYWB 4AOFA 2FIDA 1NBFC 2XK5A 3ZO5B 2JRIB 3KYDD 2HTHA 4DHZB 2Z0EB 3APCA 4RM8A 2DAJA 4ZRJA 3TCAA 3KUCB 4W9EA 4HPLB 4EZJA 1G6JA 3U8ZA 1V2YA 4WWNA 4BOSC 1V81A 2KJRA 3ML8A 3JVZX 2JZ3B 4BBNC 4DDID 4J6IA 4W9GA 3BY4B 2ZZPB 3EC8A 4WJOA 4F7ZA 3A4SC 1V5TA 2KLGA 1E7UA 2MSED 2NBVB 3A9KB 4F8CB 1XD3B 2K1FA 2D10A 4LDTB 2KX3A 3DOWA 2BWES 2DZIA 4ANWA 1Z2MA 2KVRA 1YIWA 4E74A 2J0KA 5LXHA 4BVUC 5CHFA 2BYFA 4IUMB 3VDZA 2ZNVC 2J0MA 1LQBA 4XX5A 2MLBA 1SIFA 1RLFA 1WJUA 2M1MA 4TQ0A 3PTFC 3R7RA 3ZDTA 4HDOA 2FIFA 3HK0A 3TBLD 2KXJA 2N4FA 2PJHA 3OAWA 2O6VA 2LRUA 3VAWA 1SE9A 2CHWA 4GDLA 3V61A 2KTRA 2HD5B 2M8SA 3QARA 2GMIC 4K81A 2GOWA 2BGFA 3ENEA 3RT3B 1E8XA 2FCQA 4KIKB 1M94A 2BKRB 2KO3A 2WWZA 2L00B 3ZKJC 4LDTD 2K8CA 2LWPA 2PE6B 3QCAA 4RM9A 4WJQA 2L3ZA 4IG7B 4P7IA 2I1JA 5E6NA 2LZ6A 4KSLC 4DHJD 1C1YB 2HJ8A 3RULA 2MRPA 5DPWA 4I6LB 1P1AA 1WZ0A 4NJ6A 2IO0B 4IM2A 1J8CA 3QQ8B 2B3AA 2UWQA 4TV3A 2AL3A 3KYCD 4HLEA 4II3B 2MW5A 3H7PB 5GMVA 4WAAA 2ZCCA 2YLMA 4MJSA 4FN2A 4EEWA 1XT9B 2MWSB 4WQOB 1YQBA 2LASA 1A5RA 2JF5A 4ICVA 2D07B 3B1LX 2DAFA 2Z59B 4BKSD 4EZKA 4URKA 2NBWB 1S1QB 2K39A 3IVFA 4ANVA 3DBSA 4EUTA 4KZ0A 1NI2A 2DZKA 3SU8X 4B95A 1F9JA 2J7QB 2NPTA 3TIXA 2MCNB 1OGWA 2XK5B 2DENB 2K6DB 2KJHB 3QJZA 2C7HA 2KHWB 2QHOA 4FJZA 2NS5A 3ZDMC 3QIJA 4K7WA 5C1ZA 1WGHA 1AARA 4PS3A 3A33B 1V49A 2LRWA 2NBUA 3VQIA 3CMMB 3PLUA 4IC7B 3UIOB 4K7SA 1E5WA 4GGQA 2ZVOA 3H7SA 5BO4B 1TGZB 2NCNA 5IA7A 1WJNA 4LJOB 3JSVB 1SGHA 4HDQA 2CHZA 3H6NA 3NHEB 1C3TA 2BKFA 4OVVA 2FNJB 1GNUA 3EFUA 3HHMA 5JZEB 3ZNGC 3DBRI 2WDTB 1D3ZA 4GU2A 2RR9A 1T0YA 3L0WB 2GBMA 4K7UA 1R4MI 1V5OA 2N9EB 1IP9A 2IO2B 3A1QB 3B0AA 4W9JA 2MBOA 1GC7A 1WF9A 3PS6A 4DHZE 2DX5B 1WIAA 3O65B 4ZYNA 3ZRFA 5DPTA 4MELA 2VRRB 5KHOA 1ZGUB 3KVFB 3M3JA 5IAAC 4GDLB 1HE8A 2JY6A 4IW0A 2RPQA 2KTRB 1P9DU 1WMHA 2IO1B 3DVGX 1L7YA 1P0RA 2K8HA 5D6JB 4FLHA 3UQAA 1KLVA 2BWFA 4XC2A 3OJ4B 5LLIA 1EF5A 1WJ4A 2M17A 3EECA 5E6PA 2NVUI 4AJWA 1V86A 3N30A 3DBHI 4I6NB 4NQKE 2L05A 1WR1A 3VXWA 3PHWB 5KHQA 2CS4A 4NPNA 3Q3FA 4KSKC 4F1SA 1J19A 2FUHB 1WX9A 3VFKA 3R7QA 4DWFA 1EO6A 2JZZA 1WY8A 4FJVB 3X23A 2GBKA 2LD9A 3R3MA 2KFKB 3CF6E 3NS8A 4W9FA 4N9F4 1LFDA 3ZNHB 2N7DA 3I3TB 1UBIA 2M4NA 2ZEQA 4JIOU 2C60A 3MTNB 4HCNB 3DDCB 4W9KA 5TR5A 3V6EB 3ZRCA 4MH0E 4JGHB 3APDA 1EF1A 5D94A 4CO7A 2BPSA 3N3KB 2FAZA 5AZFA 2N1WA 1E90A 4FHJA 2DYMA 5AZHA 4EFOA 4ANXA 2HE7A 4W9IA 3VTUA 4MJSB 1Q5WB 2ZVNA 4GDKA 4A3PA 1L2NA 1I42A 3ZVVA 4KVGB 2L7RA 3U7DA 2LUEA 1WE7A 4HCPB 3RUIB 3WA0A 4CHKA 4BFRA 3PT2B 2AYOB 3UGBB 3L08A 3MJWA 1WZ3A 1WRDB 2G45B 2V1YA 2V4LA 3DPDA 4ASWC 1CMXB 2WX0A 3HIZA 3ML9A 4OVUA 4WWPA 3HM3A 1WFYA 5J2RA 1V80A 2G4SA 3DVNV 2O2VA 1QZEA 2WX1A 3NY5A 3R66C 1U4AA 5LXIB 3ONSA 4LJPB 1KOTA 2N9PC 1TZ1A 1Z5SB 3A9JA 2IY0B 3OLMD 4ZRIA 2KD0A 4DXAB 2LGXA 2C7NB 1I35A 3IG3A 1E7VA 4BOZB 4MGIE 1ZKHA 1JRUA 4IWQA 2MP2B 2JWZA 3L16A 4IWPA 5FR6A 2FCMA 2ZCBA 3VUWA 3ZW3A 5E6OA 2JUOA 3ZLZA 4DHJB 3SDLC 4YL8A 1R4NI 3W1SC 2KZRA 3Q3JA 3D32A 3M63B 4XZ4A 2LXAA 3ZIMA 2XBBC 3L13A 2PEAA 2KWUB 1YD8U 2MBQA 2OJRA 3PHXB 4AWJA 5EDSA 1YJ1A 2JPHA 3QC8B 5DPRA 1GC6A 1WGGA 3DVGY 1MG8A 2KKCA 3DCGA 4IM0A 4M8NA 2ASQA 3JW0X 3ZNID 2MBEA 4JQWC 3BINA 5G2NA 4KZCA 1OQYA 3V6CB 1UGMA 3UIPB 4II2B 2ZPNA 3ECIA 4MEMA 2KWCA 4NNJB 2LGYA 4WJNA 3RYTA 3TMPB 4NJ7A 2CHXA 4PS7A 3PZDA 3UF8A 4BKSA 4I6PA 2EKEC 4AP4C 2L8JA 4B9KA 2LVOA 4K1RB 1WMHB 3WAOA 3JYUA 2KQ7A 1WGRA 3RZFA 1VCBA 3M95A 4NAWA 4WJPA 4EZLA 2DZMA 2C5LC 2MBBB 2N7EA 5JH5C 1WH3A 2LVQA 3PGEA 2M0XA 2LGDA 1VD2A 5CHVC 2EMTA 4BKTA 3QWZB 3B08A 3PRPB 2PE9A 3X0WA 3W1YA 2ZPYA 3A4RA 2DYBA 4W9DA 2MA9B 3L10B 4GB9A 4NQLB 3V62A 4GIVA 1UD7A 3DQVA 3NOBA 1Q0WB 2KK8A 4DK5A 2N9XA 1V9JA 4CYEA 2D3GA 1P3QU 1UBQA 4BBNF 5CTRC 1J0GA 1GG3A 4HPMB 2O6VB 2Z0DB 2KMAA 3P2BA 3L17A 2D2QA 1EUVB 3GZNI 5D2MB 4FA6A 5L83A 3QAQA 2Y5BB 4KV2A 4GDKB 2J0JA 2R2QA 2IBIB 4X57B 3VUXA 3WAMA 1FXTB 4NY0A 4JLCA 3CSTA 3KH0A 1YX5B 2DZJA 4PYZA 4WWOA 3UQBA 3VUYA 2LXCA 4EOYA 1E8ZA 2KWVB 1Q1OA 3PPAA 3VTVA 4MGKE 4W9CA 1S3SG 2K25A 4MSMB 4W9HA 4FADA 2GBJA 5C23A 2O2VB 3S2AA 1WGDA 1WM3A 3PLVA 2XEWA 2RGFA 2CKHB 4DBGA 2DHZA 4GSWA 4AUQC 2BYVE 3A9JB 1PQSA 2KDIA 2IY1B 2WYQA 2NR2A 4G11A 4LCDE 1OEYA 4KDLB 2O6VD 2MQJA 3MHSD 4MSQB 3JSVA 3RD2A 3T9LA 3KW5B 1E8YA 4ICUA 1GUAB 3K9PB 1WM2A 1OTRB 2AWTA 4PYUA 1UELA 2GBNA 1WXAA 1OEYJ 3AU5A 1Y8RC 5AEKB 3GOEA 3ALBA 1YX6B 3AU4A 3NZSA 3TL5A 4FBJB 1UZXB 2C9WB 3A1QA 3VHTC 3H1UA 1ISNA 3EHVA 3T8MA 4TQ1A 4GMVA 4GOCA 1ZW7A 2ZNVB 2EMSA 1TTNA 1RRBA 2K8BA 2L0FA 3AXCA 5J17A 2NPTB 2YVCA 3H9DA 2LVPA 3VH3B 2MX2A 2D11A 2KMCA 3ZTDA 5HKHA 3RCZA 3ZTCA 3NZUA 3A9KA 3M62B 4PS8A 4ZRKA 2A4ZA 2KTFA 4BKGA 4ANUA 3PVLA 5L95C 2L76A 1WJ6A 2FCNA 2KOXA 4FULA 4TUUA 3V60A 2IYDB 1KM7A 2JVCA 1WGYA 4MGYE 3TJPA 1H8CA 3L54A 3WANA 2KC2A 3PV1A 3ZUNA 1E8WA
chains in the Genus database with same CATH superfamily
3MC0B 2JXXA 1NDDA 4YSYB 2KFKA 1KJTA 4NAWB 1YNTE 2LI5A 2INCC 4W9LA 2IZVB 2KX0A 2KDBA 3U30A 2JWUA 3L4PA 3PRZA 3U4EG 1MVKA 3K9OB 1LM8B 1J7CA 1YJJA 2BF8B 4HXDA 3QHTA 1V1PB 2G4DB 2OOBB 4YSZB 1WX8A 3LDZE 3N32A 2AL6A 1FD6A 2KN5A 2BYEA 5JHBA 1C4AA 1X1MA 1FNWA 4GN1A 3QK0A 3H7PA 2XN9C 3ZQ4A 3HRDD 5HG2A 1IGCA 4HROA 2GBRA 3FILB 2ZJDA 2V3NA 2D3CA 1BMLC 3AI5A 3AEAB 2C7MB 3H8HA 1UH6A 1EM7A 1WYWB 1NBFC 2JRIB 4DHZB 2Z0EB 2DAJA 2WDQB 5D3DA 3NZ3A 4EZJA 1RYJA 1G6JA 3U8ZA 3ZGZA 2G1EA 4DDID 4J6IA 1XCQL 2KLGA 2MSED 1UGJA 1XD3B 3GZNB 1I4RA 4LDTB 1TY2A 3W5UB 1F2RI 2DZIA 1HTOA 1YIWA 2K5PA 2RDGA 2WXGA 4YTMB 5IP4D 2J0MA 2VH1A 2NTTA 3NJTA 3ZDTA 4ZHOA 2PJHA 4RNAA 2LRUA 1SE9A 4GDLA 2BGFA 3RT3B 1MI0A 2KO3A 1NYRA 3U52E 2LWPA 1VDVA 2PE6B 4RM9A 2LZ6A 4KSLC 4S0RA 3U7ZA 3RULA 2MRPA 5DPWA 3AMZA 4IM2A 2N0SB 2B3AA 4TV3A 3W5VB 4II3B 4YTPB 1B9RA 1XO3A 2WXJA 5GMVA 2ZCCA 4L23A 4EEWA 1TT5B 3T3NA 4WQOB 2DAFA 4LNIA 1HXYD 4ANVA 2GB1A 3SU8X 1F9JA 4RCOA 3TIXA 1QOBA 4OHJA 4RF0A 1WYGA 3QJZA 4FJZA 2QHOA 1ZUD2 3LXFA 2NS5A 3ZDMC 3QIJA 4ZHPA 2NMQA 1AARA 4PS3A 3UI3A 2QMTA 2LRWA 4IC7B 1TYGB 4K7SA 3AEBB 2WXPA 4GGQA 2ZVOA 3H7SA 4LLGM 3DWMA 5IA7A 4HDQA 2CHZA 2BKFA 1GB4A 3EFUA 2RR9A 3CWIA 4N58A 4K7UA 1V5OA 2N9EB 2PLPA 1IP9A 2IO2B 1SBBB 2ON8A 3DBLB 4YTNB 3ZXRA 4YSXB 2QJLA 2D3BA 1BUIC 3ZRFA 3GE3C 3M3JA 3KVFB 5IAAC 4IW0A 2RPQA 2KTRB 1WMHA 3E56A 1DYQA 5D6JB 1P0RA 3UQAA 1KLVA 1EWCA 2BWFA 4XC2A 1EF5A 1WJ4A 3EECA 1XLPA 2BS4B 4NPNA 3P4PB 3Q3OC 4DWFA 4A9AA 1T3QA 3X23A 3R3MA 3CF6E 1ZDXA 1B1ZA 1LFDA 1I4GA 1JW9D 5TR5A 4HCNB 3V6EB 2BPSA 2INPE 1VRAB 1E7PB 1VLBA 2N1WA 1NENB 2ACZB 4FHJA 1E6EB 1Q5WB 2ZVNA 5HHDG 3ZJUA 1PGBA 4M02A 4KVGB 4CHKA 3U7DA 4BFRA 1K53A 4K3CA 2AYOB 3MJWA 2G45B 1CMXB 3R2IA 3SR6A 3HM3A 3MC9A 1Q10A 2O2VA 1A70A 2WX1A 3R66C 2LEKA 4RGTA 5LXIB 4WWMA 4LJPB 4UDUC 3OLMD 4MH8A 2KWDA 2C7NB 2Y3AA 1ZKHA 1K52A 3B2GA 2JWZA 3L16A 4IWPA 3ZW3A 1WSPA 1WWTA 3FKYA 3WCQA 1WXQA 3NRZA 1R4NI 2MHJA 2B76B 2BQQA 4XZ4A 4AWJA 1YJ1A 1GC6A 2ZW0A 1XLNA 4M8NA 2ASQA 3ZNID 5G2NA 3V6CB 1UGMA 4II2B 4XGAB 3VR8B 2DBYA 3TMPB 4NJ7A 3UF8A 3PZDA 3IT4B 4RGOS 4M00A 3N9YC 1R4NB 2WS3B 2D3AA 2J4XA 1FRRA 1VZ8A 2DZMA 5JH5C 1WH3A 2EMTA 3QWZB 3PRPB 3W1YA 3A4RA 4W9DA 3V62A 3NOBA 4L2YA 4Q2JA 2BB6A 3TEYA 1NYQA 4CYEA 1E10A 1C77A 2O6VB 2KMAA 2RDBC 1ET9A 3L17A 1EUVB 5D2MB 5L83A 4FA6A 4ZYSA 2Y5BB 4KV2A 3AE3B 1T5XD 1JWUD 3HVZA 4NY0A 4JLCA 3KH0A 2JYTA 4WWOA 2DZJA 2SEBD 2LXCA 3TSSA 2W54A 4MGKE 3RNEC 3AEDB 4W9HA 4FADA 5EE0A 1QOAA 4B0EA 2XEWA 4GSWA 4LNOA 3A9JB 1I7HA 2NR2A 2R61A 4G11A 1XF5L 4LCDE 3RD2A 2L52A 3BVGA 1T0QC 3DHGC 1C4CA 4ICUA 1GUAB 3KWLA 3T3OA 4M0WA 4PYUA 1WXAA 3TEXA 4FBJB 1UZXB 2MJ3A 2C9WB 1I4HA 3VHTC 1WRIA 2Z8LA 1ZW7A 2ZNVB 2JX5A 3NVVA 2LGSA 3AXCA 2NPTB 3AH7A 2LVPA 5HKHA 2INDC 3M62B 4BKGA 2KTFA 1XCTL 2ONQA 4ZRPA 4KGTA 2IYDB 2M19A 1KM7A 3TJPA 3L54A 3KUZA 4EKUA 2INNE 5IN7A 3AV8A 2KDFB 2MJDA 1WXVA 1V1OA 4IWOA 3IHPC 3AULA 1IBXB 2PPHA 2N1VA 2EKIA 4H2AA 2N9KA 2KJ6A 3NUHB 2KFJA 2CU1A 3OG5A 5AUKA 2QCZA 3IFWB 2K6QA 3W2DA 3VH4B 2K22A 4KIKA 3ZNZB 2L0TA 1IYFA 5G55A 2RSUA 3DHHC 4FJYA 2VZKD 1QILA 2IO3B 3P4SB 1K8RB 3P1MA 4K3BA 4OZCA 3OJ3A 2UYZB 1YJIA 2FE8A 4J3OD 2IJ0A 3VRAB 2V3SA 3RFZB 1WXMA 4DHJD 3PSEB 1IPGA 2KACA 1TJEA 1AW7A 2RD0A 1D5ZC 2A5UA 4A20A 1WI0A 3MFGA 3C0RB 4HVBA 1MG4A 5J18A 2CR5A 3VTWA 3VVWB 1ESFA 2BT6A 4E3CA 1QOGA 2NTSA 1H4RA 1BT0A 2FBWB 4KKJA 1AWDA 1QF6A 1F52A 2XK5A 3ZO5B 1D4BA 2HTHA 1PYWD 5H92C 4HPLB 2PKOA 1TKYA 4BOSC 3ML8A 4BBNC 3EC8A 2ZZPB 1RM6C 4F7ZA 3A4SC 1E7UA 3P4QB 3A9KB 4F8CB 1SE4A 2D10A 1LO5D 2KAJA 2BWES 4ANWA 1Z2MA 4MACA 2J0KA 2K3UA 2KVZA 4BVUC 4KKIA 2WXOA 1SIFA 4TQ0A 3PTFC 2FIFA 1UWXA 1TZOA 2KXJA 5D3IB 2O6VA 4HKQA 2CHWA 3V61A 2Y5CA 4KX6B 2QSDA 2M8SA 2GMIC 4K81A 1M94A 1TS4A 2BKRB 4KGRA 4LDTD 3W9CB 3QCAA 1KFYB 2L3ZA 4P7IA 4NJCA 1C78A 3AE8B 1KLGD 4MM3B 2MW5A 2WXNA 2YLMA 3B2FA 1TS5A 2HDEA 4MJSA 3B9JA 1XT9B 2GLSA 2JU6X 4A6QA 2LASA 2SAKA 4MT5A 4ICVA 3Q69A 1SE3A 3IVFA 2WDRB 1MFWA 4EUTA 4KZ0A 1SEBD 2NPTA 4RGNA 3BWUD 1HA5A 2KHWB 1I4XA 2KYWA 1LGRA 3RNAC 1WGHA 4HKZE 1MHXA 3UIOB 1TGZB 2J53A 3BIID 3C8YA 4LJOB 4OVZA 1IBXA 2FNJB 1M4VA 5BMHA 5JZEB 3DBRI 4N59A 2DLBA 3BYTB 4LTUA 1DOIA 4AS1A 1KLUD 4W9JA 1GC7A 1WF9A 3PS6A 3EUB2 4ZYNA 2VRRB 4A55A 1ZGUB 1HE8A 3LB8C 1L7YA 5LLIA 2NVUI 1V86A 1STEA 2L05A 1WR1A 1JCKB 2DNFA 1ZDVA 3R7QA 1WY8A 2V0GA 1FIQA 3NS8A 3MP9A 2M4NA 4W9KA 3MTNB 3ZRCA 4JGHB 3APDA 5D94A 4CO7A 3SFEB 3N3KB 5JXVA 2DYMA 5AZHA 4EFOA 3NVWA 4A3PA 2YEPF 4HCPB 3PT2B 3UGBB 3L08A 4JPSA 2V4LA 3DPDA 2WX0A 3HIZA 1WFYA 5J2RA 1V80A 1YMHE 2G4SA 1QZEA 3BYYB 3NY5A 2LUMA 1KF6B 2N9PC 1Z5SB 4ZRIA 2KD0A 1DGJA 2OEDA 1I35A 4M01A 4IWQA 5E6JA 2MP2B 1VZ7A 5E6OA 4C4VB 2LFIA 5AUIA 4XDCA 3W1SC 3D32A 2LXAA 3ZIMA 2KWUB 4HRSA 5DPRA 1WGGA 1SJHD 3DVGY 3JW0X 2MBEA 5MPOA 3BINA 4DXFA 4KZCA 2LHDA 1DOXA 4ARIA 3KQ4A 5TSSA 1SXTA 1F1HA 1I4PA 3GB1A 1ENFA 1WGRA 4NAWA 2LVQA 2M0XA 1VD2A 2KDMA 4BKTA 2PE9A 1J7AA 2ZPYA 2MA9B 2QILA 1UD7A 5IKCM 1P3QU 4BBNF 1J0GA 4HPMB 2Z0DB 3U2SC 1GOZA 1ET6A 3I57A 3P2BA 4AQ7A 1V1PA 4WIPA 4QAYA 4N6EB 1PFDA 2LMCA 2V9HA 4GDKB 3Q2AC 4OZAA 2IBIB 4X57B 3WAMA 1FXTB 3BVZA 3PPAA 1S3SG 2GBJA 3AN1A 3S2AA 3PLVA 3IXSA 3FILA 2X8XX 4AUQC 2KDIA 4BAXA 2IY1B 4S17A 4IKGA 2O6VD 2WXMA 2RDHA 4USAA 3T9LA 3ZXVA 1OTRB 3N1ZC 3AU5A 1Y8RC 5AEKB 1VZ6A 1YX6B 3EHVA 3ZYYX 4GOCA 1QKZA 1TTNA 1FCLA 1RRBA 2E6XA 3Q3NC 3Q8AA 1L6UA 2YVCA 2D11A 2KMCA 3Q6BA 2V3PA 3RCZA 3NZUA 4PS8A 4ZRKA 2A4ZA 1QQRA 1SJED 1TKEA 4FULA 3V60A 1SF0A 2KN4A 4MGYE 3MC8A 1H8CA 1F0ZA 4JE3B 4ZRJA 3QA8A 3APFA 1ZE3D 1P7FA 2CJOA 4BZAA 3SD5A 2KNBA 2WXFA 4KDIC 1XQQA 4WH4A 3WALA 2J52A 5CX3A 3WAPA 4O1NA 1WR6E 3HUIA 3V05A 3CSFA 2KT7A 3QX1A 5DPSA 3KUDB 1N60A 4IM3A 4E71A 1YQ3B 3PRMB 4HK2A 4HWIB 3LJ3A 2N7JA 1RFAA 1WX7A 5EE1A 5I4DA 2JT4B 3DWGC 2KANA 4PT5A 4ZDVA 3HM6X 1HZ5A 2KDEB 3PREA 2MEKA 2IGGA 4YT0B 4HJKA 2MP2A 2KC1A 2N9LA 4RMAA 4B6WA 4TKNA 1FRDA 2KLCA 2K0PA 4XYCA 5BYSA 3ZJVA 3DVNU 1J7BA 2JYEA 1GJZA 2VH2A 2R2OA 2REXA 1C4PA 1EWYC 4MGZE 3W1SA 1P98A 4A3OA 3HVDA 1XEEA 2G3QB 2RMMA 4AOFA 3TEWA 5BMGA 3P63A 3APCA 3TCAA 2LJIA 1YQ4B 3KUCB 4W9EA 1V2YA 4WWNA 2BVCA 1V81A 4GLSC 2JZ3B 4W9GA 3I63C 1N61A 2K1FA 2Y5PA 1NVID 2QEJC 2W3SA 5LXHA 2H89B 3VDZA 1ZOYB 2ZNVC 4XX5A 2BBCA 1WJUA 1MHHE 4ITKA 1SIJA 4XWTA 3RI7C 3HK0A 1PUTA 2K9XA 2KTRA 2HD5B 2GOWA 1E8XA 5IOIA 3RPFC 2WWZA 3ZKJC 1L6VA 5HI1A 4WJQA 4IG7B 1C9FA 2I1JA 5E6NA 1T0RC 4TSSA 2HJ8A 2X38A 2OJWA 1WZ0A 1K50A 3BK1A 2CJNA 1J8CA 3QQ8B 2UWQA 2AL3A 4P16A 3H7PB 1D5XC 3Q3MC 2MWSB 5G5GA 2PVGC 1YQBA 1A5RA 2JF5A 3PZ8A 4HPPA 1S1QB 2K39A 4RF1A 1FM0D 1NI2A 2DZKA 1YN4A 2J7QB 1MPEA 2MCNB 1HTQA 2QDFA 2C7HA 4K7WA 3A33B 2NBUA 3PLUA 1TS3A 2NCNA 2WXRA 1WJNA 4C7ZA 2H88B 1SGHA 3KLSX 3H6NA 3NHEB 2BYTA 1C3TA 4OVVA 1GNUA 4FXCA 3ZNGC 1D3ZA 4GU2A 1FMAD 2GBMA 1NEKB 3AE5B 5C2TB 3B0AA 1VR9A 1YOVB 1TKGA 1WIAA 2I38A 1JWSD 5DPTA 4KGSA 2WXHA 4GDLB 2JY6A 2WHIA 2IO1B 3DVGX 3OJ4B 2M17A 5E6PA 4P6VF 3DBHI 4I6NB 2I2YA 3VXWA 3PHWB 5KHQA 4WURA 2PTLA 3LYYA 1XLQA 4KSKC 2DWQA 4F1SA 3VFKA 1F77A 1EO6A 4LNFA 3I5JC 2LD9A 1QT9A 4W9FA 4N9F4 3AE9B 2WXKA 2N7DA 4JWSC 2ZEQA 2C60A 1JALA 4MH0E 4R3DA 2BB5A 4D2KA 2FAZA 2UU7A 3Q8CA 5AZFA 1JMLA 4ANXA 2JXTA 3N1XC 3DBHB 1CK1A 1L2NA 2RPVA 3ZVVA 1JRPA 5BMIA 3WA0A 2L7RA 2LUEA 1WE7A 1K51A 1WZ3A 2V1YA 4OVUA 3RMKC 1FEHA 1U4AA 4JX1C 3ONSA 1KOTA 3A9JA 1L4ZB 2IY0B 5FK9C 2ZW1A 4LK0M 4HJGE 5FKAC 4BOZB 3MJ5A 1FXAA 3VUWA 3ZLZA 4A90A 4DHJB 3SDLC 3PZ7A 1FPYA 2KZRA 4P1CC 2XBBC 1N5XA 3L13A 2PEAA 1YD8U 2MJEA 3PHXB 5EDSA 2W3RA 3QC8B 2AQ1B 4IM0A 3DCGA 2KKCA 3OWEB 4XWWA 3ECIA 4C56C 4MEMA 4NNJB 4WJNA 4BKSA 1SB3C 4I6PA 2EKEC 4AP4C 4YXDB 1L0XB 1WMHB 3WAOA 3RZFA 1C79A 3M95A 4ZOHC 1JWMD 4EZLA 1P7EA 2C5LC 2LGDA 1UNSA 3B08A 3SFDB 2E3TA 4NQLB 4DXGA 1Q0WB 4DK5A 4OW0A 2N9XA 1V9JA 3AE1B 1FCCC 2D3GA 1UBQA 2QC8A 5CTRC 1GG3A 1IGDA 3E9SA 2WXIA 3GZNI 1E9MA 3QAQA 2AX5A 1I4QA 3VUXA 3RNCC 3RNGC 3CSTA 4PYZA 4DQOC 1E8ZA 3DBRB 1T6BX 2K25A 5C23A 2O2VB 1WM3A 3BK2A 1FFUA 2RGFA 4DBGA 3Q14C 3AE2B 2BYVE 1E0ZA 1PQSA 2JZPA 2WYQA 1ROEA 1SSNA 1F2RC 2MQJA 3MHSD 3N20C 4US8A 3K9PB 1V97A 2AWTA 5FR3A 3C19A 3NVYA 5LNK1 1HQRD 3GOEA 3AE4B 3ALBA 3IT6B 3NZSA 3TL5A 3H1UA 3Q8EA 4TQ1A 1ACCA 4GMVA 4YWGG 3NVZA 2EMSA 1FO4A 5J17A 4EE2A 3VH3B 1N62A 3ZTDA 3FC4A 3A9KA 1HEZE 1XXGA 3PVLA 2L76A 1WJ6A 4TUUA 2PMVA 2JVCA 3WANA 2KC2A 3PV1A 1RAXA 3IBEA 1OQRA 1FNVA 2W9NA 3TEZA 3UINB 4AJYB 1WE6A 1TIFA 5CHWA 1TBEA 2WQYB 2PIAA 2GRIA 3WIMA 1CQVA 2MBHA 2GI9A 4GXBA 4DDGD 4OZBA 3EA6A 2LJ5A 2L1AA 2TSSA 3O13A 4G0NB 2IPKD 4A8XC 1V6EA 4G3XB 2EELA 3IAS1 4MM3A 1JQ4A 1PGXA 5DCNA 2AEHA 5JHAA 2FCSA 3DBLI 1FNUA 2JRHA 3GP7A 3TUOA 3P4RB 2BW2A 1AYFA 2DYOA 1L0YB 2LGIA 4ACFA 3FAHA 4JL9A 2WDVB 1DOYA 2I1KA 2MH7A 4FHKA 1WXSA 1ZXHA 3RZWC 5D7GA 2L32A 2KQSA 1JWAD 1QOFA 1LXDA 4M8MA 2LHEA 1AN8A 4M0WB 4G50A 4MDKE 3SEBA 5AZGA 3SHQA 5H8YE 2FIDA 3EGRA 3BZDB 3KYDD 4RM8A 1N5WA 3MHZA 1L4DB 2WP9B 2KJRA 3JVZX 3BY4B 1OFFA 4WJOA 4ARCA 1V5TA 2NBVB 2M56B 1VJKA 2KX3A 3DOWA 4PK1A 3J9CA 2KVRA 4E74A 2WNMA 5CHFA 2L83A 2BYFA 4IUMB 1UWMA 1LQBA 3DHIC 2MLBA 1RLFA 4HEA1 1L5PA 1IUEA 2M1MA 3R7RA 4HDOA 2V4IB 3TBLD 2N4FA 3OAWA 3AE7B 3GE8C 3VAWA 3N1YC 2Q5WD 3QARA 3RNBC 3ENEA 2AQ3B 4KIKB 2FCQA 2WLBA 2WU2B 2L00B 3AM9A 1WGKA 2WGSA 2K8CA 2CU3A 1SE2A 1D6EC 2KMMA 1C1YB 2W55A 1JWBD 1OQQA 4I6LB 1P1AA 1T0SC 1CZPA 4NJ6A 2IO0B 4WAFA 3NS1A 3KYCD 4HLEA 2JSVX 4WAAA 4FN2A 2PW9A 1EU3A 2OHFA 2D07B 3B1LX 4BKSD 2Z59B 4EZKA 4URKA 2NBWB 4US9A 3DBSA 2ICIA 4B95A 1OGWA 2XK5B 2DENB 2K6DB 2KJHB 1R7SA 1V8CA 5C1ZA 1V49A 2BS3B 4C7YA 3VQIA 3CMMB 4C4VA 1E5WA 5BO4B 3AECB 1L0VB 2WU5B 3Q8BA 3Q8FA 3JSVB 5GXGB 2AQ2B 3URYA 3ETRA 3AE6B 4NZLB 1RFKA 2G9HD 3VRBB 3HHMA 5IO9A 4C00A 2WDTB 1T0YA 3L0WB 5EE9A 3AEGB 1R4MI 3A1QB 2MBOA 4XDDA 2DX5B 3I9V1 3O65B 4MELA 5KHOA 3V3XA 1PDXA 1EU4A 1P9DU 2K8HA 4FLHA 3RN9C 2IGDA 2FUG1 4AJWA 3N30A 4NQKE 1ZXIA 2BS2B 1XLOA 2CS4A 5EE3A 1N6ZA 3NG0A 3Q3FA 1J19A 2FUHB 1WX9A 1R4MB 2JZZA 4FJVB 2GBKA 2KFKB 1HZ6A 3ZNHB 3I3TB 1UBIA 4JIOU 4DHZE 4XE0A 3DDCB 2J42A 1EF1A 1E90A 4C80A 2HE7A 4W9IA 4RGMA 3VTUA 4MJSB 4GDKA 4WQMA 2HJ1A 1I42A 3ABVB 3RUIB 3AEFB 1WRDB 1KRHA 4TMAB 4ASWC 3ML9A 4WWPA 1Y56A 3AEEB 3DVNV 4IOIE 1TY0A 1TZ1A 1ZPSA 4DXAB 3VR9B 1TS2A 2LGXA 2M0AA 2W82A 3IG3A 1E7VA 4RH6A 4MGIE 1JRUA 4P1BC 3PO0A 5FR6A 2FCMA 2ZCBA 2JUOA 1QLBB 3EFCA 2QIEB 4CQNA 2WXLA 2YEPB 4YL8A 3Q3JA 3M63B 2KQ4X 1KTKA 2MBQA 1RWSA 2OJRA 2WXQA 2JPHA 1MG8A 4JWUC 4JQWC 4LNNA 1OQYA 1YN3A 3UIPB 2ZPNA 1BXTA 2KWCA 2LGYA 3RYTA 2IGHA 2CHXA 4PS7A 5T8IA 2JQRB 2L8JA 4B9KA 1FFVA 1YN5A 2LVOA 4IDIA 4K1RB 3JYUA 2KQ7A 1C76A 2BTEA 1VCBA 4WJPA 2MBBB 2N7EA 3PGEA 5CHVC 3X0WA 4NAMA 5C3JB 2DYBA 3L10B 4GB9A 4GIVA 3DQVA 5HFYA 2KK8A 1D5MC 2D2QA 4RFBA 1N63A 3P42A 2J0JA 2R2QA 1JROA 3BVMA 3RNFC 4B0MA 3R8BA 3UQBA 1KH0A 1YX5B 3VUYA 4EOYA 2KWVB 3R2TA 1Q1OA 4L1BA 3VTVA 4W9CA 4MSMB 3IAM1 4REZA 1WGDA 1NI3A 1FXIA 2CKHB 1CJEA 2D5GA 3CIRB 5G5HA 3ZJTA 2DHZA 2XNAC 1GB1A 1PGAA 1UUPA 5BYQA 1ZP0B 1OEYA 4KDLB 4MSQB 3JSVA 3KW5B 1E8YA 1GPXA 1WM2A 1GAQB 1UELA 2GBNA 1OEYJ 2HTME 3AU4A 1UF0A 3A1QA 1MJDA 1ISNA 3T8MA 3GS2A 2L0FA 2K8BA 4LNKA 3H9DA 2MX2A 2IDYA 3ZTCA 2VZKB 4ANUA 5L95C 2FCNA 2KOXA 5BYRA 2PVOD 3AB5A 1WGYA 3KWVA 3ZUNA 1E8WA 4ZRQA
chains in the Genus database with same CATH topology
1RAXA 3QA8A 3KUZA 4EKUA 2JXXA 1NDDA 3APFA 3IBEA 2W9NA 3UINB 2KFKA 2KDFB 1KJTA 4NAWB 1WXVA 2LI5A 1WE6A 4AJYB 4IWOA 3SD5A 2KNBA 3IHPC 3AULA 4W9LA 2PPHA 2IZVB 2KX0A 2N1VA 4KDIC 2KDBA 5CHWA 1TBEA 1XQQA 3U30A 3WALA 2KJ6A 2KFJA 2CU1A 5CX3A 3PRZA 3WAPA 3IFWB 3WIMA 2MBHA 2K6QA 3VH4B 1WR6E 3K9OB 4KIKA 1LM8B 3CSFA 2L0TA 3ZNZB 4GXBA 5G55A 4DDGD 2RSUA 3QX1A 1IYFA 5DPSA 4FJYA 3KUDB 2IO3B 1K8RB 2BF8B 4HXDA 4IM3A 3OJ3A 4E71A 3QHTA 2LJ5A 2UYZB 3PRMB 2G4DB 4HK2A 2OOBB 2V3SA 1WX8A 1WXMA 3LDZE 3N32A 2AL6A 1IPGA 3PSEB 4G0NB 4HWIB 3LJ3A 2KN5A 1V6EA 4G3XB 2BYEA 2RD0A 5JHBA 1RFAA 4MM3A 1WX7A 1X1MA 2A5UA 2JT4B 4A20A 1WI0A 2KANA 4GN1A 3C0RB 5DCNA 4HVBA 4ZDVA 2AEHA 5JHAA 3HM6X 3QK0A 2FCSA 3DBLI 2JRHA 2KDEB 3H7PA 3PREA 5J18A 4HJKA 2CR5A 2MP2A 2KC1A 3VTWA 2GBRA 2DYOA 3VVWB 4RMAA 2ZJDA 4JL9A 4B6WA 4TKNA 4E3CA 2KLCA 2I1KA 4FHKA 3DVNU 1WXSA 1GJZA 3RZWC 5D7GA 1H4RA 2KQSA 2R2OA 1BT0A 1LXDA 2REXA 4M8MA 4MGZE 3AI5A 4M0WB 4G50A 1P98A 2C7MB 3W1SA 4MDKE 4A3OA 1UH6A 5AZGA 3SHQA 2G3QB 1WYWB 4AOFA 2FIDA 1NBFC 2XK5A 3ZO5B 2JRIB 3KYDD 2HTHA 4DHZB 2Z0EB 3APCA 4RM8A 2DAJA 4ZRJA 3TCAA 3KUCB 4W9EA 4HPLB 4EZJA 1G6JA 3U8ZA 1V2YA 4WWNA 4BOSC 1V81A 2KJRA 3ML8A 3JVZX 2JZ3B 4BBNC 4DDID 4J6IA 4W9GA 3BY4B 2ZZPB 3EC8A 4WJOA 4F7ZA 3A4SC 1V5TA 2KLGA 1E7UA 2MSED 2NBVB 3A9KB 4F8CB 1XD3B 2K1FA 2D10A 4LDTB 2KX3A 3DOWA 2BWES 2DZIA 4ANWA 1Z2MA 2KVRA 1YIWA 4E74A 2J0KA 5LXHA 4BVUC 5CHFA 2BYFA 4IUMB 3VDZA 2ZNVC 2J0MA 1LQBA 4XX5A 2MLBA 1SIFA 1RLFA 1WJUA 2M1MA 4TQ0A 3PTFC 3R7RA 3ZDTA 4HDOA 2FIFA 3HK0A 3TBLD 2KXJA 2N4FA 2PJHA 3OAWA 2O6VA 2LRUA 3VAWA 1SE9A 2CHWA 4GDLA 3V61A 2KTRA 2HD5B 2M8SA 3QARA 2GMIC 4K81A 2GOWA 2BGFA 3ENEA 3RT3B 1E8XA 2FCQA 4KIKB 1M94A 2BKRB 2KO3A 2WWZA 2L00B 3ZKJC 4LDTD 2K8CA 2LWPA 2PE6B 3QCAA 4RM9A 4WJQA 2L3ZA 4IG7B 4P7IA 2I1JA 5E6NA 2LZ6A 4KSLC 4DHJD 1C1YB 2HJ8A 3RULA 2MRPA 5DPWA 4I6LB 1P1AA 1WZ0A 4NJ6A 2IO0B 4IM2A 1J8CA 3QQ8B 2B3AA 2UWQA 4TV3A 2AL3A 3KYCD 4HLEA 4II3B 2MW5A 3H7PB 5GMVA 4WAAA 2ZCCA 2YLMA 4MJSA 4FN2A 4EEWA 1XT9B 2MWSB 4WQOB 1YQBA 2LASA 1A5RA 2JF5A 4ICVA 2D07B 3B1LX 2DAFA 2Z59B 4BKSD 4EZKA 4URKA 2NBWB 1S1QB 2K39A 3IVFA 4ANVA 3DBSA 4EUTA 4KZ0A 1NI2A 2DZKA 3SU8X 4B95A 1F9JA 2J7QB 2NPTA 3TIXA 2MCNB 1OGWA 2XK5B 2DENB 2K6DB 2KJHB 3QJZA 2C7HA 2KHWB 2QHOA 4FJZA 2NS5A 3ZDMC 3QIJA 4K7WA 5C1ZA 1WGHA 1AARA 4PS3A 3A33B 1V49A 2LRWA 2NBUA 3VQIA 3CMMB 3PLUA 4IC7B 3UIOB 4K7SA 1E5WA 4GGQA 2ZVOA 3H7SA 5BO4B 1TGZB 2NCNA 5IA7A 1WJNA 4LJOB 3JSVB 1SGHA 4HDQA 2CHZA 3H6NA 3NHEB 1C3TA 2BKFA 4OVVA 2FNJB 1GNUA 3EFUA 3HHMA 5JZEB 3ZNGC 3DBRI 2WDTB 1D3ZA 4GU2A 2RR9A 1T0YA 3L0WB 2GBMA 4K7UA 1R4MI 1V5OA 2N9EB 1IP9A 2IO2B 3A1QB 3B0AA 4W9JA 2MBOA 1GC7A 1WF9A 3PS6A 4DHZE 2DX5B 1WIAA 3O65B 4ZYNA 3ZRFA 5DPTA 4MELA 2VRRB 5KHOA 1ZGUB 3KVFB 3M3JA 5IAAC 4GDLB 1HE8A 2JY6A 4IW0A 2RPQA 2KTRB 1P9DU 1WMHA 2IO1B 3DVGX 1L7YA 1P0RA 2K8HA 5D6JB 4FLHA 3UQAA 1KLVA 2BWFA 4XC2A 3OJ4B 5LLIA 1EF5A 1WJ4A 2M17A 3EECA 5E6PA 2NVUI 4AJWA 1V86A 3N30A 3DBHI 4I6NB 4NQKE 2L05A 1WR1A 3VXWA 3PHWB 5KHQA 2CS4A 4NPNA 3Q3FA 4KSKC 4F1SA 1J19A 2FUHB 1WX9A 3VFKA 3R7QA 4DWFA 1EO6A 2JZZA 1WY8A 4FJVB 3X23A 2GBKA 2LD9A 3R3MA 2KFKB 3CF6E 3NS8A 4W9FA 4N9F4 1LFDA 3ZNHB 2N7DA 3I3TB 1UBIA 2M4NA 2ZEQA 4JIOU 2C60A 3MTNB 4HCNB 3DDCB 4W9KA 5TR5A 3V6EB 3ZRCA 4MH0E 4JGHB 3APDA 1EF1A 5D94A 4CO7A 2BPSA 3N3KB 2FAZA 5AZFA 2N1WA 1E90A 4FHJA 2DYMA 5AZHA 4EFOA 4ANXA 2HE7A 4W9IA 3VTUA 4MJSB 1Q5WB 2ZVNA 4GDKA 4A3PA 1L2NA 1I42A 3ZVVA 4KVGB 2L7RA 3U7DA 2LUEA 1WE7A 4HCPB 3RUIB 3WA0A 4CHKA 4BFRA 3PT2B 2AYOB 3UGBB 3L08A 3MJWA 1WZ3A 1WRDB 2G45B 2V1YA 2V4LA 3DPDA 4ASWC 1CMXB 2WX0A 3HIZA 3ML9A 4OVUA 4WWPA 3HM3A 1WFYA 5J2RA 1V80A 2G4SA 3DVNV 2O2VA 1QZEA 2WX1A 3NY5A 3R66C 1U4AA 5LXIB 3ONSA 4LJPB 1KOTA 2N9PC 1TZ1A 1Z5SB 3A9JA 2IY0B 3OLMD 4ZRIA 2KD0A 4DXAB 2LGXA 2C7NB 1I35A 3IG3A 1E7VA 4BOZB 4MGIE 1ZKHA 1JRUA 4IWQA 2MP2B 2JWZA 3L16A 4IWPA 5FR6A 2FCMA 2ZCBA 3VUWA 3ZW3A 5E6OA 2JUOA 3ZLZA 4DHJB 3SDLC 4YL8A 1R4NI 3W1SC 2KZRA 3Q3JA 3D32A 3M63B 4XZ4A 2LXAA 3ZIMA 2XBBC 3L13A 2PEAA 2KWUB 1YD8U 2MBQA 2OJRA 3PHXB 4AWJA 5EDSA 1YJ1A 2JPHA 3QC8B 5DPRA 1GC6A 1WGGA 3DVGY 1MG8A 2KKCA 3DCGA 4IM0A 4M8NA 2ASQA 3JW0X 3ZNID 2MBEA 4JQWC 3BINA 5G2NA 4KZCA 1OQYA 3V6CB 1UGMA 3UIPB 4II2B 2ZPNA 3ECIA 4MEMA 2KWCA 4NNJB 2LGYA 4WJNA 3RYTA 3TMPB 4NJ7A 2CHXA 4PS7A 3PZDA 3UF8A 4BKSA 4I6PA 2EKEC 4AP4C 2L8JA 4B9KA 2LVOA 4K1RB 1WMHB 3WAOA 3JYUA 2KQ7A 1WGRA 3RZFA 1VCBA 3M95A 4NAWA 4WJPA 4EZLA 2DZMA 2C5LC 2MBBB 2N7EA 5JH5C 1WH3A 2LVQA 3PGEA 2M0XA 2LGDA 1VD2A 5CHVC 2EMTA 4BKTA 3QWZB 3B08A 3PRPB 2PE9A 3X0WA 3W1YA 2ZPYA 3A4RA 2DYBA 4W9DA 2MA9B 3L10B 4GB9A 4NQLB 3V62A 4GIVA 1UD7A 3DQVA 3NOBA 1Q0WB 2KK8A 4DK5A 2N9XA 1V9JA 4CYEA 2D3GA 1P3QU 1UBQA 4BBNF 5CTRC 1J0GA 1GG3A 4HPMB 2O6VB 2Z0DB 2KMAA 3P2BA 3L17A 2D2QA 1EUVB 3GZNI 5D2MB 4FA6A 5L83A 3QAQA 2Y5BB 4KV2A 4GDKB 2J0JA 2R2QA 2IBIB 4X57B 3VUXA 3WAMA 1FXTB 4NY0A 4JLCA 3CSTA 3KH0A 1YX5B 2DZJA 4PYZA 4WWOA 3UQBA 3VUYA 2LXCA 4EOYA 1E8ZA 2KWVB 1Q1OA 3PPAA 3VTVA 4MGKE 4W9CA 1S3SG 2K25A 4MSMB 4W9HA 4FADA 2GBJA 5C23A 2O2VB 3S2AA 1WGDA 1WM3A 3PLVA 2XEWA 2RGFA 2CKHB 4DBGA 2DHZA 4GSWA 4AUQC 2BYVE 3A9JB 1PQSA 2KDIA 2IY1B 2WYQA 2NR2A 4G11A 4LCDE 1OEYA 4KDLB 2O6VD 2MQJA 3MHSD 4MSQB 3JSVA 3RD2A 3T9LA 3KW5B 1E8YA 4ICUA 1GUAB 3K9PB 1WM2A 1OTRB 2AWTA 4PYUA 1UELA 2GBNA 1WXAA 1OEYJ 3AU5A 1Y8RC 5AEKB 3GOEA 3ALBA 1YX6B 3AU4A 3NZSA 3TL5A 4FBJB 1UZXB 2C9WB 3A1QA 3VHTC 3H1UA 1ISNA 3EHVA 3T8MA 4TQ1A 4GMVA 4GOCA 1ZW7A 2ZNVB 2EMSA 1TTNA 1RRBA 2K8BA 2L0FA 3AXCA 5J17A 2NPTB 2YVCA 3H9DA 2LVPA 3VH3B 2MX2A 2D11A 2KMCA 3ZTDA 5HKHA 3RCZA 3ZTCA 3NZUA 3A9KA 3M62B 4PS8A 4ZRKA 2A4ZA 2KTFA 4BKGA 4ANUA 3PVLA 5L95C 2L76A 1WJ6A 2FCNA 2KOXA 4FULA 4TUUA 3V60A 2IYDB 1KM7A 2JVCA 1WGYA 4MGYE 3TJPA 1H8CA 3L54A 3WANA 2KC2A 3PV1A 3ZUNA 1E8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RAX A;  3QA8 A;  3KUZ A;  4EKU A;  2JXX A;  1NDD A;  3APF A;  3IBE A;  2W9N A;  3UIN B;  2KFK A;  2KDF B;  1KJT A;  4NAW B;  1WXV A;  2LI5 A;  1WE6 A;  4AJY B;  4IWO A;  3SD5 A;  2KNB A;  3IHP C;  3AUL A;  4W9L A;  2PPH A;  2IZV B;  2KX0 A;  2N1V A;  4KDI C;  2KDB A;  5CHW A;  1TBE A;  1XQQ A;  3U30 A;  3WAL A;  2KJ6 A;  2KFJ A;  2CU1 A;  5CX3 A;  3PRZ A;  3WAP A;  3IFW B;  3WIM A;  2MBH A;  2K6Q A;  3VH4 B;  1WR6 E;  3K9O B;  4KIK A;  1LM8 B;  3CSF A;  2L0T A;  3ZNZ B;  4GXB A;  5G55 A;  4DDG D;  2RSU A;  3QX1 A;  1IYF A;  5DPS A;  4FJY A;  3KUD B;  2IO3 B;  1K8R B;  2BF8 B;  4HXD A;  4IM3 A;  3OJ3 A;  4E71 A;  3QHT A;  2LJ5 A;  2UYZ B;  3PRM B;  2G4D B;  4HK2 A;  2OOB B;  2V3S A;  1WX8 A;  1WXM A;  3LDZ E;  3N32 A;  2AL6 A;  1IPG A;  3PSE B;  4G0N B;  4HWI B;  3LJ3 A;  2KN5 A;  1V6E A;  4G3X B;  2BYE A;  2RD0 A;  5JHB A;  1RFA A;  4MM3 A;  1WX7 A;  1X1M A;  2A5U A;  2JT4 B;  4A20 A;  1WI0 A;  2KAN A;  4GN1 A;  3C0R B;  5DCN A;  4HVB A;  4ZDV A;  2AEH A;  5JHA A;  3HM6 X;  3QK0 A;  2FCS A;  3DBL I;  2JRH A;  2KDE B;  3H7P A;  3PRE A;  5J18 A;  4HJK A;  2CR5 A;  2MP2 A;  2KC1 A;  3VTW A;  2GBR A;  2DYO A;  3VVW B;  4RMA A;  2ZJD A;  4JL9 A;  4B6W A;  4TKN A;  4E3C A;  2KLC A;  2I1K A;  4FHK A;  3DVN U;  1WXS A;  1GJZ A;  3RZW C;  5D7G A;  1H4R A;  2KQS A;  2R2O A;  1BT0 A;  1LXD A;  2REX A;  4M8M A;  4MGZ E;  3AI5 A;  4M0W B;  4G50 A;  1P98 A;  2C7M B;  3W1S A;  4MDK E;  4A3O A;  1UH6 A;  5AZG A;  3SHQ A;  2G3Q B;  1WYW B;  4AOF A;  2FID A;  1NBF C;  2XK5 A;  3ZO5 B;  2JRI B;  3KYD D;  2HTH A;  4DHZ B;  2Z0E B;  3APC A;  4RM8 A;  2DAJ A;  4ZRJ A;  3TCA A;  3KUC B;  4W9E A;  4HPL B;  4EZJ A;  1G6J A;  3U8Z A;  1V2Y A;  4WWN A;  4BOS C;  1V81 A;  2KJR A;  3ML8 A;  3JVZ X;  2JZ3 B;  4BBN C;  4DDI D;  4J6I A;  4W9G A;  3BY4 B;  2ZZP B;  3EC8 A;  4WJO A;  4F7Z A;  3A4S C;  1V5T A;  2KLG A;  1E7U A;  2MSE D;  2NBV B;  3A9K B;  4F8C B;  1XD3 B;  2K1F A;  2D10 A;  4LDT B;  2KX3 A;  3DOW A;  2BWE S;  2DZI A;  4ANW A;  1Z2M A;  2KVR A;  1YIW A;  4E74 A;  2J0K A;  5LXH A;  4BVU C;  5CHF A;  2BYF A;  4IUM B;  3VDZ A;  2ZNV C;  2J0M A;  1LQB A;  4XX5 A;  2MLB A;  1SIF A;  1RLF A;  1WJU A;  2M1M A;  4TQ0 A;  3PTF C;  3R7R A;  3ZDT A;  4HDO A;  2FIF A;  3HK0 A;  3TBL D;  2KXJ A;  2N4F A;  2PJH A;  3OAW A;  2O6V A;  2LRU A;  3VAW A;  1SE9 A;  2CHW A;  4GDL A;  3V61 A;  2KTR A;  2HD5 B;  2M8S A;  3QAR A;  2GMI C;  4K81 A;  2GOW A;  2BGF A;  3ENE A;  3RT3 B;  1E8X A;  2FCQ A;  4KIK B;  1M94 A;  2BKR B;  2KO3 A;  2WWZ A;  2L00 B;  3ZKJ C;  4LDT D;  2K8C A;  2LWP A;  2PE6 B;  3QCA A;  4RM9 A;  4WJQ A;  2L3Z A;  4IG7 B;  4P7I A;  2I1J A;  5E6N A;  2LZ6 A;  4KSL C;  4DHJ D;  1C1Y B;  2HJ8 A;  3RUL A;  2MRP A;  5DPW A;  4I6L B;  1P1A A;  1WZ0 A;  4NJ6 A;  2IO0 B;  4IM2 A;  1J8C A;  3QQ8 B;  2B3A A;  2UWQ A;  4TV3 A;  2AL3 A;  3KYC D;  4HLE A;  4II3 B;  2MW5 A;  3H7P B;  5GMV A;  4WAA A;  2ZCC A;  2YLM A;  4MJS A;  4FN2 A;  4EEW A;  1XT9 B;  2MWS B;  4WQO B;  1YQB A;  2LAS A;  1A5R A;  2JF5 A;  4ICV A;  2D07 B;  3B1L X;  2DAF A;  2Z59 B;  4BKS D;  4EZK A;  4URK A;  2NBW B;  1S1Q B;  2K39 A;  3IVF A;  4ANV A;  3DBS A;  4EUT A;  4KZ0 A;  1NI2 A;  2DZK A;  3SU8 X;  4B95 A;  1F9J A;  2J7Q B;  2NPT A;  3TIX A;  2MCN B;  1OGW A;  2XK5 B;  2DEN B;  2K6D B;  2KJH B;  3QJZ A;  2C7H A;  2KHW B;  2QHO A;  4FJZ A;  2NS5 A;  3ZDM C;  3QIJ A;  4K7W A;  5C1Z A;  1WGH A;  1AAR A;  4PS3 A;  3A33 B;  1V49 A;  2LRW A;  2NBU A;  3VQI A;  3CMM B;  3PLU A;  4IC7 B;  3UIO B;  4K7S A;  1E5W A;  4GGQ A;  2ZVO A;  3H7S A;  5BO4 B;  1TGZ B;  2NCN A;  5IA7 A;  1WJN A;  4LJO B;  3JSV B;  1SGH A;  4HDQ A;  2CHZ A;  3H6N A;  3NHE B;  1C3T A;  2BKF A;  4OVV A;  2FNJ B;  1GNU A;  3EFU A;  3HHM A;  5JZE B;  3ZNG C;  3DBR I;  2WDT B;  1D3Z A;  4GU2 A;  2RR9 A;  1T0Y A;  3L0W B;  2GBM A;  4K7U A;  1R4M I;  1V5O A;  2N9E B;  1IP9 A;  2IO2 B;  3A1Q B;  3B0A A;  4W9J A;  2MBO A;  1GC7 A;  1WF9 A;  3PS6 A;  4DHZ E;  2DX5 B;  1WIA A;  3O65 B;  4ZYN A;  3ZRF A;  5DPT A;  4MEL A;  2VRR B;  5KHO A;  1ZGU B;  3KVF B;  3M3J A;  5IAA C;  4GDL B;  1HE8 A;  2JY6 A;  4IW0 A;  2RPQ A;  2KTR B;  1P9D U;  1WMH A;  2IO1 B;  3DVG X;  1L7Y A;  1P0R A;  2K8H A;  5D6J B;  4FLH A;  3UQA A;  1KLV A;  2BWF A;  4XC2 A;  3OJ4 B;  5LLI A;  1EF5 A;  1WJ4 A;  2M17 A;  3EEC A;  5E6P A;  2NVU I;  4AJW A;  1V86 A;  3N30 A;  3DBH I;  4I6N B;  4NQK E;  2L05 A;  1WR1 A;  3VXW A;  3PHW B;  5KHQ A;  2CS4 A;  4NPN A;  3Q3F A;  4KSK C;  4F1S A;  1J19 A;  2FUH B;  1WX9 A;  3VFK A;  3R7Q A;  4DWF A;  1EO6 A;  2JZZ A;  1WY8 A;  4FJV B;  3X23 A;  2GBK A;  2LD9 A;  3R3M A;  2KFK B;  3CF6 E;  3NS8 A;  4W9F A;  4N9F 4;  1LFD A;  3ZNH B;  2N7D A;  3I3T B;  1UBI A;  2M4N A;  2ZEQ A;  4JIO U;  2C60 A;  3MTN B;  4HCN B;  3DDC B;  4W9K A;  5TR5 A;  3V6E B;  3ZRC A;  4MH0 E;  4JGH B;  3APD A;  1EF1 A;  5D94 A;  4CO7 A;  2BPS A;  3N3K B;  2FAZ A;  5AZF A;  2N1W A;  1E90 A;  4FHJ A;  2DYM A;  5AZH A;  4EFO A;  4ANX A;  2HE7 A;  4W9I A;  3VTU A;  4MJS B;  1Q5W B;  2ZVN A;  4GDK A;  4A3P A;  1L2N A;  1I42 A;  3ZVV A;  4KVG B;  2L7R A;  3U7D A;  2LUE A;  1WE7 A;  4HCP B;  3RUI B;  3WA0 A;  4CHK A;  4BFR A;  3PT2 B;  2AYO B;  3UGB B;  3L08 A;  3MJW A;  1WZ3 A;  1WRD B;  2G45 B;  2V1Y A;  2V4L A;  3DPD A;  4ASW C;  1CMX B;  2WX0 A;  3HIZ A;  3ML9 A;  4OVU A;  4WWP A;  3HM3 A;  1WFY A;  5J2R A;  1V80 A;  2G4S A;  3DVN V;  2O2V A;  1QZE A;  2WX1 A;  3NY5 A;  3R66 C;  1U4A A;  5LXI B;  3ONS A;  4LJP B;  1KOT A;  2N9P C;  1TZ1 A;  1Z5S B;  3A9J A;  2IY0 B;  3OLM D;  4ZRI A;  2KD0 A;  4DXA B;  2LGX A;  2C7N B;  1I35 A;  3IG3 A;  1E7V A;  4BOZ B;  4MGI E;  1ZKH A;  1JRU A;  4IWQ A;  2MP2 B;  2JWZ A;  3L16 A;  4IWP A;  5FR6 A;  2FCM A;  2ZCB A;  3VUW A;  3ZW3 A;  5E6O A;  2JUO A;  3ZLZ A;  4DHJ B;  3SDL C;  4YL8 A;  1R4N I;  3W1S C;  2KZR A;  3Q3J A;  3D32 A;  3M63 B;  4XZ4 A;  2LXA A;  3ZIM A;  2XBB C;  3L13 A;  2PEA A;  2KWU B;  1YD8 U;  2MBQ A;  2OJR A;  3PHX B;  4AWJ A;  5EDS A;  1YJ1 A;  2JPH A;  3QC8 B;  5DPR A;  1GC6 A;  1WGG A;  3DVG Y;  1MG8 A;  2KKC A;  3DCG A;  4IM0 A;  4M8N A;  2ASQ A;  3JW0 X;  3ZNI D;  2MBE A;  4JQW C;  3BIN A;  5G2N A;  4KZC A;  1OQY A;  3V6C B;  1UGM A;  3UIP B;  4II2 B;  2ZPN A;  3ECI A;  4MEM A;  2KWC A;  4NNJ B;  2LGY A;  4WJN A;  3RYT A;  3TMP B;  4NJ7 A;  2CHX A;  4PS7 A;  3PZD A;  3UF8 A;  4BKS A;  4I6P A;  2EKE C;  4AP4 C;  2L8J A;  4B9K A;  2LVO A;  4K1R B;  1WMH B;  3WAO A;  3JYU A;  2KQ7 A;  1WGR A;  3RZF A;  1VCB A;  3M95 A;  4NAW A;  4WJP A;  4EZL A;  2DZM A;  2C5L C;  2MBB B;  2N7E A;  5JH5 C;  1WH3 A;  2LVQ A;  3PGE A;  2M0X A;  2LGD A;  1VD2 A;  5CHV C;  2EMT A;  4BKT A;  3QWZ B;  3B08 A;  3PRP B;  2PE9 A;  3X0W A;  3W1Y A;  2ZPY A;  3A4R A;  2DYB A;  4W9D A;  2MA9 B;  3L10 B;  4GB9 A;  4NQL B;  3V62 A;  4GIV A;  1UD7 A;  3DQV A;  3NOB A;  1Q0W B;  2KK8 A;  4DK5 A;  2N9X A;  1V9J A;  4CYE A;  2D3G A;  1P3Q U;  1UBQ A;  4BBN F;  5CTR C;  1J0G A;  1GG3 A;  4HPM B;  2O6V B;  2Z0D B;  2KMA A;  3P2B A;  3L17 A;  2D2Q A;  1EUV B;  3GZN I;  5D2M B;  4FA6 A;  5L83 A;  3QAQ A;  2Y5B B;  4KV2 A;  4GDK B;  2J0J A;  2R2Q A;  2IBI B;  4X57 B;  3VUX A;  3WAM A;  1FXT B;  4NY0 A;  4JLC A;  3CST A;  3KH0 A;  1YX5 B;  2DZJ A;  4PYZ A;  4WWO A;  3UQB A;  3VUY A;  2LXC A;  4EOY A;  1E8Z A;  2KWV B;  1Q1O A;  3PPA A;  3VTV A;  4MGK E;  4W9C A;  1S3S G;  2K25 A;  4MSM B;  4W9H A;  4FAD A;  2GBJ A;  5C23 A;  2O2V B;  3S2A A;  1WGD A;  1WM3 A;  3PLV A;  2XEW A;  2RGF A;  2CKH B;  4DBG A;  2DHZ A;  4GSW A;  4AUQ C;  2BYV E;  3A9J B;  1PQS A;  2KDI A;  2IY1 B;  2WYQ A;  2NR2 A;  4G11 A;  4LCD E;  1OEY A;  4KDL B;  2O6V D;  2MQJ A;  3MHS D;  4MSQ B;  3JSV A;  3RD2 A;  3T9L A;  3KW5 B;  1E8Y A;  4ICU A;  1GUA B;  3K9P B;  1WM2 A;  1OTR B;  2AWT A;  4PYU A;  1UEL A;  2GBN A;  1WXA A;  1OEY J;  3AU5 A;  1Y8R C;  5AEK B;  3GOE A;  3ALB A;  1YX6 B;  3AU4 A;  3NZS A;  3TL5 A;  4FBJ B;  1UZX B;  2C9W B;  3A1Q A;  3VHT C;  3H1U A;  1ISN A;  3EHV A;  3T8M A;  4TQ1 A;  4GMV A;  4GOC A;  1ZW7 A;  2ZNV B;  2EMS A;  1TTN A;  1RRB A;  2K8B A;  2L0F A;  3AXC A;  5J17 A;  2NPT B;  2YVC A;  3H9D A;  2LVP A;  3VH3 B;  2MX2 A;  2D11 A;  2KMC A;  3ZTD A;  5HKH A;  3RCZ A;  3ZTC A;  3NZU A;  3A9K A;  3M62 B;  4PS8 A;  4ZRK A;  2A4Z A;  2KTF A;  4BKG A;  4ANU A;  3PVL A;  5L95 C;  2L76 A;  1WJ6 A;  2FCN A;  2KOX A;  4FUL A;  4TUU A;  3V60 A;  2IYD B;  1KM7 A;  2JVC A;  1WGY A;  4MGY E;  3TJP A;  1H8C A;  3L54 A;  3WAN A;  2KC2 A;  3PV1 A;  3ZUN A;  1E8W A; 
#chains in the Genus database with same CATH topology
 3MC0 B;  2JXX A;  1NDD A;  4YSY B;  2KFK A;  1KJT A;  4NAW B;  1YNT E;  2LI5 A;  2INC C;  4W9L A;  2IZV B;  2KX0 A;  2KDB A;  3U30 A;  2JWU A;  3L4P A;  3PRZ A;  3U4E G;  1MVK A;  3K9O B;  1LM8 B;  1J7C A;  1YJJ A;  2BF8 B;  4HXD A;  3QHT A;  1V1P B;  2G4D B;  2OOB B;  4YSZ B;  1WX8 A;  3LDZ E;  3N32 A;  2AL6 A;  1FD6 A;  2KN5 A;  2BYE A;  5JHB A;  1C4A A;  1X1M A;  1FNW A;  4GN1 A;  3QK0 A;  3H7P A;  2XN9 C;  3ZQ4 A;  3HRD D;  5HG2 A;  1IGC A;  4HRO A;  2GBR A;  3FIL B;  2ZJD A;  2V3N A;  2D3C A;  1BML C;  3AI5 A;  3AEA B;  2C7M B;  3H8H A;  1UH6 A;  1EM7 A;  1WYW B;  1NBF C;  2JRI B;  4DHZ B;  2Z0E B;  2DAJ A;  2WDQ B;  5D3D A;  3NZ3 A;  4EZJ A;  1RYJ A;  1G6J A;  3U8Z A;  3ZGZ A;  2G1E A;  4DDI D;  4J6I A;  1XCQ L;  2KLG A;  2MSE D;  1UGJ A;  1XD3 B;  3GZN B;  1I4R A;  4LDT B;  1TY2 A;  3W5U B;  1F2R I;  2DZI A;  1HTO A;  1YIW A;  2K5P A;  2RDG A;  2WXG A;  4YTM B;  5IP4 D;  2J0M A;  2VH1 A;  2NTT A;  3NJT A;  3ZDT A;  4ZHO A;  2PJH A;  4RNA A;  2LRU A;  1SE9 A;  4GDL A;  2BGF A;  3RT3 B;  1MI0 A;  2KO3 A;  1NYR A;  3U52 E;  2LWP A;  1VDV A;  2PE6 B;  4RM9 A;  2LZ6 A;  4KSL C;  4S0R A;  3U7Z A;  3RUL A;  2MRP A;  5DPW A;  3AMZ A;  4IM2 A;  2N0S B;  2B3A A;  4TV3 A;  3W5V B;  4II3 B;  4YTP B;  1B9R A;  1XO3 A;  2WXJ A;  5GMV A;  2ZCC A;  4L23 A;  4EEW A;  1TT5 B;  3T3N A;  4WQO B;  2DAF A;  4LNI A;  1HXY D;  4ANV A;  2GB1 A;  3SU8 X;  1F9J A;  4RCO A;  3TIX A;  1QOB A;  4OHJ A;  4RF0 A;  1WYG A;  3QJZ A;  4FJZ A;  2QHO A;  1ZUD 2;  3LXF A;  2NS5 A;  3ZDM C;  3QIJ A;  4ZHP A;  2NMQ A;  1AAR A;  4PS3 A;  3UI3 A;  2QMT A;  2LRW A;  4IC7 B;  1TYG B;  4K7S A;  3AEB B;  2WXP A;  4GGQ A;  2ZVO A;  3H7S A;  4LLG M;  3DWM A;  5IA7 A;  4HDQ A;  2CHZ A;  2BKF A;  1GB4 A;  3EFU A;  2RR9 A;  3CWI A;  4N58 A;  4K7U A;  1V5O A;  2N9E B;  2PLP A;  1IP9 A;  2IO2 B;  1SBB B;  2ON8 A;  3DBL B;  4YTN B;  3ZXR A;  4YSX B;  2QJL A;  2D3B A;  1BUI C;  3ZRF A;  3GE3 C;  3M3J A;  3KVF B;  5IAA C;  4IW0 A;  2RPQ A;  2KTR B;  1WMH A;  3E56 A;  1DYQ A;  5D6J B;  1P0R A;  3UQA A;  1KLV A;  1EWC A;  2BWF A;  4XC2 A;  1EF5 A;  1WJ4 A;  3EEC A;  1XLP A;  2BS4 B;  4NPN A;  3P4P B;  3Q3O C;  4DWF A;  4A9A A;  1T3Q A;  3X23 A;  3R3M A;  3CF6 E;  1ZDX A;  1B1Z A;  1LFD A;  1I4G A;  1JW9 D;  5TR5 A;  4HCN B;  3V6E B;  2BPS A;  2INP E;  1VRA B;  1E7P B;  1VLB A;  2N1W A;  1NEN B;  2ACZ B;  4FHJ A;  1E6E B;  1Q5W B;  2ZVN A;  5HHD G;  3ZJU A;  1PGB A;  4M02 A;  4KVG B;  4CHK A;  3U7D A;  4BFR A;  1K53 A;  4K3C A;  2AYO B;  3MJW A;  2G45 B;  1CMX B;  3R2I A;  3SR6 A;  3HM3 A;  3MC9 A;  1Q10 A;  2O2V A;  1A70 A;  2WX1 A;  3R66 C;  2LEK A;  4RGT A;  5LXI B;  4WWM A;  4LJP B;  4UDU C;  3OLM D;  4MH8 A;  2KWD A;  2C7N B;  2Y3A A;  1ZKH A;  1K52 A;  3B2G A;  2JWZ A;  3L16 A;  4IWP A;  3ZW3 A;  1WSP A;  1WWT A;  3FKY A;  3WCQ A;  1WXQ A;  3NRZ A;  1R4N I;  2MHJ A;  2B76 B;  2BQQ A;  4XZ4 A;  4AWJ A;  1YJ1 A;  1GC6 A;  2ZW0 A;  1XLN A;  4M8N A;  2ASQ A;  3ZNI D;  5G2N A;  3V6C B;  1UGM A;  4II2 B;  4XGA B;  3VR8 B;  2DBY A;  3TMP B;  4NJ7 A;  3UF8 A;  3PZD A;  3IT4 B;  4RGO S;  4M00 A;  3N9Y C;  1R4N B;  2WS3 B;  2D3A A;  2J4X A;  1FRR A;  1VZ8 A;  2DZM A;  5JH5 C;  1WH3 A;  2EMT A;  3QWZ B;  3PRP B;  3W1Y A;  3A4R A;  4W9D A;  3V62 A;  3NOB A;  4L2Y A;  4Q2J A;  2BB6 A;  3TEY A;  1NYQ A;  4CYE A;  1E10 A;  1C77 A;  2O6V B;  2KMA A;  2RDB C;  1ET9 A;  3L17 A;  1EUV B;  5D2M B;  5L83 A;  4FA6 A;  4ZYS A;  2Y5B B;  4KV2 A;  3AE3 B;  1T5X D;  1JWU D;  3HVZ A;  4NY0 A;  4JLC A;  3KH0 A;  2JYT A;  4WWO A;  2DZJ A;  2SEB D;  2LXC A;  3TSS A;  2W54 A;  4MGK E;  3RNE C;  3AED B;  4W9H A;  4FAD A;  5EE0 A;  1QOA A;  4B0E A;  2XEW A;  4GSW A;  4LNO A;  3A9J B;  1I7H A;  2NR2 A;  2R61 A;  4G11 A;  1XF5 L;  4LCD E;  3RD2 A;  2L52 A;  3BVG A;  1T0Q C;  3DHG C;  1C4C A;  4ICU A;  1GUA B;  3KWL A;  3T3O A;  4M0W A;  4PYU A;  1WXA A;  3TEX A;  4FBJ B;  1UZX B;  2MJ3 A;  2C9W B;  1I4H A;  3VHT C;  1WRI A;  2Z8L A;  1ZW7 A;  2ZNV B;  2JX5 A;  3NVV A;  2LGS A;  3AXC A;  2NPT B;  3AH7 A;  2LVP A;  5HKH A;  2IND C;  3M62 B;  4BKG A;  2KTF A;  1XCT L;  2ONQ A;  4ZRP A;  4KGT A;  2IYD B;  2M19 A;  1KM7 A;  3TJP A;  3L54 A;  3KUZ A;  4EKU A;  2INN E;  5IN7 A;  3AV8 A;  2KDF B;  2MJD A;  1WXV A;  1V1O A;  4IWO A;  3IHP C;  3AUL A;  1IBX B;  2PPH A;  2N1V A;  2EKI A;  4H2A A;  2N9K A;  2KJ6 A;  3NUH B;  2KFJ A;  2CU1 A;  3OG5 A;  5AUK A;  2QCZ A;  3IFW B;  2K6Q A;  3W2D A;  3VH4 B;  2K22 A;  4KIK A;  3ZNZ B;  2L0T A;  1IYF A;  5G55 A;  2RSU A;  3DHH C;  4FJY A;  2VZK D;  1QIL A;  2IO3 B;  3P4S B;  1K8R B;  3P1M A;  4K3B A;  4OZC A;  3OJ3 A;  2UYZ B;  1YJI A;  2FE8 A;  4J3O D;  2IJ0 A;  3VRA B;  2V3S A;  3RFZ B;  1WXM A;  4DHJ D;  3PSE B;  1IPG A;  2KAC A;  1TJE A;  1AW7 A;  2RD0 A;  1D5Z C;  2A5U A;  4A20 A;  1WI0 A;  3MFG A;  3C0R B;  4HVB A;  1MG4 A;  5J18 A;  2CR5 A;  3VTW A;  3VVW B;  1ESF A;  2BT6 A;  4E3C A;  1QOG A;  2NTS A;  1H4R A;  1BT0 A;  2FBW B;  4KKJ A;  1AWD A;  1QF6 A;  1F52 A;  2XK5 A;  3ZO5 B;  1D4B A;  2HTH A;  1PYW D;  5H92 C;  4HPL B;  2PKO A;  1TKY A;  4BOS C;  3ML8 A;  4BBN C;  3EC8 A;  2ZZP B;  1RM6 C;  4F7Z A;  3A4S C;  1E7U A;  3P4Q B;  3A9K B;  4F8C B;  1SE4 A;  2D10 A;  1LO5 D;  2KAJ A;  2BWE S;  4ANW A;  1Z2M A;  4MAC A;  2J0K A;  2K3U A;  2KVZ A;  4BVU C;  4KKI A;  2WXO A;  1SIF A;  4TQ0 A;  3PTF C;  2FIF A;  1UWX A;  1TZO A;  2KXJ A;  5D3I B;  2O6V A;  4HKQ A;  2CHW A;  3V61 A;  2Y5C A;  4KX6 B;  2QSD A;  2M8S A;  2GMI C;  4K81 A;  1M94 A;  1TS4 A;  2BKR B;  4KGR A;  4LDT D;  3W9C B;  3QCA A;  1KFY B;  2L3Z A;  4P7I A;  4NJC A;  1C78 A;  3AE8 B;  1KLG D;  4MM3 B;  2MW5 A;  2WXN A;  2YLM A;  3B2F A;  1TS5 A;  2HDE A;  4MJS A;  3B9J A;  1XT9 B;  2GLS A;  2JU6 X;  4A6Q A;  2LAS A;  2SAK A;  4MT5 A;  4ICV A;  3Q69 A;  1SE3 A;  3IVF A;  2WDR B;  1MFW A;  4EUT A;  4KZ0 A;  1SEB D;  2NPT A;  4RGN A;  3BWU D;  1HA5 A;  2KHW B;  1I4X A;  2KYW A;  1LGR A;  3RNA C;  1WGH A;  4HKZ E;  1MHX A;  3UIO B;  1TGZ B;  2J53 A;  3BII D;  3C8Y A;  4LJO B;  4OVZ A;  1IBX A;  2FNJ B;  1M4V A;  5BMH A;  5JZE B;  3DBR I;  4N59 A;  2DLB A;  3BYT B;  4LTU A;  1DOI A;  4AS1 A;  1KLU D;  4W9J A;  1GC7 A;  1WF9 A;  3PS6 A;  3EUB 2;  4ZYN A;  2VRR B;  4A55 A;  1ZGU B;  1HE8 A;  3LB8 C;  1L7Y A;  5LLI A;  2NVU I;  1V86 A;  1STE A;  2L05 A;  1WR1 A;  1JCK B;  2DNF A;  1ZDV A;  3R7Q A;  1WY8 A;  2V0G A;  1FIQ A;  3NS8 A;  3MP9 A;  2M4N A;  4W9K A;  3MTN B;  3ZRC A;  4JGH B;  3APD A;  5D94 A;  4CO7 A;  3SFE B;  3N3K B;  5JXV A;  2DYM A;  5AZH A;  4EFO A;  3NVW A;  4A3P A;  2YEP F;  4HCP B;  3PT2 B;  3UGB B;  3L08 A;  4JPS A;  2V4L A;  3DPD A;  2WX0 A;  3HIZ A;  1WFY A;  5J2R A;  1V80 A;  1YMH E;  2G4S A;  1QZE A;  3BYY B;  3NY5 A;  2LUM A;  1KF6 B;  2N9P C;  1Z5S B;  4ZRI A;  2KD0 A;  1DGJ A;  2OED A;  1I35 A;  4M01 A;  4IWQ A;  5E6J A;  2MP2 B;  1VZ7 A;  5E6O A;  4C4V B;  2LFI A;  5AUI A;  4XDC A;  3W1S C;  3D32 A;  2LXA A;  3ZIM A;  2KWU B;  4HRS A;  5DPR A;  1WGG A;  1SJH D;  3DVG Y;  3JW0 X;  2MBE A;  5MPO A;  3BIN A;  4DXF A;  4KZC A;  2LHD A;  1DOX A;  4ARI A;  3KQ4 A;  5TSS A;  1SXT A;  1F1H A;  1I4P A;  3GB1 A;  1ENF A;  1WGR A;  4NAW A;  2LVQ A;  2M0X A;  1VD2 A;  2KDM A;  4BKT A;  2PE9 A;  1J7A A;  2ZPY A;  2MA9 B;  2QIL A;  1UD7 A;  5IKC M;  1P3Q U;  4BBN F;  1J0G A;  4HPM B;  2Z0D B;  3U2S C;  1GOZ A;  1ET6 A;  3I57 A;  3P2B A;  4AQ7 A;  1V1P A;  4WIP A;  4QAY A;  4N6E B;  1PFD A;  2LMC A;  2V9H A;  4GDK B;  3Q2A C;  4OZA A;  2IBI B;  4X57 B;  3WAM A;  1FXT B;  3BVZ A;  3PPA A;  1S3S G;  2GBJ A;  3AN1 A;  3S2A A;  3PLV A;  3IXS A;  3FIL A;  2X8X X;  4AUQ C;  2KDI A;  4BAX A;  2IY1 B;  4S17 A;  4IKG A;  2O6V D;  2WXM A;  2RDH A;  4USA A;  3T9L A;  3ZXV A;  1OTR B;  3N1Z C;  3AU5 A;  1Y8R C;  5AEK B;  1VZ6 A;  1YX6 B;  3EHV A;  3ZYY X;  4GOC A;  1QKZ A;  1TTN A;  1FCL A;  1RRB A;  2E6X A;  3Q3N C;  3Q8A A;  1L6U A;  2YVC A;  2D11 A;  2KMC A;  3Q6B A;  2V3P A;  3RCZ A;  3NZU A;  4PS8 A;  4ZRK A;  2A4Z A;  1QQR A;  1SJE D;  1TKE A;  4FUL A;  3V60 A;  1SF0 A;  2KN4 A;  4MGY E;  3MC8 A;  1H8C A;  1F0Z A;  4JE3 B;  4ZRJ A;  3QA8 A;  3APF A;  1ZE3 D;  1P7F A;  2CJO A;  4BZA A;  3SD5 A;  2KNB A;  2WXF A;  4KDI C;  1XQQ A;  4WH4 A;  3WAL A;  2J52 A;  5CX3 A;  3WAP A;  4O1N A;  1WR6 E;  3HUI A;  3V05 A;  3CSF A;  2KT7 A;  3QX1 A;  5DPS A;  3KUD B;  1N60 A;  4IM3 A;  4E71 A;  1YQ3 B;  3PRM B;  4HK2 A;  4HWI B;  3LJ3 A;  2N7J A;  1RFA A;  1WX7 A;  5EE1 A;  5I4D A;  2JT4 B;  3DWG C;  2KAN A;  4PT5 A;  4ZDV A;  3HM6 X;  1HZ5 A;  2KDE B;  3PRE A;  2MEK A;  2IGG A;  4YT0 B;  4HJK A;  2MP2 A;  2KC1 A;  2N9L A;  4RMA A;  4B6W A;  4TKN A;  1FRD A;  2KLC A;  2K0P A;  4XYC A;  5BYS A;  3ZJV A;  3DVN U;  1J7B A;  2JYE A;  1GJZ A;  2VH2 A;  2R2O A;  2REX A;  1C4P A;  1EWY C;  4MGZ E;  3W1S A;  1P98 A;  4A3O A;  3HVD A;  1XEE A;  2G3Q B;  2RMM A;  4AOF A;  3TEW A;  5BMG A;  3P63 A;  3APC A;  3TCA A;  2LJI A;  1YQ4 B;  3KUC B;  4W9E A;  1V2Y A;  4WWN A;  2BVC A;  1V81 A;  4GLS C;  2JZ3 B;  4W9G A;  3I63 C;  1N61 A;  2K1F A;  2Y5P A;  1NVI D;  2QEJ C;  2W3S A;  5LXH A;  2H89 B;  3VDZ A;  1ZOY B;  2ZNV C;  4XX5 A;  2BBC A;  1WJU A;  1MHH E;  4ITK A;  1SIJ A;  4XWT A;  3RI7 C;  3HK0 A;  1PUT A;  2K9X A;  2KTR A;  2HD5 B;  2GOW A;  1E8X A;  5IOI A;  3RPF C;  2WWZ A;  3ZKJ C;  1L6V A;  5HI1 A;  4WJQ A;  4IG7 B;  1C9F A;  2I1J A;  5E6N A;  1T0R C;  4TSS A;  2HJ8 A;  2X38 A;  2OJW A;  1WZ0 A;  1K50 A;  3BK1 A;  2CJN A;  1J8C A;  3QQ8 B;  2UWQ A;  2AL3 A;  4P16 A;  3H7P B;  1D5X C;  3Q3M C;  2MWS B;  5G5G A;  2PVG C;  1YQB A;  1A5R A;  2JF5 A;  3PZ8 A;  4HPP A;  1S1Q B;  2K39 A;  4RF1 A;  1FM0 D;  1NI2 A;  2DZK A;  1YN4 A;  2J7Q B;  1MPE A;  2MCN B;  1HTQ A;  2QDF A;  2C7H A;  4K7W A;  3A33 B;  2NBU A;  3PLU A;  1TS3 A;  2NCN A;  2WXR A;  1WJN A;  4C7Z A;  2H88 B;  1SGH A;  3KLS X;  3H6N A;  3NHE B;  2BYT A;  1C3T A;  4OVV A;  1GNU A;  4FXC A;  3ZNG C;  1D3Z A;  4GU2 A;  1FMA D;  2GBM A;  1NEK B;  3AE5 B;  5C2T B;  3B0A A;  1VR9 A;  1YOV B;  1TKG A;  1WIA A;  2I38 A;  1JWS D;  5DPT A;  4KGS A;  2WXH A;  4GDL B;  2JY6 A;  2WHI A;  2IO1 B;  3DVG X;  3OJ4 B;  2M17 A;  5E6P A;  4P6V F;  3DBH I;  4I6N B;  2I2Y A;  3VXW A;  3PHW B;  5KHQ A;  4WUR A;  2PTL A;  3LYY A;  1XLQ A;  4KSK C;  2DWQ A;  4F1S A;  3VFK A;  1F77 A;  1EO6 A;  4LNF A;  3I5J C;  2LD9 A;  1QT9 A;  4W9F A;  4N9F 4;  3AE9 B;  2WXK A;  2N7D A;  4JWS C;  2ZEQ A;  2C60 A;  1JAL A;  4MH0 E;  4R3D A;  2BB5 A;  4D2K A;  2FAZ A;  2UU7 A;  3Q8C A;  5AZF A;  1JML A;  4ANX A;  2JXT A;  3N1X C;  3DBH B;  1CK1 A;  1L2N A;  2RPV A;  3ZVV A;  1JRP A;  5BMI A;  3WA0 A;  2L7R A;  2LUE A;  1WE7 A;  1K51 A;  1WZ3 A;  2V1Y A;  4OVU A;  3RMK C;  1FEH A;  1U4A A;  4JX1 C;  3ONS A;  1KOT A;  3A9J A;  1L4Z B;  2IY0 B;  5FK9 C;  2ZW1 A;  4LK0 M;  4HJG E;  5FKA C;  4BOZ B;  3MJ5 A;  1FXA A;  3VUW A;  3ZLZ A;  4A90 A;  4DHJ B;  3SDL C;  3PZ7 A;  1FPY A;  2KZR A;  4P1C C;  2XBB C;  1N5X A;  3L13 A;  2PEA A;  1YD8 U;  2MJE A;  3PHX B;  5EDS A;  2W3R A;  3QC8 B;  2AQ1 B;  4IM0 A;  3DCG A;  2KKC A;  3OWE B;  4XWW A;  3ECI A;  4C56 C;  4MEM A;  4NNJ B;  4WJN A;  4BKS A;  1SB3 C;  4I6P A;  2EKE C;  4AP4 C;  4YXD B;  1L0X B;  1WMH B;  3WAO A;  3RZF A;  1C79 A;  3M95 A;  4ZOH C;  1JWM D;  4EZL A;  1P7E A;  2C5L C;  2LGD A;  1UNS A;  3B08 A;  3SFD B;  2E3T A;  4NQL B;  4DXG A;  1Q0W B;  4DK5 A;  4OW0 A;  2N9X A;  1V9J A;  3AE1 B;  1FCC C;  2D3G A;  1UBQ A;  2QC8 A;  5CTR C;  1GG3 A;  1IGD A;  3E9S A;  2WXI A;  3GZN I;  1E9M A;  3QAQ A;  2AX5 A;  1I4Q A;  3VUX A;  3RNC C;  3RNG C;  3CST A;  4PYZ A;  4DQO C;  1E8Z A;  3DBR B;  1T6B X;  2K25 A;  5C23 A;  2O2V B;  1WM3 A;  3BK2 A;  1FFU A;  2RGF A;  4DBG A;  3Q14 C;  3AE2 B;  2BYV E;  1E0Z A;  1PQS A;  2JZP A;  2WYQ A;  1ROE A;  1SSN A;  1F2R C;  2MQJ A;  3MHS D;  3N20 C;  4US8 A;  3K9P B;  1V97 A;  2AWT A;  5FR3 A;  3C19 A;  3NVY A;  5LNK 1;  1HQR D;  3GOE A;  3AE4 B;  3ALB A;  3IT6 B;  3NZS A;  3TL5 A;  3H1U A;  3Q8E A;  4TQ1 A;  1ACC A;  4GMV A;  4YWG G;  3NVZ A;  2EMS A;  1FO4 A;  5J17 A;  4EE2 A;  3VH3 B;  1N62 A;  3ZTD A;  3FC4 A;  3A9K A;  1HEZ E;  1XXG A;  3PVL A;  2L76 A;  1WJ6 A;  4TUU A;  2PMV A;  2JVC A;  3WAN A;  2KC2 A;  3PV1 A;  1RAX A;  3IBE A;  1OQR A;  1FNV A;  2W9N A;  3TEZ A;  3UIN B;  4AJY B;  1WE6 A;  1TIF A;  5CHW A;  1TBE A;  2WQY B;  2PIA A;  2GRI A;  3WIM A;  1CQV A;  2MBH A;  2GI9 A;  4GXB A;  4DDG D;  4OZB A;  3EA6 A;  2LJ5 A;  2L1A A;  2TSS A;  3O13 A;  4G0N B;  2IPK D;  4A8X C;  1V6E A;  4G3X B;  2EEL A;  3IAS 1;  4MM3 A;  1JQ4 A;  1PGX A;  5DCN A;  2AEH A;  5JHA A;  2FCS A;  3DBL I;  1FNU A;  2JRH A;  3GP7 A;  3TUO A;  3P4R B;  2BW2 A;  1AYF A;  2DYO A;  1L0Y B;  2LGI A;  4ACF A;  3FAH A;  4JL9 A;  2WDV B;  1DOY A;  2I1K A;  2MH7 A;  4FHK A;  1WXS A;  1ZXH A;  3RZW C;  5D7G A;  2L32 A;  2KQS A;  1JWA D;  1QOF A;  1LXD A;  4M8M A;  2LHE A;  1AN8 A;  4M0W B;  4G50 A;  4MDK E;  3SEB A;  5AZG A;  3SHQ A;  5H8Y E;  2FID A;  3EGR A;  3BZD B;  3KYD D;  4RM8 A;  1N5W A;  3MHZ A;  1L4D B;  2WP9 B;  2KJR A;  3JVZ X;  3BY4 B;  1OFF A;  4WJO A;  4ARC A;  1V5T A;  2NBV B;  2M56 B;  1VJK A;  2KX3 A;  3DOW A;  4PK1 A;  3J9C A;  2KVR A;  4E74 A;  2WNM A;  5CHF A;  2L83 A;  2BYF A;  4IUM B;  1UWM A;  1LQB A;  3DHI C;  2MLB A;  1RLF A;  4HEA 1;  1L5P A;  1IUE A;  2M1M A;  3R7R A;  4HDO A;  2V4I B;  3TBL D;  2N4F A;  3OAW A;  3AE7 B;  3GE8 C;  3VAW A;  3N1Y C;  2Q5W D;  3QAR A;  3RNB C;  3ENE A;  2AQ3 B;  4KIK B;  2FCQ A;  2WLB A;  2WU2 B;  2L00 B;  3AM9 A;  1WGK A;  2WGS A;  2K8C A;  2CU3 A;  1SE2 A;  1D6E C;  2KMM A;  1C1Y B;  2W55 A;  1JWB D;  1OQQ A;  4I6L B;  1P1A A;  1T0S C;  1CZP A;  4NJ6 A;  2IO0 B;  4WAF A;  3NS1 A;  3KYC D;  4HLE A;  2JSV X;  4WAA A;  4FN2 A;  2PW9 A;  1EU3 A;  2OHF A;  2D07 B;  3B1L X;  4BKS D;  2Z59 B;  4EZK A;  4URK A;  2NBW B;  4US9 A;  3DBS A;  2ICI A;  4B95 A;  1OGW A;  2XK5 B;  2DEN B;  2K6D B;  2KJH B;  1R7S A;  1V8C A;  5C1Z A;  1V49 A;  2BS3 B;  4C7Y A;  3VQI A;  3CMM B;  4C4V A;  1E5W A;  5BO4 B;  3AEC B;  1L0V B;  2WU5 B;  3Q8B A;  3Q8F A;  3JSV B;  5GXG B;  2AQ2 B;  3URY A;  3ETR A;  3AE6 B;  4NZL B;  1RFK A;  2G9H D;  3VRB B;  3HHM A;  5IO9 A;  4C00 A;  2WDT B;  1T0Y A;  3L0W B;  5EE9 A;  3AEG B;  1R4M I;  3A1Q B;  2MBO A;  4XDD A;  2DX5 B;  3I9V 1;  3O65 B;  4MEL A;  5KHO A;  3V3X A;  1PDX A;  1EU4 A;  1P9D U;  2K8H A;  4FLH A;  3RN9 C;  2IGD A;  2FUG 1;  4AJW A;  3N30 A;  4NQK E;  1ZXI A;  2BS2 B;  1XLO A;  2CS4 A;  5EE3 A;  1N6Z A;  3NG0 A;  3Q3F A;  1J19 A;  2FUH B;  1WX9 A;  1R4M B;  2JZZ A;  4FJV B;  2GBK A;  2KFK B;  1HZ6 A;  3ZNH B;  3I3T B;  1UBI A;  4JIO U;  4DHZ E;  4XE0 A;  3DDC B;  2J42 A;  1EF1 A;  1E90 A;  4C80 A;  2HE7 A;  4W9I A;  4RGM A;  3VTU A;  4MJS B;  4GDK A;  4WQM A;  2HJ1 A;  1I42 A;  3ABV B;  3RUI B;  3AEF B;  1WRD B;  1KRH A;  4TMA B;  4ASW C;  3ML9 A;  4WWP A;  1Y56 A;  3AEE B;  3DVN V;  4IOI E;  1TY0 A;  1TZ1 A;  1ZPS A;  4DXA B;  3VR9 B;  1TS2 A;  2LGX A;  2M0A A;  2W82 A;  3IG3 A;  1E7V A;  4RH6 A;  4MGI E;  1JRU A;  4P1B C;  3PO0 A;  5FR6 A;  2FCM A;  2ZCB A;  2JUO A;  1QLB B;  3EFC A;  2QIE B;  4CQN A;  2WXL A;  2YEP B;  4YL8 A;  3Q3J A;  3M63 B;  2KQ4 X;  1KTK A;  2MBQ A;  1RWS A;  2OJR A;  2WXQ A;  2JPH A;  1MG8 A;  4JWU C;  4JQW C;  4LNN A;  1OQY A;  1YN3 A;  3UIP B;  2ZPN A;  1BXT A;  2KWC A;  2LGY A;  3RYT A;  2IGH A;  2CHX A;  4PS7 A;  5T8I A;  2JQR B;  2L8J A;  4B9K A;  1FFV A;  1YN5 A;  2LVO A;  4IDI A;  4K1R B;  3JYU A;  2KQ7 A;  1C76 A;  2BTE A;  1VCB A;  4WJP A;  2MBB B;  2N7E A;  3PGE A;  5CHV C;  3X0W A;  4NAM A;  5C3J B;  2DYB A;  3L10 B;  4GB9 A;  4GIV A;  3DQV A;  5HFY A;  2KK8 A;  1D5M C;  2D2Q A;  4RFB A;  1N63 A;  3P42 A;  2J0J A;  2R2Q A;  1JRO A;  3BVM A;  3RNF C;  4B0M A;  3R8B A;  3UQB A;  1KH0 A;  1YX5 B;  3VUY A;  4EOY A;  2KWV B;  3R2T A;  1Q1O A;  4L1B A;  3VTV A;  4W9C A;  4MSM B;  3IAM 1;  4REZ A;  1WGD A;  1NI3 A;  1FXI A;  2CKH B;  1CJE A;  2D5G A;  3CIR B;  5G5H A;  3ZJT A;  2DHZ A;  2XNA C;  1GB1 A;  1PGA A;  1UUP A;  5BYQ A;  1ZP0 B;  1OEY A;  4KDL B;  4MSQ B;  3JSV A;  3KW5 B;  1E8Y A;  1GPX A;  1WM2 A;  1GAQ B;  1UEL A;  2GBN A;  1OEY J;  2HTM E;  3AU4 A;  1UF0 A;  3A1Q A;  1MJD A;  1ISN A;  3T8M A;  3GS2 A;  2L0F A;  2K8B A;  4LNK A;  3H9D A;  2MX2 A;  2IDY A;  3ZTC A;  2VZK B;  4ANU A;  5L95 C;  2FCN A;  2KOX A;  5BYR A;  2PVO D;  3AB5 A;  1WGY A;  3KWV A;  3ZUN A;  1E8W A;  4ZRQ A; 
#chains in the Genus database with same CATH homology
 1RAX A;  3QA8 A;  3KUZ A;  4EKU A;  2JXX A;  1NDD A;  3APF A;  3IBE A;  2W9N A;  3UIN B;  2KFK A;  2KDF B;  1KJT A;  4NAW B;  1WXV A;  2LI5 A;  1WE6 A;  4AJY B;  4IWO A;  3SD5 A;  2KNB A;  3IHP C;  3AUL A;  4W9L A;  2PPH A;  2IZV B;  2KX0 A;  2N1V A;  4KDI C;  2KDB A;  5CHW A;  1TBE A;  1XQQ A;  3U30 A;  3WAL A;  2KJ6 A;  2KFJ A;  2CU1 A;  5CX3 A;  3PRZ A;  3WAP A;  3IFW B;  3WIM A;  2MBH A;  2K6Q A;  3VH4 B;  1WR6 E;  3K9O B;  4KIK A;  1LM8 B;  3CSF A;  2L0T A;  3ZNZ B;  4GXB A;  5G55 A;  4DDG D;  2RSU A;  3QX1 A;  1IYF A;  5DPS A;  4FJY A;  3KUD B;  2IO3 B;  1K8R B;  2BF8 B;  4HXD A;  4IM3 A;  3OJ3 A;  4E71 A;  3QHT A;  2LJ5 A;  2UYZ B;  3PRM B;  2G4D B;  4HK2 A;  2OOB B;  2V3S A;  1WX8 A;  1WXM A;  3LDZ E;  3N32 A;  2AL6 A;  1IPG A;  3PSE B;  4G0N B;  4HWI B;  3LJ3 A;  2KN5 A;  1V6E A;  4G3X B;  2BYE A;  2RD0 A;  5JHB A;  1RFA A;  4MM3 A;  1WX7 A;  1X1M A;  2A5U A;  2JT4 B;  4A20 A;  1WI0 A;  2KAN A;  4GN1 A;  3C0R B;  5DCN A;  4HVB A;  4ZDV A;  2AEH A;  5JHA A;  3HM6 X;  3QK0 A;  2FCS A;  3DBL I;  2JRH A;  2KDE B;  3H7P A;  3PRE A;  5J18 A;  4HJK A;  2CR5 A;  2MP2 A;  2KC1 A;  3VTW A;  2GBR A;  2DYO A;  3VVW B;  4RMA A;  2ZJD A;  4JL9 A;  4B6W A;  4TKN A;  4E3C A;  2KLC A;  2I1K A;  4FHK A;  3DVN U;  1WXS A;  1GJZ A;  3RZW C;  5D7G A;  1H4R A;  2KQS A;  2R2O A;  1BT0 A;  1LXD A;  2REX A;  4M8M A;  4MGZ E;  3AI5 A;  4M0W B;  4G50 A;  1P98 A;  2C7M B;  3W1S A;  4MDK E;  4A3O A;  1UH6 A;  5AZG A;  3SHQ A;  2G3Q B;  1WYW B;  4AOF A;  2FID A;  1NBF C;  2XK5 A;  3ZO5 B;  2JRI B;  3KYD D;  2HTH A;  4DHZ B;  2Z0E B;  3APC A;  4RM8 A;  2DAJ A;  4ZRJ A;  3TCA A;  3KUC B;  4W9E A;  4HPL B;  4EZJ A;  1G6J A;  3U8Z A;  1V2Y A;  4WWN A;  4BOS C;  1V81 A;  2KJR A;  3ML8 A;  3JVZ X;  2JZ3 B;  4BBN C;  4DDI D;  4J6I A;  4W9G A;  3BY4 B;  2ZZP B;  3EC8 A;  4WJO A;  4F7Z A;  3A4S C;  1V5T A;  2KLG A;  1E7U A;  2MSE D;  2NBV B;  3A9K B;  4F8C B;  1XD3 B;  2K1F A;  2D10 A;  4LDT B;  2KX3 A;  3DOW A;  2BWE S;  2DZI A;  4ANW A;  1Z2M A;  2KVR A;  1YIW A;  4E74 A;  2J0K A;  5LXH A;  4BVU C;  5CHF A;  2BYF A;  4IUM B;  3VDZ A;  2ZNV C;  2J0M A;  1LQB A;  4XX5 A;  2MLB A;  1SIF A;  1RLF A;  1WJU A;  2M1M A;  4TQ0 A;  3PTF C;  3R7R A;  3ZDT A;  4HDO A;  2FIF A;  3HK0 A;  3TBL D;  2KXJ A;  2N4F A;  2PJH A;  3OAW A;  2O6V A;  2LRU A;  3VAW A;  1SE9 A;  2CHW A;  4GDL A;  3V61 A;  2KTR A;  2HD5 B;  2M8S A;  3QAR A;  2GMI C;  4K81 A;  2GOW A;  2BGF A;  3ENE A;  3RT3 B;  1E8X A;  2FCQ A;  4KIK B;  1M94 A;  2BKR B;  2KO3 A;  2WWZ A;  2L00 B;  3ZKJ C;  4LDT D;  2K8C A;  2LWP A;  2PE6 B;  3QCA A;  4RM9 A;  4WJQ A;  2L3Z A;  4IG7 B;  4P7I A;  2I1J A;  5E6N A;  2LZ6 A;  4KSL C;  4DHJ D;  1C1Y B;  2HJ8 A;  3RUL A;  2MRP A;  5DPW A;  4I6L B;  1P1A A;  1WZ0 A;  4NJ6 A;  2IO0 B;  4IM2 A;  1J8C A;  3QQ8 B;  2B3A A;  2UWQ A;  4TV3 A;  2AL3 A;  3KYC D;  4HLE A;  4II3 B;  2MW5 A;  3H7P B;  5GMV A;  4WAA A;  2ZCC A;  2YLM A;  4MJS A;  4FN2 A;  4EEW A;  1XT9 B;  2MWS B;  4WQO B;  1YQB A;  2LAS A;  1A5R A;  2JF5 A;  4ICV A;  2D07 B;  3B1L X;  2DAF A;  2Z59 B;  4BKS D;  4EZK A;  4URK A;  2NBW B;  1S1Q B;  2K39 A;  3IVF A;  4ANV A;  3DBS A;  4EUT A;  4KZ0 A;  1NI2 A;  2DZK A;  3SU8 X;  4B95 A;  1F9J A;  2J7Q B;  2NPT A;  3TIX A;  2MCN B;  1OGW A;  2XK5 B;  2DEN B;  2K6D B;  2KJH B;  3QJZ A;  2C7H A;  2KHW B;  2QHO A;  4FJZ A;  2NS5 A;  3ZDM C;  3QIJ A;  4K7W A;  5C1Z A;  1WGH A;  1AAR A;  4PS3 A;  3A33 B;  1V49 A;  2LRW A;  2NBU A;  3VQI A;  3CMM B;  3PLU A;  4IC7 B;  3UIO B;  4K7S A;  1E5W A;  4GGQ A;  2ZVO A;  3H7S A;  5BO4 B;  1TGZ B;  2NCN A;  5IA7 A;  1WJN A;  4LJO B;  3JSV B;  1SGH A;  4HDQ A;  2CHZ A;  3H6N A;  3NHE B;  1C3T A;  2BKF A;  4OVV A;  2FNJ B;  1GNU A;  3EFU A;  3HHM A;  5JZE B;  3ZNG C;  3DBR I;  2WDT B;  1D3Z A;  4GU2 A;  2RR9 A;  1T0Y A;  3L0W B;  2GBM A;  4K7U A;  1R4M I;  1V5O A;  2N9E B;  1IP9 A;  2IO2 B;  3A1Q B;  3B0A A;  4W9J A;  2MBO A;  1GC7 A;  1WF9 A;  3PS6 A;  4DHZ E;  2DX5 B;  1WIA A;  3O65 B;  4ZYN A;  3ZRF A;  5DPT A;  4MEL A;  2VRR B;  5KHO A;  1ZGU B;  3KVF B;  3M3J A;  5IAA C;  4GDL B;  1HE8 A;  2JY6 A;  4IW0 A;  2RPQ A;  2KTR B;  1P9D U;  1WMH A;  2IO1 B;  3DVG X;  1L7Y A;  1P0R A;  2K8H A;  5D6J B;  4FLH A;  3UQA A;  1KLV A;  2BWF A;  4XC2 A;  3OJ4 B;  5LLI A;  1EF5 A;  1WJ4 A;  2M17 A;  3EEC A;  5E6P A;  2NVU I;  4AJW A;  1V86 A;  3N30 A;  3DBH I;  4I6N B;  4NQK E;  2L05 A;  1WR1 A;  3VXW A;  3PHW B;  5KHQ A;  2CS4 A;  4NPN A;  3Q3F A;  4KSK C;  4F1S A;  1J19 A;  2FUH B;  1WX9 A;  3VFK A;  3R7Q A;  4DWF A;  1EO6 A;  2JZZ A;  1WY8 A;  4FJV B;  3X23 A;  2GBK A;  2LD9 A;  3R3M A;  2KFK B;  3CF6 E;  3NS8 A;  4W9F A;  4N9F 4;  1LFD A;  3ZNH B;  2N7D A;  3I3T B;  1UBI A;  2M4N A;  2ZEQ A;  4JIO U;  2C60 A;  3MTN B;  4HCN B;  3DDC B;  4W9K A;  5TR5 A;  3V6E B;  3ZRC A;  4MH0 E;  4JGH B;  3APD A;  1EF1 A;  5D94 A;  4CO7 A;  2BPS A;  3N3K B;  2FAZ A;  5AZF A;  2N1W A;  1E90 A;  4FHJ A;  2DYM A;  5AZH A;  4EFO A;  4ANX A;  2HE7 A;  4W9I A;  3VTU A;  4MJS B;  1Q5W B;  2ZVN A;  4GDK A;  4A3P A;  1L2N A;  1I42 A;  3ZVV A;  4KVG B;  2L7R A;  3U7D A;  2LUE A;  1WE7 A;  4HCP B;  3RUI B;  3WA0 A;  4CHK A;  4BFR A;  3PT2 B;  2AYO B;  3UGB B;  3L08 A;  3MJW A;  1WZ3 A;  1WRD B;  2G45 B;  2V1Y A;  2V4L A;  3DPD A;  4ASW C;  1CMX B;  2WX0 A;  3HIZ A;  3ML9 A;  4OVU A;  4WWP A;  3HM3 A;  1WFY A;  5J2R A;  1V80 A;  2G4S A;  3DVN V;  2O2V A;  1QZE A;  2WX1 A;  3NY5 A;  3R66 C;  1U4A A;  5LXI B;  3ONS A;  4LJP B;  1KOT A;  2N9P C;  1TZ1 A;  1Z5S B;  3A9J A;  2IY0 B;  3OLM D;  4ZRI A;  2KD0 A;  4DXA B;  2LGX A;  2C7N B;  1I35 A;  3IG3 A;  1E7V A;  4BOZ B;  4MGI E;  1ZKH A;  1JRU A;  4IWQ A;  2MP2 B;  2JWZ A;  3L16 A;  4IWP A;  5FR6 A;  2FCM A;  2ZCB A;  3VUW A;  3ZW3 A;  5E6O A;  2JUO A;  3ZLZ A;  4DHJ B;  3SDL C;  4YL8 A;  1R4N I;  3W1S C;  2KZR A;  3Q3J A;  3D32 A;  3M63 B;  4XZ4 A;  2LXA A;  3ZIM A;  2XBB C;  3L13 A;  2PEA A;  2KWU B;  1YD8 U;  2MBQ A;  2OJR A;  3PHX B;  4AWJ A;  5EDS A;  1YJ1 A;  2JPH A;  3QC8 B;  5DPR A;  1GC6 A;  1WGG A;  3DVG Y;  1MG8 A;  2KKC A;  3DCG A;  4IM0 A;  4M8N A;  2ASQ A;  3JW0 X;  3ZNI D;  2MBE A;  4JQW C;  3BIN A;  5G2N A;  4KZC A;  1OQY A;  3V6C B;  1UGM A;  3UIP B;  4II2 B;  2ZPN A;  3ECI A;  4MEM A;  2KWC A;  4NNJ B;  2LGY A;  4WJN A;  3RYT A;  3TMP B;  4NJ7 A;  2CHX A;  4PS7 A;  3PZD A;  3UF8 A;  4BKS A;  4I6P A;  2EKE C;  4AP4 C;  2L8J A;  4B9K A;  2LVO A;  4K1R B;  1WMH B;  3WAO A;  3JYU A;  2KQ7 A;  1WGR A;  3RZF A;  1VCB A;  3M95 A;  4NAW A;  4WJP A;  4EZL A;  2DZM A;  2C5L C;  2MBB B;  2N7E A;  5JH5 C;  1WH3 A;  2LVQ A;  3PGE A;  2M0X A;  2LGD A;  1VD2 A;  5CHV C;  2EMT A;  4BKT A;  3QWZ B;  3B08 A;  3PRP B;  2PE9 A;  3X0W A;  3W1Y A;  2ZPY A;  3A4R A;  2DYB A;  4W9D A;  2MA9 B;  3L10 B;  4GB9 A;  4NQL B;  3V62 A;  4GIV A;  1UD7 A;  3DQV A;  3NOB A;  1Q0W B;  2KK8 A;  4DK5 A;  2N9X A;  1V9J A;  4CYE A;  2D3G A;  1P3Q U;  1UBQ A;  4BBN F;  5CTR C;  1J0G A;  1GG3 A;  4HPM B;  2O6V B;  2Z0D B;  2KMA A;  3P2B A;  3L17 A;  2D2Q A;  1EUV B;  3GZN I;  5D2M B;  4FA6 A;  5L83 A;  3QAQ A;  2Y5B B;  4KV2 A;  4GDK B;  2J0J A;  2R2Q A;  2IBI B;  4X57 B;  3VUX A;  3WAM A;  1FXT B;  4NY0 A;  4JLC A;  3CST A;  3KH0 A;  1YX5 B;  2DZJ A;  4PYZ A;  4WWO A;  3UQB A;  3VUY A;  2LXC A;  4EOY A;  1E8Z A;  2KWV B;  1Q1O A;  3PPA A;  3VTV A;  4MGK E;  4W9C A;  1S3S G;  2K25 A;  4MSM B;  4W9H A;  4FAD A;  2GBJ A;  5C23 A;  2O2V B;  3S2A A;  1WGD A;  1WM3 A;  3PLV A;  2XEW A;  2RGF A;  2CKH B;  4DBG A;  2DHZ A;  4GSW A;  4AUQ C;  2BYV E;  3A9J B;  1PQS A;  2KDI A;  2IY1 B;  2WYQ A;  2NR2 A;  4G11 A;  4LCD E;  1OEY A;  4KDL B;  2O6V D;  2MQJ A;  3MHS D;  4MSQ B;  3JSV A;  3RD2 A;  3T9L A;  3KW5 B;  1E8Y A;  4ICU A;  1GUA B;  3K9P B;  1WM2 A;  1OTR B;  2AWT A;  4PYU A;  1UEL A;  2GBN A;  1WXA A;  1OEY J;  3AU5 A;  1Y8R C;  5AEK B;  3GOE A;  3ALB A;  1YX6 B;  3AU4 A;  3NZS A;  3TL5 A;  4FBJ B;  1UZX B;  2C9W B;  3A1Q A;  3VHT C;  3H1U A;  1ISN A;  3EHV A;  3T8M A;  4TQ1 A;  4GMV A;  4GOC A;  1ZW7 A;  2ZNV B;  2EMS A;  1TTN A;  1RRB A;  2K8B A;  2L0F A;  3AXC A;  5J17 A;  2NPT B;  2YVC A;  3H9D A;  2LVP A;  3VH3 B;  2MX2 A;  2D11 A;  2KMC A;  3ZTD A;  5HKH A;  3RCZ A;  3ZTC A;  3NZU A;  3A9K A;  3M62 B;  4PS8 A;  4ZRK A;  2A4Z A;  2KTF A;  4BKG A;  4ANU A;  3PVL A;  5L95 C;  2L76 A;  1WJ6 A;  2FCN A;  2KOX A;  4FUL A;  4TUU A;  3V60 A;  2IYD B;  1KM7 A;  2JVC A;  1WGY A;  4MGY E;  3TJP A;  1H8C A;  3L54 A;  3WAN A;  2KC2 A;  3PV1 A;  3ZUN A;  1E8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...