2BYFA

Nmr solution structure of phospholipase c epsilon ra 2 domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
116
structure length
116
Chain Sequence
SSEEESFFVQVHDVSPEQPLTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipase
molecule keywords PHOSPHOLIPASE C, EPSILON 1
total genus 20
structure length 116
sequence length 116
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2byfA01
2IO2B 2Z0EB 1SGHA 3A1QB 4TV3A 1LQBA 1WZ3A 3RZWC 2DX5B 4IWQA 1WGDA 3TL5A 4MGIE 4IM3A 3WA0A 3RYTA 1EO6A 4EZLA 3IFWB 2WX1A 3AXCA 2IY1B 3RZFA 3WAMA 2L76A 1OGWA 2KNBA 5KHOA 1WR6E 3PRZA 1WXMA 4AP4C 2KVRA 1KOTA 3PSEB 1T0YA 3CSTA 4TKNA 4NPNA 2DZKA 2LWPA 3V6EB 4BKGA 5D6JB 2MRPA 3L17A 2V4LA 4KDIC 3KW5B 4PYUA 4BBNF 1WGGA 4HCPB 1TZ1A 4EEWA 2FIDA 2M1MA 1VD2A 3IBEA 3WIMA 4DDID 5EDSA 4CO7A 4DHZE 3PTFC 3DBHI 2ASQA 2LASA 4EOYA 1M94A 2NVUI 4NAWB 3X0WA 4ANWA 2FIFA 2FAZA 1E8WA 2A5UA 4AJWA 4BVUC 3UGBB 3KH0A 3NY5A 1WH3A 5JH5C 4LCDE 2BKFA 4M0WB 3VUYA 1WXVA 3ZO5B 5J17A 2KO3A 3QAQA 3TJPA 2K39A 5BO4B 4FBJB 3L10B 2L8JA 2LGDA 2LUEA 2K6QA 2MLBA 2OJRA 3QK0A 3TBLD 2CHXA 5E6PA 2KX0A 2O2VB 3SHQA 4I6PA 4A3PA 5KHQA 1RRBA 1L7YA 2ZZPB 4GGQA 1EF1A 2MQJA 1X1MA 3KVFB 2JVCA 3QCAA 3UINB 1I35A 2V3SA 1ISNA 2VRRB 1KM7A 1V81A 1WF9A 4IWOA 4MJSA 5CTRC 1EUVB 1WX9A 4LDTD 4PS3A 4PS8A 3DOWA 2DZIA 2ZJDA 5DPWA 2CHZA 2L0TA 3P2BA 1IYFA 5JHAA 2AYOB 2WX0A 2M4NA 3A9KA 2DYBA 3EECA 2D11A 2PEAA 3DVNU 4ICVA 4ZRKA 5D94A 2GBMA 2KDFB 3W1YA 1WGRA 2KZRA 3VH4B 4K7SA 2DZMA 5C1ZA 4F1SA 3QX1A 1E8YA 4DDGD 3RULA 5DPSA 4TQ1A 1LXDA 1HE8A 2AWTA 2IZVB 1RLFA 2EKEC 2ZCCA 4WWPA 4EZJA 1C3TA 4BKSD 2GBJA 1P3QU 3GZNI 2C7NB 2N9XA 3O65B 5C23A 1V80A 3QQ8B 5LXHA 1E5WA 2RGFA 3DVNV 3HM6X 3QJZA 3W1SC 2KDBA 4DHJD 3ENEA 4G3XB 4A20A 2KXJA 2DYMA 2JF5A 2BYVE 3T9LA 2KQSA 3A9JA 3OJ3A 1WXAA 2KTRB 3BINA 4EKUA 2HJ8A 2BGFA 5D2MB 2JUOA 2KX3A 2CR5A 3A9KB 4FJZA 5G55A 3KUCB 4GDLB 1WE6A 2DHZA 3D32A 4TQ0A 2CS4A 2MWSB 2J7QB 3PPAA 4HWIB 2N1VA 5D7GA 4AWJA 3ZNHB 4EUTA 3DCGA 4PS7A 4KIKB 3AI5A 5DPRA 4K7UA 1J0GA 2HD5B 2GBRA 5AZHA 4HDQA 1YD8U 4W9DA 2L0FA 2REXA 4RM8A 2KJHB 1OTRB 2NPTA 4G11A 5TR5A 3ZTDA 3H1UA 2G4SA 1WX8A 2Y5BB 2KK8A 4NQKE 3VAWA 1IPGA 2LI5A 2PJHA 1PQSA 3PT2B 3QARA 4IW0A 4WJPA 4B9KA 2N9EB 4NQLB 3L08A 2K6DB 3VQIA 3RCZA 4HPLB 3ZDMC 4W9IA 2MBOA 2KC1A 3PREA 4II3B 4F7ZA 2BWFA 1XQQA 2KQ7A 2KMCA 3VXWA 4HPMB 4ANVA 2YLMA 3UF8A 5CX3A 4N9F4 2HE7A 4XX5A 4DXAB 1V2YA 1FXTB 1WGHA 2IO0B 2IO3B 2KTFA 3GOEA 4FN2A 3DQVA 2KHWB 2LJ5A 1P0RA 2LXCA 2ZNVB 2I1KA 2J0MA 4LJOB 4B95A 1J8CA 4M8MA 4BFRA 2KDIA 3HHMA 4DWFA 2L7RA 3ZKJC 3UIOB 3KYDD 3OAWA 3NZUA 4OVVA 2C7HA 3MHSD 4GMVA 1SE9A 1GUAB 3I3TB 4WJOA 1Z2MA 5E6NA 4F8CB 2JRHA 2LGYA 4GXBA 4X57B 4GDLA 3PV1A 2J0JA 5JHBA 1MG8A 2I1JA 1EF5A 2ZVNA 2CKHB 1AARA 3U8ZA 2BPSA 3SD5A 4GOCA 2O6VD 2K1FA 2GBNA 1UH6A 3U30A 2D3GA 4E74A 1WFYA 3WAOA 1WZ0A 4ZRJA 2K25A 4KSKC 3ZW3A 1P1AA 1ZW7A 3VH3B 3PRPB 3V62A 2LGXA 2DYOA 5LLIA 3TCAA 3ZDTA 1OEYJ 1H4RA 4E71A 1XD3B 2GMIC 2G45B 2DAFA 2RR9A 1CMXB 4W9HA 2KOXA 4K7WA 2IYDB 4YL8A 4WQOB 3R3MA 4IWPA 1RFAA 3PS6A 1V9JA 3Q3JA 4ANUA 2JPHA 3M62B 3QHTA 1E8ZA 2D2QA 1UELA 3AU5A 2EMSA 4MEMA 1R4NI 3NS8A 1IP9A 3N30A 3PHXB 1WJ4A 1Z5SB 4J6IA 4FHKA 3NHEB 3UIPB 1YX6B 2KMAA 2XBBC 2PE9A 1R4MI 3N32A 3JW0X 3L54A 4IG7B 1OEYA 2MW5A 5E6OA 4JLCA 2GOWA 2J0KA 2NS5A 3ZVVA 1E7VA 5AZGA 2BYFA 4K1RB 4MSMB 4XC2A 3A9JB 3LDZE 2KN5A 3A4SC 3PHWB 4W9CA 2D10A 4K81A 5FR6A 4WWOA 3RUIB 1WYWB 1Q1OA 3ML8A 4XZ4A 2MBBB 4IM2A 4MH0E 1SIFA 4MM3A 2CU1A 3WAPA 3ZUNA 1J19A 2EMTA 4RM9A 4BOSC 2A4ZA 3WANA 2D07B 2C5LC 3PRMB 4GSWA 1UGMA 2FUHB 1WRDB 3WALA 2BF8B 1UD7A 2QHOA 3IVFA 5L95C 2ZPYA 2CHWA 2LXAA 2UYZB 4W9LA 2KTRA 4MELA 2N4FA 4JL9A 2XK5B 4IC7B 3VUXA 3ZLZA 2KWUB 3DBRI 2N9PC 4GU2A 3HM3A 1WX7A 4WJNA 1WXSA 1UBQA 3R7QA 2LRUA 4BOZB 3PVLA 4KV2A 5L83A 4DBGA 4FULA 3K9PB 1L2NA 2ZCBA 1BT0A 1GC7A 2WDTB 2L3ZA 1Y8RC 2OOBB 3AULA 4IUMB 2JY6A 3H9DA 4W9GA 1GG3A 3DDCB 2YVCA 3H7PA 1F9JA 2LVPA 2DAJA 2DENB 2IY0B 2MBEA 3DVGX 2MBHA 5J18A 2G4DB 4WAAA 3L13A 4CYEA 1YQBA 3R66C 3ZNZB 4DK5A 4WWNA 1K8RB 2KLGA 3A33B 1KLVA 3S2AA 5AEKB 2XEWA 5CHFA 1S3SG 2NCNA 4II2B 4EFOA 3M63B 2IBIB 4HK2A 4NJ6A 1V6EA 1E90A 3W1SA 2LZ6A 2FCSA 1D3ZA 5DPTA 2LVOA 5DCNA 2MCNB 2C9WB 3PLVA 2BKRB 3AU4A 4GN1A 3CSFA 2M8SA 5CHWA 2HTHA 2B3AA 1TGZB 2KJRA 2C7MB 3DBSA 1ZGUB 4IM0A 4BBNC 3M3JA 2R2QA 4I6NB 1UZXB 2LRWA 2UWQA 3A1QA 2KWCA 3RD2A 3L0WB 1OQYA 3OLMD 4MJSB 3B0AA 4ZDVA 3ZNID 4MGZE 1WE7A 2KDEB 3NOBA 4G0NB 4W9FA 4GIVA 3APFA 4W9JA 4JGHB 4JQWC 2JZ3B 4MGKE 4GDKA 1Q5WB 2O6VB 4OVUA 2JRIB 2AL3A 1WJUA 1WM3A 2XK5A 3VTUA 3CF6E 3R7RA 1E8XA 1V49A 2NBWB 5AZFA 3RT3B 1WJNA 2GBKA 2KLCA 2Z59B 2W9NA 3B08A 5GMVA 3VHTC 3IHPC 4LJPB 4MSQB 2MX2A 2FCNA 1I42A 2MBQA 2G3QB 4JIOU 3JYUA 2RPQA 1WJ6A 2AEHA 4RMAA 3QA8A 1WIAA 4FHJA 2K8HA 2RSUA 4GB9A 1V5OA 3ALBA 1S1QB 4WJQA 5G2NA 4ASWC 4KSLC 3SU8X 3SDLC 3UQAA 2JXXA 2LD9A 2NPTB 1G6JA 3M95A 1JRUA 1E7UA 4KZCA 3X23A 3ECIA 3V6CB 1GJZA 4FLHA 2JWZA 1LFDA 3ZRCA 3UQBA 1GNUA 3PLUA 3V60A 3ZRFA 2RD0A 3JSVB 4EZKA 2WYQA 2O2VA 3MTNB 3DPDA 3QWZB 3U7DA 3VUWA 3N3KB 4DHJB 3B1LX 2FNJB 4I6LB 2KFKA 2L00B 3KUDB 2PE6B 4A3OA 3JVZX 3ZNGC 3BY4B 3T8MA 1Q0WB 1WMHA 4ZYNA 2PPHA 4ZRIA 2DZJA 2IO1B 3MJWA 4BKTA 4HVBA 3A4RA 3EHVA 3KUZA 1NI2A 1V5TA 4ICUA 2M0XA 4PYZA 5CHVC 3QC8B 3PGEA 4MDKE 4KIKA 1P9DU 1WR1A 2V1YA 4FADA 3EFUA 4HJKA 3APDA 3PZDA 1C1YB 3H6NA 3HIZA 4W9EA 3VFKA 4B6WA 4G50A 4HXDA 4M8NA 3QIJA 4W9KA 4KDLB 2KC2A 2WWZA 3LJ3A 4HLEA 4BKSA 4NJ7A 2BWES 4FA6A 5IA7A 2C60A 2AL6A 4TUUA 2ZEQA 2KD0A 4AUQC 1WI0A 5JZEB 2Z0DB 4MGYE 2KWVB 1VCBA 4LDTB 2JZZA 1YX5B 4GDKB 2KKCA 4KVGB 4AOFA 1A5RA 3IG3A 2N1WA 3KYCD 2R2OA 3TMPB 1TBEA 2K8CA 2MSED 3VTVA 4E3CA 1XT9B 3C0RB 3H7PB 4NNJB 3L16A 3Q3FA 3H7SA 4ANXA 3NZSA 3DVGY 1P98A 2NR2A 4CHKA 2M17A 4DHZB 1WM2A 1U4AA 3APCA 3EC8A 3DBLI 2NBUA 2ZPNA 1KJTA 3ONSA 1WGYA 2KANA 3ZIMA 3VTWA 1H8CA 1V86A 4KZ0A 2LVQA 5J2RA 3TIXA 4P7IA 1UBIA 3ML9A 3VDZA 2K8BA 1YJ1A 5LXIB 4AJYB 1YIWA 1QZEA 2KFKB 2MP2A 4FJYA 2JT4B 2MP2B 2FCQA 1WY8A 2FCMA 1NDDA 4NY0A 1ZKHA 3V61A 2KJ6A 5HKHA 4FJVB 3JSVA 3CMMB 2O6VA 3VVWB 2L05A 1TTNA 1RAXA 2KFJA 1GC6A 3OJ4B 2MA9B 2N7EA 2ZNVC 4HDOA 3HK0A 1NBFC 4NAWA 4URKA 2N7DA 5IAAC 3ZTCA 3K9OB 1LM8B 2ZVOA 4HCNB 2BYEA 1WMHB 2NBVB
chains in the Genus database with same CATH superfamily
1SGHA 4TV3A 1LQBA 3LYYA 3Q6BA 2IY1B 2H89B 1KOTA 2WDQB 3L4PA 3B2GA 1XEEA 2DZKA 3U2SC 3SR6A 1JQ4A 3KW5B 4PYUA 1VJKA 3RNCC 3N9YC 2PVOD 4DHZE 1UUPA 2FUG1 1STEA 2YEPB 4EOYA 2FAZA 1E8WA 2GRIA 4IDIA 2ICIA 2KO3A 3HVDA 1AYFA 1KF6B 4WIPA 3C8YA 3ZYYX 3SHQA 4A3PA 1C77A 5KHQA 4GGQA 2MQJA 4YT0B 2JXTA 1PFDA 2I38A 2V3SA 1ISNA 1C4CA 1V81A 2KAJA 1EUVB 5DPWA 2HDEA 2ZJDA 1P7EA 2AYOB 3A9KA 2DYBA 4ICVA 2GBMA 1E6EB 4K7SA 2BS2B 5C1ZA 4F1SA 1E8YA 3FILA 1MHXA 1LXDA 1HE8A 2LUMA 1RLFA 2IZVB 2V0GA 1C3TA 1L4DB 1I4XA 1FXAA 2V4IB 5GXGB 3HM6X 4G3XB 2JF5A 1WXAA 3BINA 1FNWA 1SB3C 4EKUA 5D3IB 4XWTA 5D2MB 2KX3A 5G55A 1WE6A 2KMMA 5FK9C 1D5XC 2CS4A 2MWSB 2L83A 3ZGZA 1AW7A 4AWJA 4EUTA 3DCGA 2QCZA 1ROEA 3LXFA 4KIKB 4K7UA 2HD5B 5AZHA 3AV8A 4HDQA 2REXA 1OTRB 3ZTDA 3ZUNA 1WX8A 3VAWA 2LI5A 1Q10A 3PT2B 4WJPA 1R4NB 1BMLC 3E9SA 3VQIA 3ZDMC 3TEZA 2LHDA 3AE3B 4RGMA 4OW0A 3VR8B 4KGTA 2MJDA 1OQRA 2KT7A 3DHIC 4N9F4 1IGCA 2HE7A 1V2YA 1WGHA 2IO0B 2W54A 4LNNA 1P0RA 2KHWB 2LXCA 2ZNVB 4M8MA 1D4BA 1QOAA 4BFRA 2KDIA 3KYDD 3OAWA 2JQRB 5AUIA 4F8CB 3J9CA 4X57B 2I1JA 4M0WA 2ONQA 3U8ZA 3SD5A 2JU6X 2ZW1A 1N60A 2CJNA 3EGRA 1L0VB 5HG2A 4J3OD 1WFYA 1XF5L 1WSPA 1ZW7A 1VZ6A 3RN9C 1QQRA 3PRPB 3IAM1 2RR9A 3ZXVA 3PZ8A 3AE4B 2QEJC 4K7WA 2IYDB 1D6EC 1V9JA 3C19A 4MT5A 3PHXB 2L52A 1Z5SB 4J6IA 1F77A 1K53A 3VRAB 1R4MI 1TY0A 2MW5A 4ZHPA 1E0ZA 2J0KA 4RCOA 4XC2A 3A9JB 1L4ZB 1SJHD 3NVWA 1V97A 1YMHE 2WXPA 4XZ4A 1DOIA 2CU1A 1J19A 3P4QB 4RM9A 3WANA 2D07B 4LNOA 3TEWA 3PRMB 4HKQA 2R61A 2BF8B 3P1MA 4MH8A 3NG0A 2ZPYA 2CHWA 1TS5A 4JPSA 4W9LA 2M56B 2XK5B 4IC7B 2LFIA 2H88B 2LRUA 4BOZB 1L2NA 2GLSA 2QC8A 1GC7A 2L3ZA 2NTSA 1PUTA 4LTUA 2QSDA 3H7PA 3U7ZA 2DAJA 3T3OA 2DENB 2IY0B 3DVGX 2MBHA 3Q14C 1YQBA 3ZNZB 3CWIA 4C00A 1K8RB 3A33B 2XEWA 4II2B 3AM9A 3BYTB 2LZ6A 1ESFA 2FCSA 3GP7A 4A55A 2C9WB 5CHWA 2C7MB 4IM0A 2R2QA 3AB5A 1NVID 2BW2A 1OQYA 3OLMD 4MJSB 4EE2A 3B0AA 4ZDVA 1T0RC 4MGZE 3ZNID 1RFKA 4G0NB 3NOBA 3AE6B 3APFA 2KACA 1MVKA 3NVYA 4MGKE 2O6VB 3CF6E 3VR9B 3RT3B 1WJNA 5GMVA 1Y56A 2MX2A 1A70A 4N58A 2K8HA 4GB9A 4XE0A 1S1QB 1XCTL 2JXXA 1G6JA 3M95A 5EE9A 2NTTA 1E7UA 3X23A 1GJZA 1LGRA 1C4AA 2RD0A 3JSVB 1VDVA 3BVZA 3V3XA 3MTNB 3VUWA 1HQRD 2LGIA 5TSSA 2FNJB 4XYCA 3JVZX 4AQ7A 3BY4B 3T8MA 1FD6A 2IO1B 4BKTA 4HVBA 1V1PA 3N1ZC 1I4GA 5IP4D 1EWCA 2JYTA 1ZXIA 3P4SB 1C1YB 3VRBB 4W9EA 4G50A 1ACCA 3QIJA 4W9KA 1L6UA 2KC2A 2QDFA 4KDLB 4FA6A 2AL6A 2KD0A 1JWBD 3DHGC 5JZEB 2IJ0A 4MGYE 2X8XX 4LDTB 4GDKB 2KKCA 1IUEA 4AOFA 3KYCD 2N1WA 1TBEA 1AWDA 2MSED 4E3CA 1XT9B 1GOZA 1HZ6A 4US8A 3NZSA 1MG4A 3W2DA 1UWXA 2W55A 2M17A 5EE0A 3APCA 2NBUA 2KANA 3AE1B 5MPOA 3VTWA 4YSYB 1XXGA 2Y3AA 4KZ0A 3TIXA 1UBIA 2AX5A 2K8BA 3GZNB 2V9HA 3R8BA 4TSSA 4FJYA 2MP2B 2FCMA 3VVWB 2KFJA 1GC6A 4IOIE 2JWUA 2L1AA 2N7DA 4RF0A 1JWSD 1EO6A 1MFWA 3KLSX 4ARIA 2WP9B 4EZLA 3IFWB 3RZFA 5IO9A 2L76A 3OG5A 5KHOA 2J42A 3PSEB 1F52A 1T0YA 1VLBA 3CSTA 5BYQA 1SE4A 4MM3B 4Q2JA 3V6EB 5D6JB 2PLPA 5BMHA 4KDIC 4HRSA 4HCPB 2M1MA 4DDID 2MJ3A 5EDSA 4CO7A 2WXIA 1FFVA 4NAWB 3X0WA 2FIFA 2A5UA 4AJWA 3LB8C 4OZBA 1WH3A 5JH5C 2BKFA 3ZO5B 1QLBB 4A6QA 3QAQA 4K3CA 4H2AA 2K39A 4FBJB 2OEDA 1I7HA 1UGJA 4OVZA 3TBLD 4ACFA 2CHXA 1RRBA 1D5ZC 1GB1A 1X1MA 2JVCA 3QCAA 3CIRB 4P16A 3AH7A 1WF9A 4MJSA 5CTRC 3NVZA 1WX9A 4PS3A 4PS8A 1IYFA 1QT9A 4FXCA 1TJEA 2WX0A 2L32A 2PEAA 3SFEB 3RNEC 3UI3A 4LNKA 2AWTA 2EKEC 2ZCCA 4EZJA 2GBJA 1C79A 1UNSA 2C7NB 2N9XA 3GZNI 5C23A 1V80A 3W1SC 3WCQA 2TSSA 3EUB2 3ENEA 2KXJA 3A9JA 3OJ3A 2MH7A 4NZLB 2BGFA 2JUOA 4GDLB 2DHZA 3MC9A 3PPAA 4HWIB 2KWDA 2N1VA 5D7GA 5FR3A 5IKCM 2WXRA 1JALA 4W9DA 1T5XD 2KJHB 4RM8A 3AE8B 2PW9A 5TR5A 3H1UA 1XLNA 2PJHA 2AQ1B 4IW0A 1ZDVA 1UF0A 4HKZE 2IPKD 2N9EB 4NQLB 3L08A 2K6DB 4REZA 2KC1A 3NRZA 4II3B 2JYEA 2VH1A 2BWFA 4F7ZA 2N0SB 2IGHA 3VXWA 4HPMB 1JMLA 5CX3A 4A8XC 2IO3B 1FXTB 3DQVA 2LJ5A 3SFDB 3UIOB 1FM0D 1RYJA 1RM6C 1KFYB 3MHSD 4GMVA 1SE9A 1FRRA 3Q8FA 3I3TB 3RFZB 2KYWA 1SJED 2JRHA 1DGJA 3I63C 1MG8A 4L2YA 1EF5A 2ZVNA 2DLBA 2O6VD 2PMVA 1UH6A 3U30A 4E74A 3WAOA 1WZ0A 1FPYA 3VH3B 3V62A 3ZDTA 5LLIA 1ZPSA 1OEYJ 1VR9A 1XD3B 4W9HA 4RFBA 3Q8BA 4YL8A 1TKEA 4DXGA 4WQOB 1T6BX 1FNUA 3PS6A 1CZPA 4ANUA 1DOYA 1E8ZA 2D2QA 1UELA 1CK1A 4MEMA 1R4NI 1IP9A 3N30A 4LLGM 4FHKA 4OHJA 3OWEB 1JWMD 2N9KA 1PGAA 2PE9A 4US9A 3N32A 3JW0X 1T0SC 1OEYA 3MC8A 4ZYSA 3R2IA 2NS5A 1KLGD 4P1BC 3AECB 4WH4A 1XLPA 3A4SC 3PHWB 1B1ZA 4WWOA 2KN4A 3ML8A 3ZJUA 2MBBB 3Q3OC 1SIFA 1BXTA 4MM3A 4BOSC 2BB5A 2C5LC 2WXFA 1WRDB 1UD7A 3MP9A 3FKYA 2N4FA 3VUXA 4OZAA 4XWWA 3W5UB 4WJNA 3GE8C 4KV2A 4FULA 3TEXA 2K5PA 4IUMB 2JY6A 3H9DA 4W9GA 1GG3A 1C78A 1N62A 5HI1A 2WU5B 1DYQA 2WQYB 3BVGA 4RGTA 2W3RA 5E6JA 4DK5A 4WWNA 2KLGA 1L5PA 1KH0A 1S3SG 1FCLA 1TS4A 1HZ5A 4EFOA 4HK2A 4NJ6A 1E90A 1SF0A 2MCNB 1IBXB 1GAQB 4XDDA 3PLVA 3AEAB 1TGZB 3NUHB 3DBSA 1ZGUB 2INPE 4B0MA 1UZXB 5D3DA 4RGOS 1WE7A 4GIVA 4JGHB 1XLOA 4JQWC 1RWSA 3O13A 2JRIB 3P42A 4PT5A 2GBKA 2KLCA 2Z59B 2W9NA 4P1CC 3IT4B 3NZ3A 4MSQB 2FCNA 1I42A 1ZUD2 1PDXA 4JIOU 3BK1A 2INDC 3JYUA 1SEBD 3NJTA 1WJ6A 3Q69A 4N6EB 3NVVA 1WIAA 1YN5A 1V5OA 3HRDD 4WJQA 4ASWC 2D3AA 4KSLC 3UQAA 1YNTE 2NPTB 2D3CA 2FBWB 1QOBA 1GNUA 3PLUA 2HJ1A 4IKGA 3U7DA 4DHJB 2ON8A 2WXHA 2VH2A 4LNFA 1Q0WB 4ZRIA 3MJWA 3EHVA 2BYTA 1V5TA 2M0XA 3W9CB 1QOGA 1C9FA 3RNBC 1WR1A 4C7ZA 3APDA 3HIZA 1YQ3B 3VFKA 2WDVB 3BYYB 4HLEA 5IA7A 2K3UA 2ZEQA 2QMTA 4AUQC 2QIEB 2Z0DB 1VCBA 1SXTA 4LNIA 1A5RA 3DBRB 3VTVA 3BWUD 3C0RB 4NNJB 1I4RA 3H7SA 4ANXA 1MPEA 1P98A 5FKAC 2NR2A 4ZOHC 1WM2A 1ET6A 2K0PA 3DBLI 2ZPNA 3ONSA 1H8CA 5HFYA 5T8IA 3Q8CA 1YJ1A 4L1BA 1QZEA 2MP2A 3MJ5A 4ZRQA 4JWSC 1IGDA 4FJVB 3JSVA 3CMMB 4S17A 2L05A 1TTNA 1TS3A 3OJ4B 2MA9B 2N7EA 2BTEA 1NBFC 1MI0A 4HPPA 5IAAC 2J53A 4HROA 4UDUC 1LM8B 4R3DA 3I57A 1WMHB 2IO2B 3A1QB 2VZKB 3AE9B 2DX5B 2NMQA 4IWQA 3TL5A 3P63A 2SEBD 2BVCA 3WA0A 2X38A 3RPFC 2J4XA 3AXCA 3WAMA 1OGWA 2KNBA 4AP4C 1OFFA 2KVRA 5G5GA 2MRPA 1JWAD 1TS2A 1WGGA 1WWTA 2N7JA 3IBEA 1VD2A 3WIMA 1K50A 4KKJA 3PTFC 1ZOYB 1M94A 2W3SA 1B9RA 4BVUC 3KH0A 3NY5A 2BS3B 1QILA 3VUYA 1WXVA 5J17A 4YXDB 2GB1A 2L8JA 2LGDA 2LUEA 2Z8LA 2MLBA 3QK0A 2KX0A 2Y5CA 1EU3A 1L7YA 1BUIC 2ZZPB 2D3BA 2XN9C 3KVFB 1I4HA 4KGRA 1JRPA 4LDTD 3DOWA 2DZIA 2L0TA 4QAYA 5JHAA 2K22A 2D11A 2KDFB 2OHFA 3W1YA 1WGRA 1QKZA 1QF6A 3QX1A 4DDGD 3RULA 2PTLA 4BKSD 1I4QA 3QQ8B 2DNFA 1E5WA 5LXHA 2RGFA 4A20A 3TUOA 3T9LA 3P4RB 2KQSA 1QOFA 4HEA1 1ENFA 3H8HA 4KKIA 3A9KB 4FJZA 3KUCB 3D32A 4TQ0A 2RDHA 2BQQA 2ZW0A 3ZNHB 2G1EA 4PS7A 5DPRA 2GBRA 4K3BA 3RNFC 1YD8U 2PIAA 2NPTA 4G11A 2G4SA 1R4MB 2KK8A 4NQKE 1V1OA 1PQSA 4B9KA 4BAXA 1N63A 1KLUD 2MBOA 3PREA 3AE2B 2EKIA 3BVMA 3AE7B 2WS3B 2KQ7A 2KMCA 5C2TB 3DWGC 4ANVA 3UF8A 4DXAB 3GOEA 2LJIA 4FN2A 3KQ4A 3W5VB 2I1KA 4LJOB 4B95A 1J8CA 2RPVA 3HHMA 2L7RA 3ZKJC 3FILB 3NZUA 4OVVA 1GUAB 2YEPF 4WJOA 1Z2MA 1ZXHA 4B0EA 3HUIA 4GXBA 2LGYA 2MEKA 4GDLA 1PYWD 5JHBA 2B76B 2V3NA 2CKHB 5H8YE 1AARA 2WXJA 1N6ZA 4PK1A 1SE3A 2GBNA 2KVZA 4CQNA 4KSKC 4ZHOA 2CU3A 2LGXA 2DYOA 3TCAA 4E71A 2GMIC 2IGGA 2G45B 4IWPA 4P6VF 3M62B 3QHTA 3AU5A 2EMSA 1WJ4A 1P7FA 3NHEB 3URYA 2QJLA 2LMCA 4A9AA 1TYGB 4JLCA 2GOWA 4YTPB 3ZVVA 5AZGA 2BYFA 1WXQA 4K1RB 2MJEA 2D10A 4K81A 5FR6A 4OZCA 1WYWB 1YQ4B 1KRHA 4IM2A 3V05A 3WAPA 1TKGA 4KX6B 1HTOA 4GSWA 1UGMA 3WALA 1J7CA 2QHOA 3IVFA 2LXAA 3RNGC 2KTRA 4MELA 4NJCA 1WGKA 3U52E 2KWUB 3MHZA 2N9PC 4GU2A 1WX7A 1F2RC 3ABVB 3PVLA 5L83A 3K9PB 2OOBB 3IXSA 1V8CA 3DDCB 5C3JB 3TSSA 2YVCA 3MFGA 4YWGG 1F9JA 2LVPA 1ZP0B 2MBEA 5J18A 2G4DB 1CQVA 3R66C 3Q2AC 3AMZA 1NYRA 2IDYA 2PKOA 2WXOA 5AEKB 1HXYD 3SEBA 1FEHA 3N1XC 3M63B 2IBIB 1V6EA 1D3ZA 5DPTA 2BKRB 3AU4A 4GN1A 2M8SA 2KJRA 4BBNC 3A1QA 2LRWA 2KWCA 3RD2A 1YN4A 2WXMA 2JZ3B 2OJWA 4GDKA 4OVUA 2WDRB 1WJUA 1WM3A 1FNVA 3VTUA 3R7RA 1E8XA 1V49A 2NBWB 5AZFA 2AQ3B 3IHPC 5AUKA 2MBQA 2G3QB 2AEHA 4RMAA 4FHJA 2WNMA 2D5GA 1E10A 3ALBA 2INNE 5H92C 3SU8X 2LD9A 3HVZA 1JRUA 4KZCA 1L0XB 2WXQA 3V6CB 1LFDA 3UQBA 2W82A 4M00A 2WYQA 3AEGB 3DPDA 3N3KB 2WXLA 3B1LX 2KFKA 2L00B 2PE6B 3ZNGC 1OQQA 1GPXA 2M0AA 1WMHA 4ZYNA 1FO4A 2MHJA 3A4RA 3KUZA 3P4PB 4C4VA 1I4PA 1TT5B 3QC8B 4KIKA 1P9DU 2V1YA 4FADA 4RGNA 3H6NA 4ITKA 2M19A 3BZDB 3LJ3A 4BKSA 4NJ7A 3EFCA 5BYSA 2LGSA 1WI0A 5LNK1 3MC0B 1FRDA 2AQ2B 2KWVB 2JZZA 4NAMA 4KVGB 1F1HA 1XCQL 1M4VA 3NS1A 4BZAA 3H7PB 1KTKA 5EE3A 2WXKA 1HTQA 4GLSC 1U4AA 3EC8A 3B2FA 1KJTA 1SBBB 1WGYA 3T3NA 1V86A 2LVQA 3ML9A 3EA6A 2KFKB 2FCQA 3DBLB 1EWYC 2QILA 1NDDA 1ZKHA 3V61A 2BB6A 1RAXA 4M02A 4NAWA 4URKA 4JE3B 2DWQA 1FCCC 1L6VA 3DBRI 2BYEA 3Q3JA 2Z0EB 1WZ3A 3RZWC 1WGDA 4MGIE 4IM3A 3RYTA 3U4EG 2E3TA 2WX1A 1VRAB 2VZKD 1WR6E 3PRZA 1WXMA 1J7BA 2Q5WD 4TKNA 4NPNA 2LWPA 1FXIA 3KWLA 3DWMA 4BKGA 3L17A 2V4LA 2KDMA 1VZ7A 4BBNF 1TZ1A 4D2KA 4EEWA 3AN1A 2FIDA 2IGDA 2WLBA 4YTMB 2INCC 3DBHI 2ASQA 2LASA 2NVUI 4ANWA 3UGBB 4ARCA 4LCDE 4M0WB 2FE8A 3TJPA 3IAS1 5BO4B 1K51A 3L10B 1D5MC 2K6QA 2OJRA 5E6PA 2EELA 2O2VB 1N5XA 4I6PA 3FAHA 1EF1A 2K9XA 2BS4B 3UINB 1I35A 3DHHC 2VRRB 1KM7A 4IWOA 1TKYA 2G9HD 3RI7C 2CHZA 3P2BA 2M4NA 4WWMA 1NEKB 4USAA 4DQOC 3EECA 3DVNU 3IT6B 4ZRKA 5D94A 1T0QC 3KWVA 2KZRA 3VH4B 3B9JA 2DZMA 1C76A 4AS1A 4WAFA 3RMKC 5DPSA 4TQ1A 4WWPA 1P3QU 3O65B 3DVNV 3QJZA 4XDCA 2KDBA 1FIQA 4DHJD 1NYQA 2DYMA 5JXVA 1CJEA 2BYVE 2KTRB 2BBCA 2HJ8A 2E6XA 2CR5A 4C80A 2WGSA 3PO0A 2J7QB 3ZXRA 1ET9A 1NI3A 1PGXA 3FC4A 3GB1A 4M01A 3AI5A 1J0GA 1EU4A 2L0FA 2WU2B 1EM7A 3BIID 4WQMA 2Y5BB 1FFUA 1IPGA 3AEFB 2ACZB 3QARA 5I4DA 1TIFA 4TMAB 4HPLB 3RCZA 2RMMA 4W9IA 4O1NA 1XQQA 2YLMA 1SSNA 3DBHB 4XX5A 2KTFA 1JCKB 2LEKA 2J0MA 2JX5A 4DWFA 3Q3NC 3Q8EA 3I9V1 1N61A 2C7HA 4A90A 4C4VB 4XGAB 3ZJVA 5E6NA 3PV1A 2J0JA 1XO3A 2BPSA 2WXNA 4GOCA 2K1FA 2D3GA 2JSVX 4ZRJA 2K25A 3ZW3A 1P1AA 1H4RA 1HA5A 2DAFA 3Q8AA 1CMXB 2KOXA 3AEDB 3R3MA 1RFAA 2PVGC 1ZE3D 2JPHA 5BYRA 3NS8A 2V3PA 1WYGA 2UU7A 2HTME 3UIPB 1F2RI 1YX6B 2KMAA 2XBBC 3L54A 4IG7B 5E6OA 2LHEA 1JROA 5HHDG 1E7VA 2I2YA 4MSMB 1E9MA 3LDZE 5IOIA 2KN5A 4W9CA 4L23A 3RUIB 1Q1OA 1UWMA 1TY2A 4MH0E 2XNAC 4DXFA 2EMTA 2A4ZA 4N59A 2FUHB 5L95C 2UYZB 1E7PB 3ZLZA 4JL9A 1K52A 1F0ZA 3HM3A 2GI9A 1WRIA 1UBQA 1WXSA 3R7QA 4DBGA 4JWUC 2ZCBA 1BT0A 2BT6A 2WDTB 1Y8RC 3AULA 1TZOA 2KQ4X 1IBXA 4RNAA 1PGBA 3I5JC 3N20C 4WAAA 3L13A 4CYEA 3BK2A 3PZ7A 1MHHE 1FMAD 4YTNB 1KLVA 3S2AA 3N1YC 1AN8A 4RH6A 5CHFA 2NCNA 2CJOA 1JWUD 3AEEB 3W1SA 1MJDA 5G5HA 3GS2A 3AE5B 2LVOA 5DCNA 5BMIA 3CSFA 5BMGA 1XLQA 2HTHA 2B3AA 2SAKA 3M3JA 4I6NB 2J52A 2UWQA 3L0WB 1HEZE 2KDEB 4W9FA 4W9JA 1VZ8A 1V1PB 1Q5WB 2AL3A 2XK5A 3VHTC 3B08A 1YN3A 4LJPB 2RPQA 3Q3MC 3QA8A 3ZJTA 2DBYA 4KGSA 2RSUA 5G2NA 3E56A 1GB4A 3SDLC 4RF1A 1YOVB 3ECIA 4FLHA 2JWZA 3ZRCA 5IN7A 3V60A 3ZRFA 4EZKA 2O2VA 3QWZB 3ETRA 2RDGA 1YJIA 4I6LB 3KUDB 4A3OA 4WURA 2PPHA 2DZJA 2Y5PA 4ICUA 1NI2A 3ZQ4A 3RNAC 4PYZA 5CHVC 3PGEA 4MDKE 3EFUA 4HJKA 1YJJA 4JX1C 3PZDA 4YSZB 2WHIA 4B6WA 2JZPA 4HXDA 4M8NA 4LK0M 2WWZA 4ZRPA 2BWES 2C60A 4TUUA 1C4PA 1ZDXA 1YX5B 1SE2A 3IG3A 2R2OA 3TMPB 2K8CA 4C7YA 4S0RA 3R2TA 1L0YB 3L16A 5EE1A 3Q3FA 3DVGY 4MACA 1SIJA 4CHKA 4DHZB 1DOXA 2RDBC 1R7SA 3ZIMA 3GE3C 1NENB 1N5WA 5J2RA 3AEBB 4P7IA 1T3QA 3VDZA 5LXIB 4HJGE 1YIWA 4AJYB 1J7AA 1JW9D 2JT4B 1WY8A 4YSXB 4NY0A 5HKHA 2KJ6A 3TEYA 2O6VA 2N9LA 1LO5D 4C56C 2ZNVC 4HDOA 3HK0A 2WXGA 3ZTCA 3K9OB 2ZVOA 4HCNB 2NBVB
chains in the Genus database with same CATH topology
2IO2B 2Z0EB 1SGHA 3A1QB 4TV3A 1LQBA 1WZ3A 3RZWC 2DX5B 4IWQA 1WGDA 3TL5A 4MGIE 4IM3A 3WA0A 3RYTA 1EO6A 4EZLA 3IFWB 2WX1A 3AXCA 2IY1B 3RZFA 3WAMA 2L76A 1OGWA 2KNBA 5KHOA 1WR6E 3PRZA 1WXMA 4AP4C 2KVRA 1KOTA 3PSEB 1T0YA 3CSTA 4TKNA 4NPNA 2DZKA 2LWPA 3V6EB 4BKGA 5D6JB 2MRPA 3L17A 2V4LA 4KDIC 3KW5B 4PYUA 4BBNF 1WGGA 4HCPB 1TZ1A 4EEWA 2FIDA 2M1MA 1VD2A 3IBEA 3WIMA 4DDID 5EDSA 4CO7A 4DHZE 3PTFC 3DBHI 2ASQA 2LASA 4EOYA 1M94A 2NVUI 4NAWB 3X0WA 4ANWA 2FIFA 2FAZA 1E8WA 2A5UA 4AJWA 4BVUC 3UGBB 3KH0A 3NY5A 1WH3A 5JH5C 4LCDE 2BKFA 4M0WB 3VUYA 1WXVA 3ZO5B 5J17A 2KO3A 3QAQA 3TJPA 2K39A 5BO4B 4FBJB 3L10B 2L8JA 2LGDA 2LUEA 2K6QA 2MLBA 2OJRA 3QK0A 3TBLD 2CHXA 5E6PA 2KX0A 2O2VB 3SHQA 4I6PA 4A3PA 5KHQA 1RRBA 1L7YA 2ZZPB 4GGQA 1EF1A 2MQJA 1X1MA 3KVFB 2JVCA 3QCAA 3UINB 1I35A 2V3SA 1ISNA 2VRRB 1KM7A 1V81A 1WF9A 4IWOA 4MJSA 5CTRC 1EUVB 1WX9A 4LDTD 4PS3A 4PS8A 3DOWA 2DZIA 2ZJDA 5DPWA 2CHZA 2L0TA 3P2BA 1IYFA 5JHAA 2AYOB 2WX0A 2M4NA 3A9KA 2DYBA 3EECA 2D11A 2PEAA 3DVNU 4ICVA 4ZRKA 5D94A 2GBMA 2KDFB 3W1YA 1WGRA 2KZRA 3VH4B 4K7SA 2DZMA 5C1ZA 4F1SA 3QX1A 1E8YA 4DDGD 3RULA 5DPSA 4TQ1A 1LXDA 1HE8A 2AWTA 2IZVB 1RLFA 2EKEC 2ZCCA 4WWPA 4EZJA 1C3TA 4BKSD 2GBJA 1P3QU 3GZNI 2C7NB 2N9XA 3O65B 5C23A 1V80A 3QQ8B 5LXHA 1E5WA 2RGFA 3DVNV 3HM6X 3QJZA 3W1SC 2KDBA 4DHJD 3ENEA 4G3XB 4A20A 2KXJA 2DYMA 2JF5A 2BYVE 3T9LA 2KQSA 3A9JA 3OJ3A 1WXAA 2KTRB 3BINA 4EKUA 2HJ8A 2BGFA 5D2MB 2JUOA 2KX3A 2CR5A 3A9KB 4FJZA 5G55A 3KUCB 4GDLB 1WE6A 2DHZA 3D32A 4TQ0A 2CS4A 2MWSB 2J7QB 3PPAA 4HWIB 2N1VA 5D7GA 4AWJA 3ZNHB 4EUTA 3DCGA 4PS7A 4KIKB 3AI5A 5DPRA 4K7UA 1J0GA 2HD5B 2GBRA 5AZHA 4HDQA 1YD8U 4W9DA 2L0FA 2REXA 4RM8A 2KJHB 1OTRB 2NPTA 4G11A 5TR5A 3ZTDA 3H1UA 2G4SA 1WX8A 2Y5BB 2KK8A 4NQKE 3VAWA 1IPGA 2LI5A 2PJHA 1PQSA 3PT2B 3QARA 4IW0A 4WJPA 4B9KA 2N9EB 4NQLB 3L08A 2K6DB 3VQIA 3RCZA 4HPLB 3ZDMC 4W9IA 2MBOA 2KC1A 3PREA 4II3B 4F7ZA 2BWFA 1XQQA 2KQ7A 2KMCA 3VXWA 4HPMB 4ANVA 2YLMA 3UF8A 5CX3A 4N9F4 2HE7A 4XX5A 4DXAB 1V2YA 1FXTB 1WGHA 2IO0B 2IO3B 2KTFA 3GOEA 4FN2A 3DQVA 2KHWB 2LJ5A 1P0RA 2LXCA 2ZNVB 2I1KA 2J0MA 4LJOB 4B95A 1J8CA 4M8MA 4BFRA 2KDIA 3HHMA 4DWFA 2L7RA 3ZKJC 3UIOB 3KYDD 3OAWA 3NZUA 4OVVA 2C7HA 3MHSD 4GMVA 1SE9A 1GUAB 3I3TB 4WJOA 1Z2MA 5E6NA 4F8CB 2JRHA 2LGYA 4GXBA 4X57B 4GDLA 3PV1A 2J0JA 5JHBA 1MG8A 2I1JA 1EF5A 2ZVNA 2CKHB 1AARA 3U8ZA 2BPSA 3SD5A 4GOCA 2O6VD 2K1FA 2GBNA 1UH6A 3U30A 2D3GA 4E74A 1WFYA 3WAOA 1WZ0A 4ZRJA 2K25A 4KSKC 3ZW3A 1P1AA 1ZW7A 3VH3B 3PRPB 3V62A 2LGXA 2DYOA 5LLIA 3TCAA 3ZDTA 1OEYJ 1H4RA 4E71A 1XD3B 2GMIC 2G45B 2DAFA 2RR9A 1CMXB 4W9HA 2KOXA 4K7WA 2IYDB 4YL8A 4WQOB 3R3MA 4IWPA 1RFAA 3PS6A 1V9JA 3Q3JA 4ANUA 2JPHA 3M62B 3QHTA 1E8ZA 2D2QA 1UELA 3AU5A 2EMSA 4MEMA 1R4NI 3NS8A 1IP9A 3N30A 3PHXB 1WJ4A 1Z5SB 4J6IA 4FHKA 3NHEB 3UIPB 1YX6B 2KMAA 2XBBC 2PE9A 1R4MI 3N32A 3JW0X 3L54A 4IG7B 1OEYA 2MW5A 5E6OA 4JLCA 2GOWA 2J0KA 2NS5A 3ZVVA 1E7VA 5AZGA 2BYFA 4K1RB 4MSMB 4XC2A 3A9JB 3LDZE 2KN5A 3A4SC 3PHWB 4W9CA 2D10A 4K81A 5FR6A 4WWOA 3RUIB 1WYWB 1Q1OA 3ML8A 4XZ4A 2MBBB 4IM2A 4MH0E 1SIFA 4MM3A 2CU1A 3WAPA 3ZUNA 1J19A 2EMTA 4RM9A 4BOSC 2A4ZA 3WANA 2D07B 2C5LC 3PRMB 4GSWA 1UGMA 2FUHB 1WRDB 3WALA 2BF8B 1UD7A 2QHOA 3IVFA 5L95C 2ZPYA 2CHWA 2LXAA 2UYZB 4W9LA 2KTRA 4MELA 2N4FA 4JL9A 2XK5B 4IC7B 3VUXA 3ZLZA 2KWUB 3DBRI 2N9PC 4GU2A 3HM3A 1WX7A 4WJNA 1WXSA 1UBQA 3R7QA 2LRUA 4BOZB 3PVLA 4KV2A 5L83A 4DBGA 4FULA 3K9PB 1L2NA 2ZCBA 1BT0A 1GC7A 2WDTB 2L3ZA 1Y8RC 2OOBB 3AULA 4IUMB 2JY6A 3H9DA 4W9GA 1GG3A 3DDCB 2YVCA 3H7PA 1F9JA 2LVPA 2DAJA 2DENB 2IY0B 2MBEA 3DVGX 2MBHA 5J18A 2G4DB 4WAAA 3L13A 4CYEA 1YQBA 3R66C 3ZNZB 4DK5A 4WWNA 1K8RB 2KLGA 3A33B 1KLVA 3S2AA 5AEKB 2XEWA 5CHFA 1S3SG 2NCNA 4II2B 4EFOA 3M63B 2IBIB 4HK2A 4NJ6A 1V6EA 1E90A 3W1SA 2LZ6A 2FCSA 1D3ZA 5DPTA 2LVOA 5DCNA 2MCNB 2C9WB 3PLVA 2BKRB 3AU4A 4GN1A 3CSFA 2M8SA 5CHWA 2HTHA 2B3AA 1TGZB 2KJRA 2C7MB 3DBSA 1ZGUB 4IM0A 4BBNC 3M3JA 2R2QA 4I6NB 1UZXB 2LRWA 2UWQA 3A1QA 2KWCA 3RD2A 3L0WB 1OQYA 3OLMD 4MJSB 3B0AA 4ZDVA 3ZNID 4MGZE 1WE7A 2KDEB 3NOBA 4G0NB 4W9FA 4GIVA 3APFA 4W9JA 4JGHB 4JQWC 2JZ3B 4MGKE 4GDKA 1Q5WB 2O6VB 4OVUA 2JRIB 2AL3A 1WJUA 1WM3A 2XK5A 3VTUA 3CF6E 3R7RA 1E8XA 1V49A 2NBWB 5AZFA 3RT3B 1WJNA 2GBKA 2KLCA 2Z59B 2W9NA 3B08A 5GMVA 3VHTC 3IHPC 4LJPB 4MSQB 2MX2A 2FCNA 1I42A 2MBQA 2G3QB 4JIOU 3JYUA 2RPQA 1WJ6A 2AEHA 4RMAA 3QA8A 1WIAA 4FHJA 2K8HA 2RSUA 4GB9A 1V5OA 3ALBA 1S1QB 4WJQA 5G2NA 4ASWC 4KSLC 3SU8X 3SDLC 3UQAA 2JXXA 2LD9A 2NPTB 1G6JA 3M95A 1JRUA 1E7UA 4KZCA 3X23A 3ECIA 3V6CB 1GJZA 4FLHA 2JWZA 1LFDA 3ZRCA 3UQBA 1GNUA 3PLUA 3V60A 3ZRFA 2RD0A 3JSVB 4EZKA 2WYQA 2O2VA 3MTNB 3DPDA 3QWZB 3U7DA 3VUWA 3N3KB 4DHJB 3B1LX 2FNJB 4I6LB 2KFKA 2L00B 3KUDB 2PE6B 4A3OA 3JVZX 3ZNGC 3BY4B 3T8MA 1Q0WB 1WMHA 4ZYNA 2PPHA 4ZRIA 2DZJA 2IO1B 3MJWA 4BKTA 4HVBA 3A4RA 3EHVA 3KUZA 1NI2A 1V5TA 4ICUA 2M0XA 4PYZA 5CHVC 3QC8B 3PGEA 4MDKE 4KIKA 1P9DU 1WR1A 2V1YA 4FADA 3EFUA 4HJKA 3APDA 3PZDA 1C1YB 3H6NA 3HIZA 4W9EA 3VFKA 4B6WA 4G50A 4HXDA 4M8NA 3QIJA 4W9KA 4KDLB 2KC2A 2WWZA 3LJ3A 4HLEA 4BKSA 4NJ7A 2BWES 4FA6A 5IA7A 2C60A 2AL6A 4TUUA 2ZEQA 2KD0A 4AUQC 1WI0A 5JZEB 2Z0DB 4MGYE 2KWVB 1VCBA 4LDTB 2JZZA 1YX5B 4GDKB 2KKCA 4KVGB 4AOFA 1A5RA 3IG3A 2N1WA 3KYCD 2R2OA 3TMPB 1TBEA 2K8CA 2MSED 3VTVA 4E3CA 1XT9B 3C0RB 3H7PB 4NNJB 3L16A 3Q3FA 3H7SA 4ANXA 3NZSA 3DVGY 1P98A 2NR2A 4CHKA 2M17A 4DHZB 1WM2A 1U4AA 3APCA 3EC8A 3DBLI 2NBUA 2ZPNA 1KJTA 3ONSA 1WGYA 2KANA 3ZIMA 3VTWA 1H8CA 1V86A 4KZ0A 2LVQA 5J2RA 3TIXA 4P7IA 1UBIA 3ML9A 3VDZA 2K8BA 1YJ1A 5LXIB 4AJYB 1YIWA 1QZEA 2KFKB 2MP2A 4FJYA 2JT4B 2MP2B 2FCQA 1WY8A 2FCMA 1NDDA 4NY0A 1ZKHA 3V61A 2KJ6A 5HKHA 4FJVB 3JSVA 3CMMB 2O6VA 3VVWB 2L05A 1TTNA 1RAXA 2KFJA 1GC6A 3OJ4B 2MA9B 2N7EA 2ZNVC 4HDOA 3HK0A 1NBFC 4NAWA 4URKA 2N7DA 5IAAC 3ZTCA 3K9OB 1LM8B 2ZVOA 4HCNB 2BYEA 1WMHB 2NBVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 B;  2Z0E B;  1SGH A;  3A1Q B;  4TV3 A;  1LQB A;  1WZ3 A;  3RZW C;  2DX5 B;  4IWQ A;  1WGD A;  3TL5 A;  4MGI E;  4IM3 A;  3WA0 A;  3RYT A;  1EO6 A;  4EZL A;  3IFW B;  2WX1 A;  3AXC A;  2IY1 B;  3RZF A;  3WAM A;  2L76 A;  1OGW A;  2KNB A;  5KHO A;  1WR6 E;  3PRZ A;  1WXM A;  4AP4 C;  2KVR A;  1KOT A;  3PSE B;  1T0Y A;  3CST A;  4TKN A;  4NPN A;  2DZK A;  2LWP A;  3V6E B;  4BKG A;  5D6J B;  2MRP A;  3L17 A;  2V4L A;  4KDI C;  3KW5 B;  4PYU A;  4BBN F;  1WGG A;  4HCP B;  1TZ1 A;  4EEW A;  2FID A;  2M1M A;  1VD2 A;  3IBE A;  3WIM A;  4DDI D;  5EDS A;  4CO7 A;  4DHZ E;  3PTF C;  3DBH I;  2ASQ A;  2LAS A;  4EOY A;  1M94 A;  2NVU I;  4NAW B;  3X0W A;  4ANW A;  2FIF A;  2FAZ A;  1E8W A;  2A5U A;  4AJW A;  4BVU C;  3UGB B;  3KH0 A;  3NY5 A;  1WH3 A;  5JH5 C;  4LCD E;  2BKF A;  4M0W B;  3VUY A;  1WXV A;  3ZO5 B;  5J17 A;  2KO3 A;  3QAQ A;  3TJP A;  2K39 A;  5BO4 B;  4FBJ B;  3L10 B;  2L8J A;  2LGD A;  2LUE A;  2K6Q A;  2MLB A;  2OJR A;  3QK0 A;  3TBL D;  2CHX A;  5E6P A;  2KX0 A;  2O2V B;  3SHQ A;  4I6P A;  4A3P A;  5KHQ A;  1RRB A;  1L7Y A;  2ZZP B;  4GGQ A;  1EF1 A;  2MQJ A;  1X1M A;  3KVF B;  2JVC A;  3QCA A;  3UIN B;  1I35 A;  2V3S A;  1ISN A;  2VRR B;  1KM7 A;  1V81 A;  1WF9 A;  4IWO A;  4MJS A;  5CTR C;  1EUV B;  1WX9 A;  4LDT D;  4PS3 A;  4PS8 A;  3DOW A;  2DZI A;  2ZJD A;  5DPW A;  2CHZ A;  2L0T A;  3P2B A;  1IYF A;  5JHA A;  2AYO B;  2WX0 A;  2M4N A;  3A9K A;  2DYB A;  3EEC A;  2D11 A;  2PEA A;  3DVN U;  4ICV A;  4ZRK A;  5D94 A;  2GBM A;  2KDF B;  3W1Y A;  1WGR A;  2KZR A;  3VH4 B;  4K7S A;  2DZM A;  5C1Z A;  4F1S A;  3QX1 A;  1E8Y A;  4DDG D;  3RUL A;  5DPS A;  4TQ1 A;  1LXD A;  1HE8 A;  2AWT A;  2IZV B;  1RLF A;  2EKE C;  2ZCC A;  4WWP A;  4EZJ A;  1C3T A;  4BKS D;  2GBJ A;  1P3Q U;  3GZN I;  2C7N B;  2N9X A;  3O65 B;  5C23 A;  1V80 A;  3QQ8 B;  5LXH A;  1E5W A;  2RGF A;  3DVN V;  3HM6 X;  3QJZ A;  3W1S C;  2KDB A;  4DHJ D;  3ENE A;  4G3X B;  4A20 A;  2KXJ A;  2DYM A;  2JF5 A;  2BYV E;  3T9L A;  2KQS A;  3A9J A;  3OJ3 A;  1WXA A;  2KTR B;  3BIN A;  4EKU A;  2HJ8 A;  2BGF A;  5D2M B;  2JUO A;  2KX3 A;  2CR5 A;  3A9K B;  4FJZ A;  5G55 A;  3KUC B;  4GDL B;  1WE6 A;  2DHZ A;  3D32 A;  4TQ0 A;  2CS4 A;  2MWS B;  2J7Q B;  3PPA A;  4HWI B;  2N1V A;  5D7G A;  4AWJ A;  3ZNH B;  4EUT A;  3DCG A;  4PS7 A;  4KIK B;  3AI5 A;  5DPR A;  4K7U A;  1J0G A;  2HD5 B;  2GBR A;  5AZH A;  4HDQ A;  1YD8 U;  4W9D A;  2L0F A;  2REX A;  4RM8 A;  2KJH B;  1OTR B;  2NPT A;  4G11 A;  5TR5 A;  3ZTD A;  3H1U A;  2G4S A;  1WX8 A;  2Y5B B;  2KK8 A;  4NQK E;  3VAW A;  1IPG A;  2LI5 A;  2PJH A;  1PQS A;  3PT2 B;  3QAR A;  4IW0 A;  4WJP A;  4B9K A;  2N9E B;  4NQL B;  3L08 A;  2K6D B;  3VQI A;  3RCZ A;  4HPL B;  3ZDM C;  4W9I A;  2MBO A;  2KC1 A;  3PRE A;  4II3 B;  4F7Z A;  2BWF A;  1XQQ A;  2KQ7 A;  2KMC A;  3VXW A;  4HPM B;  4ANV A;  2YLM A;  3UF8 A;  5CX3 A;  4N9F 4;  2HE7 A;  4XX5 A;  4DXA B;  1V2Y A;  1FXT B;  1WGH A;  2IO0 B;  2IO3 B;  2KTF A;  3GOE A;  4FN2 A;  3DQV A;  2KHW B;  2LJ5 A;  1P0R A;  2LXC A;  2ZNV B;  2I1K A;  2J0M A;  4LJO B;  4B95 A;  1J8C A;  4M8M A;  4BFR A;  2KDI A;  3HHM A;  4DWF A;  2L7R A;  3ZKJ C;  3UIO B;  3KYD D;  3OAW A;  3NZU A;  4OVV A;  2C7H A;  3MHS D;  4GMV A;  1SE9 A;  1GUA B;  3I3T B;  4WJO A;  1Z2M A;  5E6N A;  4F8C B;  2JRH A;  2LGY A;  4GXB A;  4X57 B;  4GDL A;  3PV1 A;  2J0J A;  5JHB A;  1MG8 A;  2I1J A;  1EF5 A;  2ZVN A;  2CKH B;  1AAR A;  3U8Z A;  2BPS A;  3SD5 A;  4GOC A;  2O6V D;  2K1F A;  2GBN A;  1UH6 A;  3U30 A;  2D3G A;  4E74 A;  1WFY A;  3WAO A;  1WZ0 A;  4ZRJ A;  2K25 A;  4KSK C;  3ZW3 A;  1P1A A;  1ZW7 A;  3VH3 B;  3PRP B;  3V62 A;  2LGX A;  2DYO A;  5LLI A;  3TCA A;  3ZDT A;  1OEY J;  1H4R A;  4E71 A;  1XD3 B;  2GMI C;  2G45 B;  2DAF A;  2RR9 A;  1CMX B;  4W9H A;  2KOX A;  4K7W A;  2IYD B;  4YL8 A;  4WQO B;  3R3M A;  4IWP A;  1RFA A;  3PS6 A;  1V9J A;  3Q3J A;  4ANU A;  2JPH A;  3M62 B;  3QHT A;  1E8Z A;  2D2Q A;  1UEL A;  3AU5 A;  2EMS A;  4MEM A;  1R4N I;  3NS8 A;  1IP9 A;  3N30 A;  3PHX B;  1WJ4 A;  1Z5S B;  4J6I A;  4FHK A;  3NHE B;  3UIP B;  1YX6 B;  2KMA A;  2XBB C;  2PE9 A;  1R4M I;  3N32 A;  3JW0 X;  3L54 A;  4IG7 B;  1OEY A;  2MW5 A;  5E6O A;  4JLC A;  2GOW A;  2J0K A;  2NS5 A;  3ZVV A;  1E7V A;  5AZG A;  2BYF A;  4K1R B;  4MSM B;  4XC2 A;  3A9J B;  3LDZ E;  2KN5 A;  3A4S C;  3PHW B;  4W9C A;  2D10 A;  4K81 A;  5FR6 A;  4WWO A;  3RUI B;  1WYW B;  1Q1O A;  3ML8 A;  4XZ4 A;  2MBB B;  4IM2 A;  4MH0 E;  1SIF A;  4MM3 A;  2CU1 A;  3WAP A;  3ZUN A;  1J19 A;  2EMT A;  4RM9 A;  4BOS C;  2A4Z A;  3WAN A;  2D07 B;  2C5L C;  3PRM B;  4GSW A;  1UGM A;  2FUH B;  1WRD B;  3WAL A;  2BF8 B;  1UD7 A;  2QHO A;  3IVF A;  5L95 C;  2ZPY A;  2CHW A;  2LXA A;  2UYZ B;  4W9L A;  2KTR A;  4MEL A;  2N4F A;  4JL9 A;  2XK5 B;  4IC7 B;  3VUX A;  3ZLZ A;  2KWU B;  3DBR I;  2N9P C;  4GU2 A;  3HM3 A;  1WX7 A;  4WJN A;  1WXS A;  1UBQ A;  3R7Q A;  2LRU A;  4BOZ B;  3PVL A;  4KV2 A;  5L83 A;  4DBG A;  4FUL A;  3K9P B;  1L2N A;  2ZCB A;  1BT0 A;  1GC7 A;  2WDT B;  2L3Z A;  1Y8R C;  2OOB B;  3AUL A;  4IUM B;  2JY6 A;  3H9D A;  4W9G A;  1GG3 A;  3DDC B;  2YVC A;  3H7P A;  1F9J A;  2LVP A;  2DAJ A;  2DEN B;  2IY0 B;  2MBE A;  3DVG X;  2MBH A;  5J18 A;  2G4D B;  4WAA A;  3L13 A;  4CYE A;  1YQB A;  3R66 C;  3ZNZ B;  4DK5 A;  4WWN A;  1K8R B;  2KLG A;  3A33 B;  1KLV A;  3S2A A;  5AEK B;  2XEW A;  5CHF A;  1S3S G;  2NCN A;  4II2 B;  4EFO A;  3M63 B;  2IBI B;  4HK2 A;  4NJ6 A;  1V6E A;  1E90 A;  3W1S A;  2LZ6 A;  2FCS A;  1D3Z A;  5DPT A;  2LVO A;  5DCN A;  2MCN B;  2C9W B;  3PLV A;  2BKR B;  3AU4 A;  4GN1 A;  3CSF A;  2M8S A;  5CHW A;  2HTH A;  2B3A A;  1TGZ B;  2KJR A;  2C7M B;  3DBS A;  1ZGU B;  4IM0 A;  4BBN C;  3M3J A;  2R2Q A;  4I6N B;  1UZX B;  2LRW A;  2UWQ A;  3A1Q A;  2KWC A;  3RD2 A;  3L0W B;  1OQY A;  3OLM D;  4MJS B;  3B0A A;  4ZDV A;  3ZNI D;  4MGZ E;  1WE7 A;  2KDE B;  3NOB A;  4G0N B;  4W9F A;  4GIV A;  3APF A;  4W9J A;  4JGH B;  4JQW C;  2JZ3 B;  4MGK E;  4GDK A;  1Q5W B;  2O6V B;  4OVU A;  2JRI B;  2AL3 A;  1WJU A;  1WM3 A;  2XK5 A;  3VTU A;  3CF6 E;  3R7R A;  1E8X A;  1V49 A;  2NBW B;  5AZF A;  3RT3 B;  1WJN A;  2GBK A;  2KLC A;  2Z59 B;  2W9N A;  3B08 A;  5GMV A;  3VHT C;  3IHP C;  4LJP B;  4MSQ B;  2MX2 A;  2FCN A;  1I42 A;  2MBQ A;  2G3Q B;  4JIO U;  3JYU A;  2RPQ A;  1WJ6 A;  2AEH A;  4RMA A;  3QA8 A;  1WIA A;  4FHJ A;  2K8H A;  2RSU A;  4GB9 A;  1V5O A;  3ALB A;  1S1Q B;  4WJQ A;  5G2N A;  4ASW C;  4KSL C;  3SU8 X;  3SDL C;  3UQA A;  2JXX A;  2LD9 A;  2NPT B;  1G6J A;  3M95 A;  1JRU A;  1E7U A;  4KZC A;  3X23 A;  3ECI A;  3V6C B;  1GJZ A;  4FLH A;  2JWZ A;  1LFD A;  3ZRC A;  3UQB A;  1GNU A;  3PLU A;  3V60 A;  3ZRF A;  2RD0 A;  3JSV B;  4EZK A;  2WYQ A;  2O2V A;  3MTN B;  3DPD A;  3QWZ B;  3U7D A;  3VUW A;  3N3K B;  4DHJ B;  3B1L X;  2FNJ B;  4I6L B;  2KFK A;  2L00 B;  3KUD B;  2PE6 B;  4A3O A;  3JVZ X;  3ZNG C;  3BY4 B;  3T8M A;  1Q0W B;  1WMH A;  4ZYN A;  2PPH A;  4ZRI A;  2DZJ A;  2IO1 B;  3MJW A;  4BKT A;  4HVB A;  3A4R A;  3EHV A;  3KUZ A;  1NI2 A;  1V5T A;  4ICU A;  2M0X A;  4PYZ A;  5CHV C;  3QC8 B;  3PGE A;  4MDK E;  4KIK A;  1P9D U;  1WR1 A;  2V1Y A;  4FAD A;  3EFU A;  4HJK A;  3APD A;  3PZD A;  1C1Y B;  3H6N A;  3HIZ A;  4W9E A;  3VFK A;  4B6W A;  4G50 A;  4HXD A;  4M8N A;  3QIJ A;  4W9K A;  4KDL B;  2KC2 A;  2WWZ A;  3LJ3 A;  4HLE A;  4BKS A;  4NJ7 A;  2BWE S;  4FA6 A;  5IA7 A;  2C60 A;  2AL6 A;  4TUU A;  2ZEQ A;  2KD0 A;  4AUQ C;  1WI0 A;  5JZE B;  2Z0D B;  4MGY E;  2KWV B;  1VCB A;  4LDT B;  2JZZ A;  1YX5 B;  4GDK B;  2KKC A;  4KVG B;  4AOF A;  1A5R A;  3IG3 A;  2N1W A;  3KYC D;  2R2O A;  3TMP B;  1TBE A;  2K8C A;  2MSE D;  3VTV A;  4E3C A;  1XT9 B;  3C0R B;  3H7P B;  4NNJ B;  3L16 A;  3Q3F A;  3H7S A;  4ANX A;  3NZS A;  3DVG Y;  1P98 A;  2NR2 A;  4CHK A;  2M17 A;  4DHZ B;  1WM2 A;  1U4A A;  3APC A;  3EC8 A;  3DBL I;  2NBU A;  2ZPN A;  1KJT A;  3ONS A;  1WGY A;  2KAN A;  3ZIM A;  3VTW A;  1H8C A;  1V86 A;  4KZ0 A;  2LVQ A;  5J2R A;  3TIX A;  4P7I A;  1UBI A;  3ML9 A;  3VDZ A;  2K8B A;  1YJ1 A;  5LXI B;  4AJY B;  1YIW A;  1QZE A;  2KFK B;  2MP2 A;  4FJY A;  2JT4 B;  2MP2 B;  2FCQ A;  1WY8 A;  2FCM A;  1NDD A;  4NY0 A;  1ZKH A;  3V61 A;  2KJ6 A;  5HKH A;  4FJV B;  3JSV A;  3CMM B;  2O6V A;  3VVW B;  2L05 A;  1TTN A;  1RAX A;  2KFJ A;  1GC6 A;  3OJ4 B;  2MA9 B;  2N7E A;  2ZNV C;  4HDO A;  3HK0 A;  1NBF C;  4NAW A;  4URK A;  2N7D A;  5IAA C;  3ZTC A;  3K9O B;  1LM8 B;  2ZVO A;  4HCN B;  2BYE A;  1WMH B;  2NBV B; 
#chains in the Genus database with same CATH topology
 1SGH A;  4TV3 A;  1LQB A;  3LYY A;  3Q6B A;  2IY1 B;  2H89 B;  1KOT A;  2WDQ B;  3L4P A;  3B2G A;  1XEE A;  2DZK A;  3U2S C;  3SR6 A;  1JQ4 A;  3KW5 B;  4PYU A;  1VJK A;  3RNC C;  3N9Y C;  2PVO D;  4DHZ E;  1UUP A;  2FUG 1;  1STE A;  2YEP B;  4EOY A;  2FAZ A;  1E8W A;  2GRI A;  4IDI A;  2ICI A;  2KO3 A;  3HVD A;  1AYF A;  1KF6 B;  4WIP A;  3C8Y A;  3ZYY X;  3SHQ A;  4A3P A;  1C77 A;  5KHQ A;  4GGQ A;  2MQJ A;  4YT0 B;  2JXT A;  1PFD A;  2I38 A;  2V3S A;  1ISN A;  1C4C A;  1V81 A;  2KAJ A;  1EUV B;  5DPW A;  2HDE A;  2ZJD A;  1P7E A;  2AYO B;  3A9K A;  2DYB A;  4ICV A;  2GBM A;  1E6E B;  4K7S A;  2BS2 B;  5C1Z A;  4F1S A;  1E8Y A;  3FIL A;  1MHX A;  1LXD A;  1HE8 A;  2LUM A;  1RLF A;  2IZV B;  2V0G A;  1C3T A;  1L4D B;  1I4X A;  1FXA A;  2V4I B;  5GXG B;  3HM6 X;  4G3X B;  2JF5 A;  1WXA A;  3BIN A;  1FNW A;  1SB3 C;  4EKU A;  5D3I B;  4XWT A;  5D2M B;  2KX3 A;  5G55 A;  1WE6 A;  2KMM A;  5FK9 C;  1D5X C;  2CS4 A;  2MWS B;  2L83 A;  3ZGZ A;  1AW7 A;  4AWJ A;  4EUT A;  3DCG A;  2QCZ A;  1ROE A;  3LXF A;  4KIK B;  4K7U A;  2HD5 B;  5AZH A;  3AV8 A;  4HDQ A;  2REX A;  1OTR B;  3ZTD A;  3ZUN A;  1WX8 A;  3VAW A;  2LI5 A;  1Q10 A;  3PT2 B;  4WJP A;  1R4N B;  1BML C;  3E9S A;  3VQI A;  3ZDM C;  3TEZ A;  2LHD A;  3AE3 B;  4RGM A;  4OW0 A;  3VR8 B;  4KGT A;  2MJD A;  1OQR A;  2KT7 A;  3DHI C;  4N9F 4;  1IGC A;  2HE7 A;  1V2Y A;  1WGH A;  2IO0 B;  2W54 A;  4LNN A;  1P0R A;  2KHW B;  2LXC A;  2ZNV B;  4M8M A;  1D4B A;  1QOA A;  4BFR A;  2KDI A;  3KYD D;  3OAW A;  2JQR B;  5AUI A;  4F8C B;  3J9C A;  4X57 B;  2I1J A;  4M0W A;  2ONQ A;  3U8Z A;  3SD5 A;  2JU6 X;  2ZW1 A;  1N60 A;  2CJN A;  3EGR A;  1L0V B;  5HG2 A;  4J3O D;  1WFY A;  1XF5 L;  1WSP A;  1ZW7 A;  1VZ6 A;  3RN9 C;  1QQR A;  3PRP B;  3IAM 1;  2RR9 A;  3ZXV A;  3PZ8 A;  3AE4 B;  2QEJ C;  4K7W A;  2IYD B;  1D6E C;  1V9J A;  3C19 A;  4MT5 A;  3PHX B;  2L52 A;  1Z5S B;  4J6I A;  1F77 A;  1K53 A;  3VRA B;  1R4M I;  1TY0 A;  2MW5 A;  4ZHP A;  1E0Z A;  2J0K A;  4RCO A;  4XC2 A;  3A9J B;  1L4Z B;  1SJH D;  3NVW A;  1V97 A;  1YMH E;  2WXP A;  4XZ4 A;  1DOI A;  2CU1 A;  1J19 A;  3P4Q B;  4RM9 A;  3WAN A;  2D07 B;  4LNO A;  3TEW A;  3PRM B;  4HKQ A;  2R61 A;  2BF8 B;  3P1M A;  4MH8 A;  3NG0 A;  2ZPY A;  2CHW A;  1TS5 A;  4JPS A;  4W9L A;  2M56 B;  2XK5 B;  4IC7 B;  2LFI A;  2H88 B;  2LRU A;  4BOZ B;  1L2N A;  2GLS A;  2QC8 A;  1GC7 A;  2L3Z A;  2NTS A;  1PUT A;  4LTU A;  2QSD A;  3H7P A;  3U7Z A;  2DAJ A;  3T3O A;  2DEN B;  2IY0 B;  3DVG X;  2MBH A;  3Q14 C;  1YQB A;  3ZNZ B;  3CWI A;  4C00 A;  1K8R B;  3A33 B;  2XEW A;  4II2 B;  3AM9 A;  3BYT B;  2LZ6 A;  1ESF A;  2FCS A;  3GP7 A;  4A55 A;  2C9W B;  5CHW A;  2C7M B;  4IM0 A;  2R2Q A;  3AB5 A;  1NVI D;  2BW2 A;  1OQY A;  3OLM D;  4MJS B;  4EE2 A;  3B0A A;  4ZDV A;  1T0R C;  4MGZ E;  3ZNI D;  1RFK A;  4G0N B;  3NOB A;  3AE6 B;  3APF A;  2KAC A;  1MVK A;  3NVY A;  4MGK E;  2O6V B;  3CF6 E;  3VR9 B;  3RT3 B;  1WJN A;  5GMV A;  1Y56 A;  2MX2 A;  1A70 A;  4N58 A;  2K8H A;  4GB9 A;  4XE0 A;  1S1Q B;  1XCT L;  2JXX A;  1G6J A;  3M95 A;  5EE9 A;  2NTT A;  1E7U A;  3X23 A;  1GJZ A;  1LGR A;  1C4A A;  2RD0 A;  3JSV B;  1VDV A;  3BVZ A;  3V3X A;  3MTN B;  3VUW A;  1HQR D;  2LGI A;  5TSS A;  2FNJ B;  4XYC A;  3JVZ X;  4AQ7 A;  3BY4 B;  3T8M A;  1FD6 A;  2IO1 B;  4BKT A;  4HVB A;  1V1P A;  3N1Z C;  1I4G A;  5IP4 D;  1EWC A;  2JYT A;  1ZXI A;  3P4S B;  1C1Y B;  3VRB B;  4W9E A;  4G50 A;  1ACC A;  3QIJ A;  4W9K A;  1L6U A;  2KC2 A;  2QDF A;  4KDL B;  4FA6 A;  2AL6 A;  2KD0 A;  1JWB D;  3DHG C;  5JZE B;  2IJ0 A;  4MGY E;  2X8X X;  4LDT B;  4GDK B;  2KKC A;  1IUE A;  4AOF A;  3KYC D;  2N1W A;  1TBE A;  1AWD A;  2MSE D;  4E3C A;  1XT9 B;  1GOZ A;  1HZ6 A;  4US8 A;  3NZS A;  1MG4 A;  3W2D A;  1UWX A;  2W55 A;  2M17 A;  5EE0 A;  3APC A;  2NBU A;  2KAN A;  3AE1 B;  5MPO A;  3VTW A;  4YSY B;  1XXG A;  2Y3A A;  4KZ0 A;  3TIX A;  1UBI A;  2AX5 A;  2K8B A;  3GZN B;  2V9H A;  3R8B A;  4TSS A;  4FJY A;  2MP2 B;  2FCM A;  3VVW B;  2KFJ A;  1GC6 A;  4IOI E;  2JWU A;  2L1A A;  2N7D A;  4RF0 A;  1JWS D;  1EO6 A;  1MFW A;  3KLS X;  4ARI A;  2WP9 B;  4EZL A;  3IFW B;  3RZF A;  5IO9 A;  2L76 A;  3OG5 A;  5KHO A;  2J42 A;  3PSE B;  1F52 A;  1T0Y A;  1VLB A;  3CST A;  5BYQ A;  1SE4 A;  4MM3 B;  4Q2J A;  3V6E B;  5D6J B;  2PLP A;  5BMH A;  4KDI C;  4HRS A;  4HCP B;  2M1M A;  4DDI D;  2MJ3 A;  5EDS A;  4CO7 A;  2WXI A;  1FFV A;  4NAW B;  3X0W A;  2FIF A;  2A5U A;  4AJW A;  3LB8 C;  4OZB A;  1WH3 A;  5JH5 C;  2BKF A;  3ZO5 B;  1QLB B;  4A6Q A;  3QAQ A;  4K3C A;  4H2A A;  2K39 A;  4FBJ B;  2OED A;  1I7H A;  1UGJ A;  4OVZ A;  3TBL D;  4ACF A;  2CHX A;  1RRB A;  1D5Z C;  1GB1 A;  1X1M A;  2JVC A;  3QCA A;  3CIR B;  4P16 A;  3AH7 A;  1WF9 A;  4MJS A;  5CTR C;  3NVZ A;  1WX9 A;  4PS3 A;  4PS8 A;  1IYF A;  1QT9 A;  4FXC A;  1TJE A;  2WX0 A;  2L32 A;  2PEA A;  3SFE B;  3RNE C;  3UI3 A;  4LNK A;  2AWT A;  2EKE C;  2ZCC A;  4EZJ A;  2GBJ A;  1C79 A;  1UNS A;  2C7N B;  2N9X A;  3GZN I;  5C23 A;  1V80 A;  3W1S C;  3WCQ A;  2TSS A;  3EUB 2;  3ENE A;  2KXJ A;  3A9J A;  3OJ3 A;  2MH7 A;  4NZL B;  2BGF A;  2JUO A;  4GDL B;  2DHZ A;  3MC9 A;  3PPA A;  4HWI B;  2KWD A;  2N1V A;  5D7G A;  5FR3 A;  5IKC M;  2WXR A;  1JAL A;  4W9D A;  1T5X D;  2KJH B;  4RM8 A;  3AE8 B;  2PW9 A;  5TR5 A;  3H1U A;  1XLN A;  2PJH A;  2AQ1 B;  4IW0 A;  1ZDV A;  1UF0 A;  4HKZ E;  2IPK D;  2N9E B;  4NQL B;  3L08 A;  2K6D B;  4REZ A;  2KC1 A;  3NRZ A;  4II3 B;  2JYE A;  2VH1 A;  2BWF A;  4F7Z A;  2N0S B;  2IGH A;  3VXW A;  4HPM B;  1JML A;  5CX3 A;  4A8X C;  2IO3 B;  1FXT B;  3DQV A;  2LJ5 A;  3SFD B;  3UIO B;  1FM0 D;  1RYJ A;  1RM6 C;  1KFY B;  3MHS D;  4GMV A;  1SE9 A;  1FRR A;  3Q8F A;  3I3T B;  3RFZ B;  2KYW A;  1SJE D;  2JRH A;  1DGJ A;  3I63 C;  1MG8 A;  4L2Y A;  1EF5 A;  2ZVN A;  2DLB A;  2O6V D;  2PMV A;  1UH6 A;  3U30 A;  4E74 A;  3WAO A;  1WZ0 A;  1FPY A;  3VH3 B;  3V62 A;  3ZDT A;  5LLI A;  1ZPS A;  1OEY J;  1VR9 A;  1XD3 B;  4W9H A;  4RFB A;  3Q8B A;  4YL8 A;  1TKE A;  4DXG A;  4WQO B;  1T6B X;  1FNU A;  3PS6 A;  1CZP A;  4ANU A;  1DOY A;  1E8Z A;  2D2Q A;  1UEL A;  1CK1 A;  4MEM A;  1R4N I;  1IP9 A;  3N30 A;  4LLG M;  4FHK A;  4OHJ A;  3OWE B;  1JWM D;  2N9K A;  1PGA A;  2PE9 A;  4US9 A;  3N32 A;  3JW0 X;  1T0S C;  1OEY A;  3MC8 A;  4ZYS A;  3R2I A;  2NS5 A;  1KLG D;  4P1B C;  3AEC B;  4WH4 A;  1XLP A;  3A4S C;  3PHW B;  1B1Z A;  4WWO A;  2KN4 A;  3ML8 A;  3ZJU A;  2MBB B;  3Q3O C;  1SIF A;  1BXT A;  4MM3 A;  4BOS C;  2BB5 A;  2C5L C;  2WXF A;  1WRD B;  1UD7 A;  3MP9 A;  3FKY A;  2N4F A;  3VUX A;  4OZA A;  4XWW A;  3W5U B;  4WJN A;  3GE8 C;  4KV2 A;  4FUL A;  3TEX A;  2K5P A;  4IUM B;  2JY6 A;  3H9D A;  4W9G A;  1GG3 A;  1C78 A;  1N62 A;  5HI1 A;  2WU5 B;  1DYQ A;  2WQY B;  3BVG A;  4RGT A;  2W3R A;  5E6J A;  4DK5 A;  4WWN A;  2KLG A;  1L5P A;  1KH0 A;  1S3S G;  1FCL A;  1TS4 A;  1HZ5 A;  4EFO A;  4HK2 A;  4NJ6 A;  1E90 A;  1SF0 A;  2MCN B;  1IBX B;  1GAQ B;  4XDD A;  3PLV A;  3AEA B;  1TGZ B;  3NUH B;  3DBS A;  1ZGU B;  2INP E;  4B0M A;  1UZX B;  5D3D A;  4RGO S;  1WE7 A;  4GIV A;  4JGH B;  1XLO A;  4JQW C;  1RWS A;  3O13 A;  2JRI B;  3P42 A;  4PT5 A;  2GBK A;  2KLC A;  2Z59 B;  2W9N A;  4P1C C;  3IT4 B;  3NZ3 A;  4MSQ B;  2FCN A;  1I42 A;  1ZUD 2;  1PDX A;  4JIO U;  3BK1 A;  2IND C;  3JYU A;  1SEB D;  3NJT A;  1WJ6 A;  3Q69 A;  4N6E B;  3NVV A;  1WIA A;  1YN5 A;  1V5O A;  3HRD D;  4WJQ A;  4ASW C;  2D3A A;  4KSL C;  3UQA A;  1YNT E;  2NPT B;  2D3C A;  2FBW B;  1QOB A;  1GNU A;  3PLU A;  2HJ1 A;  4IKG A;  3U7D A;  4DHJ B;  2ON8 A;  2WXH A;  2VH2 A;  4LNF A;  1Q0W B;  4ZRI A;  3MJW A;  3EHV A;  2BYT A;  1V5T A;  2M0X A;  3W9C B;  1QOG A;  1C9F A;  3RNB C;  1WR1 A;  4C7Z A;  3APD A;  3HIZ A;  1YQ3 B;  3VFK A;  2WDV B;  3BYY B;  4HLE A;  5IA7 A;  2K3U A;  2ZEQ A;  2QMT A;  4AUQ C;  2QIE B;  2Z0D B;  1VCB A;  1SXT A;  4LNI A;  1A5R A;  3DBR B;  3VTV A;  3BWU D;  3C0R B;  4NNJ B;  1I4R A;  3H7S A;  4ANX A;  1MPE A;  1P98 A;  5FKA C;  2NR2 A;  4ZOH C;  1WM2 A;  1ET6 A;  2K0P A;  3DBL I;  2ZPN A;  3ONS A;  1H8C A;  5HFY A;  5T8I A;  3Q8C A;  1YJ1 A;  4L1B A;  1QZE A;  2MP2 A;  3MJ5 A;  4ZRQ A;  4JWS C;  1IGD A;  4FJV B;  3JSV A;  3CMM B;  4S17 A;  2L05 A;  1TTN A;  1TS3 A;  3OJ4 B;  2MA9 B;  2N7E A;  2BTE A;  1NBF C;  1MI0 A;  4HPP A;  5IAA C;  2J53 A;  4HRO A;  4UDU C;  1LM8 B;  4R3D A;  3I57 A;  1WMH B;  2IO2 B;  3A1Q B;  2VZK B;  3AE9 B;  2DX5 B;  2NMQ A;  4IWQ A;  3TL5 A;  3P63 A;  2SEB D;  2BVC A;  3WA0 A;  2X38 A;  3RPF C;  2J4X A;  3AXC A;  3WAM A;  1OGW A;  2KNB A;  4AP4 C;  1OFF A;  2KVR A;  5G5G A;  2MRP A;  1JWA D;  1TS2 A;  1WGG A;  1WWT A;  2N7J A;  3IBE A;  1VD2 A;  3WIM A;  1K50 A;  4KKJ A;  3PTF C;  1ZOY B;  1M94 A;  2W3S A;  1B9R A;  4BVU C;  3KH0 A;  3NY5 A;  2BS3 B;  1QIL A;  3VUY A;  1WXV A;  5J17 A;  4YXD B;  2GB1 A;  2L8J A;  2LGD A;  2LUE A;  2Z8L A;  2MLB A;  3QK0 A;  2KX0 A;  2Y5C A;  1EU3 A;  1L7Y A;  1BUI C;  2ZZP B;  2D3B A;  2XN9 C;  3KVF B;  1I4H A;  4KGR A;  1JRP A;  4LDT D;  3DOW A;  2DZI A;  2L0T A;  4QAY A;  5JHA A;  2K22 A;  2D11 A;  2KDF B;  2OHF A;  3W1Y A;  1WGR A;  1QKZ A;  1QF6 A;  3QX1 A;  4DDG D;  3RUL A;  2PTL A;  4BKS D;  1I4Q A;  3QQ8 B;  2DNF A;  1E5W A;  5LXH A;  2RGF A;  4A20 A;  3TUO A;  3T9L A;  3P4R B;  2KQS A;  1QOF A;  4HEA 1;  1ENF A;  3H8H A;  4KKI A;  3A9K B;  4FJZ A;  3KUC B;  3D32 A;  4TQ0 A;  2RDH A;  2BQQ A;  2ZW0 A;  3ZNH B;  2G1E A;  4PS7 A;  5DPR A;  2GBR A;  4K3B A;  3RNF C;  1YD8 U;  2PIA A;  2NPT A;  4G11 A;  2G4S A;  1R4M B;  2KK8 A;  4NQK E;  1V1O A;  1PQS A;  4B9K A;  4BAX A;  1N63 A;  1KLU D;  2MBO A;  3PRE A;  3AE2 B;  2EKI A;  3BVM A;  3AE7 B;  2WS3 B;  2KQ7 A;  2KMC A;  5C2T B;  3DWG C;  4ANV A;  3UF8 A;  4DXA B;  3GOE A;  2LJI A;  4FN2 A;  3KQ4 A;  3W5V B;  2I1K A;  4LJO B;  4B95 A;  1J8C A;  2RPV A;  3HHM A;  2L7R A;  3ZKJ C;  3FIL B;  3NZU A;  4OVV A;  1GUA B;  2YEP F;  4WJO A;  1Z2M A;  1ZXH A;  4B0E A;  3HUI A;  4GXB A;  2LGY A;  2MEK A;  4GDL A;  1PYW D;  5JHB A;  2B76 B;  2V3N A;  2CKH B;  5H8Y E;  1AAR A;  2WXJ A;  1N6Z A;  4PK1 A;  1SE3 A;  2GBN A;  2KVZ A;  4CQN A;  4KSK C;  4ZHO A;  2CU3 A;  2LGX A;  2DYO A;  3TCA A;  4E71 A;  2GMI C;  2IGG A;  2G45 B;  4IWP A;  4P6V F;  3M62 B;  3QHT A;  3AU5 A;  2EMS A;  1WJ4 A;  1P7F A;  3NHE B;  3URY A;  2QJL A;  2LMC A;  4A9A A;  1TYG B;  4JLC A;  2GOW A;  4YTP B;  3ZVV A;  5AZG A;  2BYF A;  1WXQ A;  4K1R B;  2MJE A;  2D10 A;  4K81 A;  5FR6 A;  4OZC A;  1WYW B;  1YQ4 B;  1KRH A;  4IM2 A;  3V05 A;  3WAP A;  1TKG A;  4KX6 B;  1HTO A;  4GSW A;  1UGM A;  3WAL A;  1J7C A;  2QHO A;  3IVF A;  2LXA A;  3RNG C;  2KTR A;  4MEL A;  4NJC A;  1WGK A;  3U52 E;  2KWU B;  3MHZ A;  2N9P C;  4GU2 A;  1WX7 A;  1F2R C;  3ABV B;  3PVL A;  5L83 A;  3K9P B;  2OOB B;  3IXS A;  1V8C A;  3DDC B;  5C3J B;  3TSS A;  2YVC A;  3MFG A;  4YWG G;  1F9J A;  2LVP A;  1ZP0 B;  2MBE A;  5J18 A;  2G4D B;  1CQV A;  3R66 C;  3Q2A C;  3AMZ A;  1NYR A;  2IDY A;  2PKO A;  2WXO A;  5AEK B;  1HXY D;  3SEB A;  1FEH A;  3N1X C;  3M63 B;  2IBI B;  1V6E A;  1D3Z A;  5DPT A;  2BKR B;  3AU4 A;  4GN1 A;  2M8S A;  2KJR A;  4BBN C;  3A1Q A;  2LRW A;  2KWC A;  3RD2 A;  1YN4 A;  2WXM A;  2JZ3 B;  2OJW A;  4GDK A;  4OVU A;  2WDR B;  1WJU A;  1WM3 A;  1FNV A;  3VTU A;  3R7R A;  1E8X A;  1V49 A;  2NBW B;  5AZF A;  2AQ3 B;  3IHP C;  5AUK A;  2MBQ A;  2G3Q B;  2AEH A;  4RMA A;  4FHJ A;  2WNM A;  2D5G A;  1E10 A;  3ALB A;  2INN E;  5H92 C;  3SU8 X;  2LD9 A;  3HVZ A;  1JRU A;  4KZC A;  1L0X B;  2WXQ A;  3V6C B;  1LFD A;  3UQB A;  2W82 A;  4M00 A;  2WYQ A;  3AEG B;  3DPD A;  3N3K B;  2WXL A;  3B1L X;  2KFK A;  2L00 B;  2PE6 B;  3ZNG C;  1OQQ A;  1GPX A;  2M0A A;  1WMH A;  4ZYN A;  1FO4 A;  2MHJ A;  3A4R A;  3KUZ A;  3P4P B;  4C4V A;  1I4P A;  1TT5 B;  3QC8 B;  4KIK A;  1P9D U;  2V1Y A;  4FAD A;  4RGN A;  3H6N A;  4ITK A;  2M19 A;  3BZD B;  3LJ3 A;  4BKS A;  4NJ7 A;  3EFC A;  5BYS A;  2LGS A;  1WI0 A;  5LNK 1;  3MC0 B;  1FRD A;  2AQ2 B;  2KWV B;  2JZZ A;  4NAM A;  4KVG B;  1F1H A;  1XCQ L;  1M4V A;  3NS1 A;  4BZA A;  3H7P B;  1KTK A;  5EE3 A;  2WXK A;  1HTQ A;  4GLS C;  1U4A A;  3EC8 A;  3B2F A;  1KJT A;  1SBB B;  1WGY A;  3T3N A;  1V86 A;  2LVQ A;  3ML9 A;  3EA6 A;  2KFK B;  2FCQ A;  3DBL B;  1EWY C;  2QIL A;  1NDD A;  1ZKH A;  3V61 A;  2BB6 A;  1RAX A;  4M02 A;  4NAW A;  4URK A;  4JE3 B;  2DWQ A;  1FCC C;  1L6V A;  3DBR I;  2BYE A;  3Q3J A;  2Z0E B;  1WZ3 A;  3RZW C;  1WGD A;  4MGI E;  4IM3 A;  3RYT A;  3U4E G;  2E3T A;  2WX1 A;  1VRA B;  2VZK D;  1WR6 E;  3PRZ A;  1WXM A;  1J7B A;  2Q5W D;  4TKN A;  4NPN A;  2LWP A;  1FXI A;  3KWL A;  3DWM A;  4BKG A;  3L17 A;  2V4L A;  2KDM A;  1VZ7 A;  4BBN F;  1TZ1 A;  4D2K A;  4EEW A;  3AN1 A;  2FID A;  2IGD A;  2WLB A;  4YTM B;  2INC C;  3DBH I;  2ASQ A;  2LAS A;  2NVU I;  4ANW A;  3UGB B;  4ARC A;  4LCD E;  4M0W B;  2FE8 A;  3TJP A;  3IAS 1;  5BO4 B;  1K51 A;  3L10 B;  1D5M C;  2K6Q A;  2OJR A;  5E6P A;  2EEL A;  2O2V B;  1N5X A;  4I6P A;  3FAH A;  1EF1 A;  2K9X A;  2BS4 B;  3UIN B;  1I35 A;  3DHH C;  2VRR B;  1KM7 A;  4IWO A;  1TKY A;  2G9H D;  3RI7 C;  2CHZ A;  3P2B A;  2M4N A;  4WWM A;  1NEK B;  4USA A;  4DQO C;  3EEC A;  3DVN U;  3IT6 B;  4ZRK A;  5D94 A;  1T0Q C;  3KWV A;  2KZR A;  3VH4 B;  3B9J A;  2DZM A;  1C76 A;  4AS1 A;  4WAF A;  3RMK C;  5DPS A;  4TQ1 A;  4WWP A;  1P3Q U;  3O65 B;  3DVN V;  3QJZ A;  4XDC A;  2KDB A;  1FIQ A;  4DHJ D;  1NYQ A;  2DYM A;  5JXV A;  1CJE A;  2BYV E;  2KTR B;  2BBC A;  2HJ8 A;  2E6X A;  2CR5 A;  4C80 A;  2WGS A;  3PO0 A;  2J7Q B;  3ZXR A;  1ET9 A;  1NI3 A;  1PGX A;  3FC4 A;  3GB1 A;  4M01 A;  3AI5 A;  1J0G A;  1EU4 A;  2L0F A;  2WU2 B;  1EM7 A;  3BII D;  4WQM A;  2Y5B B;  1FFU A;  1IPG A;  3AEF B;  2ACZ B;  3QAR A;  5I4D A;  1TIF A;  4TMA B;  4HPL B;  3RCZ A;  2RMM A;  4W9I A;  4O1N A;  1XQQ A;  2YLM A;  1SSN A;  3DBH B;  4XX5 A;  2KTF A;  1JCK B;  2LEK A;  2J0M A;  2JX5 A;  4DWF A;  3Q3N C;  3Q8E A;  3I9V 1;  1N61 A;  2C7H A;  4A90 A;  4C4V B;  4XGA B;  3ZJV A;  5E6N A;  3PV1 A;  2J0J A;  1XO3 A;  2BPS A;  2WXN A;  4GOC A;  2K1F A;  2D3G A;  2JSV X;  4ZRJ A;  2K25 A;  3ZW3 A;  1P1A A;  1H4R A;  1HA5 A;  2DAF A;  3Q8A A;  1CMX B;  2KOX A;  3AED B;  3R3M A;  1RFA A;  2PVG C;  1ZE3 D;  2JPH A;  5BYR A;  3NS8 A;  2V3P A;  1WYG A;  2UU7 A;  2HTM E;  3UIP B;  1F2R I;  1YX6 B;  2KMA A;  2XBB C;  3L54 A;  4IG7 B;  5E6O A;  2LHE A;  1JRO A;  5HHD G;  1E7V A;  2I2Y A;  4MSM B;  1E9M A;  3LDZ E;  5IOI A;  2KN5 A;  4W9C A;  4L23 A;  3RUI B;  1Q1O A;  1UWM A;  1TY2 A;  4MH0 E;  2XNA C;  4DXF A;  2EMT A;  2A4Z A;  4N59 A;  2FUH B;  5L95 C;  2UYZ B;  1E7P B;  3ZLZ A;  4JL9 A;  1K52 A;  1F0Z A;  3HM3 A;  2GI9 A;  1WRI A;  1UBQ A;  1WXS A;  3R7Q A;  4DBG A;  4JWU C;  2ZCB A;  1BT0 A;  2BT6 A;  2WDT B;  1Y8R C;  3AUL A;  1TZO A;  2KQ4 X;  1IBX A;  4RNA A;  1PGB A;  3I5J C;  3N20 C;  4WAA A;  3L13 A;  4CYE A;  3BK2 A;  3PZ7 A;  1MHH E;  1FMA D;  4YTN B;  1KLV A;  3S2A A;  3N1Y C;  1AN8 A;  4RH6 A;  5CHF A;  2NCN A;  2CJO A;  1JWU D;  3AEE B;  3W1S A;  1MJD A;  5G5H A;  3GS2 A;  3AE5 B;  2LVO A;  5DCN A;  5BMI A;  3CSF A;  5BMG A;  1XLQ A;  2HTH A;  2B3A A;  2SAK A;  3M3J A;  4I6N B;  2J52 A;  2UWQ A;  3L0W B;  1HEZ E;  2KDE B;  4W9F A;  4W9J A;  1VZ8 A;  1V1P B;  1Q5W B;  2AL3 A;  2XK5 A;  3VHT C;  3B08 A;  1YN3 A;  4LJP B;  2RPQ A;  3Q3M C;  3QA8 A;  3ZJT A;  2DBY A;  4KGS A;  2RSU A;  5G2N A;  3E56 A;  1GB4 A;  3SDL C;  4RF1 A;  1YOV B;  3ECI A;  4FLH A;  2JWZ A;  3ZRC A;  5IN7 A;  3V60 A;  3ZRF A;  4EZK A;  2O2V A;  3QWZ B;  3ETR A;  2RDG A;  1YJI A;  4I6L B;  3KUD B;  4A3O A;  4WUR A;  2PPH A;  2DZJ A;  2Y5P A;  4ICU A;  1NI2 A;  3ZQ4 A;  3RNA C;  4PYZ A;  5CHV C;  3PGE A;  4MDK E;  3EFU A;  4HJK A;  1YJJ A;  4JX1 C;  3PZD A;  4YSZ B;  2WHI A;  4B6W A;  2JZP A;  4HXD A;  4M8N A;  4LK0 M;  2WWZ A;  4ZRP A;  2BWE S;  2C60 A;  4TUU A;  1C4P A;  1ZDX A;  1YX5 B;  1SE2 A;  3IG3 A;  2R2O A;  3TMP B;  2K8C A;  4C7Y A;  4S0R A;  3R2T A;  1L0Y B;  3L16 A;  5EE1 A;  3Q3F A;  3DVG Y;  4MAC A;  1SIJ A;  4CHK A;  4DHZ B;  1DOX A;  2RDB C;  1R7S A;  3ZIM A;  3GE3 C;  1NEN B;  1N5W A;  5J2R A;  3AEB B;  4P7I A;  1T3Q A;  3VDZ A;  5LXI B;  4HJG E;  1YIW A;  4AJY B;  1J7A A;  1JW9 D;  2JT4 B;  1WY8 A;  4YSX B;  4NY0 A;  5HKH A;  2KJ6 A;  3TEY A;  2O6V A;  2N9L A;  1LO5 D;  4C56 C;  2ZNV C;  4HDO A;  3HK0 A;  2WXG A;  3ZTC A;  3K9O B;  2ZVO A;  4HCN B;  2NBV B; 
#chains in the Genus database with same CATH homology
 2IO2 B;  2Z0E B;  1SGH A;  3A1Q B;  4TV3 A;  1LQB A;  1WZ3 A;  3RZW C;  2DX5 B;  4IWQ A;  1WGD A;  3TL5 A;  4MGI E;  4IM3 A;  3WA0 A;  3RYT A;  1EO6 A;  4EZL A;  3IFW B;  2WX1 A;  3AXC A;  2IY1 B;  3RZF A;  3WAM A;  2L76 A;  1OGW A;  2KNB A;  5KHO A;  1WR6 E;  3PRZ A;  1WXM A;  4AP4 C;  2KVR A;  1KOT A;  3PSE B;  1T0Y A;  3CST A;  4TKN A;  4NPN A;  2DZK A;  2LWP A;  3V6E B;  4BKG A;  5D6J B;  2MRP A;  3L17 A;  2V4L A;  4KDI C;  3KW5 B;  4PYU A;  4BBN F;  1WGG A;  4HCP B;  1TZ1 A;  4EEW A;  2FID A;  2M1M A;  1VD2 A;  3IBE A;  3WIM A;  4DDI D;  5EDS A;  4CO7 A;  4DHZ E;  3PTF C;  3DBH I;  2ASQ A;  2LAS A;  4EOY A;  1M94 A;  2NVU I;  4NAW B;  3X0W A;  4ANW A;  2FIF A;  2FAZ A;  1E8W A;  2A5U A;  4AJW A;  4BVU C;  3UGB B;  3KH0 A;  3NY5 A;  1WH3 A;  5JH5 C;  4LCD E;  2BKF A;  4M0W B;  3VUY A;  1WXV A;  3ZO5 B;  5J17 A;  2KO3 A;  3QAQ A;  3TJP A;  2K39 A;  5BO4 B;  4FBJ B;  3L10 B;  2L8J A;  2LGD A;  2LUE A;  2K6Q A;  2MLB A;  2OJR A;  3QK0 A;  3TBL D;  2CHX A;  5E6P A;  2KX0 A;  2O2V B;  3SHQ A;  4I6P A;  4A3P A;  5KHQ A;  1RRB A;  1L7Y A;  2ZZP B;  4GGQ A;  1EF1 A;  2MQJ A;  1X1M A;  3KVF B;  2JVC A;  3QCA A;  3UIN B;  1I35 A;  2V3S A;  1ISN A;  2VRR B;  1KM7 A;  1V81 A;  1WF9 A;  4IWO A;  4MJS A;  5CTR C;  1EUV B;  1WX9 A;  4LDT D;  4PS3 A;  4PS8 A;  3DOW A;  2DZI A;  2ZJD A;  5DPW A;  2CHZ A;  2L0T A;  3P2B A;  1IYF A;  5JHA A;  2AYO B;  2WX0 A;  2M4N A;  3A9K A;  2DYB A;  3EEC A;  2D11 A;  2PEA A;  3DVN U;  4ICV A;  4ZRK A;  5D94 A;  2GBM A;  2KDF B;  3W1Y A;  1WGR A;  2KZR A;  3VH4 B;  4K7S A;  2DZM A;  5C1Z A;  4F1S A;  3QX1 A;  1E8Y A;  4DDG D;  3RUL A;  5DPS A;  4TQ1 A;  1LXD A;  1HE8 A;  2AWT A;  2IZV B;  1RLF A;  2EKE C;  2ZCC A;  4WWP A;  4EZJ A;  1C3T A;  4BKS D;  2GBJ A;  1P3Q U;  3GZN I;  2C7N B;  2N9X A;  3O65 B;  5C23 A;  1V80 A;  3QQ8 B;  5LXH A;  1E5W A;  2RGF A;  3DVN V;  3HM6 X;  3QJZ A;  3W1S C;  2KDB A;  4DHJ D;  3ENE A;  4G3X B;  4A20 A;  2KXJ A;  2DYM A;  2JF5 A;  2BYV E;  3T9L A;  2KQS A;  3A9J A;  3OJ3 A;  1WXA A;  2KTR B;  3BIN A;  4EKU A;  2HJ8 A;  2BGF A;  5D2M B;  2JUO A;  2KX3 A;  2CR5 A;  3A9K B;  4FJZ A;  5G55 A;  3KUC B;  4GDL B;  1WE6 A;  2DHZ A;  3D32 A;  4TQ0 A;  2CS4 A;  2MWS B;  2J7Q B;  3PPA A;  4HWI B;  2N1V A;  5D7G A;  4AWJ A;  3ZNH B;  4EUT A;  3DCG A;  4PS7 A;  4KIK B;  3AI5 A;  5DPR A;  4K7U A;  1J0G A;  2HD5 B;  2GBR A;  5AZH A;  4HDQ A;  1YD8 U;  4W9D A;  2L0F A;  2REX A;  4RM8 A;  2KJH B;  1OTR B;  2NPT A;  4G11 A;  5TR5 A;  3ZTD A;  3H1U A;  2G4S A;  1WX8 A;  2Y5B B;  2KK8 A;  4NQK E;  3VAW A;  1IPG A;  2LI5 A;  2PJH A;  1PQS A;  3PT2 B;  3QAR A;  4IW0 A;  4WJP A;  4B9K A;  2N9E B;  4NQL B;  3L08 A;  2K6D B;  3VQI A;  3RCZ A;  4HPL B;  3ZDM C;  4W9I A;  2MBO A;  2KC1 A;  3PRE A;  4II3 B;  4F7Z A;  2BWF A;  1XQQ A;  2KQ7 A;  2KMC A;  3VXW A;  4HPM B;  4ANV A;  2YLM A;  3UF8 A;  5CX3 A;  4N9F 4;  2HE7 A;  4XX5 A;  4DXA B;  1V2Y A;  1FXT B;  1WGH A;  2IO0 B;  2IO3 B;  2KTF A;  3GOE A;  4FN2 A;  3DQV A;  2KHW B;  2LJ5 A;  1P0R A;  2LXC A;  2ZNV B;  2I1K A;  2J0M A;  4LJO B;  4B95 A;  1J8C A;  4M8M A;  4BFR A;  2KDI A;  3HHM A;  4DWF A;  2L7R A;  3ZKJ C;  3UIO B;  3KYD D;  3OAW A;  3NZU A;  4OVV A;  2C7H A;  3MHS D;  4GMV A;  1SE9 A;  1GUA B;  3I3T B;  4WJO A;  1Z2M A;  5E6N A;  4F8C B;  2JRH A;  2LGY A;  4GXB A;  4X57 B;  4GDL A;  3PV1 A;  2J0J A;  5JHB A;  1MG8 A;  2I1J A;  1EF5 A;  2ZVN A;  2CKH B;  1AAR A;  3U8Z A;  2BPS A;  3SD5 A;  4GOC A;  2O6V D;  2K1F A;  2GBN A;  1UH6 A;  3U30 A;  2D3G A;  4E74 A;  1WFY A;  3WAO A;  1WZ0 A;  4ZRJ A;  2K25 A;  4KSK C;  3ZW3 A;  1P1A A;  1ZW7 A;  3VH3 B;  3PRP B;  3V62 A;  2LGX A;  2DYO A;  5LLI A;  3TCA A;  3ZDT A;  1OEY J;  1H4R A;  4E71 A;  1XD3 B;  2GMI C;  2G45 B;  2DAF A;  2RR9 A;  1CMX B;  4W9H A;  2KOX A;  4K7W A;  2IYD B;  4YL8 A;  4WQO B;  3R3M A;  4IWP A;  1RFA A;  3PS6 A;  1V9J A;  3Q3J A;  4ANU A;  2JPH A;  3M62 B;  3QHT A;  1E8Z A;  2D2Q A;  1UEL A;  3AU5 A;  2EMS A;  4MEM A;  1R4N I;  3NS8 A;  1IP9 A;  3N30 A;  3PHX B;  1WJ4 A;  1Z5S B;  4J6I A;  4FHK A;  3NHE B;  3UIP B;  1YX6 B;  2KMA A;  2XBB C;  2PE9 A;  1R4M I;  3N32 A;  3JW0 X;  3L54 A;  4IG7 B;  1OEY A;  2MW5 A;  5E6O A;  4JLC A;  2GOW A;  2J0K A;  2NS5 A;  3ZVV A;  1E7V A;  5AZG A;  2BYF A;  4K1R B;  4MSM B;  4XC2 A;  3A9J B;  3LDZ E;  2KN5 A;  3A4S C;  3PHW B;  4W9C A;  2D10 A;  4K81 A;  5FR6 A;  4WWO A;  3RUI B;  1WYW B;  1Q1O A;  3ML8 A;  4XZ4 A;  2MBB B;  4IM2 A;  4MH0 E;  1SIF A;  4MM3 A;  2CU1 A;  3WAP A;  3ZUN A;  1J19 A;  2EMT A;  4RM9 A;  4BOS C;  2A4Z A;  3WAN A;  2D07 B;  2C5L C;  3PRM B;  4GSW A;  1UGM A;  2FUH B;  1WRD B;  3WAL A;  2BF8 B;  1UD7 A;  2QHO A;  3IVF A;  5L95 C;  2ZPY A;  2CHW A;  2LXA A;  2UYZ B;  4W9L A;  2KTR A;  4MEL A;  2N4F A;  4JL9 A;  2XK5 B;  4IC7 B;  3VUX A;  3ZLZ A;  2KWU B;  3DBR I;  2N9P C;  4GU2 A;  3HM3 A;  1WX7 A;  4WJN A;  1WXS A;  1UBQ A;  3R7Q A;  2LRU A;  4BOZ B;  3PVL A;  4KV2 A;  5L83 A;  4DBG A;  4FUL A;  3K9P B;  1L2N A;  2ZCB A;  1BT0 A;  1GC7 A;  2WDT B;  2L3Z A;  1Y8R C;  2OOB B;  3AUL A;  4IUM B;  2JY6 A;  3H9D A;  4W9G A;  1GG3 A;  3DDC B;  2YVC A;  3H7P A;  1F9J A;  2LVP A;  2DAJ A;  2DEN B;  2IY0 B;  2MBE A;  3DVG X;  2MBH A;  5J18 A;  2G4D B;  4WAA A;  3L13 A;  4CYE A;  1YQB A;  3R66 C;  3ZNZ B;  4DK5 A;  4WWN A;  1K8R B;  2KLG A;  3A33 B;  1KLV A;  3S2A A;  5AEK B;  2XEW A;  5CHF A;  1S3S G;  2NCN A;  4II2 B;  4EFO A;  3M63 B;  2IBI B;  4HK2 A;  4NJ6 A;  1V6E A;  1E90 A;  3W1S A;  2LZ6 A;  2FCS A;  1D3Z A;  5DPT A;  2LVO A;  5DCN A;  2MCN B;  2C9W B;  3PLV A;  2BKR B;  3AU4 A;  4GN1 A;  3CSF A;  2M8S A;  5CHW A;  2HTH A;  2B3A A;  1TGZ B;  2KJR A;  2C7M B;  3DBS A;  1ZGU B;  4IM0 A;  4BBN C;  3M3J A;  2R2Q A;  4I6N B;  1UZX B;  2LRW A;  2UWQ A;  3A1Q A;  2KWC A;  3RD2 A;  3L0W B;  1OQY A;  3OLM D;  4MJS B;  3B0A A;  4ZDV A;  3ZNI D;  4MGZ E;  1WE7 A;  2KDE B;  3NOB A;  4G0N B;  4W9F A;  4GIV A;  3APF A;  4W9J A;  4JGH B;  4JQW C;  2JZ3 B;  4MGK E;  4GDK A;  1Q5W B;  2O6V B;  4OVU A;  2JRI B;  2AL3 A;  1WJU A;  1WM3 A;  2XK5 A;  3VTU A;  3CF6 E;  3R7R A;  1E8X A;  1V49 A;  2NBW B;  5AZF A;  3RT3 B;  1WJN A;  2GBK A;  2KLC A;  2Z59 B;  2W9N A;  3B08 A;  5GMV A;  3VHT C;  3IHP C;  4LJP B;  4MSQ B;  2MX2 A;  2FCN A;  1I42 A;  2MBQ A;  2G3Q B;  4JIO U;  3JYU A;  2RPQ A;  1WJ6 A;  2AEH A;  4RMA A;  3QA8 A;  1WIA A;  4FHJ A;  2K8H A;  2RSU A;  4GB9 A;  1V5O A;  3ALB A;  1S1Q B;  4WJQ A;  5G2N A;  4ASW C;  4KSL C;  3SU8 X;  3SDL C;  3UQA A;  2JXX A;  2LD9 A;  2NPT B;  1G6J A;  3M95 A;  1JRU A;  1E7U A;  4KZC A;  3X23 A;  3ECI A;  3V6C B;  1GJZ A;  4FLH A;  2JWZ A;  1LFD A;  3ZRC A;  3UQB A;  1GNU A;  3PLU A;  3V60 A;  3ZRF A;  2RD0 A;  3JSV B;  4EZK A;  2WYQ A;  2O2V A;  3MTN B;  3DPD A;  3QWZ B;  3U7D A;  3VUW A;  3N3K B;  4DHJ B;  3B1L X;  2FNJ B;  4I6L B;  2KFK A;  2L00 B;  3KUD B;  2PE6 B;  4A3O A;  3JVZ X;  3ZNG C;  3BY4 B;  3T8M A;  1Q0W B;  1WMH A;  4ZYN A;  2PPH A;  4ZRI A;  2DZJ A;  2IO1 B;  3MJW A;  4BKT A;  4HVB A;  3A4R A;  3EHV A;  3KUZ A;  1NI2 A;  1V5T A;  4ICU A;  2M0X A;  4PYZ A;  5CHV C;  3QC8 B;  3PGE A;  4MDK E;  4KIK A;  1P9D U;  1WR1 A;  2V1Y A;  4FAD A;  3EFU A;  4HJK A;  3APD A;  3PZD A;  1C1Y B;  3H6N A;  3HIZ A;  4W9E A;  3VFK A;  4B6W A;  4G50 A;  4HXD A;  4M8N A;  3QIJ A;  4W9K A;  4KDL B;  2KC2 A;  2WWZ A;  3LJ3 A;  4HLE A;  4BKS A;  4NJ7 A;  2BWE S;  4FA6 A;  5IA7 A;  2C60 A;  2AL6 A;  4TUU A;  2ZEQ A;  2KD0 A;  4AUQ C;  1WI0 A;  5JZE B;  2Z0D B;  4MGY E;  2KWV B;  1VCB A;  4LDT B;  2JZZ A;  1YX5 B;  4GDK B;  2KKC A;  4KVG B;  4AOF A;  1A5R A;  3IG3 A;  2N1W A;  3KYC D;  2R2O A;  3TMP B;  1TBE A;  2K8C A;  2MSE D;  3VTV A;  4E3C A;  1XT9 B;  3C0R B;  3H7P B;  4NNJ B;  3L16 A;  3Q3F A;  3H7S A;  4ANX A;  3NZS A;  3DVG Y;  1P98 A;  2NR2 A;  4CHK A;  2M17 A;  4DHZ B;  1WM2 A;  1U4A A;  3APC A;  3EC8 A;  3DBL I;  2NBU A;  2ZPN A;  1KJT A;  3ONS A;  1WGY A;  2KAN A;  3ZIM A;  3VTW A;  1H8C A;  1V86 A;  4KZ0 A;  2LVQ A;  5J2R A;  3TIX A;  4P7I A;  1UBI A;  3ML9 A;  3VDZ A;  2K8B A;  1YJ1 A;  5LXI B;  4AJY B;  1YIW A;  1QZE A;  2KFK B;  2MP2 A;  4FJY A;  2JT4 B;  2MP2 B;  2FCQ A;  1WY8 A;  2FCM A;  1NDD A;  4NY0 A;  1ZKH A;  3V61 A;  2KJ6 A;  5HKH A;  4FJV B;  3JSV A;  3CMM B;  2O6V A;  3VVW B;  2L05 A;  1TTN A;  1RAX A;  2KFJ A;  1GC6 A;  3OJ4 B;  2MA9 B;  2N7E A;  2ZNV C;  4HDO A;  3HK0 A;  1NBF C;  4NAW A;  4URK A;  2N7D A;  5IAA C;  3ZTC A;  3K9O B;  1LM8 B;  2ZVO A;  4HCN B;  2BYE A;  1WMH B;  2NBV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...