2BYNA

Crystal structure of apo achbp from aplysia californica
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
216
structure length
216
Chain Sequence
YKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE ACETYLCHOLINE RECEPTOR
publication title Structures of Aplysia Achbp Complexes with Nicotinic Agonists and Antagonists Reveal Distinctive Binding Interfaces and Conformations.
pubmed doi rcsb
molecule tags Receptor
total genus 55
structure length 216
sequence length 216
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2bynA00
4UXUA 3JAFA 3ZDGA 5KE4A 4HFIA 5BW2A 5LG3A 2Y7YA 4QH4A 4AFGA 4UM3S 3GUAA 2W8FA 3WTOA 4QH5A 2Y54A 3SH1A 2Y57A 4ZR6A 4HFHA 5AINA 5L4EA 5J5GA 2BR8A 2XZ5A 2YN6A 2QC1B 2YKSA 3TLSA 2XQ8A 5HCJA 2XQ9A 5AFHA 1UW6A 5CO5A 3TLVA 2XNUA 5J5HA 3IGQA 4HFDA 4QACA 4TNWA 3UQ4A 4QH1A 5AFNA 4ZZBA 4PIRA 4ILAA 2WNLA 3WTIA 5L47A 3U8JA 3WTMA 2BG9B 3SQ6A 3UU3A 5CFBA 4QAAA 4ZRUA 3P50A 3ZDHA 5J5IA 3TLTA 2UZ6A 3SIOA 5IUXA 2XYSA 4LMJA 4X5TA 5L4HA 4B5DA 3PEOA 4Z90A 2XQ7A 3WTHA 2BG9C 2YMEA 3RHWA 5HEJA 3RQUA 2BG9E 4IREA 4HFCA 3RIAA 3WTJA 2BG9A 1I9BA 2PH9A 2Y56A 2XZ6A 2X00D 2WNJA 4HFEA 3P4WA 4TWFA 3U8LA 4TNVA 4ILBA 3JADA 4ZJTA 3LSVA 2ZJUA 3UU6A 3PMZA 3EHZA 3ZKRA 2XQ4A 2YOEA 5BP0A 2BYRA 2XQ3A 4ZJSA 5AFJA 4F8HA 2BYQA 3UU5A 5J0ZA 4NZBA 2C9TA 2XQ6A 4TWHA 2BJ0A 4BFQA 3TLWA 5AFMB 2XQ5A 5TVCA 3WTNA 2Y58A 3UUBA 4DBMA 4XHEA 5BRXA 4ILCA 2XNTA 3RQWA 3U8MA 4ZK4A 4A98A 4NPPA 2PGZA 2WZYA 4HQPA 4UM3A 4WV9A 5FJVA 5HCMA 3C79A 4UM3P 5HEUA 3EAMA 2BYNA 3C84A 5LXBA 3UU8A 3UU4A 2YMDA 2BYPA 4ZZCA 5HEHA 5AFMA 3RIFA 3EI0A 4AFHA 5KZUA 4AFTA 1UV6A 4HFBA 5JMEA 3SQ9A 3WTKA 3T4MA 5AFLA 2X00A 4IL4A 4COFA 5J5FA 2WNCA 2XYTA 2ZJVA 4UM1A 2VL0A 4A97A 3JAEA 4ZK1A 3WTLA 2BR7A 2XQAA 4TWDA 4XK9A 4D01A 5HEOA 5SYOA 4IL9A 3TLUA 2W8GA 4FRRA 4ALXA 4Z91A 5AFKA 5HEGA 3U8KA 4QABA 4EZ1A 3UQ7A 4UY2A 3RI5A 2BYSA 2XNVA 2WN9A 4LMLA 4LMKA 3WIPA 4BQTA 1UX2A 3U8NA
chains in the Genus database with same CATH superfamily
4UXUA 3JAFA 3ZDGA 5KE4A 4HFIA 5BW2A 5LG3A 2Y7YA 4QH4A 4AFGA 4UM3S 3GUAA 2W8FA 3WTOA 4QH5A 2Y54A 3SH1A 2Y57A 4ZR6A 4HFHA 5AINA 5L4EA 5J5GA 2BR8A 2XZ5A 2YN6A 2QC1B 2YKSA 3TLSA 2XQ8A 5HCJA 2XQ9A 5AFHA 1UW6A 5CO5A 3TLVA 2XNUA 5J5HA 3IGQA 4HFDA 4QACA 4TNWA 3UQ4A 4QH1A 5AFNA 4ZZBA 4PIRA 4ILAA 2WNLA 3WTIA 5L47A 3U8JA 3WTMA 2BG9B 3SQ6A 3UU3A 5CFBA 4QAAA 4ZRUA 3P50A 3ZDHA 5J5IA 3TLTA 2UZ6A 3SIOA 5IUXA 2XYSA 4LMJA 4X5TA 5L4HA 4B5DA 3PEOA 4Z90A 2XQ7A 3WTHA 2BG9C 2YMEA 3RHWA 5HEJA 3RQUA 2BG9E 4IREA 4HFCA 3RIAA 3WTJA 2BG9A 1I9BA 2PH9A 2Y56A 2XZ6A 2X00D 2WNJA 4HFEA 3P4WA 4TWFA 3U8LA 4TNVA 4ILBA 3JADA 4ZJTA 3LSVA 2ZJUA 3UU6A 3PMZA 3EHZA 3ZKRA 2XQ4A 2YOEA 5BP0A 2BYRA 2XQ3A 4ZJSA 5AFJA 4F8HA 2BYQA 3UU5A 5J0ZA 4NZBA 2C9TA 2XQ6A 4TWHA 2BJ0A 4BFQA 3TLWA 5AFMB 2XQ5A 5TVCA 3WTNA 2Y58A 3UUBA 4DBMA 4XHEA 5BRXA 4ILCA 2XNTA 3RQWA 3U8MA 4ZK4A 4A98A 4NPPA 2PGZA 2WZYA 4HQPA 4UM3A 4WV9A 5FJVA 5HCMA 3C79A 4UM3P 5HEUA 3EAMA 2BYNA 3C84A 5LXBA 3UU8A 3UU4A 2YMDA 2BYPA 4ZZCA 5HEHA 5AFMA 3RIFA 3EI0A 4AFHA 5KZUA 4AFTA 1UV6A 4HFBA 5JMEA 3SQ9A 3WTKA 3T4MA 5AFLA 2X00A 4IL4A 4COFA 5J5FA 2WNCA 2XYTA 2ZJVA 4UM1A 2VL0A 4A97A 3JAEA 4ZK1A 3WTLA 2BR7A 2XQAA 4TWDA 4XK9A 4D01A 5HEOA 5SYOA 4IL9A 3TLUA 2W8GA 4FRRA 4ALXA 4Z91A 5AFKA 5HEGA 3U8KA 4QABA 4EZ1A 3UQ7A 4UY2A 3RI5A 2BYSA 2XNVA 2WN9A 4LMLA 4LMKA 3WIPA 4BQTA 1UX2A 3U8NA
chains in the Genus database with same CATH topology
4UXUA 3JAFA 3ZDGA 5KE4A 4HFIA 5BW2A 5LG3A 2Y7YA 4QH4A 4AFGA 4UM3S 3GUAA 2W8FA 3WTOA 4QH5A 2Y54A 3SH1A 2Y57A 4ZR6A 4HFHA 5AINA 5L4EA 5J5GA 2BR8A 2XZ5A 2YN6A 2QC1B 2YKSA 3TLSA 2XQ8A 5HCJA 2XQ9A 5AFHA 1UW6A 5CO5A 3TLVA 2XNUA 5J5HA 3IGQA 4HFDA 4QACA 4TNWA 3UQ4A 4QH1A 5AFNA 4ZZBA 4PIRA 4ILAA 2WNLA 3WTIA 5L47A 3U8JA 3WTMA 2BG9B 3SQ6A 3UU3A 5CFBA 4QAAA 4ZRUA 3P50A 3ZDHA 5J5IA 3TLTA 2UZ6A 3SIOA 5IUXA 2XYSA 4LMJA 4X5TA 5L4HA 4B5DA 3PEOA 4Z90A 2XQ7A 3WTHA 2BG9C 2YMEA 3RHWA 5HEJA 3RQUA 2BG9E 4IREA 4HFCA 3RIAA 3WTJA 2BG9A 1I9BA 2PH9A 2Y56A 2XZ6A 2X00D 2WNJA 4HFEA 3P4WA 4TWFA 3U8LA 4TNVA 4ILBA 3JADA 4ZJTA 3LSVA 2ZJUA 3UU6A 3PMZA 3EHZA 3ZKRA 2XQ4A 2YOEA 5BP0A 2BYRA 2XQ3A 4ZJSA 5AFJA 4F8HA 2BYQA 3UU5A 5J0ZA 4NZBA 2C9TA 2XQ6A 4TWHA 2BJ0A 4BFQA 3TLWA 5AFMB 2XQ5A 5TVCA 3WTNA 2Y58A 3UUBA 4DBMA 4XHEA 5BRXA 4ILCA 2XNTA 3RQWA 3U8MA 4ZK4A 4A98A 4NPPA 2PGZA 2WZYA 4HQPA 4UM3A 4WV9A 5FJVA 5HCMA 3C79A 4UM3P 5HEUA 3EAMA 2BYNA 3C84A 5LXBA 3UU8A 3UU4A 2YMDA 2BYPA 4ZZCA 5HEHA 5AFMA 3RIFA 3EI0A 4AFHA 5KZUA 4AFTA 1UV6A 4HFBA 5JMEA 3SQ9A 3WTKA 3T4MA 5AFLA 2X00A 4IL4A 4COFA 5J5FA 2WNCA 2XYTA 2ZJVA 4UM1A 2VL0A 4A97A 3JAEA 4ZK1A 3WTLA 2BR7A 2XQAA 4TWDA 4XK9A 4D01A 5HEOA 5SYOA 4IL9A 3TLUA 2W8GA 4FRRA 4ALXA 4Z91A 5AFKA 5HEGA 3U8KA 4QABA 4EZ1A 3UQ7A 4UY2A 3RI5A 2BYSA 2XNVA 2WN9A 4LMLA 4LMKA 3WIPA 4BQTA 1UX2A 3U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UXU A;  3JAF A;  3ZDG A;  5KE4 A;  4HFI A;  5BW2 A;  5LG3 A;  2Y7Y A;  4QH4 A;  4AFG A;  4UM3 S;  3GUA A;  2W8F A;  3WTO A;  4QH5 A;  2Y54 A;  3SH1 A;  2Y57 A;  4ZR6 A;  4HFH A;  5AIN A;  5L4E A;  5J5G A;  2BR8 A;  2XZ5 A;  2YN6 A;  2QC1 B;  2YKS A;  3TLS A;  2XQ8 A;  5HCJ A;  2XQ9 A;  5AFH A;  1UW6 A;  5CO5 A;  3TLV A;  2XNU A;  5J5H A;  3IGQ A;  4HFD A;  4QAC A;  4TNW A;  3UQ4 A;  4QH1 A;  5AFN A;  4ZZB A;  4PIR A;  4ILA A;  2WNL A;  3WTI A;  5L47 A;  3U8J A;  3WTM A;  2BG9 B;  3SQ6 A;  3UU3 A;  5CFB A;  4QAA A;  4ZRU A;  3P50 A;  3ZDH A;  5J5I A;  3TLT A;  2UZ6 A;  3SIO A;  5IUX A;  2XYS A;  4LMJ A;  4X5T A;  5L4H A;  4B5D A;  3PEO A;  4Z90 A;  2XQ7 A;  3WTH A;  2BG9 C;  2YME A;  3RHW A;  5HEJ A;  3RQU A;  2BG9 E;  4IRE A;  4HFC A;  3RIA A;  3WTJ A;  2BG9 A;  1I9B A;  2PH9 A;  2Y56 A;  2XZ6 A;  2X00 D;  2WNJ A;  4HFE A;  3P4W A;  4TWF A;  3U8L A;  4TNV A;  4ILB A;  3JAD A;  4ZJT A;  3LSV A;  2ZJU A;  3UU6 A;  3PMZ A;  3EHZ A;  3ZKR A;  2XQ4 A;  2YOE A;  5BP0 A;  2BYR A;  2XQ3 A;  4ZJS A;  5AFJ A;  4F8H A;  2BYQ A;  3UU5 A;  5J0Z A;  4NZB A;  2C9T A;  2XQ6 A;  4TWH A;  2BJ0 A;  4BFQ A;  3TLW A;  5AFM B;  2XQ5 A;  5TVC A;  3WTN A;  2Y58 A;  3UUB A;  4DBM A;  4XHE A;  5BRX A;  4ILC A;  2XNT A;  3RQW A;  3U8M A;  4ZK4 A;  4A98 A;  4NPP A;  2PGZ A;  2WZY A;  4HQP A;  4UM3 A;  4WV9 A;  5FJV A;  5HCM A;  3C79 A;  4UM3 P;  5HEU A;  3EAM A;  2BYN A;  3C84 A;  5LXB A;  3UU8 A;  3UU4 A;  2YMD A;  2BYP A;  4ZZC A;  5HEH A;  5AFM A;  3RIF A;  3EI0 A;  4AFH A;  5KZU A;  4AFT A;  1UV6 A;  4HFB A;  5JME A;  3SQ9 A;  3WTK A;  3T4M A;  5AFL A;  2X00 A;  4IL4 A;  4COF A;  5J5F A;  2WNC A;  2XYT A;  2ZJV A;  4UM1 A;  2VL0 A;  4A97 A;  3JAE A;  4ZK1 A;  3WTL A;  2BR7 A;  2XQA A;  4TWD A;  4XK9 A;  4D01 A;  5HEO A;  5SYO A;  4IL9 A;  3TLU A;  2W8G A;  4FRR A;  4ALX A;  4Z91 A;  5AFK A;  5HEG A;  3U8K A;  4QAB A;  4EZ1 A;  3UQ7 A;  4UY2 A;  3RI5 A;  2BYS A;  2XNV A;  2WN9 A;  4LML A;  4LMK A;  3WIP A;  4BQT A;  1UX2 A;  3U8N A; 
#chains in the Genus database with same CATH topology
 4UXU A;  3JAF A;  3ZDG A;  5KE4 A;  4HFI A;  5BW2 A;  5LG3 A;  2Y7Y A;  4QH4 A;  4AFG A;  4UM3 S;  3GUA A;  2W8F A;  3WTO A;  4QH5 A;  2Y54 A;  3SH1 A;  2Y57 A;  4ZR6 A;  4HFH A;  5AIN A;  5L4E A;  5J5G A;  2BR8 A;  2XZ5 A;  2YN6 A;  2QC1 B;  2YKS A;  3TLS A;  2XQ8 A;  5HCJ A;  2XQ9 A;  5AFH A;  1UW6 A;  5CO5 A;  3TLV A;  2XNU A;  5J5H A;  3IGQ A;  4HFD A;  4QAC A;  4TNW A;  3UQ4 A;  4QH1 A;  5AFN A;  4ZZB A;  4PIR A;  4ILA A;  2WNL A;  3WTI A;  5L47 A;  3U8J A;  3WTM A;  2BG9 B;  3SQ6 A;  3UU3 A;  5CFB A;  4QAA A;  4ZRU A;  3P50 A;  3ZDH A;  5J5I A;  3TLT A;  2UZ6 A;  3SIO A;  5IUX A;  2XYS A;  4LMJ A;  4X5T A;  5L4H A;  4B5D A;  3PEO A;  4Z90 A;  2XQ7 A;  3WTH A;  2BG9 C;  2YME A;  3RHW A;  5HEJ A;  3RQU A;  2BG9 E;  4IRE A;  4HFC A;  3RIA A;  3WTJ A;  2BG9 A;  1I9B A;  2PH9 A;  2Y56 A;  2XZ6 A;  2X00 D;  2WNJ A;  4HFE A;  3P4W A;  4TWF A;  3U8L A;  4TNV A;  4ILB A;  3JAD A;  4ZJT A;  3LSV A;  2ZJU A;  3UU6 A;  3PMZ A;  3EHZ A;  3ZKR A;  2XQ4 A;  2YOE A;  5BP0 A;  2BYR A;  2XQ3 A;  4ZJS A;  5AFJ A;  4F8H A;  2BYQ A;  3UU5 A;  5J0Z A;  4NZB A;  2C9T A;  2XQ6 A;  4TWH A;  2BJ0 A;  4BFQ A;  3TLW A;  5AFM B;  2XQ5 A;  5TVC A;  3WTN A;  2Y58 A;  3UUB A;  4DBM A;  4XHE A;  5BRX A;  4ILC A;  2XNT A;  3RQW A;  3U8M A;  4ZK4 A;  4A98 A;  4NPP A;  2PGZ A;  2WZY A;  4HQP A;  4UM3 A;  4WV9 A;  5FJV A;  5HCM A;  3C79 A;  4UM3 P;  5HEU A;  3EAM A;  2BYN A;  3C84 A;  5LXB A;  3UU8 A;  3UU4 A;  2YMD A;  2BYP A;  4ZZC A;  5HEH A;  5AFM A;  3RIF A;  3EI0 A;  4AFH A;  5KZU A;  4AFT A;  1UV6 A;  4HFB A;  5JME A;  3SQ9 A;  3WTK A;  3T4M A;  5AFL A;  2X00 A;  4IL4 A;  4COF A;  5J5F A;  2WNC A;  2XYT A;  2ZJV A;  4UM1 A;  2VL0 A;  4A97 A;  3JAE A;  4ZK1 A;  3WTL A;  2BR7 A;  2XQA A;  4TWD A;  4XK9 A;  4D01 A;  5HEO A;  5SYO A;  4IL9 A;  3TLU A;  2W8G A;  4FRR A;  4ALX A;  4Z91 A;  5AFK A;  5HEG A;  3U8K A;  4QAB A;  4EZ1 A;  3UQ7 A;  4UY2 A;  3RI5 A;  2BYS A;  2XNV A;  2WN9 A;  4LML A;  4LMK A;  3WIP A;  4BQT A;  1UX2 A;  3U8N A; 
#chains in the Genus database with same CATH homology
 4UXU A;  3JAF A;  3ZDG A;  5KE4 A;  4HFI A;  5BW2 A;  5LG3 A;  2Y7Y A;  4QH4 A;  4AFG A;  4UM3 S;  3GUA A;  2W8F A;  3WTO A;  4QH5 A;  2Y54 A;  3SH1 A;  2Y57 A;  4ZR6 A;  4HFH A;  5AIN A;  5L4E A;  5J5G A;  2BR8 A;  2XZ5 A;  2YN6 A;  2QC1 B;  2YKS A;  3TLS A;  2XQ8 A;  5HCJ A;  2XQ9 A;  5AFH A;  1UW6 A;  5CO5 A;  3TLV A;  2XNU A;  5J5H A;  3IGQ A;  4HFD A;  4QAC A;  4TNW A;  3UQ4 A;  4QH1 A;  5AFN A;  4ZZB A;  4PIR A;  4ILA A;  2WNL A;  3WTI A;  5L47 A;  3U8J A;  3WTM A;  2BG9 B;  3SQ6 A;  3UU3 A;  5CFB A;  4QAA A;  4ZRU A;  3P50 A;  3ZDH A;  5J5I A;  3TLT A;  2UZ6 A;  3SIO A;  5IUX A;  2XYS A;  4LMJ A;  4X5T A;  5L4H A;  4B5D A;  3PEO A;  4Z90 A;  2XQ7 A;  3WTH A;  2BG9 C;  2YME A;  3RHW A;  5HEJ A;  3RQU A;  2BG9 E;  4IRE A;  4HFC A;  3RIA A;  3WTJ A;  2BG9 A;  1I9B A;  2PH9 A;  2Y56 A;  2XZ6 A;  2X00 D;  2WNJ A;  4HFE A;  3P4W A;  4TWF A;  3U8L A;  4TNV A;  4ILB A;  3JAD A;  4ZJT A;  3LSV A;  2ZJU A;  3UU6 A;  3PMZ A;  3EHZ A;  3ZKR A;  2XQ4 A;  2YOE A;  5BP0 A;  2BYR A;  2XQ3 A;  4ZJS A;  5AFJ A;  4F8H A;  2BYQ A;  3UU5 A;  5J0Z A;  4NZB A;  2C9T A;  2XQ6 A;  4TWH A;  2BJ0 A;  4BFQ A;  3TLW A;  5AFM B;  2XQ5 A;  5TVC A;  3WTN A;  2Y58 A;  3UUB A;  4DBM A;  4XHE A;  5BRX A;  4ILC A;  2XNT A;  3RQW A;  3U8M A;  4ZK4 A;  4A98 A;  4NPP A;  2PGZ A;  2WZY A;  4HQP A;  4UM3 A;  4WV9 A;  5FJV A;  5HCM A;  3C79 A;  4UM3 P;  5HEU A;  3EAM A;  2BYN A;  3C84 A;  5LXB A;  3UU8 A;  3UU4 A;  2YMD A;  2BYP A;  4ZZC A;  5HEH A;  5AFM A;  3RIF A;  3EI0 A;  4AFH A;  5KZU A;  4AFT A;  1UV6 A;  4HFB A;  5JME A;  3SQ9 A;  3WTK A;  3T4M A;  5AFL A;  2X00 A;  4IL4 A;  4COF A;  5J5F A;  2WNC A;  2XYT A;  2ZJV A;  4UM1 A;  2VL0 A;  4A97 A;  3JAE A;  4ZK1 A;  3WTL A;  2BR7 A;  2XQA A;  4TWD A;  4XK9 A;  4D01 A;  5HEO A;  5SYO A;  4IL9 A;  3TLU A;  2W8G A;  4FRR A;  4ALX A;  4Z91 A;  5AFK A;  5HEG A;  3U8K A;  4QAB A;  4EZ1 A;  3UQ7 A;  4UY2 A;  3RI5 A;  2BYS A;  2XNV A;  2WN9 A;  4LML A;  4LMK A;  3WIP A;  4BQT A;  1UX2 A;  3U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...