2BZ8A

N-terminal sh3 domain of cin85 bound to cbl-b peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-DOMAIN KINASE BINDING PROTEIN 1
publication title Cbl Promotes Clustering of Endocytic Adaptor Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 10
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bz8A00
2FRWA 2RQWA 4WCIA 4AG1C 4D8DA 3LH5A 4HXJA 3H0IA 2DL4A 2JM8A 4KRTA 2EGCA 1M27C 2OAWA 1FMKA 1GFDA 3VS5A 3EG1A 1U3OA 3H0FA 3UATA 3UA7A 1W1FA 1G83A 4JJDA 2BZYA 2FEIA 1UG1A 1X2KA 1SSHA 2C0OA 2DE0X 2FPEA 2GTOA 3I5RA 4E6RA 1BU1A 4JZ3A 1JO8A 2KT1A 2DL8A 2BTTA 4J9GA 2O31A 3RBBB 2JXBA 2JS0A 1TUDA 1B3QA 5GJVB 1H8KA 2LX7A 2A36A 1MV3A 1HJDA 3R6NA 2FPFA 1UTIA 1OEBA 1ABOA 4GLMA 2KE9A 1HD3A 4OMMA 4LE9A 2F2WA 4X1VA 5IH2A 2VVKA 2YSQA 3U23A 2PZ1A 4D8KA 1AOJA 1NLOC 2C0TA 4CC7A 1X27A 2DF6A 2DL5A 1GRIA 3NGPA 2DNUA 1AEYA 2KNBB 2KXDA 2LMJA 1YN8A 1X6GA 2CUDA 1QKXA 2W10A 4Y92A 2D1XA 1AD5A 2M51A 2AZVA 2DBMA 2L3QA 5FWBA 4J9FA 1UJ0A 2D8JA 3UF4A 2KRMA 2KYBA 1IO6A 1K0XA 1KJWA 1SHGA 3NHNA 2KRNA 3VS7A 3I35A 1WXTA 2KYMA 1T3LA 2HEQA 4K11A 1KSWA 2DLPA 2V1QA 2IIMA 2A08A 2RQTA 2VKNA 2YUPA 1KFZA 3M0UA 5GJWB 2J6KA 2EW3A 2SRCA 1Y0MA 2W0ZA 4Z89A 3ULRB 5L23A 4F17A 2LNHB 4RUGA 1ABQA 1K1ZA 2RNAA 1PHTA 1XOVA 1WXBA 3SEMA 1M3BA 2ED0A 5IXFA 2ENMA 4Z88A 2KRSA 3QWXX 2JTEA 1X6BA 2EYYA 4RTUA 5I22A 2P4RA 3M0SA 3TVTA 1GL5A 1PNJA 1HSQA 1EFNA 2ABLA 3RNJA 2DM1A 1ZUKA 4HVWA 4M4ZA 1ZBJA 4QT7A 2KT8A 1AZGB 1FYNA 2JMAA 1U5SA 3I9QA 1AZEA 2F2XA 3VS1A 1WA7A 2DBKA 1UE9A 2KR3A 2LJ3A 4DEXA 4DEYA 2KROA 3I5SA 1NM7A 2D8HA 2O9SA 2DX1A 2RMOA 2JS2A 1GCQA 1NYGA 1T0HA 2AZSA 1QWEA 2E5KA 1A0NB 4RTWA 3VS4A 2DVJA 1RI9A 4LN2A 2A28A 2CT4A 2OI3A 5FW9A 3THKA 1K4US 2FPDA 2X3WD 4CC2A 1OOTA 3PVQA 2J05A 1ZLMA 1JXMA 1RUWA 2LQNA 4FSSA 5FWCA 1NYFA 3REAB 2RN8A 2EVRA 4RTTA 1ZX6A 1YCSB 2EYXA 2D0NA 1YWOA 4LUEA 2DYBA 2O2OA 2CSIA 1TUCA 4ZNXA 2ESWA 3TSZA 2K7AA 4AFSC 2ROLA 4ESRA 2LJ1A 1QWFA 1JQQA 1UECA 2GGRA 5IXBA 1M8MA 1H92A 4JJBA 2JM9A 1AWWA 1NEGA 1M30A 1AWOA 2H8HA 2NWMA 1PRLC 2KGTA 1SEMA 2O88A 1GFCA 2L0AA 2AK5A 4JJCA 1VYTA 2YUOA 2JMCA 1PWTA 4IIMA 5IHKA 1ZUUA 3GBQA 2YUQA 4CC4B 2BZXA 1OPKA 1RLQC 2YT6A 1TG0A 1W70A 1WI7A 3JV3A 4F14A 1PRMC 4GBQA 1WIEA 1YNZA 2B86A 2QDLA 2MCNA 3REBB 3PVLA 2CH4W 2F2VA 2FO0A 3EG2A 2O9VA 4J9IA 1GCQC 1AWXA 2CUBA 2J6OA 3VS6A 2K6DA 3C0CA 4OMPA 1UUEA 1M3AA 1X43A 2DA9A 1X69A 4Z8AA 2VWFA 4LUDA 1BB9A 1E7OA 2LQWA 3KFVA 1QCFA 1CKAA 1M3CA 3A98A 4RTYA 2EKHA 3EGUA 1H3HA 1J3TA 1OPLA 1BBZA 1WLPB 2K2MA 2SEMA 2EGEA 1ZSGA 1VA7A 2K3BA 1E6GA 2EYWA 1WFWA 1UFFA 2V1RA 3EG0A 1SRLA 1Z9QA 4J9CA 2ECZA 2JW4A 3EHRA 1MV0B 1NLPC 1YP5A 2KXCA 4J9HA 4OMNA 4AFQC 2HBWA 1E6HA 1WX6A 5IHIA 2PTKA 1AVZC 1VYVA 2RF0A 2DRMA 2I0NA 2HCKA 2NUZA 4IIOA 4OMOA 3UA6A 2HSPA 1MUZA 2AKKA 2LCSA 1B07A 4OMLA 1K76A 4CC3A 2KBTA 2GQIA 2CT3A 1WDXA 2EPDA 2FG0A 2EBPA 1YWPA 4HVUA 5EC7A 2ED1A 2DRKA 2JT4A 3CQTA 4F16A 2PNIA 2LZ6B 3VS2A 2FRYA 4LNPA 2HDAA 1G2BA 1UHCA 2J6FA 4HVVA 4ORZA 1UDLA 4EIKA 3NPFA 2BZ8A 2L3PA 2X3XD 3IQLA 1I1JA 1GBRA 1SPKA 1OV3A 3VRZA 1NEBA 4R0KA 2DJQA 1VYUA 3EHQA 1Z9ZA 3H0HA 1PKSA 1X2QA 2A37A 2LP5A 4RTXA 1QLYA 2M0YA 4HCKA 4RTZA 2RQUA 1K0SA 1T0JA 1K9AA 2K79A 1UHFA 2GNCA 1I0CA 2MIOA 4RTVA 1JU5C 1NG2A 1V1CA 3M0QA 3VS0A 1N5ZA 2G6FX 1WYXA 3QWYA 3VRYA 2YUNA 2MOXA 2YDLA 1UGVA 5IHNA 1LCKA 2RQVA 1BK2A 1ZUYA 5ECAA 1CKBA 4J9EA 1JXOA 2J06A 2GTJA 3VS3A 1U06A 1RLPC 4OMQA 1SHFA 2KEAA 2DMOA 2L2PA 2RPNA 2CREA 3M0RA 2EQIA 4AG2C 2AKLA 4AFUC 2K9GA 3H41A 4JZ4A 1Y57A 3ZL7C 5I11A 2CDTA 2CSQA 4JPBW 2CH4A 2DL3A 1CSKA 2DILA 2C0IA 2LJ0A 3M0TA 1KIKA 2RQRA 1JEGA 1ARKA 4A63B 4J9BA 1QKWA 1AWJA 1GBQA 4AFZC 1PKTA 1W6XA 1WXUA 3TSWA 2XMFA 1SRMA 2OJ2A 3PE0A 4J9DA 5HCKA 2EGAA 3EG3A 2EYZA 1UJYA 2DL7A 2ROTA 1GCPA 1T3SA 3O5ZA 2GBQA 3NMZC 1S1NA 3M0PA 1I07A 2J7IA 3SHWA 3FJ5A 2L3SA
chains in the Genus database with same CATH superfamily
2YRCA 4WCIA 5KE2A 1K9MR 4AT1B 3CC4T 4JS4A 3VS5A 1U3OA 2K2VA 3UA7A 4M75C 3V8LA 1G83A 2DXUA 2BZYA 4HT8A 4LDYA 3OS1A 4C8QA 3FIFA 4XTUA 2K57A 2MYSA 2FPEA 2GTOA 3I5RA 2LT4A 4JZ3A 1JO8A 4GY5A 3JCMg 1VQMQ 4C92F 3RBBB 1X6OA 4IUUA 2JXBA 4M75G 4ZTJA 1B3QA 4C0FA 5GJVB 5LJ5j 1VQ4T 2DXBA 4CI0C 5I2SA 1KQ2A 3PNWC 4OF1A 1VQLT 3R6NA 1UTIA 4A4GA 3C95A 3PIOA 1RADB 1VQ8Q 3LH0A 4OGEA 5J3BA 4XTXA 1OZ3A 1NPPA 4M75A 3CCST 2YHTA 2EJFA 3KXTA 3CD6Q 1N8RU 3F70A 2P0PA 3JRZA 4X1VA 1S72A 3OYCA 3U23A 4BD3A 3MEUA 5GMKi 4C5IA 1LVKA 3X20B 2M9UA 1Y7XA 3CC4Q 1BKBA 3NGPA 2VGNA 2DNUA 5LJ5h 3GPLA 1AEYA 2KNBB 4DQ2A 4MZPA 2LMJA 3LWIA 1YN8A 1S72T 1QKXA 2W10A 4Y92A 5GANf 4M78B 1B34A 1AD5A 2M51A 2NLUA 1Q7YU 2DBMA 3CMAT 3VV0A 1HYOA 1I4K1 4JUVA 1UJ0A 2D8JA 3QJ6A 1IZ6A 1KJWA 5KCHA 4M7DE 2QASA 3M4GA 3QKJA 2HEQA 2DK3A 5I2MA 2HBPA 1KSWA 1VQ4Q 1VQKA 2V1QA 2IIMA 5CIUA 3PIPA 1VQLQ 3RR6A 4F7UE 4A4FA 9ATCB 5GAMe 2EW3A 1YI2A 5L23A 2RD1A 2DZCA 4F17A 3CCSQ 3JCMW 2HKNA 2KQWA 1ABQA 1PHTA 3V8JA 2ED0A 4IUPA 2ENMA 4Z88A 5GAN3 5J39A 1MNEA 2R5AA 3HKSA 2JTEA 4PJLA 2E5QA 3CPWP 1G3TA 4MMLA 5I22A 1Q7YC 1XNIA 1EFNA 5AT1B 1ZUKA 4M4ZA 3BFMA 1S72Q 3RKXA 1M90R 2CKKA 5KH6A 3E19A 5HY6A 3EH2A 3CCUA 3CMAQ 2JMAA 4NOYA 2F2XA 3QZ9B 1G8XA 3VUZA 1QW1A 4JLIA 3I5SA 1WGSA 4ZGEB 2IG0A 2HMAA 2JS2A 3M4YA 1GCQA 2AZSA 1QWEA 2DD5A 3X26B 3ZEHA 1VQ9A 2DVJA 2CT4A 4XTZA 1Q81R 2VASA 1RAAB 3INZA 4IUVA 1YCYA 1I5LA 4KGZB 1WHHA 1WHKA 2BUDA 4A54A 5FWCA 4JLGA 5EG2A 3JCMc 1KG1A 4C92E 5LJ3e 4O5VA 1ACMB 2D0NA 3LLRA 3TQ7P 2COZA 1Y96A 1WHMA 3M53A 1TUCA 4ZNXA 1JRIA 3CCVT 2COWA 2ROLA 3WVEB 4ESRA 3OYIA 4C92C 2LJ1A 4E7JA 5IXBA 2ZCFB 1H92A 2RJDA 4JJBA 1ZSZB 2QAZA 1M30A 1AWOA 2H8HA 1YITT 2KK4A 3OA6A 3BY7A 2GCXA 3CPWA 3OS5A 4M78A 1VYTA 2PVOB 1PWTA 5IHKA 4C92G 3FJPA 1VUBA 4CC4B 4BE2A 3AT1B 3OS0A 3SD4A 1RLQC 3MP8A 3A8MB 1M2VB 2MAMA 4F14A 3A8HB 1OULA 2L8DA 1FMVA 3CEYA 3JCMe 2QDLA 2NUTA 2PVDB 3OYYA 3G71A 3EG2A 3OB9A 4N4IA 3P8DA 4FM4B 1LJOA 3MP1A 4HCZA 3VS6A 2V8KA 1UUEA 1X43A 3X25B 3CCVQ 2QQSA 1XTDA 2RJCA 1WHLA 5KYNA 4VUBA 1M90C 2XICA 4L5GA 4DOVA 1VQ6T 2EKHA 3CPFA 1H3ZA 2VGMA 1BBZA 4NS5A 1YITQ 1WLPB 1B7TA 2EGEA 3OW2P 2O01E 3L2VA 3I56T 2YRVA 3MP6A 1WFWA 1SRLA 1WJSA 4J9CA 2JW4A 2QG9B 1MV0B 4FYVB 4J9HA 2PUOB 5DLQE 1M1FA 1TWBA 2HQXA 2MMPA 3M58A 3FEOA 3A8OB 4M77B 4ZGDB 4XU2A 4OMLA 1K76A 4CC3A 1HK9A 2I2LA 1FWZA 1ZSZC 2LCLA 2RHZA 2ED1A 2YLCA 3CQTA 4F16A 1OX8A 2Z0WA 2LZ6B 3VS2A 2FRYA 2HDAA 3CPWS 1UDLA 1RACB 2BZ8A 2CP7A 2L3PA 3IQLA 1OV3A 3VRZA 2ZPEB 3CC7A 2RA2A 1FXXA 3I56Q 4BACA 4F04B 1G5VA 3H0HA 1M1KR 1QLYA 5FROA 2HQHA 2RQUA 1GXIE 1T0JA 3E1SA 3CBMA 2GNCA 1Q82R 2E1HA 3PMIA 1D3BB 2KY9A 1JU5C 4TVRA 2DFUA 3VS0A 1YIJT 3OYNA 1ZSZA 3VRYA 4C8QF 3V7CA 2YDLA 3HRTA 1LCKA 1YJ9A 3OYKA 2RQVA 4FW1A 1PSFA 2XK0A 1QMCA 2DZ9A 1UGQB 4BY6B 3VS3A 3JB9I 2A7YA 2E6ZA 2FYKA 3OW2A 2L2PA 5GAN4 1OYXA 3CCMT 3M0RA 4ELYC 3MEAA 2EWNA 3H41A 3ASKA 2CDTA 2CSQA 1M2VA 1IHVA 2JTFA 3OQ5A 1ARKA 3ER0A 4J9BA 1M1GA 1QKWA 3RMSA 3RMQA 2EYQA 1RAFB 1W6XA 2GQVA 4PJOB 4FT2A 4UC4A 4XU1A 1K8AU 2VB6A 2Y4XA 1PG5B 3VU3C 2DL7A 3M0PA 1I07A 2J7IA 4PK4A 5CK9A 5KYXB 1YIJQ 2XHCA 2RQWA 3QIIA 2GFUA 3H0IA 3CCJA 1FMKA 4MMKA 1GFDA 4M7DD 3QPHA 3S3NA 1UG1A 3CCMQ 3RUXA 3GLXA 1YJ9Q 1N27A 4E6RA 4QQ6A 1OQKA 2BTTA 2B8AA 3HFNA 4M7AB 2JS0A 1BCOA 4V2SA 3T9NA 4M77A 1H8KA 4C5EA 1MV3A 4ANJA 4Y28E 2RB6A 2FPFA 3CCLA 1WJRA 2HKQB 3G6EA 1ABOA 4DBFA 4GLMA 2KE9A 4OMMA 2LRQA 2F2WA 5FU6B 2DEQA 1M1KC 3V8KA 4BY6C 4XTVA 4QVZA 2DO3A 1YHQT 1B34B 1BCMA 1AOJA 1Q82C 4EMKC 4N0AC 3OW2S 1NLOC 2C0TA 4CC7A 2DL5A 3FC3A 5A0DA 1RAIB 1G3WA 2YRDA 4OGCA 4A4KA 4IUTA 1X6GA 2E3IA 1IREB 1D3BA 2H3EB 1VQMA 3L42A 5LJ3d 1R77A 4J9FA 3HPWA 2KYBA 1R8OB 2OTJT 4XU0A 1SHGA 5LJ5g 2ZPGB 3QDRB 1D1CA 3EFRA 1MNDA 4MZMA 4C8QE 2E70A 2R58A 1IXDA 1KK7A 2CZ6B 1VQ8A 3DB3A 1WQWA 2A08A 4OB2B 2RK2A 5GMKh 2VKNA 2M16A 2XDDA 2RK1A 4C92D 5CR2A 5GJWB 3EH1A 2LC4A 1N8RR 3LX7A 1Y0MA 4Z89A 3ULRB 3D7SB 3JB9H 3UDCA 1V76A 4X9DA 3CC4A 3QWXX 5D7UA 1YHQQ 3EG9B 2CYZB 4J8OA 4M75E 1X6BA 2EYYA 2X51A 2M02A 2YLBA 4PJOA 4L59A 1GL5A 1HSQA 5GAMj 1Q7YR 2DM1A 1UB4A 4C8QG 1EX4A 3OYBA 1PSEA 1AZGB 1FYNA 2AT1B 3I9QA 4E47A 4M78F 5GAOr 5KYXA 3VS1A 1WA7A 3CCEA 2OTJQ 2XD0A 5GAOq 2LJ3A 2XI9A 2WSFE 2FB7A 1VQPA 1VQ4A 5GAN2 3QUIA 3NTKA 1X01A 1NYGA 2E5KA 1VQLA 2E6NA 4MDWA 4QKUA 5FU6C 3CCET 5GAMh 2A3LA 1MMNA 3M56A 4BE1A 3M9QA 4LN2A 3CCSA 1H641 3OSVA 1VQPT 1K4US 1RL2A 2M0OA 4F7UB 2XIDA 2AHJB 3HFOA 4NL3A 1JXMA 4M7AA 1RUWA 1Y96B 4FSSA 3GOXA 1KQSP 2X4JA 3MPUB 1NJIU 4A4HA 4RG8A 2FZCB 3I55T 3X28B 3CMAA 3V7SA 2K7AA 4AFSC 4WF2A 5LJ5f 3MEWA 1KHIA 1UEBA 3SFMA 2VXFA 1JQQA 2NUPB 4JDSA 4PLIA 5LJ3j 4KULA 1WPYA 5KYUB 2P0QA 1SEMA 2L0AA 4JJCA 1BI0A 3CCEQ 2JMCA 4ATOA 2EAYA 2NUTB 2LNVA 1VQPQ 1D1BA 1M4ZA 3O8VA 5GAN5 2YT6A 4LD9K 1W70A 1WI7A 5LJ3h 4GBQA 1WIEA 2KVQG 1N8RC 5L8RE 3REBB 2CH4W 2F2VA 2FO0A 2O9VA 4E7KA 3E9FA 2F5TX 3LYIA 1GCQC 1AWXA 5CO7A 3I55Q 3J81E 4OMPA 4ME7A 1M3AA 1OZ2A 2QI2A 2QA4A 1MGQA 4OB1B 2QTVA 2VV5A 4LDWA 2FL7A 2LQWA 3ME9A 2E10A 1OU9A 2VYTA 1CKAA 4RTYA 3EG9A 1H3HA 1J3TA 1OPLA 2QA4T 4JJNK 2DKGA 2OTLT 1KQSA 4FIBA 1TTHB 1O9SA 4ELZC 5DM7R 3G4ST 2V1RA 2GFAA 2Y90A 3OYLA 3RERA 2DETA 1K73U 2V8JA 3OYJA 2LVMA 3SB2A 4B6MA 4M78E 2HBWA 1G3SA 3HP9A 4M7DA 2RF0A 1BI3A 4PL6A 3RESA 4RKUE 2CP6A 4EPCA 5GANe 1KD1U 3EAEA 2BIVA 4JRPA 2AKKA 3QXEB 3TEEA 2X4WA 3CCVA 1SG5A 4PFOA 4M78C 1LPLA 2KBTA 3JAME 4F7UA 2WSEE 3OYDA 2QGGA 4PKCC 4EMGA 2EPDA 2FG0A 3CCRA 5EC7A 3V7RA 5IN1A 3JB9J 2JT4A 2Y4YA 3M5AA 3LGFA 1ZA2B 2CS7A 4HVVA 3JCMQ 1YITA 4ORZA 2QA4Q 1W4SA 1I1JA 2MPXC 4M78G 1M2OA 2OTLQ 3CCRT 5LL6S 2DJQA 1VYUA 3EHQA 3META 3G4SQ 1X2QA 2A37A 2QQAA 5C6SA 2M0YA 4E7ZA 1K0SA 2WSCE 1HXDA 2K79A 2NUPA 1V1CA 1N5ZA 2G6FX 1WYXA 2A0FB 3L2RA 2QEXT 4LXCA 2K5FA 4KGXB 2X4YA 1KD1C 2MOXA 3DB4A 4J5YA 1QP2A 1PM3A 1BK2A 1ZA1B 5KYUA 1CKBA 1U06A 4CRIA 1RLPC 2DMOA 3UPUA 4A4EA 3SWNA 1Q86U 2AKLA 4M77F 4AFUC 2CGHA 1ZQ1A 1Y57A 3ZL7C 1VQ6A 2EQKA 3BDLA 1KQSS 1TUGB 2E4HA 2F69A 3OYHA 4A63B 2DPPB 3EGXB 2E3HA 3I56A 1GBQA 4MZTA 3TSWA 3CCRQ 2XMFA 1SRMA 2DEUA 2EGAA 3L2WA 4AMCA 1UJYA 4FSXA 1S1NA 2DXCA 3SHWA 2L3SA 4KH0B 2QEXQ 5CCAA 3H9NA 2DIGA 5IT9E 4HXJA 5CKDA 1JBMA 2RI3A 2JM8A 4KRTA 3LGLA 5GAN6 3JCMX 1M27C 2OAWA 4GLKA 2QGFB 3MHXA 3EG1A 3P8HA 3H0FA 3UATA 1Q86C 3MO8A 1W1FA 2EJ9A 4JJDA 4C8QD 3OYAA 1D0XA 1X2KA 1Y07A 4DA4A 1YBYA 2DTIA 1WZOA 1BU1A 4EMHA 2DL8A 3WVDB 4J9GA 2O31A 1TH7A 2KSSA 2XDPA 2PUKB 4BUGA 5HK3A 1UGSB 2A36A 5KCOA 1K8AR 2OAUA 5A2QE 1YJWT 1VQ6Q 1OEBA 4M75D 1KC8U 4N4HA 4PJOF 3N5BB 4LE9A 1MMAA 3H8ZA 1YIJA 1YJNT 5IH2A 2RJEA 2PZ1A 1TSFA 4D8KA 1QP3A 4PJJA 3JSCA 5KYYB 1WHGA 2HAXA 2QDYB 1X27A 5CKEA 1RAGB 2KXDA 2LCCA 3CCMA 2EJGA 4B9XA 2K5IA 1R0BG 2AZVA 4FYWB 2CP0A 4DOWA 2X35A 1R0CB 2LT1A 3CXCP 3UF4A 2KRMA 8ATCB 4OMFB 1I5OB 3QHSA 1IO6A 1K0XA 3NHNA 2ZAEA 3VS7A 2BKDN 2JOYA 3I35A 4M7AF 4J6WA 2RQTA 1YJWQ 1SF9A 2DJZA 3M0UA 3OBYA 1WJQA 2J6KA 1XJWB 4QQDA 4FW2A 3GIBA 2W0ZA 3EFOA 3M57A 1IGQA 3OSSC 4M77E 1YJNQ 4YTLA 2RNAA 3SEMA 3QJYA 3EGXA 2MI6A 1VQOA 1JJ2P 4RTUA 3M0SA 1PNJA 2ZGWA 4M77C 5HK0A 3RNJA 1ZBJA 4QT7A 4C0GA 5GAMd 1U5SA 2MWOA 1VQOT 1MMGA 2ZPFB 1U8RA 1VIFA 1UE9A 2KR3A 1LNXA 4DEXA 4DEYA 2D8HA 4M77G 2HQEA 2O9SA 3C94A 3TCJA 4BDZA 4NL2A 2JVVA 3H6ZA 4XU3A 3GP8A 5J26A 5GAN8 2QK0A 2OI3A 4FYYB 1VOMA 5FW9A 3THKA 1SKUB 3CCQT 2ZPIB 1K8AC 2FPDA 4CC2A 2KDSA 1OOTA 3PVQA 2J05A 1ZLMA 1YHQA 3CXCA 2RI5A 2EQJA 4E7HA 2LQNA 3FRNA 1NYFA 3REAB 5GAMg 4HT9A 2PU9B 2IVWA 1ZX6A 4RTTA 2ZPHB 1YWOA 4LUEA 2DYBA 4O6JA 1RI0A 2DVEA 3SDZA 3L2QA 4R55A 2ESWA 2MWPA 1NBEB 2OX7A 1U1SA 1W2BP 2OTJA 1VQOQ 1UECA 2E41A 1VQNT 2GGRA 1M8MA 1KHCA 5KYYA 2JM9A 1OI1A 3M59A 1PRLC 5CQYA 4M78D 2AK5A 4M7DF 4IURA 4PJOC 2YUOA 3OBWA 4XQ3A 1JJ2A 4IIMA 1ZUUA 4KGVB 4OB3B 1SSFA 3VUBA 4J7IA 4J7FA 1BI1A 3GNGA 3QDFA 3S6WA 1OPKA 3RKYA 4LD6A 8AT1B 2LQKA 1IRXA 4F7UF 3VYGA 1UGPB 2PVGB 3M54A 1NJIR 2MCNA 3PVLA 4PJOG 2RO0A 1WQ7A 5D6WA 5HKCA 2D0QB 4J9IA 2CUBA 2X9HA 2K6DA 4E7LA 2F5KA 1X69A 1RABB 5LJ3g 3FB9A 4PFZA 4LUDA 1D1AA 1BB9A 3RKWA 3JCMV 1Y71A 3KFVA 3OYMA 1VQNQ 1M3CA 3A5ZB 2K5LA 3JCMd 3EGUA 2ZPBB 1I81A 4M7AC 4RMOA 4HKEA 2K2MA 2L5QA 1BI2A 1E6GA 4J6YA 5KYWB 3L2UA 4XAXB 2EYWA 1D0YA 2ATCB 3C4SA 3EG0A 4Y91A 4M7DB 1Z9QA 1YFNA 4BI3A 3CXCS 2K3XA 1BYMA 3JCMP 2EFIA 1NLPC 3TREA 2KXCA 3JCMb 2XKOC 4R56A 1W2BA 1PCXA 4M7AG 5GAMf 2QQBA 1E6HA 4C0DB 5IHIA 3URGA 2PTKA 2I0NA 2HCKA 4B9WA 2NUZA 4OMOA 3JB9F 4PNOA 3I55A 2O4XB 1MUZA 2E65A 4FCYA 1B07A 1I8FA 3ZBDA 2GQIA 1IB8A 2D6FA 2CT3A 1PD0A 1WDXA 5FRNA 4ZTFA 2EBPA 3HTRA 4J6XA 1P92A 2RJFA 4HVUA 2G3RA 3JCMJ 4WTOB 5GANj 4LNPA 1G2BA 2J6FA 2DAQA 3CC2A 1JJ2S 2X3XD 2JZ2A 3OYGA 1GBRA 5GMKe 3A8LB 2X4XA 1NEBA 3EGDB 3R6OA 1Z9ZA 2JTMA 1PKSA 2HL5C 2LP5A 4RTXA 1K73R 3PMTA 4HCKA 4RTZA 2M1HA 1K9AA 2E64A 3CC2T 4RTVA 1TOVA 1NG2A 3CBPA 3HHTB 3M0QA 2IPOB 5GANh 1QCOA 5IHNA 1QQJA 3SWNB 1KD1R 2QQ9A 3J7AF 4J9EA 1JXOA 3QYGB 2VUBA 1TU0B 1K9MU 2CP5A 2GTJA 2V8IA 4ZN3A 5I21A 2HL3A 1OU8A 2KEAA 5LJ3f 6AT1B 3S3OA 1NJIC 1NE8A 2RPNA 1DJ7B 2EQIA 1C0MA 5D6XA 2MK5A 1MHNA 4C92B 4JPBW 1BIAA 2CH4A 2LQ8A 1CSKA 3EFSA 5GAOp 2LJ0A 3M0TA 1KIKA 2XDBA 3CMEA 2CZ7B 3OYEA 2KMTA 2DTHA 3BW1A 4KBMB 1M5Q1 1VQ5A 4M7DC 2OTLA 3MCAB 4AFZC 2RI2A 4HA8A 1PKTA 3G4SA 5FU7B 3E9GA 4A53A 3OMGA 2OJ2A 2LTOA 4J9DA 1VQKT 5HCKA 3EG3A 3LWHA 3CMET 1W2BS 4C0DC 2ROTA 1T3SA 1VQ5T 4JRQA 3CC2Q 4ZN1A 1V29B 4XK8E 1YI2T 1EZZB 2JNGA 3MEVA 4M7DG 3BE3A 3A8GB 2FRWA 2CZ1B 5CVIA 3UWNA 4AG1C 1QVPA 4D8DA 3LH5A 1K9MC 2DL4A 3JCMh 4ZGJB 2P0KA 2EGCA 3JCMf 5KYWA 3P8BB 2EQMA 1ZBXA 1C6VX 2E12A 1Q86R 3C12A 4OVAA 5LJ5e 4F7UG 2FEIA 5CAIA 1SSHA 2MF2A 2C0OA 4HCBA 4QVCA 3M55A 2DE0X 3CCUT 1WNLA 1N9SA 2YXYA 1VQ7A 2RM4A 2KT1A 4C5GA 4X9CA 1RAHB 2O4XA 1TUDA 4M77D 2YWWA 4E2FB 3AHUA 2LX7A 4II1A 4XTYA 1VQ7T 1HJDA 1VQKQ 2ZZDA 3DKMA 3CMEQ 1VQ9T 5GAOn 1HD3A 3SWNC 1VQ5Q 2WACA 3QYHB 1XQHA 4E7IA 3NTHA 2QEXA 2VVKA 1YI2Q 2YSQA 1VIEA 1K73C 5FRMA 2JUFA 3S3MA 2DF6A 1GRIA 3QG1A 3WXMB 3EGDA 3RDVA 2CUDA 1UGRB 5CQXA 1O75A 2F1LA 5CKBA 2D1XA 2DIQA 4FYXB 1M8VA 3RIRA 1M90U 4JRIA 3JB9G 2L3QA 5FWBA 3FLGA 3CCUQ 4KH1B 3HSBA 3HRSA 4OP0A 3L2ZA 5FU7C 5M9OA 5A0LA 2KRNA 3OY9A 3OMCA 5IAYA 2CP2A 1AT1B 1WXTA 2KYMA 1T3LA 4KT0E 3EFOB 4K11A 2EKOA 2DLPA 1VQ7Q 1G3YA 2BE7D 1KFZA 2YUPA 4OB0B 1KC8R 3VKIA 4C92A 1VQ9Q 2SRCA 3PGGA 1EIFA 1Q81U 2LNHB 2K3YA 4RUGA 1K1ZA 1XOVA 1WXBA 1M3BA 2XU8A 5IXFA 3ZFJA 2KRSA 2QQRA 2GF7A 1X75C 4PJOD 4QQGA 4X34A 2P4RA 3G71T 3TVTA 1TS9A 2ABLA 3LW5E 5DY9A 4HVWA 3TU4K 2RHUA 3NTIA 2KT8A 3PFSA 3OYFA 1AZEA 1N6AA 2DBKA 3J80E 5A0GA 1D09B 2KROA 2COYA 1NM7A 2CZ0B 3HL8A 2DX1A 2RMOA 1TXQA 1YJWA 1T0HA 2KI7A 1A0NB 4RTWA 4C5HA 4BI8B 4L6V5 4LDXA 2P4TA 3VS4A 4IKFA 1QVFP 1Q81C 1RI9A 2A28A 4LDVA 1YJNA 1NPRA 2X3WD 4PLLA 4PJMA 2P84A 2CP3A 4M7AD 3QSUA 2QXFA 4BI4A 4XTWA 3A1PA 2DYIA 4PFPA 2RN8A 1Q95G 2EVRA 1YCSB 2EYXA 1QVGP 2BE9B 4DBQA 4C0ZA 1N9RA 2DTOA 3MKDA 3G71Q 3OS2A 2O2OA 2CSIA 3TSZA 1KQ1A 4MDXA 3KBGA 3QBYA 4DBHA 4LDUA 5DLOA 1NZ9A 1QWFA 2RHYA 1AWWA 1NEGA 4QW2A 4KUDK 2NWMA 3GNFB 3BDUA 2K4YA 2FHDA 2KGTA 2FZKB 2O88A 1GFCA 5KE3A 4DBRA 3CC7T 4BDYA 3GBQA 2YUQA 2BZXA 4Q5WA 1BIBA 4P5NA 2QTXA 1FX7A 1KC8C 1TG0A 3GF5A 3JV3A 4IUQA 3CBOA 1PRMC 1YNZA 2B86A 1PC0A 4EMKB 4BE0A 2LDMA 3FDRA 5CKFA 2KAFA 1YJ9T 3QZ5B 4J83A 2DERA 2J6OA 3E2UA 1JB0E 3C0CA 2DXTA 2DA9A 2HNIA 1D0ZA 4Z8AA 4M75F 2VWFA 1QVFA 5FLXE 1E7OA 3HRUA 4HCCA 3PT9A 1QCFA 3X24B 3A98A 3L1AA 3DLLA 4RCBA 2SEMA 1ZSGA 1VA7A 2K3BA 3VJPA 4E7SA 1QVGA 1UFFA 2QYZA 3CC7Q 3CCQA 2ECZA 3EHRA 4JRKA 2L89A 1M1KU 4PJNA 4C8QB 1F1BB 1YP5A 1M9SA 1Q82U 5C0MA 2AIRB 4OMNA 1U1TA 3VYHB 4AFQC 1WX6A 1OX9A 1AVZC 1VYVA 2DRMA 4EDUA 4IIOA 1ZHIA 1FMWA 3UA6A 2HSEB 2HSPA 2R57A 4Z02A 2HD0A 3CCJT 5GAN7 5GAOl 4KUIA 2LCSA 2PQWA 2R5MA 3NFCA 3G7ZA 1QCNA 1VQNA 4RG2A 5AYFA 2L3RA 1IGUA 1YWPA 4M75B 2DRKA 2PNIA 5D6YA 5LJ5d 1UHCA 1C1AA 4EIKA 3NPFA 5GAOm 2RHIA 5GANd 4PJOE 1SPKA 3DLMA 1PD1A 3UT1A 4R0KA 1IHWA 4FL6A 4D6WA 2D9TA 3CCLT 1LOJA 1UHFA 3G6ET 1I0CA 1AHJB 2FZGB 2MIOA 3QO3A 2RH2A 1RAEB 4JS5A 3KUFA 3QWYA 2YUNA 5GMKj 4FT4A 2VC8A 1UGVA 7AT1B 4RCCA 1ZUYA 3CCQQ 5ECAA 2HZYA 5GMKl 2J06A 2V26A 4N4GA 2DD4A 3CCJQ 4OMQA 1SHFA 1QVFS 2JN0A 2CREA 4AG2C 5CKHA 3MJXA 2JJ9A 3JB9D 2K9GA 5GANg 4JZ4A 4QVDA 4BB7A 5I11A 2DL3A 2EIFA 1VQMT 3G1JA 2DILA 2C0IA 4M7AE 4FU6A 1MMDA 4EMKA 2RHXA 2RQRA 4N0AA 1JEGA 5GMKm 1QVGS 2NYSA 2H3JA 3PTAA 3CD6A 1AWJA 3Q1JA 4C8QC 1WXUA 3PE0A 1VQ8T 2LX9A 1WHJA 2EYZA 2EQUA 2FVUA 1GCPA 3CCLQ 3O5ZA 2C06A 2GBQA 3NMZC 3CD6T 3G6EQ 2XG8D 2VXEA 3FJ5A
chains in the Genus database with same CATH topology
2FRWA 2RQWA 4WCIA 4AG1C 4D8DA 3LH5A 4HXJA 3H0IA 2DL4A 2JM8A 4KRTA 2EGCA 1M27C 2OAWA 1FMKA 1GFDA 3VS5A 3EG1A 1U3OA 3H0FA 3UATA 3UA7A 1W1FA 1G83A 4JJDA 2BZYA 2FEIA 1UG1A 1X2KA 1SSHA 2C0OA 2DE0X 2FPEA 2GTOA 3I5RA 4E6RA 1BU1A 4JZ3A 1JO8A 2KT1A 2DL8A 2BTTA 4J9GA 2O31A 3RBBB 2JXBA 2JS0A 1TUDA 1B3QA 5GJVB 1H8KA 2LX7A 2A36A 1MV3A 1HJDA 3R6NA 2FPFA 1UTIA 1OEBA 1ABOA 4GLMA 2KE9A 1HD3A 4OMMA 4LE9A 2F2WA 4X1VA 5IH2A 2VVKA 2YSQA 3U23A 2PZ1A 4D8KA 1AOJA 1NLOC 2C0TA 4CC7A 1X27A 2DF6A 2DL5A 1GRIA 3NGPA 2DNUA 1AEYA 2KNBB 2KXDA 2LMJA 1YN8A 1X6GA 2CUDA 1QKXA 2W10A 4Y92A 2D1XA 1AD5A 2M51A 2AZVA 2DBMA 2L3QA 5FWBA 4J9FA 1UJ0A 2D8JA 3UF4A 2KRMA 2KYBA 1IO6A 1K0XA 1KJWA 1SHGA 3NHNA 2KRNA 3VS7A 3I35A 1WXTA 2KYMA 1T3LA 2HEQA 4K11A 1KSWA 2DLPA 2V1QA 2IIMA 2A08A 2RQTA 2VKNA 2YUPA 1KFZA 3M0UA 5GJWB 2J6KA 2EW3A 2SRCA 1Y0MA 2W0ZA 4Z89A 3ULRB 5L23A 4F17A 2LNHB 4RUGA 1ABQA 1K1ZA 2RNAA 1PHTA 1XOVA 1WXBA 3SEMA 1M3BA 2ED0A 5IXFA 2ENMA 4Z88A 2KRSA 3QWXX 2JTEA 1X6BA 2EYYA 4RTUA 5I22A 2P4RA 3M0SA 3TVTA 1GL5A 1PNJA 1HSQA 1EFNA 2ABLA 3RNJA 2DM1A 1ZUKA 4HVWA 4M4ZA 1ZBJA 4QT7A 2KT8A 1AZGB 1FYNA 2JMAA 1U5SA 3I9QA 1AZEA 2F2XA 3VS1A 1WA7A 2DBKA 1UE9A 2KR3A 2LJ3A 4DEXA 4DEYA 2KROA 3I5SA 1NM7A 2D8HA 2O9SA 2DX1A 2RMOA 2JS2A 1GCQA 1NYGA 1T0HA 2AZSA 1QWEA 2E5KA 1A0NB 4RTWA 3VS4A 2DVJA 1RI9A 4LN2A 2A28A 2CT4A 2OI3A 5FW9A 3THKA 1K4US 2FPDA 2X3WD 4CC2A 1OOTA 3PVQA 2J05A 1ZLMA 1JXMA 1RUWA 2LQNA 4FSSA 5FWCA 1NYFA 3REAB 2RN8A 2EVRA 4RTTA 1ZX6A 1YCSB 2EYXA 2D0NA 1YWOA 4LUEA 2DYBA 2O2OA 2CSIA 1TUCA 4ZNXA 2ESWA 3TSZA 2K7AA 4AFSC 2ROLA 4ESRA 2LJ1A 1QWFA 1JQQA 1UECA 2GGRA 5IXBA 1M8MA 1H92A 4JJBA 2JM9A 1AWWA 1NEGA 1M30A 1AWOA 2H8HA 2NWMA 1PRLC 2KGTA 1SEMA 2O88A 1GFCA 2L0AA 2AK5A 4JJCA 1VYTA 2YUOA 2JMCA 1PWTA 4IIMA 5IHKA 1ZUUA 3GBQA 2YUQA 4CC4B 2BZXA 1OPKA 1RLQC 2YT6A 1TG0A 1W70A 1WI7A 3JV3A 4F14A 1PRMC 4GBQA 1WIEA 1YNZA 2B86A 2QDLA 2MCNA 3REBB 3PVLA 2CH4W 2F2VA 2FO0A 3EG2A 2O9VA 4J9IA 1GCQC 1AWXA 2CUBA 2J6OA 3VS6A 2K6DA 3C0CA 4OMPA 1UUEA 1M3AA 1X43A 2DA9A 1X69A 4Z8AA 2VWFA 4LUDA 1BB9A 1E7OA 2LQWA 3KFVA 1QCFA 1CKAA 1M3CA 3A98A 4RTYA 2EKHA 3EGUA 1H3HA 1J3TA 1OPLA 1BBZA 1WLPB 2K2MA 2SEMA 2EGEA 1ZSGA 1VA7A 2K3BA 1E6GA 2EYWA 1WFWA 1UFFA 2V1RA 3EG0A 1SRLA 1Z9QA 4J9CA 2ECZA 2JW4A 3EHRA 1MV0B 1NLPC 1YP5A 2KXCA 4J9HA 4OMNA 4AFQC 2HBWA 1E6HA 1WX6A 5IHIA 2PTKA 1AVZC 1VYVA 2RF0A 2DRMA 2I0NA 2HCKA 2NUZA 4IIOA 4OMOA 3UA6A 2HSPA 1MUZA 2AKKA 2LCSA 1B07A 4OMLA 1K76A 4CC3A 2KBTA 2GQIA 2CT3A 1WDXA 2EPDA 2FG0A 2EBPA 1YWPA 4HVUA 5EC7A 2ED1A 2DRKA 2JT4A 3CQTA 4F16A 2PNIA 2LZ6B 3VS2A 2FRYA 4LNPA 2HDAA 1G2BA 1UHCA 2J6FA 4HVVA 4ORZA 1UDLA 4EIKA 3NPFA 2BZ8A 2L3PA 2X3XD 3IQLA 1I1JA 1GBRA 1SPKA 1OV3A 3VRZA 1NEBA 4R0KA 2DJQA 1VYUA 3EHQA 1Z9ZA 3H0HA 1PKSA 1X2QA 2A37A 2LP5A 4RTXA 1QLYA 2M0YA 4HCKA 4RTZA 2RQUA 1K0SA 1T0JA 1K9AA 2K79A 1UHFA 2GNCA 1I0CA 2MIOA 4RTVA 1JU5C 1NG2A 1V1CA 3M0QA 3VS0A 1N5ZA 2G6FX 1WYXA 3QWYA 3VRYA 2YUNA 2MOXA 2YDLA 1UGVA 5IHNA 1LCKA 2RQVA 1BK2A 1ZUYA 5ECAA 1CKBA 4J9EA 1JXOA 2J06A 2GTJA 3VS3A 1U06A 1RLPC 4OMQA 1SHFA 2KEAA 2DMOA 2L2PA 2RPNA 2CREA 3M0RA 2EQIA 4AG2C 2AKLA 4AFUC 2K9GA 3H41A 4JZ4A 1Y57A 3ZL7C 5I11A 2CDTA 2CSQA 4JPBW 2CH4A 2DL3A 1CSKA 2DILA 2C0IA 2LJ0A 3M0TA 1KIKA 2RQRA 1JEGA 1ARKA 4A63B 4J9BA 1QKWA 1AWJA 1GBQA 4AFZC 1PKTA 1W6XA 1WXUA 3TSWA 2XMFA 1SRMA 2OJ2A 3PE0A 4J9DA 5HCKA 2EGAA 3EG3A 2EYZA 1UJYA 2DL7A 2ROTA 1GCPA 1T3SA 3O5ZA 2GBQA 3NMZC 1S1NA 3M0PA 1I07A 2J7IA 3SHWA 3FJ5A 2L3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRW A;  2RQW A;  4WCI A;  4AG1 C;  4D8D A;  3LH5 A;  4HXJ A;  3H0I A;  2DL4 A;  2JM8 A;  4KRT A;  2EGC A;  1M27 C;  2OAW A;  1FMK A;  1GFD A;  3VS5 A;  3EG1 A;  1U3O A;  3H0F A;  3UAT A;  3UA7 A;  1W1F A;  1G83 A;  4JJD A;  2BZY A;  2FEI A;  1UG1 A;  1X2K A;  1SSH A;  2C0O A;  2DE0 X;  2FPE A;  2GTO A;  3I5R A;  4E6R A;  1BU1 A;  4JZ3 A;  1JO8 A;  2KT1 A;  2DL8 A;  2BTT A;  4J9G A;  2O31 A;  3RBB B;  2JXB A;  2JS0 A;  1TUD A;  1B3Q A;  5GJV B;  1H8K A;  2LX7 A;  2A36 A;  1MV3 A;  1HJD A;  3R6N A;  2FPF A;  1UTI A;  1OEB A;  1ABO A;  4GLM A;  2KE9 A;  1HD3 A;  4OMM A;  4LE9 A;  2F2W A;  4X1V A;  5IH2 A;  2VVK A;  2YSQ A;  3U23 A;  2PZ1 A;  4D8K A;  1AOJ A;  1NLO C;  2C0T A;  4CC7 A;  1X27 A;  2DF6 A;  2DL5 A;  1GRI A;  3NGP A;  2DNU A;  1AEY A;  2KNB B;  2KXD A;  2LMJ A;  1YN8 A;  1X6G A;  2CUD A;  1QKX A;  2W10 A;  4Y92 A;  2D1X A;  1AD5 A;  2M51 A;  2AZV A;  2DBM A;  2L3Q A;  5FWB A;  4J9F A;  1UJ0 A;  2D8J A;  3UF4 A;  2KRM A;  2KYB A;  1IO6 A;  1K0X A;  1KJW A;  1SHG A;  3NHN A;  2KRN A;  3VS7 A;  3I35 A;  1WXT A;  2KYM A;  1T3L A;  2HEQ A;  4K11 A;  1KSW A;  2DLP A;  2V1Q A;  2IIM A;  2A08 A;  2RQT A;  2VKN A;  2YUP A;  1KFZ A;  3M0U A;  5GJW B;  2J6K A;  2EW3 A;  2SRC A;  1Y0M A;  2W0Z A;  4Z89 A;  3ULR B;  5L23 A;  4F17 A;  2LNH B;  4RUG A;  1ABQ A;  1K1Z A;  2RNA A;  1PHT A;  1XOV A;  1WXB A;  3SEM A;  1M3B A;  2ED0 A;  5IXF A;  2ENM A;  4Z88 A;  2KRS A;  3QWX X;  2JTE A;  1X6B A;  2EYY A;  4RTU A;  5I22 A;  2P4R A;  3M0S A;  3TVT A;  1GL5 A;  1PNJ A;  1HSQ A;  1EFN A;  2ABL A;  3RNJ A;  2DM1 A;  1ZUK A;  4HVW A;  4M4Z A;  1ZBJ A;  4QT7 A;  2KT8 A;  1AZG B;  1FYN A;  2JMA A;  1U5S A;  3I9Q A;  1AZE A;  2F2X A;  3VS1 A;  1WA7 A;  2DBK A;  1UE9 A;  2KR3 A;  2LJ3 A;  4DEX A;  4DEY A;  2KRO A;  3I5S A;  1NM7 A;  2D8H A;  2O9S A;  2DX1 A;  2RMO A;  2JS2 A;  1GCQ A;  1NYG A;  1T0H A;  2AZS A;  1QWE A;  2E5K A;  1A0N B;  4RTW A;  3VS4 A;  2DVJ A;  1RI9 A;  4LN2 A;  2A28 A;  2CT4 A;  2OI3 A;  5FW9 A;  3THK A;  1K4U S;  2FPD A;  2X3W D;  4CC2 A;  1OOT A;  3PVQ A;  2J05 A;  1ZLM A;  1JXM A;  1RUW A;  2LQN A;  4FSS A;  5FWC A;  1NYF A;  3REA B;  2RN8 A;  2EVR A;  4RTT A;  1ZX6 A;  1YCS B;  2EYX A;  2D0N A;  1YWO A;  4LUE A;  2DYB A;  2O2O A;  2CSI A;  1TUC A;  4ZNX A;  2ESW A;  3TSZ A;  2K7A A;  4AFS C;  2ROL A;  4ESR A;  2LJ1 A;  1QWF A;  1JQQ A;  1UEC A;  2GGR A;  5IXB A;  1M8M A;  1H92 A;  4JJB A;  2JM9 A;  1AWW A;  1NEG A;  1M30 A;  1AWO A;  2H8H A;  2NWM A;  1PRL C;  2KGT A;  1SEM A;  2O88 A;  1GFC A;  2L0A A;  2AK5 A;  4JJC A;  1VYT A;  2YUO A;  2JMC A;  1PWT A;  4IIM A;  5IHK A;  1ZUU A;  3GBQ A;  2YUQ A;  4CC4 B;  2BZX A;  1OPK A;  1RLQ C;  2YT6 A;  1TG0 A;  1W70 A;  1WI7 A;  3JV3 A;  4F14 A;  1PRM C;  4GBQ A;  1WIE A;  1YNZ A;  2B86 A;  2QDL A;  2MCN A;  3REB B;  3PVL A;  2CH4 W;  2F2V A;  2FO0 A;  3EG2 A;  2O9V A;  4J9I A;  1GCQ C;  1AWX A;  2CUB A;  2J6O A;  3VS6 A;  2K6D A;  3C0C A;  4OMP A;  1UUE A;  1M3A A;  1X43 A;  2DA9 A;  1X69 A;  4Z8A A;  2VWF A;  4LUD A;  1BB9 A;  1E7O A;  2LQW A;  3KFV A;  1QCF A;  1CKA A;  1M3C A;  3A98 A;  4RTY A;  2EKH A;  3EGU A;  1H3H A;  1J3T A;  1OPL A;  1BBZ A;  1WLP B;  2K2M A;  2SEM A;  2EGE A;  1ZSG A;  1VA7 A;  2K3B A;  1E6G A;  2EYW A;  1WFW A;  1UFF A;  2V1R A;  3EG0 A;  1SRL A;  1Z9Q A;  4J9C A;  2ECZ A;  2JW4 A;  3EHR A;  1MV0 B;  1NLP C;  1YP5 A;  2KXC A;  4J9H A;  4OMN A;  4AFQ C;  2HBW A;  1E6H A;  1WX6 A;  5IHI A;  2PTK A;  1AVZ C;  1VYV A;  2RF0 A;  2DRM A;  2I0N A;  2HCK A;  2NUZ A;  4IIO A;  4OMO A;  3UA6 A;  2HSP A;  1MUZ A;  2AKK A;  2LCS A;  1B07 A;  4OML A;  1K76 A;  4CC3 A;  2KBT A;  2GQI A;  2CT3 A;  1WDX A;  2EPD A;  2FG0 A;  2EBP A;  1YWP A;  4HVU A;  5EC7 A;  2ED1 A;  2DRK A;  2JT4 A;  3CQT A;  4F16 A;  2PNI A;  2LZ6 B;  3VS2 A;  2FRY A;  4LNP A;  2HDA A;  1G2B A;  1UHC A;  2J6F A;  4HVV A;  4ORZ A;  1UDL A;  4EIK A;  3NPF A;  2BZ8 A;  2L3P A;  2X3X D;  3IQL A;  1I1J A;  1GBR A;  1SPK A;  1OV3 A;  3VRZ A;  1NEB A;  4R0K A;  2DJQ A;  1VYU A;  3EHQ A;  1Z9Z A;  3H0H A;  1PKS A;  1X2Q A;  2A37 A;  2LP5 A;  4RTX A;  1QLY A;  2M0Y A;  4HCK A;  4RTZ A;  2RQU A;  1K0S A;  1T0J A;  1K9A A;  2K79 A;  1UHF A;  2GNC A;  1I0C A;  2MIO A;  4RTV A;  1JU5 C;  1NG2 A;  1V1C A;  3M0Q A;  3VS0 A;  1N5Z A;  2G6F X;  1WYX A;  3QWY A;  3VRY A;  2YUN A;  2MOX A;  2YDL A;  1UGV A;  5IHN A;  1LCK A;  2RQV A;  1BK2 A;  1ZUY A;  5ECA A;  1CKB A;  4J9E A;  1JXO A;  2J06 A;  2GTJ A;  3VS3 A;  1U06 A;  1RLP C;  4OMQ A;  1SHF A;  2KEA A;  2DMO A;  2L2P A;  2RPN A;  2CRE A;  3M0R A;  2EQI A;  4AG2 C;  2AKL A;  4AFU C;  2K9G A;  3H41 A;  4JZ4 A;  1Y57 A;  3ZL7 C;  5I11 A;  2CDT A;  2CSQ A;  4JPB W;  2CH4 A;  2DL3 A;  1CSK A;  2DIL A;  2C0I A;  2LJ0 A;  3M0T A;  1KIK A;  2RQR A;  1JEG A;  1ARK A;  4A63 B;  4J9B A;  1QKW A;  1AWJ A;  1GBQ A;  4AFZ C;  1PKT A;  1W6X A;  1WXU A;  3TSW A;  2XMF A;  1SRM A;  2OJ2 A;  3PE0 A;  4J9D A;  5HCK A;  2EGA A;  3EG3 A;  2EYZ A;  1UJY A;  2DL7 A;  2ROT A;  1GCP A;  1T3S A;  3O5Z A;  2GBQ A;  3NMZ C;  1S1N A;  3M0P A;  1I07 A;  2J7I A;  3SHW A;  3FJ5 A;  2L3S A; 
#chains in the Genus database with same CATH topology
 2YRC A;  4WCI A;  5KE2 A;  1K9M R;  4AT1 B;  3CC4 T;  4JS4 A;  3VS5 A;  1U3O A;  2K2V A;  3UA7 A;  4M75 C;  3V8L A;  1G83 A;  2DXU A;  2BZY A;  4HT8 A;  4LDY A;  3OS1 A;  4C8Q A;  3FIF A;  4XTU A;  2K57 A;  2MYS A;  2FPE A;  2GTO A;  3I5R A;  2LT4 A;  4JZ3 A;  1JO8 A;  4GY5 A;  3JCM g;  1VQM Q;  4C92 F;  3RBB B;  1X6O A;  4IUU A;  2JXB A;  4M75 G;  4ZTJ A;  1B3Q A;  4C0F A;  5GJV B;  5LJ5 j;  1VQ4 T;  2DXB A;  4CI0 C;  5I2S A;  1KQ2 A;  3PNW C;  4OF1 A;  1VQL T;  3R6N A;  1UTI A;  4A4G A;  3C95 A;  3PIO A;  1RAD B;  1VQ8 Q;  3LH0 A;  4OGE A;  5J3B A;  4XTX A;  1OZ3 A;  1NPP A;  4M75 A;  3CCS T;  2YHT A;  2EJF A;  3KXT A;  3CD6 Q;  1N8R U;  3F70 A;  2P0P A;  3JRZ A;  4X1V A;  1S72 A;  3OYC A;  3U23 A;  4BD3 A;  3MEU A;  5GMK i;  4C5I A;  1LVK A;  3X20 B;  2M9U A;  1Y7X A;  3CC4 Q;  1BKB A;  3NGP A;  2VGN A;  2DNU A;  5LJ5 h;  3GPL A;  1AEY A;  2KNB B;  4DQ2 A;  4MZP A;  2LMJ A;  3LWI A;  1YN8 A;  1S72 T;  1QKX A;  2W10 A;  4Y92 A;  5GAN f;  4M78 B;  1B34 A;  1AD5 A;  2M51 A;  2NLU A;  1Q7Y U;  2DBM A;  3CMA T;  3VV0 A;  1HYO A;  1I4K 1;  4JUV A;  1UJ0 A;  2D8J A;  3QJ6 A;  1IZ6 A;  1KJW A;  5KCH A;  4M7D E;  2QAS A;  3M4G A;  3QKJ A;  2HEQ A;  2DK3 A;  5I2M A;  2HBP A;  1KSW A;  1VQ4 Q;  1VQK A;  2V1Q A;  2IIM A;  5CIU A;  3PIP A;  1VQL Q;  3RR6 A;  4F7U E;  4A4F A;  9ATC B;  5GAM e;  2EW3 A;  1YI2 A;  5L23 A;  2RD1 A;  2DZC A;  4F17 A;  3CCS Q;  3JCM W;  2HKN A;  2KQW A;  1ABQ A;  1PHT A;  3V8J A;  2ED0 A;  4IUP A;  2ENM A;  4Z88 A;  5GAN 3;  5J39 A;  1MNE A;  2R5A A;  3HKS A;  2JTE A;  4PJL A;  2E5Q A;  3CPW P;  1G3T A;  4MML A;  5I22 A;  1Q7Y C;  1XNI A;  1EFN A;  5AT1 B;  1ZUK A;  4M4Z A;  3BFM A;  1S72 Q;  3RKX A;  1M90 R;  2CKK A;  5KH6 A;  3E19 A;  5HY6 A;  3EH2 A;  3CCU A;  3CMA Q;  2JMA A;  4NOY A;  2F2X A;  3QZ9 B;  1G8X A;  3VUZ A;  1QW1 A;  4JLI A;  3I5S A;  1WGS A;  4ZGE B;  2IG0 A;  2HMA A;  2JS2 A;  3M4Y A;  1GCQ A;  2AZS A;  1QWE A;  2DD5 A;  3X26 B;  3ZEH A;  1VQ9 A;  2DVJ A;  2CT4 A;  4XTZ A;  1Q81 R;  2VAS A;  1RAA B;  3INZ A;  4IUV A;  1YCY A;  1I5L A;  4KGZ B;  1WHH A;  1WHK A;  2BUD A;  4A54 A;  5FWC A;  4JLG A;  5EG2 A;  3JCM c;  1KG1 A;  4C92 E;  5LJ3 e;  4O5V A;  1ACM B;  2D0N A;  3LLR A;  3TQ7 P;  2COZ A;  1Y96 A;  1WHM A;  3M53 A;  1TUC A;  4ZNX A;  1JRI A;  3CCV T;  2COW A;  2ROL A;  3WVE B;  4ESR A;  3OYI A;  4C92 C;  2LJ1 A;  4E7J A;  5IXB A;  2ZCF B;  1H92 A;  2RJD A;  4JJB A;  1ZSZ B;  2QAZ A;  1M30 A;  1AWO A;  2H8H A;  1YIT T;  2KK4 A;  3OA6 A;  3BY7 A;  2GCX A;  3CPW A;  3OS5 A;  4M78 A;  1VYT A;  2PVO B;  1PWT A;  5IHK A;  4C92 G;  3FJP A;  1VUB A;  4CC4 B;  4BE2 A;  3AT1 B;  3OS0 A;  3SD4 A;  1RLQ C;  3MP8 A;  3A8M B;  1M2V B;  2MAM A;  4F14 A;  3A8H B;  1OUL A;  2L8D A;  1FMV A;  3CEY A;  3JCM e;  2QDL A;  2NUT A;  2PVD B;  3OYY A;  3G71 A;  3EG2 A;  3OB9 A;  4N4I A;  3P8D A;  4FM4 B;  1LJO A;  3MP1 A;  4HCZ A;  3VS6 A;  2V8K A;  1UUE A;  1X43 A;  3X25 B;  3CCV Q;  2QQS A;  1XTD A;  2RJC A;  1WHL A;  5KYN A;  4VUB A;  1M90 C;  2XIC A;  4L5G A;  4DOV A;  1VQ6 T;  2EKH A;  3CPF A;  1H3Z A;  2VGM A;  1BBZ A;  4NS5 A;  1YIT Q;  1WLP B;  1B7T A;  2EGE A;  3OW2 P;  2O01 E;  3L2V A;  3I56 T;  2YRV A;  3MP6 A;  1WFW A;  1SRL A;  1WJS A;  4J9C A;  2JW4 A;  2QG9 B;  1MV0 B;  4FYV B;  4J9H A;  2PUO B;  5DLQ E;  1M1F A;  1TWB A;  2HQX A;  2MMP A;  3M58 A;  3FEO A;  3A8O B;  4M77 B;  4ZGD B;  4XU2 A;  4OML A;  1K76 A;  4CC3 A;  1HK9 A;  2I2L A;  1FWZ A;  1ZSZ C;  2LCL A;  2RHZ A;  2ED1 A;  2YLC A;  3CQT A;  4F16 A;  1OX8 A;  2Z0W A;  2LZ6 B;  3VS2 A;  2FRY A;  2HDA A;  3CPW S;  1UDL A;  1RAC B;  2BZ8 A;  2CP7 A;  2L3P A;  3IQL A;  1OV3 A;  3VRZ A;  2ZPE B;  3CC7 A;  2RA2 A;  1FXX A;  3I56 Q;  4BAC A;  4F04 B;  1G5V A;  3H0H A;  1M1K R;  1QLY A;  5FRO A;  2HQH A;  2RQU A;  1GXI E;  1T0J A;  3E1S A;  3CBM A;  2GNC A;  1Q82 R;  2E1H A;  3PMI A;  1D3B B;  2KY9 A;  1JU5 C;  4TVR A;  2DFU A;  3VS0 A;  1YIJ T;  3OYN A;  1ZSZ A;  3VRY A;  4C8Q F;  3V7C A;  2YDL A;  3HRT A;  1LCK A;  1YJ9 A;  3OYK A;  2RQV A;  4FW1 A;  1PSF A;  2XK0 A;  1QMC A;  2DZ9 A;  1UGQ B;  4BY6 B;  3VS3 A;  3JB9 I;  2A7Y A;  2E6Z A;  2FYK A;  3OW2 A;  2L2P A;  5GAN 4;  1OYX A;  3CCM T;  3M0R A;  4ELY C;  3MEA A;  2EWN A;  3H41 A;  3ASK A;  2CDT A;  2CSQ A;  1M2V A;  1IHV A;  2JTF A;  3OQ5 A;  1ARK A;  3ER0 A;  4J9B A;  1M1G A;  1QKW A;  3RMS A;  3RMQ A;  2EYQ A;  1RAF B;  1W6X A;  2GQV A;  4PJO B;  4FT2 A;  4UC4 A;  4XU1 A;  1K8A U;  2VB6 A;  2Y4X A;  1PG5 B;  3VU3 C;  2DL7 A;  3M0P A;  1I07 A;  2J7I A;  4PK4 A;  5CK9 A;  5KYX B;  1YIJ Q;  2XHC A;  2RQW A;  3QII A;  2GFU A;  3H0I A;  3CCJ A;  1FMK A;  4MMK A;  1GFD A;  4M7D D;  3QPH A;  3S3N A;  1UG1 A;  3CCM Q;  3RUX A;  3GLX A;  1YJ9 Q;  1N27 A;  4E6R A;  4QQ6 A;  1OQK A;  2BTT A;  2B8A A;  3HFN A;  4M7A B;  2JS0 A;  1BCO A;  4V2S A;  3T9N A;  4M77 A;  1H8K A;  4C5E A;  1MV3 A;  4ANJ A;  4Y28 E;  2RB6 A;  2FPF A;  3CCL A;  1WJR A;  2HKQ B;  3G6E A;  1ABO A;  4DBF A;  4GLM A;  2KE9 A;  4OMM A;  2LRQ A;  2F2W A;  5FU6 B;  2DEQ A;  1M1K C;  3V8K A;  4BY6 C;  4XTV A;  4QVZ A;  2DO3 A;  1YHQ T;  1B34 B;  1BCM A;  1AOJ A;  1Q82 C;  4EMK C;  4N0A C;  3OW2 S;  1NLO C;  2C0T A;  4CC7 A;  2DL5 A;  3FC3 A;  5A0D A;  1RAI B;  1G3W A;  2YRD A;  4OGC A;  4A4K A;  4IUT A;  1X6G A;  2E3I A;  1IRE B;  1D3B A;  2H3E B;  1VQM A;  3L42 A;  5LJ3 d;  1R77 A;  4J9F A;  3HPW A;  2KYB A;  1R8O B;  2OTJ T;  4XU0 A;  1SHG A;  5LJ5 g;  2ZPG B;  3QDR B;  1D1C A;  3EFR A;  1MND A;  4MZM A;  4C8Q E;  2E70 A;  2R58 A;  1IXD A;  1KK7 A;  2CZ6 B;  1VQ8 A;  3DB3 A;  1WQW A;  2A08 A;  4OB2 B;  2RK2 A;  5GMK h;  2VKN A;  2M16 A;  2XDD A;  2RK1 A;  4C92 D;  5CR2 A;  5GJW B;  3EH1 A;  2LC4 A;  1N8R R;  3LX7 A;  1Y0M A;  4Z89 A;  3ULR B;  3D7S B;  3JB9 H;  3UDC A;  1V76 A;  4X9D A;  3CC4 A;  3QWX X;  5D7U A;  1YHQ Q;  3EG9 B;  2CYZ B;  4J8O A;  4M75 E;  1X6B A;  2EYY A;  2X51 A;  2M02 A;  2YLB A;  4PJO A;  4L59 A;  1GL5 A;  1HSQ A;  5GAM j;  1Q7Y R;  2DM1 A;  1UB4 A;  4C8Q G;  1EX4 A;  3OYB A;  1PSE A;  1AZG B;  1FYN A;  2AT1 B;  3I9Q A;  4E47 A;  4M78 F;  5GAO r;  5KYX A;  3VS1 A;  1WA7 A;  3CCE A;  2OTJ Q;  2XD0 A;  5GAO q;  2LJ3 A;  2XI9 A;  2WSF E;  2FB7 A;  1VQP A;  1VQ4 A;  5GAN 2;  3QUI A;  3NTK A;  1X01 A;  1NYG A;  2E5K A;  1VQL A;  2E6N A;  4MDW A;  4QKU A;  5FU6 C;  3CCE T;  5GAM h;  2A3L A;  1MMN A;  3M56 A;  4BE1 A;  3M9Q A;  4LN2 A;  3CCS A;  1H64 1;  3OSV A;  1VQP T;  1K4U S;  1RL2 A;  2M0O A;  4F7U B;  2XID A;  2AHJ B;  3HFO A;  4NL3 A;  1JXM A;  4M7A A;  1RUW A;  1Y96 B;  4FSS A;  3GOX A;  1KQS P;  2X4J A;  3MPU B;  1NJI U;  4A4H A;  4RG8 A;  2FZC B;  3I55 T;  3X28 B;  3CMA A;  3V7S A;  2K7A A;  4AFS C;  4WF2 A;  5LJ5 f;  3MEW A;  1KHI A;  1UEB A;  3SFM A;  2VXF A;  1JQQ A;  2NUP B;  4JDS A;  4PLI A;  5LJ3 j;  4KUL A;  1WPY A;  5KYU B;  2P0Q A;  1SEM A;  2L0A A;  4JJC A;  1BI0 A;  3CCE Q;  2JMC A;  4ATO A;  2EAY A;  2NUT B;  2LNV A;  1VQP Q;  1D1B A;  1M4Z A;  3O8V A;  5GAN 5;  2YT6 A;  4LD9 K;  1W70 A;  1WI7 A;  5LJ3 h;  4GBQ A;  1WIE A;  2KVQ G;  1N8R C;  5L8R E;  3REB B;  2CH4 W;  2F2V A;  2FO0 A;  2O9V A;  4E7K A;  3E9F A;  2F5T X;  3LYI A;  1GCQ C;  1AWX A;  5CO7 A;  3I55 Q;  3J81 E;  4OMP A;  4ME7 A;  1M3A A;  1OZ2 A;  2QI2 A;  2QA4 A;  1MGQ A;  4OB1 B;  2QTV A;  2VV5 A;  4LDW A;  2FL7 A;  2LQW A;  3ME9 A;  2E10 A;  1OU9 A;  2VYT A;  1CKA A;  4RTY A;  3EG9 A;  1H3H A;  1J3T A;  1OPL A;  2QA4 T;  4JJN K;  2DKG A;  2OTL T;  1KQS A;  4FIB A;  1TTH B;  1O9S A;  4ELZ C;  5DM7 R;  3G4S T;  2V1R A;  2GFA A;  2Y90 A;  3OYL A;  3RER A;  2DET A;  1K73 U;  2V8J A;  3OYJ A;  2LVM A;  3SB2 A;  4B6M A;  4M78 E;  2HBW A;  1G3S A;  3HP9 A;  4M7D A;  2RF0 A;  1BI3 A;  4PL6 A;  3RES A;  4RKU E;  2CP6 A;  4EPC A;  5GAN e;  1KD1 U;  3EAE A;  2BIV A;  4JRP A;  2AKK A;  3QXE B;  3TEE A;  2X4W A;  3CCV A;  1SG5 A;  4PFO A;  4M78 C;  1LPL A;  2KBT A;  3JAM E;  4F7U A;  2WSE E;  3OYD A;  2QGG A;  4PKC C;  4EMG A;  2EPD A;  2FG0 A;  3CCR A;  5EC7 A;  3V7R A;  5IN1 A;  3JB9 J;  2JT4 A;  2Y4Y A;  3M5A A;  3LGF A;  1ZA2 B;  2CS7 A;  4HVV A;  3JCM Q;  1YIT A;  4ORZ A;  2QA4 Q;  1W4S A;  1I1J A;  2MPX C;  4M78 G;  1M2O A;  2OTL Q;  3CCR T;  5LL6 S;  2DJQ A;  1VYU A;  3EHQ A;  3MET A;  3G4S Q;  1X2Q A;  2A37 A;  2QQA A;  5C6S A;  2M0Y A;  4E7Z A;  1K0S A;  2WSC E;  1HXD A;  2K79 A;  2NUP A;  1V1C A;  1N5Z A;  2G6F X;  1WYX A;  2A0F B;  3L2R A;  2QEX T;  4LXC A;  2K5F A;  4KGX B;  2X4Y A;  1KD1 C;  2MOX A;  3DB4 A;  4J5Y A;  1QP2 A;  1PM3 A;  1BK2 A;  1ZA1 B;  5KYU A;  1CKB A;  1U06 A;  4CRI A;  1RLP C;  2DMO A;  3UPU A;  4A4E A;  3SWN A;  1Q86 U;  2AKL A;  4M77 F;  4AFU C;  2CGH A;  1ZQ1 A;  1Y57 A;  3ZL7 C;  1VQ6 A;  2EQK A;  3BDL A;  1KQS S;  1TUG B;  2E4H A;  2F69 A;  3OYH A;  4A63 B;  2DPP B;  3EGX B;  2E3H A;  3I56 A;  1GBQ A;  4MZT A;  3TSW A;  3CCR Q;  2XMF A;  1SRM A;  2DEU A;  2EGA A;  3L2W A;  4AMC A;  1UJY A;  4FSX A;  1S1N A;  2DXC A;  3SHW A;  2L3S A;  4KH0 B;  2QEX Q;  5CCA A;  3H9N A;  2DIG A;  5IT9 E;  4HXJ A;  5CKD A;  1JBM A;  2RI3 A;  2JM8 A;  4KRT A;  3LGL A;  5GAN 6;  3JCM X;  1M27 C;  2OAW A;  4GLK A;  2QGF B;  3MHX A;  3EG1 A;  3P8H A;  3H0F A;  3UAT A;  1Q86 C;  3MO8 A;  1W1F A;  2EJ9 A;  4JJD A;  4C8Q D;  3OYA A;  1D0X A;  1X2K A;  1Y07 A;  4DA4 A;  1YBY A;  2DTI A;  1WZO A;  1BU1 A;  4EMH A;  2DL8 A;  3WVD B;  4J9G A;  2O31 A;  1TH7 A;  2KSS A;  2XDP A;  2PUK B;  4BUG A;  5HK3 A;  1UGS B;  2A36 A;  5KCO A;  1K8A R;  2OAU A;  5A2Q E;  1YJW T;  1VQ6 Q;  1OEB A;  4M75 D;  1KC8 U;  4N4H A;  4PJO F;  3N5B B;  4LE9 A;  1MMA A;  3H8Z A;  1YIJ A;  1YJN T;  5IH2 A;  2RJE A;  2PZ1 A;  1TSF A;  4D8K A;  1QP3 A;  4PJJ A;  3JSC A;  5KYY B;  1WHG A;  2HAX A;  2QDY B;  1X27 A;  5CKE A;  1RAG B;  2KXD A;  2LCC A;  3CCM A;  2EJG A;  4B9X A;  2K5I A;  1R0B G;  2AZV A;  4FYW B;  2CP0 A;  4DOW A;  2X35 A;  1R0C B;  2LT1 A;  3CXC P;  3UF4 A;  2KRM A;  8ATC B;  4OMF B;  1I5O B;  3QHS A;  1IO6 A;  1K0X A;  3NHN A;  2ZAE A;  3VS7 A;  2BKD N;  2JOY A;  3I35 A;  4M7A F;  4J6W A;  2RQT A;  1YJW Q;  1SF9 A;  2DJZ A;  3M0U A;  3OBY A;  1WJQ A;  2J6K A;  1XJW B;  4QQD A;  4FW2 A;  3GIB A;  2W0Z A;  3EFO A;  3M57 A;  1IGQ A;  3OSS C;  4M77 E;  1YJN Q;  4YTL A;  2RNA A;  3SEM A;  3QJY A;  3EGX A;  2MI6 A;  1VQO A;  1JJ2 P;  4RTU A;  3M0S A;  1PNJ A;  2ZGW A;  4M77 C;  5HK0 A;  3RNJ A;  1ZBJ A;  4QT7 A;  4C0G A;  5GAM d;  1U5S A;  2MWO A;  1VQO T;  1MMG A;  2ZPF B;  1U8R A;  1VIF A;  1UE9 A;  2KR3 A;  1LNX A;  4DEX A;  4DEY A;  2D8H A;  4M77 G;  2HQE A;  2O9S A;  3C94 A;  3TCJ A;  4BDZ A;  4NL2 A;  2JVV A;  3H6Z A;  4XU3 A;  3GP8 A;  5J26 A;  5GAN 8;  2QK0 A;  2OI3 A;  4FYY B;  1VOM A;  5FW9 A;  3THK A;  1SKU B;  3CCQ T;  2ZPI B;  1K8A C;  2FPD A;  4CC2 A;  2KDS A;  1OOT A;  3PVQ A;  2J05 A;  1ZLM A;  1YHQ A;  3CXC A;  2RI5 A;  2EQJ A;  4E7H A;  2LQN A;  3FRN A;  1NYF A;  3REA B;  5GAM g;  4HT9 A;  2PU9 B;  2IVW A;  1ZX6 A;  4RTT A;  2ZPH B;  1YWO A;  4LUE A;  2DYB A;  4O6J A;  1RI0 A;  2DVE A;  3SDZ A;  3L2Q A;  4R55 A;  2ESW A;  2MWP A;  1NBE B;  2OX7 A;  1U1S A;  1W2B P;  2OTJ A;  1VQO Q;  1UEC A;  2E41 A;  1VQN T;  2GGR A;  1M8M A;  1KHC A;  5KYY A;  2JM9 A;  1OI1 A;  3M59 A;  1PRL C;  5CQY A;  4M78 D;  2AK5 A;  4M7D F;  4IUR A;  4PJO C;  2YUO A;  3OBW A;  4XQ3 A;  1JJ2 A;  4IIM A;  1ZUU A;  4KGV B;  4OB3 B;  1SSF A;  3VUB A;  4J7I A;  4J7F A;  1BI1 A;  3GNG A;  3QDF A;  3S6W A;  1OPK A;  3RKY A;  4LD6 A;  8AT1 B;  2LQK A;  1IRX A;  4F7U F;  3VYG A;  1UGP B;  2PVG B;  3M54 A;  1NJI R;  2MCN A;  3PVL A;  4PJO G;  2RO0 A;  1WQ7 A;  5D6W A;  5HKC A;  2D0Q B;  4J9I A;  2CUB A;  2X9H A;  2K6D A;  4E7L A;  2F5K A;  1X69 A;  1RAB B;  5LJ3 g;  3FB9 A;  4PFZ A;  4LUD A;  1D1A A;  1BB9 A;  3RKW A;  3JCM V;  1Y71 A;  3KFV A;  3OYM A;  1VQN Q;  1M3C A;  3A5Z B;  2K5L A;  3JCM d;  3EGU A;  2ZPB B;  1I81 A;  4M7A C;  4RMO A;  4HKE A;  2K2M A;  2L5Q A;  1BI2 A;  1E6G A;  4J6Y A;  5KYW B;  3L2U A;  4XAX B;  2EYW A;  1D0Y A;  2ATC B;  3C4S A;  3EG0 A;  4Y91 A;  4M7D B;  1Z9Q A;  1YFN A;  4BI3 A;  3CXC S;  2K3X A;  1BYM A;  3JCM P;  2EFI A;  1NLP C;  3TRE A;  2KXC A;  3JCM b;  2XKO C;  4R56 A;  1W2B A;  1PCX A;  4M7A G;  5GAM f;  2QQB A;  1E6H A;  4C0D B;  5IHI A;  3URG A;  2PTK A;  2I0N A;  2HCK A;  4B9W A;  2NUZ A;  4OMO A;  3JB9 F;  4PNO A;  3I55 A;  2O4X B;  1MUZ A;  2E65 A;  4FCY A;  1B07 A;  1I8F A;  3ZBD A;  2GQI A;  1IB8 A;  2D6F A;  2CT3 A;  1PD0 A;  1WDX A;  5FRN A;  4ZTF A;  2EBP A;  3HTR A;  4J6X A;  1P92 A;  2RJF A;  4HVU A;  2G3R A;  3JCM J;  4WTO B;  5GAN j;  4LNP A;  1G2B A;  2J6F A;  2DAQ A;  3CC2 A;  1JJ2 S;  2X3X D;  2JZ2 A;  3OYG A;  1GBR A;  5GMK e;  3A8L B;  2X4X A;  1NEB A;  3EGD B;  3R6O A;  1Z9Z A;  2JTM A;  1PKS A;  2HL5 C;  2LP5 A;  4RTX A;  1K73 R;  3PMT A;  4HCK A;  4RTZ A;  2M1H A;  1K9A A;  2E64 A;  3CC2 T;  4RTV A;  1TOV A;  1NG2 A;  3CBP A;  3HHT B;  3M0Q A;  2IPO B;  5GAN h;  1QCO A;  5IHN A;  1QQJ A;  3SWN B;  1KD1 R;  2QQ9 A;  3J7A F;  4J9E A;  1JXO A;  3QYG B;  2VUB A;  1TU0 B;  1K9M U;  2CP5 A;  2GTJ A;  2V8I A;  4ZN3 A;  5I21 A;  2HL3 A;  1OU8 A;  2KEA A;  5LJ3 f;  6AT1 B;  3S3O A;  1NJI C;  1NE8 A;  2RPN A;  1DJ7 B;  2EQI A;  1C0M A;  5D6X A;  2MK5 A;  1MHN A;  4C92 B;  4JPB W;  1BIA A;  2CH4 A;  2LQ8 A;  1CSK A;  3EFS A;  5GAO p;  2LJ0 A;  3M0T A;  1KIK A;  2XDB A;  3CME A;  2CZ7 B;  3OYE A;  2KMT A;  2DTH A;  3BW1 A;  4KBM B;  1M5Q 1;  1VQ5 A;  4M7D C;  2OTL A;  3MCA B;  4AFZ C;  2RI2 A;  4HA8 A;  1PKT A;  3G4S A;  5FU7 B;  3E9G A;  4A53 A;  3OMG A;  2OJ2 A;  2LTO A;  4J9D A;  1VQK T;  5HCK A;  3EG3 A;  3LWH A;  3CME T;  1W2B S;  4C0D C;  2ROT A;  1T3S A;  1VQ5 T;  4JRQ A;  3CC2 Q;  4ZN1 A;  1V29 B;  4XK8 E;  1YI2 T;  1EZZ B;  2JNG A;  3MEV A;  4M7D G;  3BE3 A;  3A8G B;  2FRW A;  2CZ1 B;  5CVI A;  3UWN A;  4AG1 C;  1QVP A;  4D8D A;  3LH5 A;  1K9M C;  2DL4 A;  3JCM h;  4ZGJ B;  2P0K A;  2EGC A;  3JCM f;  5KYW A;  3P8B B;  2EQM A;  1ZBX A;  1C6V X;  2E12 A;  1Q86 R;  3C12 A;  4OVA A;  5LJ5 e;  4F7U G;  2FEI A;  5CAI A;  1SSH A;  2MF2 A;  2C0O A;  4HCB A;  4QVC A;  3M55 A;  2DE0 X;  3CCU T;  1WNL A;  1N9S A;  2YXY A;  1VQ7 A;  2RM4 A;  2KT1 A;  4C5G A;  4X9C A;  1RAH B;  2O4X A;  1TUD A;  4M77 D;  2YWW A;  4E2F B;  3AHU A;  2LX7 A;  4II1 A;  4XTY A;  1VQ7 T;  1HJD A;  1VQK Q;  2ZZD A;  3DKM A;  3CME Q;  1VQ9 T;  5GAO n;  1HD3 A;  3SWN C;  1VQ5 Q;  2WAC A;  3QYH B;  1XQH A;  4E7I A;  3NTH A;  2QEX A;  2VVK A;  1YI2 Q;  2YSQ A;  1VIE A;  1K73 C;  5FRM A;  2JUF A;  3S3M A;  2DF6 A;  1GRI A;  3QG1 A;  3WXM B;  3EGD A;  3RDV A;  2CUD A;  1UGR B;  5CQX A;  1O75 A;  2F1L A;  5CKB A;  2D1X A;  2DIQ A;  4FYX B;  1M8V A;  3RIR A;  1M90 U;  4JRI A;  3JB9 G;  2L3Q A;  5FWB A;  3FLG A;  3CCU Q;  4KH1 B;  3HSB A;  3HRS A;  4OP0 A;  3L2Z A;  5FU7 C;  5M9O A;  5A0L A;  2KRN A;  3OY9 A;  3OMC A;  5IAY A;  2CP2 A;  1AT1 B;  1WXT A;  2KYM A;  1T3L A;  4KT0 E;  3EFO B;  4K11 A;  2EKO A;  2DLP A;  1VQ7 Q;  1G3Y A;  2BE7 D;  1KFZ A;  2YUP A;  4OB0 B;  1KC8 R;  3VKI A;  4C92 A;  1VQ9 Q;  2SRC A;  3PGG A;  1EIF A;  1Q81 U;  2LNH B;  2K3Y A;  4RUG A;  1K1Z A;  1XOV A;  1WXB A;  1M3B A;  2XU8 A;  5IXF A;  3ZFJ A;  2KRS A;  2QQR A;  2GF7 A;  1X75 C;  4PJO D;  4QQG A;  4X34 A;  2P4R A;  3G71 T;  3TVT A;  1TS9 A;  2ABL A;  3LW5 E;  5DY9 A;  4HVW A;  3TU4 K;  2RHU A;  3NTI A;  2KT8 A;  3PFS A;  3OYF A;  1AZE A;  1N6A A;  2DBK A;  3J80 E;  5A0G A;  1D09 B;  2KRO A;  2COY A;  1NM7 A;  2CZ0 B;  3HL8 A;  2DX1 A;  2RMO A;  1TXQ A;  1YJW A;  1T0H A;  2KI7 A;  1A0N B;  4RTW A;  4C5H A;  4BI8 B;  4L6V 5;  4LDX A;  2P4T A;  3VS4 A;  4IKF A;  1QVF P;  1Q81 C;  1RI9 A;  2A28 A;  4LDV A;  1YJN A;  1NPR A;  2X3W D;  4PLL A;  4PJM A;  2P84 A;  2CP3 A;  4M7A D;  3QSU A;  2QXF A;  4BI4 A;  4XTW A;  3A1P A;  2DYI A;  4PFP A;  2RN8 A;  1Q95 G;  2EVR A;  1YCS B;  2EYX A;  1QVG P;  2BE9 B;  4DBQ A;  4C0Z A;  1N9R A;  2DTO A;  3MKD A;  3G71 Q;  3OS2 A;  2O2O A;  2CSI A;  3TSZ A;  1KQ1 A;  4MDX A;  3KBG A;  3QBY A;  4DBH A;  4LDU A;  5DLO A;  1NZ9 A;  1QWF A;  2RHY A;  1AWW A;  1NEG A;  4QW2 A;  4KUD K;  2NWM A;  3GNF B;  3BDU A;  2K4Y A;  2FHD A;  2KGT A;  2FZK B;  2O88 A;  1GFC A;  5KE3 A;  4DBR A;  3CC7 T;  4BDY A;  3GBQ A;  2YUQ A;  2BZX A;  4Q5W A;  1BIB A;  4P5N A;  2QTX A;  1FX7 A;  1KC8 C;  1TG0 A;  3GF5 A;  3JV3 A;  4IUQ A;  3CBO A;  1PRM C;  1YNZ A;  2B86 A;  1PC0 A;  4EMK B;  4BE0 A;  2LDM A;  3FDR A;  5CKF A;  2KAF A;  1YJ9 T;  3QZ5 B;  4J83 A;  2DER A;  2J6O A;  3E2U A;  1JB0 E;  3C0C A;  2DXT A;  2DA9 A;  2HNI A;  1D0Z A;  4Z8A A;  4M75 F;  2VWF A;  1QVF A;  5FLX E;  1E7O A;  3HRU A;  4HCC A;  3PT9 A;  1QCF A;  3X24 B;  3A98 A;  3L1A A;  3DLL A;  4RCB A;  2SEM A;  1ZSG A;  1VA7 A;  2K3B A;  3VJP A;  4E7S A;  1QVG A;  1UFF A;  2QYZ A;  3CC7 Q;  3CCQ A;  2ECZ A;  3EHR A;  4JRK A;  2L89 A;  1M1K U;  4PJN A;  4C8Q B;  1F1B B;  1YP5 A;  1M9S A;  1Q82 U;  5C0M A;  2AIR B;  4OMN A;  1U1T A;  3VYH B;  4AFQ C;  1WX6 A;  1OX9 A;  1AVZ C;  1VYV A;  2DRM A;  4EDU A;  4IIO A;  1ZHI A;  1FMW A;  3UA6 A;  2HSE B;  2HSP A;  2R57 A;  4Z02 A;  2HD0 A;  3CCJ T;  5GAN 7;  5GAO l;  4KUI A;  2LCS A;  2PQW A;  2R5M A;  3NFC A;  3G7Z A;  1QCN A;  1VQN A;  4RG2 A;  5AYF A;  2L3R A;  1IGU A;  1YWP A;  4M75 B;  2DRK A;  2PNI A;  5D6Y A;  5LJ5 d;  1UHC A;  1C1A A;  4EIK A;  3NPF A;  5GAO m;  2RHI A;  5GAN d;  4PJO E;  1SPK A;  3DLM A;  1PD1 A;  3UT1 A;  4R0K A;  1IHW A;  4FL6 A;  4D6W A;  2D9T A;  3CCL T;  1LOJ A;  1UHF A;  3G6E T;  1I0C A;  1AHJ B;  2FZG B;  2MIO A;  3QO3 A;  2RH2 A;  1RAE B;  4JS5 A;  3KUF A;  3QWY A;  2YUN A;  5GMK j;  4FT4 A;  2VC8 A;  1UGV A;  7AT1 B;  4RCC A;  1ZUY A;  3CCQ Q;  5ECA A;  2HZY A;  5GMK l;  2J06 A;  2V26 A;  4N4G A;  2DD4 A;  3CCJ Q;  4OMQ A;  1SHF A;  1QVF S;  2JN0 A;  2CRE A;  4AG2 C;  5CKH A;  3MJX A;  2JJ9 A;  3JB9 D;  2K9G A;  5GAN g;  4JZ4 A;  4QVD A;  4BB7 A;  5I11 A;  2DL3 A;  2EIF A;  1VQM T;  3G1J A;  2DIL A;  2C0I A;  4M7A E;  4FU6 A;  1MMD A;  4EMK A;  2RHX A;  2RQR A;  4N0A A;  1JEG A;  5GMK m;  1QVG S;  2NYS A;  2H3J A;  3PTA A;  3CD6 A;  1AWJ A;  3Q1J A;  4C8Q C;  1WXU A;  3PE0 A;  1VQ8 T;  2LX9 A;  1WHJ A;  2EYZ A;  2EQU A;  2FVU A;  1GCP A;  3CCL Q;  3O5Z A;  2C06 A;  2GBQ A;  3NMZ C;  3CD6 T;  3G6E Q;  2XG8 D;  2VXE A;  3FJ5 A; 
#chains in the Genus database with same CATH homology
 2FRW A;  2RQW A;  4WCI A;  4AG1 C;  4D8D A;  3LH5 A;  4HXJ A;  3H0I A;  2DL4 A;  2JM8 A;  4KRT A;  2EGC A;  1M27 C;  2OAW A;  1FMK A;  1GFD A;  3VS5 A;  3EG1 A;  1U3O A;  3H0F A;  3UAT A;  3UA7 A;  1W1F A;  1G83 A;  4JJD A;  2BZY A;  2FEI A;  1UG1 A;  1X2K A;  1SSH A;  2C0O A;  2DE0 X;  2FPE A;  2GTO A;  3I5R A;  4E6R A;  1BU1 A;  4JZ3 A;  1JO8 A;  2KT1 A;  2DL8 A;  2BTT A;  4J9G A;  2O31 A;  3RBB B;  2JXB A;  2JS0 A;  1TUD A;  1B3Q A;  5GJV B;  1H8K A;  2LX7 A;  2A36 A;  1MV3 A;  1HJD A;  3R6N A;  2FPF A;  1UTI A;  1OEB A;  1ABO A;  4GLM A;  2KE9 A;  1HD3 A;  4OMM A;  4LE9 A;  2F2W A;  4X1V A;  5IH2 A;  2VVK A;  2YSQ A;  3U23 A;  2PZ1 A;  4D8K A;  1AOJ A;  1NLO C;  2C0T A;  4CC7 A;  1X27 A;  2DF6 A;  2DL5 A;  1GRI A;  3NGP A;  2DNU A;  1AEY A;  2KNB B;  2KXD A;  2LMJ A;  1YN8 A;  1X6G A;  2CUD A;  1QKX A;  2W10 A;  4Y92 A;  2D1X A;  1AD5 A;  2M51 A;  2AZV A;  2DBM A;  2L3Q A;  5FWB A;  4J9F A;  1UJ0 A;  2D8J A;  3UF4 A;  2KRM A;  2KYB A;  1IO6 A;  1K0X A;  1KJW A;  1SHG A;  3NHN A;  2KRN A;  3VS7 A;  3I35 A;  1WXT A;  2KYM A;  1T3L A;  2HEQ A;  4K11 A;  1KSW A;  2DLP A;  2V1Q A;  2IIM A;  2A08 A;  2RQT A;  2VKN A;  2YUP A;  1KFZ A;  3M0U A;  5GJW B;  2J6K A;  2EW3 A;  2SRC A;  1Y0M A;  2W0Z A;  4Z89 A;  3ULR B;  5L23 A;  4F17 A;  2LNH B;  4RUG A;  1ABQ A;  1K1Z A;  2RNA A;  1PHT A;  1XOV A;  1WXB A;  3SEM A;  1M3B A;  2ED0 A;  5IXF A;  2ENM A;  4Z88 A;  2KRS A;  3QWX X;  2JTE A;  1X6B A;  2EYY A;  4RTU A;  5I22 A;  2P4R A;  3M0S A;  3TVT A;  1GL5 A;  1PNJ A;  1HSQ A;  1EFN A;  2ABL A;  3RNJ A;  2DM1 A;  1ZUK A;  4HVW A;  4M4Z A;  1ZBJ A;  4QT7 A;  2KT8 A;  1AZG B;  1FYN A;  2JMA A;  1U5S A;  3I9Q A;  1AZE A;  2F2X A;  3VS1 A;  1WA7 A;  2DBK A;  1UE9 A;  2KR3 A;  2LJ3 A;  4DEX A;  4DEY A;  2KRO A;  3I5S A;  1NM7 A;  2D8H A;  2O9S A;  2DX1 A;  2RMO A;  2JS2 A;  1GCQ A;  1NYG A;  1T0H A;  2AZS A;  1QWE A;  2E5K A;  1A0N B;  4RTW A;  3VS4 A;  2DVJ A;  1RI9 A;  4LN2 A;  2A28 A;  2CT4 A;  2OI3 A;  5FW9 A;  3THK A;  1K4U S;  2FPD A;  2X3W D;  4CC2 A;  1OOT A;  3PVQ A;  2J05 A;  1ZLM A;  1JXM A;  1RUW A;  2LQN A;  4FSS A;  5FWC A;  1NYF A;  3REA B;  2RN8 A;  2EVR A;  4RTT A;  1ZX6 A;  1YCS B;  2EYX A;  2D0N A;  1YWO A;  4LUE A;  2DYB A;  2O2O A;  2CSI A;  1TUC A;  4ZNX A;  2ESW A;  3TSZ A;  2K7A A;  4AFS C;  2ROL A;  4ESR A;  2LJ1 A;  1QWF A;  1JQQ A;  1UEC A;  2GGR A;  5IXB A;  1M8M A;  1H92 A;  4JJB A;  2JM9 A;  1AWW A;  1NEG A;  1M30 A;  1AWO A;  2H8H A;  2NWM A;  1PRL C;  2KGT A;  1SEM A;  2O88 A;  1GFC A;  2L0A A;  2AK5 A;  4JJC A;  1VYT A;  2YUO A;  2JMC A;  1PWT A;  4IIM A;  5IHK A;  1ZUU A;  3GBQ A;  2YUQ A;  4CC4 B;  2BZX A;  1OPK A;  1RLQ C;  2YT6 A;  1TG0 A;  1W70 A;  1WI7 A;  3JV3 A;  4F14 A;  1PRM C;  4GBQ A;  1WIE A;  1YNZ A;  2B86 A;  2QDL A;  2MCN A;  3REB B;  3PVL A;  2CH4 W;  2F2V A;  2FO0 A;  3EG2 A;  2O9V A;  4J9I A;  1GCQ C;  1AWX A;  2CUB A;  2J6O A;  3VS6 A;  2K6D A;  3C0C A;  4OMP A;  1UUE A;  1M3A A;  1X43 A;  2DA9 A;  1X69 A;  4Z8A A;  2VWF A;  4LUD A;  1BB9 A;  1E7O A;  2LQW A;  3KFV A;  1QCF A;  1CKA A;  1M3C A;  3A98 A;  4RTY A;  2EKH A;  3EGU A;  1H3H A;  1J3T A;  1OPL A;  1BBZ A;  1WLP B;  2K2M A;  2SEM A;  2EGE A;  1ZSG A;  1VA7 A;  2K3B A;  1E6G A;  2EYW A;  1WFW A;  1UFF A;  2V1R A;  3EG0 A;  1SRL A;  1Z9Q A;  4J9C A;  2ECZ A;  2JW4 A;  3EHR A;  1MV0 B;  1NLP C;  1YP5 A;  2KXC A;  4J9H A;  4OMN A;  4AFQ C;  2HBW A;  1E6H A;  1WX6 A;  5IHI A;  2PTK A;  1AVZ C;  1VYV A;  2RF0 A;  2DRM A;  2I0N A;  2HCK A;  2NUZ A;  4IIO A;  4OMO A;  3UA6 A;  2HSP A;  1MUZ A;  2AKK A;  2LCS A;  1B07 A;  4OML A;  1K76 A;  4CC3 A;  2KBT A;  2GQI A;  2CT3 A;  1WDX A;  2EPD A;  2FG0 A;  2EBP A;  1YWP A;  4HVU A;  5EC7 A;  2ED1 A;  2DRK A;  2JT4 A;  3CQT A;  4F16 A;  2PNI A;  2LZ6 B;  3VS2 A;  2FRY A;  4LNP A;  2HDA A;  1G2B A;  1UHC A;  2J6F A;  4HVV A;  4ORZ A;  1UDL A;  4EIK A;  3NPF A;  2BZ8 A;  2L3P A;  2X3X D;  3IQL A;  1I1J A;  1GBR A;  1SPK A;  1OV3 A;  3VRZ A;  1NEB A;  4R0K A;  2DJQ A;  1VYU A;  3EHQ A;  1Z9Z A;  3H0H A;  1PKS A;  1X2Q A;  2A37 A;  2LP5 A;  4RTX A;  1QLY A;  2M0Y A;  4HCK A;  4RTZ A;  2RQU A;  1K0S A;  1T0J A;  1K9A A;  2K79 A;  1UHF A;  2GNC A;  1I0C A;  2MIO A;  4RTV A;  1JU5 C;  1NG2 A;  1V1C A;  3M0Q A;  3VS0 A;  1N5Z A;  2G6F X;  1WYX A;  3QWY A;  3VRY A;  2YUN A;  2MOX A;  2YDL A;  1UGV A;  5IHN A;  1LCK A;  2RQV A;  1BK2 A;  1ZUY A;  5ECA A;  1CKB A;  4J9E A;  1JXO A;  2J06 A;  2GTJ A;  3VS3 A;  1U06 A;  1RLP C;  4OMQ A;  1SHF A;  2KEA A;  2DMO A;  2L2P A;  2RPN A;  2CRE A;  3M0R A;  2EQI A;  4AG2 C;  2AKL A;  4AFU C;  2K9G A;  3H41 A;  4JZ4 A;  1Y57 A;  3ZL7 C;  5I11 A;  2CDT A;  2CSQ A;  4JPB W;  2CH4 A;  2DL3 A;  1CSK A;  2DIL A;  2C0I A;  2LJ0 A;  3M0T A;  1KIK A;  2RQR A;  1JEG A;  1ARK A;  4A63 B;  4J9B A;  1QKW A;  1AWJ A;  1GBQ A;  4AFZ C;  1PKT A;  1W6X A;  1WXU A;  3TSW A;  2XMF A;  1SRM A;  2OJ2 A;  3PE0 A;  4J9D A;  5HCK A;  2EGA A;  3EG3 A;  2EYZ A;  1UJY A;  2DL7 A;  2ROT A;  1GCP A;  1T3S A;  3O5Z A;  2GBQ A;  3NMZ C;  1S1N A;  3M0P A;  1I07 A;  2J7I A;  3SHW A;  3FJ5 A;  2L3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...