2BZ8A

N-terminal sh3 domain of cin85 bound to cbl-b peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
VEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVREIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-DOMAIN KINASE BINDING PROTEIN 1
publication title Cbl Promotes Clustering of Endocytic Adaptor Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 10
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bz8A00
2RNAA 2JS0A 1K1ZA 3ULRB 2DYBA 3VRZA 2J6FA 1AZGB 2GBQA 1SPKA 1U06A 1UDLA 2F2WA 2A37A 1UGVA 1M3CA 2I0NA 2O31A 1I1JA 3PVLA 2KXCA 2VKNA 2EYZA 4AG2C 2LMJA 3REAB 4RTZA 2MCNA 1H92A 4R0KA 1K9AA 2JS2A 2P4RA 4LE9A 4J9EA 1AEYA 1VA7A 3VS7A 4HVUA 1NLPC 2C0IA 2F2VA 2J6KA 4DEYA 2E5KA 1K0XA 2J6OA 1B3QA 2BZ8A 2JT4A 4IIOA 2JW4A 3REBB 1GL5A 1AWJA 1OPKA 1M8MA 5L23A 2OJ2A 1AWXA 1I0CA 3EG3A 2ED0A 4RTYA 4K11A 2LJ3A 2VVKA 3CQTA 1AVZC 1E6GA 4JJDA 1KFZA 2J06A 5GJWB 4D8DA 2W10A 4QT7A 3VS3A 2DL3A 4Y92A 1MUZA 2RQTA 2KRMA 2FO0A 4RTXA 1E6HA 2C0TA 2DM1A 4AFQC 2M51A 1YP5A 4X1VA 1X69A 2NWMA 2AKLA 1RI9A 4LUEA 2EVRA 1NM7A 3H41A 4ZNXA 2CT3A 2EYYA 1GCQC 1UTIA 3SHWA 2X3XD 2ROTA 1ZUUA 2KR3A 1UJYA 2DA9A 1SSHA 2LZ6B 2KT1A 2SRCA 4J9IA 1HD3A 2CREA 2FPFA 4F14A 1TUDA 4J9FA 4JZ3A 4HCKA 2GQIA 3NGPA 5IHKA 4OMQA 2KBTA 4OMNA 2YUOA 1PWTA 1W6XA 3UATA 4DEXA 1Y0MA 3I35A 4J9BA 1NEGA 2GTOA 3FJ5A 3VS6A 2DL5A 1JXOA 1QWFA 4JJCA 4JZ4A 4F16A 2DJQA 2L0AA 1MV3A 2LQWA 2RQVA 5IHNA 2AZVA 4GLMA 4RUGA 2DL4A 1RUWA 3GBQA 5FWBA 1RLPC 1UUEA 1GRIA 2PNIA 1GBRA 1AD5A 1T3SA 2KRNA 2A08A 1K4US 2HEQA 1N5ZA 4RTUA 3EHQA 2LP5A 2VWFA 2FRWA 3TSZA 3VS4A 1UG1A 2L3SA 2DRMA 2AKKA 1EFNA 1JO8A 1OPLA 1UE9A 2YDLA 2KT8A 3QWXX 1PKTA 3M0UA 2X3WD 2RQWA 2RQRA 2YUNA 2HDAA 4AFSC 2B86A 3PVQA 3I5SA 1H3HA 2BZYA 2RN8A 4M4ZA 1XOVA 3RBBB 1FMKA 1WA7A 1OV3A 1CSKA 2F2XA 4GBQA 1YWOA 2EGEA 2RPNA 2KRSA 2KXDA 2DILA 2EQIA 1UHCA 1WLPB 2H8HA 3JV3A 5IH2A 2LQNA 1LCKA 1AWWA 2RQUA 2DX1A 1NEBA 3NMZC 2G6FX 4OMOA 4CC7A 1X2QA 1ZX6A 3UF4A 2KYMA 4Z89A 2YSQA 3M0QA 2KYBA 1HJDA 2J7IA 2KEAA 3KFVA 4E6RA 1VYVA 2YUQA 2D1XA 3R6NA 1QWEA 2CDTA 3IQLA 4AFZC 1X6BA 1QKXA 4JPBW 2O9VA 1AOJA 4J9GA 2V1QA 1NYFA 1PNJA 2EGAA 3VRYA 1GFDA 2DL8A 1Z9QA 3EG2A 1WFWA 4FSSA 5EC7A 1B07A 2FG0A 1M30A 1WIEA 2D8HA 4J9HA 1SHFA 4AG1C 1ZLMA 2XMFA 4CC4B 4ORZA 2DLPA 3U23A 4LUDA 1GBQA 1ABQA 2EKHA 1YWPA 1GCQA 1ARKA 5IXBA 2L3PA 2K2MA 2BZXA 1WI7A 4Z88A 1PRLC 3NPFA 3M0TA 1UHFA 2CSQA 2KNBB 1Y57A 1SRLA 2JM9A 3EG0A 2EYWA 1M3AA 4CC3A 3LH5A 1KJWA 3VS5A 5ECAA 1E7OA 1ABOA 2A36A 1H8KA 1G83A 5GJVB 4OMPA 4J9CA 2MOXA 1GFCA 1MV0B 2M0YA 3I5RA 1OOTA 4J9DA 1PRMC 1S1NA 2K79A 3M0SA 2ED1A 1BK2A 2D8JA 4OMLA 4KRTA 2GNCA 1W70A 1T0JA 1U3OA 2JXBA 5I11A 1I07A 3EGUA 1BU1A 1M27C 3NHNA 3TVTA 3O5ZA 4HVVA 1UECA 2K3BA 4RTTA 2RF0A 1X27A 1CKAA 1IO6A 4CC2A 2LJ0A 2FEIA 2NUZA 2JM8A 2AZSA 4Z8AA 1A0NB 3H0IA 1AWOA 3H0HA 1WYXA 1YNZA 5IXFA 1WDXA 1FYNA 2HSPA 1CKBA 2GGRA 2DBKA 2CH4W 2L2PA 2CUBA 2JTEA 1VYUA 2JMCA 2GTJA 3TSWA 2CH4A 1WXUA 1KSWA 2EBPA 2DVJA 1JEGA 1G2BA 2DF6A 1TG0A 2J05A 2L3QA 3SEMA 1T0HA 2PTKA 5FW9A 2ENMA 4IIMA 4F17A 3EHRA 1ZSGA 1Z9ZA 1M3BA 2KROA 2FPDA 2LJ1A 4HXJA 2OI3A 2DL7A 2EPDA 2LX7A 2K6DA 2A28A 1JU5C 2C0OA 1GCPA 1UJ0A 2BTTA 1SRMA 1NLOC 2KGTA 2AK5A 4RTWA 3PE0A 1ZUYA 2DMOA 2ESWA 2SEMA 2V1RA 4ESRA 1OEBA 3VS2A 1SEMA 3ZL7C 5FWCA 2FPEA 2PZ1A 2YUPA 2ABLA 1AZEA 4LN2A 3THKA 2EW3A 3VS0A 2CSIA 3UA6A 1BBZA 2ECZA 1TUCA 3C0CA 4OMMA 1KIKA 2LCSA 4JJBA 3UA7A 3M0PA 5IHIA 4A63B 1T3LA 1W1FA 2D0NA 4D8KA 1NYGA 2HBWA 3EG1A 3I9QA 2LNHB 2K7AA 1WX6A 1V1CA 1UFFA 4RTVA 1X43A 2O2OA 4LNPA 4HVWA 1HSQA 1VYTA 5I22A 1QCFA 1BB9A 3H0FA 1QLYA 2QDLA 2YT6A 1JXMA 2DRKA 2O88A 4EIKA 2EGCA 2ROLA 1YN8A 2DBMA 2W0ZA 2IIMA 1K0SA 1X6GA 3RNJA 2DE0X 2HCKA 1U5SA 2KE9A 2EYXA 1PHTA 1JQQA 1PKSA 1YCSB 2DNUA 3VS1A 5HCKA 2JMAA 2RMOA 2MIOA 1WXTA 4WCIA 2CUDA 1J3TA 1K76A 1ZBJA 1NG2A 3QWYA 1ZUKA 1RLQC 3A98A 2OAWA 4AFUC 1X2KA 1WXBA 1QKWA 2O9SA 2CT4A 1SHGA 3M0RA 2K9GA 2FRYA
chains in the Genus database with same CATH superfamily
5GAOm 2EYQA 2JS0A 3URGA 3JB9F 1UGRB 2JZ2A 3HRTA 2VYTA 2KQWA 2HL5C 3OA6A 1VQOQ 1ZSZA 4E2FB 5GAOr 2VGMA 5FROA 3GPLA 1NPPA 2O31A 1B34B 5LJ5f 2LMJA 3RR6A 2CYZB 3FJPA 9ATCB 5L8RE 2P4RA 4LE9A 5KYNA 2NUPA 1K73U 1BKBA 1M1GA 3CCJQ 2L5QA 5DY9A 4TVRA 1YJWQ 2C0IA 2J6KA 2QA4Q 2C06A 4EDUA 2JW4A 2QG9B 1AWJA 2DAQA 4J5YA 1W2BA 2DETA 2A3LA 4M7AD 4FCYA 4C0GA 4XAXB 5GJWB 2F1LA 1BCOA 1YI2Q 1OZ3A 4M75G 4XK8E 2QGGA 1SF9A 1QP3A 2MWOA 4OGEA 1LJOA 2DM1A 2DJZA 2NWMA 1NJIR 3CC4A 1TXQA 4LUEA 3RIRA 2CZ1B 3H41A 2X4YA 4M77D 4XTXA 1RABB 1RI0A 3EGXB 1SKUB 2X3XD 1RAAB 2DA9A 5KYUB 1SSHA 2LZ6B 3WXMB 3G71A 3L2VA 1FXXA 2XDPA 4KT0E 4J9IA 1WPYA 2FYKA 3D7SB 4JRIA 5I2MA 3VUBA 3BFMA 4JZ3A 2CZ0B 3JCMb 3KXTA 2GQIA 1X01A 4OMQA 4OMNA 2LCCA 3QYGB 1PWTA 4BE0A 3UATA 5KH6A 3FJ5A 4A4GA 2VXEA 3VS6A 3DLMA 1JXOA 4F16A 4MMLA 4LDYA 4N4GA 1D1CA 3VJPA 2LQWA 3OW2A 3CCLT 1G3TA 4A4HA 5J39A 3CCSA 2AZVA 4FYVB 3CCEQ 1RUWA 3OYGA 2EQUA 1GBRA 1K4US 3LX7A 2QQAA 2E1HA 3E9GA 4RTUA 2VWFA 2QI2A 3DLLA 2AKKA 4EMKC 1EFNA 3OYNA 1JO8A 1OPLA 3MEUA 2GF7A 3RESA 4X9DA 3M0UA 3I56A 1M1KU 2E65A 4AFSC 1D1BA 4M78E 3PVQA 3OYKA 3CC2A 1TOVA 1QW1A 3RBBB 4A53A 5KYWB 1D0YA 5CQYA 1O9SA 3X25B 3OYAA 2VGNA 2KRSA 1P92A 4A4FA 2EQIA 1UHCA 3JV3A 1SG5A 2F5KA 4OVAA 4C92A 1LCKA 2E3IA 2DX1A 3WVEB 1VQKQ 1Q82C 1G3YA 1HJDA 4RG2A 2KEAA 3KFVA 4E6RA 1YIJT 2HKNA 1VQLT 1MMNA 2HKQB 3S3MA 1AOJA 2V1QA 4BI4A 1D3BB 1TUGB 2QAZA 1PNJA 2EGAA 1YJNA 4FM4B 5C0MA 3VU3C 2LVMA 3EG2A 2QEXQ 1IREB 4FSSA 3CMAT 2H3EB 1OQKA 1M5Q1 4FT4A 1PD0A 1SHFA 4AG1C 4OMFB 3LLRA 1M9SA 1RAFB 3A8HB 4O6JA 2EKHA 1M2VB 2MI6A 1ARKA 1BYMA 1VQ9T 4M78F 3QO3A 4L6V5 1WI7A 4C92E 1QVGP 1V76A 4IURA 3M0TA 1UHFA 2CSQA 1Y57A 1UEBA 1D09B 2QYZA 1M3AA 4XTWA 1IGQA 2FHDA 4ZTFA 2RB6A 2YRVA 1QVGS 4M78C 1HXDA 3OYEA 3O8VA 5ECAA 1VQPT 4PJOG 2MOXA 3JCMX 2AT1B 4NOYA 1Q7YC 3I5RA 4QVZA 2ZPEB 3GLXA 3M0SA 4FYXB 2V26A 4FIBA 2DXBA 2GNCA 4M75B 4BE1A 4II1A 3BDUA 1ZHIA 2A7YA 2JXBA 8AT1B 4PK4A 1NE8A 4QVCA 2OTLA 3OS5A 3TVTA 1VQNA 2K3BA 4RTTA 3C4SA 3PGGA 2VXFA 1YFNA 2DEUA 4ME7A 3L2ZA 2FZGB 4Z8AA 1KHCA 3M4YA 1WHKA 1FMVA 4DBQA 1RADB 1VQ8A 2OAUA 5A0GA 2K4YA 4CRIA 4PJNA 1VYUA 1Q82R 1RL2A 2O4XB 2FZCB 1N8RC 2DVJA 3CCQA 1JEGA 4C92F 1G2BA 1MGQA 3S3OA 2DF6A 5GAN3 4E7JA 1YJ9A 2QK0A 2M0OA 4IIMA 4F17A 3JCMJ 3OMGA 3M5AA 1M90U 2XKOC 2KROA 2DFUA 4C92C 5KCOA 1G3SA 1BI2A 5LJ3g 2LX7A 2K6DA 4E7KA 1JU5C 1KD1C 1GCPA 3SWNC 2BTTA 2P4TA 4RTWA 4LDWA 1C6VX 2RJDA 4BUGA 4LDUA 2HSEB 3FEOA 1TH7A 3CMET 1VQMA 3L42A 3OYYA 5CR2A 2EW3A 1R77A 3UA6A 1ZSZB 3CCRA 3CCVA 1TUCA 4OMMA 1KIKA 5LJ3f 2QQRA 3M0PA 2MWPA 2QASA 4D6WA 2XICA 3A8OB 1JJ2P 1T3LA 1W1FA 2D0NA 1NYGA 2LNHB 2ZPFB 1V1CA 2RI3A 2ZCFB 1Q7YR 4DBFA 3CCLQ 1QCFA 5M9OA 1QLYA 1JJ2S 2NUPB 2QDLA 1B7TA 4J7FA 3Q1JA 3QYHB 2O88A 4EIKA 4ANJA 1R8OB 1K8AU 3RNJA 2QGFB 1U5SA 3HTRA 2LTOA 1FMWA 3L2QA 3G6ET 4DOWA 4GLKA 3QJ6A 1JQQA 2XDDA 4F7UA 1RAHB 5D7UA 1G8XA 3CD6T 5IN1A 4L59A 2LX9A 2X4JA 2CP3A 4MZMA 3UDCA 3T9NA 2CUDA 2ZPGB 1ZBJA 2X51A 3V8LA 1QCNA 3EGDA 2E64A 4F04B 4KGZB 3FC3A 3VYGA 1VQ7A 2CGHA 1N8RR 1PD1A 2EJ9A 2FVUA 2YHTA 2MYSA 2DVEA 3BW1A 3M9QA 3ULRB 4OP0A 1YITT 3E19A 1UDLA 1U06A 2YLCA 3MKDA 2M16A 1K9MC 2Y4YA 1UGVA 1M2VA 1YIJQ 1I1JA 1KD1R 3JRZA 2QQ9A 1VQLQ 4AG2C 4F7UE 2HD0A 4BI3A 5FRMA 3MCAB 1YHQA 4RTZA 1WHLA 1ZA1B 3JB9J 2GCXA 4J9EA 4KGVB 1TSFA 3FB9A 5CKFA 3MEVA 1AEYA 2YLBA 4PJLA 1NLPC 3CMAQ 3JCMd 2D9TA 5GMKj 4B9WA 2R5AA 1B3QA 5GAMe 4IIOA 3ASKA 2JTFA 1S72A 2DTOA 5GAOp 4IUPA 1H641 3AT1B 1I0CA 3SFMA 2ED0A 1VQ9Q 2VVKA 3CQTA 2IVWA 1AVZC 1E6GA 4JJDA 2JN0A 5GMKh 3RUXA 2CP7A 2J06A 4ZGJB 1GXIE 4FW2A 2EIFA 2DL3A 4Y92A 4M7AG 2RQTA 2KRMA 3LWHA 1E6HA 1VQPQ 2C0TA 2ZAEA 3JCMQ 4AFQC 5FU6C 4X1VA 1X75C 2YXYA 3MO8A 5KCHA 3F70A 3M59A 4ZNXA 2CT3A 2AHJB 3H9NA 3QKJA 3CCEA 3X26B 5CKDA 5GAMj 4Y91A 3QDRB 2KVQG 1UJYA 4M77G 2SRCA 2K5IA 2RHIA 2KMTA 2LQ8A 2O4XA 3H8ZA 1QVFP 2GFAA 4LDVA 1I81A 1X6OA 4F7UF 5IHKA 2KBTA 4BACA 3I35A 3M56A 1QVFS 4M75E 1NJIU 4PJMA 3QG1A 1QWFA 3CCUA 4JZ4A 2EWNA 2XU8A 3S6WA 4HKEA 2D6FA 4Y28E 3JSCA 1IXDA 3EAEA 3E2UA 4R56A 3EG9A 2DL4A 1K9MR 5FU7B 1ACMB 5FRNA 2PNIA 4AT1B 2Y4XA 1MMAA 2EQMA 3EHQA 2LP5A 3TSZA 4QQGA 1BI0A 3CXCA 3JAME 1UE9A 3QIIA 3ZFJA 4JLGA 1PKTA 2PQWA 4FSXA 4A54A 8ATCB 4ZN3A 2DPPB 2YUNA 2HDAA 3PIOA 1Q86C 3OS1A 3OYCA 1BI3A 5LJ3e 4JDSA 4E7IA 1HYOA 2RJEA 3CC4T 1XOVA 4XQ3A 1OV3A 2F2XA 3HP9A 1K73C 3CMEQ 3C94A 3RMSA 3L2UA 3JCMP 2WSCE 3CC7A 4HCCA 5GANd 2DILA 4HA8A 3G71T 3VV0A 5GAOn 3PMTA 1IZ6A 1NEBA 2DD4A 3NMZC 1X2QA 2E10A 3UF4A 4M75F 2PUKB 2DZ9A 2YSQA 3M0QA 1RAEB 4C8QG 2YUQA 3R6NA 2DIQA 3FIFA 3P8DA 4RKUE 1TS9A 3GNFB 1D0XA 1QKXA 4M75C 2O9VA 4J9GA 3L1AA 1GFDA 2DL8A 3HFNA 5C6SA 3J81E 3CCST 1VQ5A 4PNOA 4J9HA 2XMFA 4M7DD 4ORZA 5GANe 3CD6Q 2HAXA 4LUDA 1GBQA 1Y7XA 4P5NA 4OB1B 1YWPA 4PJJA 1GCQA 5IXBA 3NTIA 2BIVA 2K2MA 5GAN7 2BZXA 1N6AA 2DXUA 1MMGA 1PRLC 2MK5A 5HKCA 1LPLA 3OYDA 3I56T 4WF2A 3CBOA 3OY9A 4PJOA 3PIPA 1E7OA 2DIGA 3CC2T 3V7RA 1G83A 5GJVB 4FW1A 3RMQA 2JVVA 4IUVA 3J80E 3QDFA 1YITQ 3LGLA 4J9DA 5GMKm 1W4SA 2LT4A 3MHXA 5GANj 2CZ6B 4XTYA 4OMLA 1BCMA 4OF1A 1Q86R 3NFCA 1T0JA 4M7AB 3OS0A 3ZEHA 5FU6B 1I07A 2QQBA 2LRQA 3NHNA 3LH0A 4MMKA 2VB6A 1VIEA 1K73R 4LXCA 1X27A 2YRDA 1CKAA 1IO6A 5KYXA 1I5LA 1PSFA 3MEWA 2Z0WA 2ZPIB 3V7SA 4J6XA 1F1BB 1MNEA 1ZSZC 4ZGEB 5CKEA 5HK0A 3JB9D 1WYXA 2OTJA 1WDXA 1YJNT 4KGXB 1FYNA 4PJOE 1CKBA 2BE7D 2EJGA 2DBKA 2CH4W 3ZBDA 2JTEA 2L8DA 3L2RA 2E41A 3V8JA 1KG1A 5CKHA 3BY7A 4F7UB 1TG0A 3OYHA 2J05A 1YBYA 2X4XA 3SEMA 2PTKA 2R57A 4C8QD 3G4SA 4PFPA 3EHRA 4ZTJA 2FPDA 2LJ1A 4HXJA 2OI3A 4AMCA 2A28A 2RO0A 3EGDB 2KI7A 3CBMA 1UJ0A 2RJFA 2HNIA 3PE0A 1Q82U 2K5LA 2QXFA 1D0ZA 4N4IA 1VQ4A 1AZEA 2ZGWA 4LN2A 4DQ2A 3VS0A 2CSIA 4HT8A 3C0CA 5GAOq 1KQSP 2ZPHB 2LCSA 3RKWA 3UA7A 1LNXA 3GP8A 2OTLT 2RHYA 2RK1A 4J6YA 4D8KA 1VQNT 2HBWA 3EG1A 2RHXA 5EG2A 3V7CA 1WX6A 2HQEA 1Q81U 2O2OA 4V2SA 1KQSS 3MP8A 2LCLA 4JS4A 4PJOF 1EX4A 2RJCA 1JXMA 2YT6A 3OYIA 4PKCC 2H3JA 2X35A 4E7SA 3CCMA 2W0ZA 1PCXA 5LJ5e 1K0SA 4N0AA 1X6GA 1M4ZA 1VQ8T 3QUIA 1DJ7B 3CPWP 3RKYA 4PJOC 2QQSA 2EYXA 3WVDB 3FRNA 2COWA 2E70A 2RI2A 3CBPA 3RKXA 1RAGB 5CIUA 3CPWS 3CCQT 4B6MA 2JMAA 3NTKA 4XTUA 3J7AF 1QVPA 1YJ9T 2FZKB 4C5EA 1Q7YU 3GIBA 3CC4Q 3DB3A 2OAWA 4HT9A 2O01E 3MP1A 5CO7A 4BY6B 1X2KA 1WXBA 3M54A 1QKWA 2CT4A 1SHGA 2FRYA 3G71Q 5LJ5j 2KY9A 2RNAA 2K3XA 3EFRA 1K1ZA 5GAN5 4LD9K 2DYBA 3VRZA 2J6FA 2L89A 1SPKA 1VQMT 3OMCA 4BD3A 2RD1A 3OS2A 2A37A 4OGCA 1M3CA 3CCRT 3CCVT 4PL6A 4DBRA 2VKNA 2EYZA 3MJXA 3VYHB 1BIAA 1EZZB 3HL8A 3REAB 2MCNA 1H92A 4R0KA 1K9AA 3H6ZA 5CCAA 3OYLA 4HVUA 3CCSQ 1M90C 4DEYA 1K0XA 2J6OA 2HL3A 1BIBA 2V8JA 2JT4A 3OYJA 3EG9B 3PTAA 1GL5A 4KULA 1OZ2A 2COYA 2L3RA 2RA2A 1AWXA 2RHUA 4RTYA 4K11A 2WSFE 2RI5A 3SB2A 2D0QB 1KD1U 1KFZA 4M7AA 1W2BP 3MPUB 3VS3A 3LYIA 5FU7C 4E7LA 3M53A 2PVDB 5DM7R 1MUZA 2CP6A 2FO0A 2HZYA 4RTXA 4HCBA 1M8VA 1QQJA 3CC2Q 1W2BS 2M51A 1YP5A 1X69A 3A5ZB 5HY6A 1RI9A 1NM7A 4FL6A 4JRKA 2EYYA 3OSVA 4LDXA 4O5VA 1VQ7T 1FWZA 1UTIA 3SHWA 3I55A 4M77A 4QW2A 1ZUUA 1VQ6A 4HCZA 2FPFA 4M78D 1K8AC 3HKSA 4F14A 2PVOB 4HCKA 1VQOA 3NGPA 5A0DA 4N0AC 2NUTA 2YUOA 1W6XA 4EMHA 4DEXA 4J9BA 1NEGA 1OX8A 5AT1B 1M2OA 4M7AE 2XG8D 1YHQT 5A0LA 2MMPA 4JJCA 1OU9A 1YJNQ 2CS7A 2L0AA 5CVIA 3ER0A 3CCJA 5IAYA 4FYYB 1YJWA 1WQ7A 4OB0B 3P8HA 3GBQA 5FWBA 1RLPC 5GAMd 2QA4A 3OW2P 1U1SA 4ELZC 1QMCA 5A2QE 1S72T 1AD5A 1T3SA 2KRNA 2A08A 1N5ZA 3EFOA 1ZA2B 4M77E 2FRWA 1UG1A 3OW2S 3MEAA 2KT8A 3GF5A 4OB3B 1N9SA 5D6YA 1M90R 2PU9B 2RQWA 2RQRA 1YI2A 1H3ZA 3I5SA 1H3HA 3JCMW 2E3HA 1V29B 3INZA 4PJOB 2DKGA 2RN8A 2JNGA 4M4ZA 3LWIA 1XJWB 4E7ZA 3JB9H 1LOJA 1KK7A 1K9MU 1CSKA 4X9CA 2K5FA 1YWOA 2M02A 3CCET 3CEYA 2I2LA 2KXDA 2XIDA 4VUBA 4C92D 1WLPB 2H8HA 5IH2A 2LQNA 3OBWA 2E12A 2OTLQ 2RQUA 2P84A 1VQNQ 4OMOA 4XU1A 4CC7A 1ZX6A 4C8QA 1R0BG 2KYMA 1ZQ1A 3A1PA 3CPFA 2KYBA 4XU0A 4M7AF 2J7IA 1VYVA 1QWEA 2CDTA 3IQLA 3P8BB 2HBPA 1X6BA 1MMDA 1U1TA 5KYXB 2DZCA 3CCUT 5KYYA 4M7AC 3HPWA 1VQ8Q 1WHJA 3VRYA 5D6WA 4A4EA 3M4GA 1K8AR 1WFWA 5AYFA 1B07A 1KQSA 4M77F 2FG0A 1M30A 2EFIA 4JLIA 5J3BA 1XNIA 2M9UA 4CC4B 3EH1A 3CCQQ 1I5OB 2DLPA 3U23A 2WSEE 2OX7A 2EJFA 2E5QA 5GMKi 1YJ9Q 2DD5A 1ABQA 1QVGA 3R6OA 4M77C 4WTOB 4M7DG 3UT1A 2F5TX 2CP0A 2ZZDA 2IG0A 2DTIA 4C5IA 2KNBB 2JM9A 3RDVA 4C8QE 3LH5A 4CC3A 5GAMh 5LJ3d 3VS5A 3HSBA 2A36A 1H8KA 4OMPA 2M0YA 3JCMc 1OOTA 1KC8C 5J26A 1PRMC 1S1NA 1VQMQ 2K79A 3CC7T 1Y07A 2ED1A 1BK2A 4DOVA 5FLXE 3CCRQ 3CCVQ 5LL6S 1U3OA 2LC4A 4C0DB 3EGUA 1BU1A 4KBMB 4HVVA 1VQKA 1IRXA 4MZPA 3JCMh 5KE3A 4JRQA 4XU2A 2K3YA 3EH2A 4C5GA 2JM8A 2GFUA 2AZSA 4IUQA 1A0NB 2NYSA 3H0IA 1YNZA 5IXFA 2HSPA 4C0FA 2GGRA 3L2WA 3SDZA 1WHMA 2L2PA 1VQ5T 7AT1B 2QEXA 2GTJA 3TSWA 2CH4A 3JB9G 1Q86U 3X28B 1KSWA 1AHJB 1OULA 1WJSA 2L3QA 1T0HA 1WGSA 5FW9A 1M1FA 4C8QF 1Z9ZA 1KQ2A 2DL7A 2K57A 2V8IA 1IHVA 3GOXA 1VQ7Q 2FB7A 4J8OA 4C8QC 3X20B 5LJ3j 4J83A 1MNDA 1SRMA 1NLOC 3KUFA 1WNLA 1ZUYA 2DMOA 2ESWA 2HQXA 2SEMA 3E9FA 4ZN1A 4Z02A 1OEBA 3G6EQ 4QQDA 2MAMA 5FWCA 4KH1B 2FPEA 2PZ1A 4C5HA 5GAN4 1UGPB 2JJ9A 1JJ2A 1UGQB 3TEEA 4PLIA 4BY6C 1BBZA 5LJ3h 4IUTA 1JRIA 2LQKA 5IHIA 4RMOA 1YHQQ 1QP2A 1PM3A 4OB2B 2K7AA 4RTVA 1X43A 4HVWA 2E4HA 1I4K1 1KC8R 3N5BB 3H0FA 5CKBA 5GAOl 1RAIB 1TTHB 3M57A 2EGCA 1VIFA 1S72Q 1WJQA 2IIMA 2OTJT 2DTHA 2HCKA 2JOYA 1Y71A 4M78A 3G7ZA 4C0ZA 1YCSB 3A8MB 1VOMA 3AHUA 2CZ7B 2RMOA 2MIOA 4WCIA 1J3TA 1K76A 2WACA 5D6XA 2G3RA 3QWYA 4J7IA 1VUBA 1ZUKA 3G4ST 1RLQC 2DEQA 4B9XA 2K2VA 5GANh 1WHGA 2K9GA 1M1KC 2X9HA 4M77B 3UPUA 1AT1B 2VUBA 4M7DB 2DK3A 3TU4K 1AZGB 2GBQA 5GAN6 2F2WA 1VQ4T 5GAN2 2XD0A 3HRUA 4NS5A 2I0NA 2KSSA 2KAFA 3PVLA 2NUTB 3V8KA 2KXCA 2LNVA 3CCUQ 2CP2A 2P0QA 1Q95G 2JS2A 4E7HA 1VA7A 3VS7A 3CCLA 2F2VA 1WJRA 4QVDA 1BI1A 3NTHA 2DERA 2E5KA 1C0MA 2BZ8A 2P0PA 3CCMT 5CQXA 2ZPBB 5LJ5d 3REBB 1OPKA 4KH0B 1WHHA 1M8MA 5L23A 2OJ2A 3LW5E 3EG3A 4M75D 2LJ3A 3EFOB 3SWNA 1JBMA 2Y90A 4ELYC 3QHSA 1OU8A 3GNGA 2W10A 4D8DA 4QT7A 3X24B 1NPRA 3BDLA 1PC0A 5GMKl 2AKLA 2EVRA 2RK2A 2NLUA 3ME9A 4BDZA 1TWBA 3PT9A 4R55A 5GAMg 4RCBA 1GCQC 3OYBA 1Q81C 3CC7Q 4MDWA 1QCOA 2ROTA 1C1AA 2KR3A 1Y96B 3HHTB 3PFSA 2KT1A 1QVFA 1NZ9A 1HD3A 2CREA 4XU3A 3G1JA 2ATCB 1TUDA 4J9FA 5HK3A 1NBEB 4PFZA 4C8QB 1B34A 4M78G 1Y0MA 1WQWA 3TQ7P 1YIJA 2YWWA 5GAMf 3KBGA 2GTOA 1VQLA 1KQ1A 1M1KR 2FL7A 2DL5A 3JB9I 4MZTA 1PSEA 2VASA 3JCMg 3QZ5B 3TREA 2DJQA 1MV3A 5DLQE 5KYYB 1VQ5Q 2PUOB 2RQVA 5IHNA 3VUZA 3CMAA 2MF2A 4GLMA 4RUGA 2V8KA 1I8FA 1UUEA 2AIRB 1GRIA 3PNWC 3A8GB 3C12A 4KUIA 2HEQA 2QDYB 2HQHA 1XTDA 3META 3VS4A 2L3SA 2DRMA 4KUDK 2DO3A 1VQ9A 3S3NA 2YDLA 4BB7A 3QWXX 3JCMf 1UB4A 2X3WD 3CXCP 4CI0C 2B86A 2HMAA 5LJ5h 2CKKA 2BZYA 3A8LB 1R0CB 2X4WA 1VQPA 3CXCS 1SSFA 2KK4A 3EGXA 1FMKA 1WA7A 1XQHA 1N8RU 4GBQA 4DA4A 2EGEA 5KYUA 4IKFA 3I55T 2RPNA 3OQ5A 3JCMV 1VQ6T 4FU6A 2XHCA 4FYWB 4EMGA 3TCJA 2IPOB 1AWWA 5I21A 4C92G 2G6FX 4QQ6A 4NL3A 4ATOA 1VQOT 4Z89A 2E6NA 5DLOA 2D1XA 2XI9A 3I56Q 2EAYA 1Q81R 3UWNA 2XDBA 4AFZC 2QTXA 4JRPA 1N27A 4GY5A 4JPBW 2OTJQ 2LT1A 4EMKB 1NYFA 4PFOA 4C0DC 2CP5A 3CCJT 4PLLA 1Z9QA 1YJWT 5EC7A 4RCCA 3E1SA 1WIEA 2D8HA 1YCYA 2QA4T 1ZLMA 3OYFA 4DBHA 4LD6A 3M55A 5CAIA 4M7DA 4YTLA 3SD4A 2L3PA 3RERA 3G4SQ 3M58A 2A0FB 2GQVA 4Z88A 3NPFA 2M1HA 1SRLA 4PJOD 1N9RA 2EYWA 3EG0A 1YI2T 2LDMA 2BE9B 1KJWA 5GAN8 2BUDA 1ABOA 4IUUA 1RACB 2P0KA 5KYWA 4FT2A 4J9CA 1GFCA 1MV0B 2YRCA 2VV5A 3VKIA 5GANg 2DXTA 6AT1B 3QBYA 1VQ4Q 3CMEA 2RH2A 2DYIA 1JB0E 3BE3A 2D8JA 4KRTA 1W70A 4JJNK 2EKOA 5I11A 1M27C 3O5ZA 1UECA 4M7DE 3DKMA 2RF0A 1OYXA 4NL2A 4BDYA 4CC2A 5GMKe 2LJ0A 3DB4A 2FEIA 3HRSA 5GANf 2JTMA 1D3BA 1G5VA 3CCMQ 2NUZA 5IT9E 2DXCA 1FX7A 2JUFA 1AWOA 3H0HA 4EPCA 4XTVA 3G6EA 2CUBA 2JMCA 1Y96A 2XK0A 1WXUA 1IHWA 2EBPA 4J6WA 4M78B 1OX9A 3CD6A 4QKUA 1O75A 4UC4A 2B8AA 2RHZA 1IGUA 2ENMA 4BI8B 2PVGB 1TU0B 1OI1A 1ZSGA 3QJYA 1M3BA 4MDXA 4JS5A 3QXEB 5I2SA 3OBYA 2EPDA 2C0OA 4BE2A 4E47A 4JUVA 3FLGA 2KGTA 2AK5A 1LVKA 1KHIA 1IB8A 2V1RA 4ESRA 1EIFA 3VS2A 3OYMA 3QPHA 1SEMA 2BKDN 3ZL7C 1YITA 3HFOA 1HK9A 3QZ9B 3OSSC 4M75A 2YUPA 2ABLA 3EFSA 2COZA 3THKA 3QSUA 4N4HA 4M7DF 2ECZA 5KE2A 4JJBA 2VC8A 3MP6A 2RM4A 4A63B 1U8RA 4A4KA 3I9QA 4X34A 1VQKT 1UFFA 4M7DC 4LNPA 1MHNA 1PG5B 1HSQA 1VYTA 5I22A 1BB9A 3JCMe 2R5MA 2DRKA 3CPWA 2ROLA 1YN8A 2DBMA 3C95A 2F69A 2DE0X 1NJIC 4C92B 2KE9A 2QEXT 4Q5WA 1PHTA 3PMIA 1PKSA 1WZOA 1G3WA 2EQKA 3SWNB 2DNUA 3VS1A 5HCKA 2MPXC 2E6ZA 4F7UG 1WXTA 4RG8A 5CK9A 4ZGDB 1ZBXA 1KC8U 1NG2A 3FDRA 4L5GA 3OB9A 1UGSB 2QTVA 3A98A 4AFUC 3I55Q 5LJ5g 2KDSA 2EQJA 2O9SA 1D1AA 3M0RA 4EMKA 1VQ6Q 3LGFA 4XTZA 2R58A
chains in the Genus database with same CATH topology
2RNAA 2JS0A 1K1ZA 3ULRB 2DYBA 3VRZA 2J6FA 1AZGB 2GBQA 1SPKA 1U06A 1UDLA 2F2WA 2A37A 1UGVA 1M3CA 2I0NA 2O31A 1I1JA 3PVLA 2KXCA 2VKNA 2EYZA 4AG2C 2LMJA 3REAB 4RTZA 2MCNA 1H92A 4R0KA 1K9AA 2JS2A 2P4RA 4LE9A 4J9EA 1AEYA 1VA7A 3VS7A 4HVUA 1NLPC 2C0IA 2F2VA 2J6KA 4DEYA 2E5KA 1K0XA 2J6OA 1B3QA 2BZ8A 2JT4A 4IIOA 2JW4A 3REBB 1GL5A 1AWJA 1OPKA 1M8MA 5L23A 2OJ2A 1AWXA 1I0CA 3EG3A 2ED0A 4RTYA 4K11A 2LJ3A 2VVKA 3CQTA 1AVZC 1E6GA 4JJDA 1KFZA 2J06A 5GJWB 4D8DA 2W10A 4QT7A 3VS3A 2DL3A 4Y92A 1MUZA 2RQTA 2KRMA 2FO0A 4RTXA 1E6HA 2C0TA 2DM1A 4AFQC 2M51A 1YP5A 4X1VA 1X69A 2NWMA 2AKLA 1RI9A 4LUEA 2EVRA 1NM7A 3H41A 4ZNXA 2CT3A 2EYYA 1GCQC 1UTIA 3SHWA 2X3XD 2ROTA 1ZUUA 2KR3A 1UJYA 2DA9A 1SSHA 2LZ6B 2KT1A 2SRCA 4J9IA 1HD3A 2CREA 2FPFA 4F14A 1TUDA 4J9FA 4JZ3A 4HCKA 2GQIA 3NGPA 5IHKA 4OMQA 2KBTA 4OMNA 2YUOA 1PWTA 1W6XA 3UATA 4DEXA 1Y0MA 3I35A 4J9BA 1NEGA 2GTOA 3FJ5A 3VS6A 2DL5A 1JXOA 1QWFA 4JJCA 4JZ4A 4F16A 2DJQA 2L0AA 1MV3A 2LQWA 2RQVA 5IHNA 2AZVA 4GLMA 4RUGA 2DL4A 1RUWA 3GBQA 5FWBA 1RLPC 1UUEA 1GRIA 2PNIA 1GBRA 1AD5A 1T3SA 2KRNA 2A08A 1K4US 2HEQA 1N5ZA 4RTUA 3EHQA 2LP5A 2VWFA 2FRWA 3TSZA 3VS4A 1UG1A 2L3SA 2DRMA 2AKKA 1EFNA 1JO8A 1OPLA 1UE9A 2YDLA 2KT8A 3QWXX 1PKTA 3M0UA 2X3WD 2RQWA 2RQRA 2YUNA 2HDAA 4AFSC 2B86A 3PVQA 3I5SA 1H3HA 2BZYA 2RN8A 4M4ZA 1XOVA 3RBBB 1FMKA 1WA7A 1OV3A 1CSKA 2F2XA 4GBQA 1YWOA 2EGEA 2RPNA 2KRSA 2KXDA 2DILA 2EQIA 1UHCA 1WLPB 2H8HA 3JV3A 5IH2A 2LQNA 1LCKA 1AWWA 2RQUA 2DX1A 1NEBA 3NMZC 2G6FX 4OMOA 4CC7A 1X2QA 1ZX6A 3UF4A 2KYMA 4Z89A 2YSQA 3M0QA 2KYBA 1HJDA 2J7IA 2KEAA 3KFVA 4E6RA 1VYVA 2YUQA 2D1XA 3R6NA 1QWEA 2CDTA 3IQLA 4AFZC 1X6BA 1QKXA 4JPBW 2O9VA 1AOJA 4J9GA 2V1QA 1NYFA 1PNJA 2EGAA 3VRYA 1GFDA 2DL8A 1Z9QA 3EG2A 1WFWA 4FSSA 5EC7A 1B07A 2FG0A 1M30A 1WIEA 2D8HA 4J9HA 1SHFA 4AG1C 1ZLMA 2XMFA 4CC4B 4ORZA 2DLPA 3U23A 4LUDA 1GBQA 1ABQA 2EKHA 1YWPA 1GCQA 1ARKA 5IXBA 2L3PA 2K2MA 2BZXA 1WI7A 4Z88A 1PRLC 3NPFA 3M0TA 1UHFA 2CSQA 2KNBB 1Y57A 1SRLA 2JM9A 3EG0A 2EYWA 1M3AA 4CC3A 3LH5A 1KJWA 3VS5A 5ECAA 1E7OA 1ABOA 2A36A 1H8KA 1G83A 5GJVB 4OMPA 4J9CA 2MOXA 1GFCA 1MV0B 2M0YA 3I5RA 1OOTA 4J9DA 1PRMC 1S1NA 2K79A 3M0SA 2ED1A 1BK2A 2D8JA 4OMLA 4KRTA 2GNCA 1W70A 1T0JA 1U3OA 2JXBA 5I11A 1I07A 3EGUA 1BU1A 1M27C 3NHNA 3TVTA 3O5ZA 4HVVA 1UECA 2K3BA 4RTTA 2RF0A 1X27A 1CKAA 1IO6A 4CC2A 2LJ0A 2FEIA 2NUZA 2JM8A 2AZSA 4Z8AA 1A0NB 3H0IA 1AWOA 3H0HA 1WYXA 1YNZA 5IXFA 1WDXA 1FYNA 2HSPA 1CKBA 2GGRA 2DBKA 2CH4W 2L2PA 2CUBA 2JTEA 1VYUA 2JMCA 2GTJA 3TSWA 2CH4A 1WXUA 1KSWA 2EBPA 2DVJA 1JEGA 1G2BA 2DF6A 1TG0A 2J05A 2L3QA 3SEMA 1T0HA 2PTKA 5FW9A 2ENMA 4IIMA 4F17A 3EHRA 1ZSGA 1Z9ZA 1M3BA 2KROA 2FPDA 2LJ1A 4HXJA 2OI3A 2DL7A 2EPDA 2LX7A 2K6DA 2A28A 1JU5C 2C0OA 1GCPA 1UJ0A 2BTTA 1SRMA 1NLOC 2KGTA 2AK5A 4RTWA 3PE0A 1ZUYA 2DMOA 2ESWA 2SEMA 2V1RA 4ESRA 1OEBA 3VS2A 1SEMA 3ZL7C 5FWCA 2FPEA 2PZ1A 2YUPA 2ABLA 1AZEA 4LN2A 3THKA 2EW3A 3VS0A 2CSIA 3UA6A 1BBZA 2ECZA 1TUCA 3C0CA 4OMMA 1KIKA 2LCSA 4JJBA 3UA7A 3M0PA 5IHIA 4A63B 1T3LA 1W1FA 2D0NA 4D8KA 1NYGA 2HBWA 3EG1A 3I9QA 2LNHB 2K7AA 1WX6A 1V1CA 1UFFA 4RTVA 1X43A 2O2OA 4LNPA 4HVWA 1HSQA 1VYTA 5I22A 1QCFA 1BB9A 3H0FA 1QLYA 2QDLA 2YT6A 1JXMA 2DRKA 2O88A 4EIKA 2EGCA 2ROLA 1YN8A 2DBMA 2W0ZA 2IIMA 1K0SA 1X6GA 3RNJA 2DE0X 2HCKA 1U5SA 2KE9A 2EYXA 1PHTA 1JQQA 1PKSA 1YCSB 2DNUA 3VS1A 5HCKA 2JMAA 2RMOA 2MIOA 1WXTA 4WCIA 2CUDA 1J3TA 1K76A 1ZBJA 1NG2A 3QWYA 1ZUKA 1RLQC 3A98A 2OAWA 4AFUC 1X2KA 1WXBA 1QKWA 2O9SA 2CT4A 1SHGA 3M0RA 2K9GA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNA A;  2JS0 A;  1K1Z A;  3ULR B;  2DYB A;  3VRZ A;  2J6F A;  1AZG B;  2GBQ A;  1SPK A;  1U06 A;  1UDL A;  2F2W A;  2A37 A;  1UGV A;  1M3C A;  2I0N A;  2O31 A;  1I1J A;  3PVL A;  2KXC A;  2VKN A;  2EYZ A;  4AG2 C;  2LMJ A;  3REA B;  4RTZ A;  2MCN A;  1H92 A;  4R0K A;  1K9A A;  2JS2 A;  2P4R A;  4LE9 A;  4J9E A;  1AEY A;  1VA7 A;  3VS7 A;  4HVU A;  1NLP C;  2C0I A;  2F2V A;  2J6K A;  4DEY A;  2E5K A;  1K0X A;  2J6O A;  1B3Q A;  2BZ8 A;  2JT4 A;  4IIO A;  2JW4 A;  3REB B;  1GL5 A;  1AWJ A;  1OPK A;  1M8M A;  5L23 A;  2OJ2 A;  1AWX A;  1I0C A;  3EG3 A;  2ED0 A;  4RTY A;  4K11 A;  2LJ3 A;  2VVK A;  3CQT A;  1AVZ C;  1E6G A;  4JJD A;  1KFZ A;  2J06 A;  5GJW B;  4D8D A;  2W10 A;  4QT7 A;  3VS3 A;  2DL3 A;  4Y92 A;  1MUZ A;  2RQT A;  2KRM A;  2FO0 A;  4RTX A;  1E6H A;  2C0T A;  2DM1 A;  4AFQ C;  2M51 A;  1YP5 A;  4X1V A;  1X69 A;  2NWM A;  2AKL A;  1RI9 A;  4LUE A;  2EVR A;  1NM7 A;  3H41 A;  4ZNX A;  2CT3 A;  2EYY A;  1GCQ C;  1UTI A;  3SHW A;  2X3X D;  2ROT A;  1ZUU A;  2KR3 A;  1UJY A;  2DA9 A;  1SSH A;  2LZ6 B;  2KT1 A;  2SRC A;  4J9I A;  1HD3 A;  2CRE A;  2FPF A;  4F14 A;  1TUD A;  4J9F A;  4JZ3 A;  4HCK A;  2GQI A;  3NGP A;  5IHK A;  4OMQ A;  2KBT A;  4OMN A;  2YUO A;  1PWT A;  1W6X A;  3UAT A;  4DEX A;  1Y0M A;  3I35 A;  4J9B A;  1NEG A;  2GTO A;  3FJ5 A;  3VS6 A;  2DL5 A;  1JXO A;  1QWF A;  4JJC A;  4JZ4 A;  4F16 A;  2DJQ A;  2L0A A;  1MV3 A;  2LQW A;  2RQV A;  5IHN A;  2AZV A;  4GLM A;  4RUG A;  2DL4 A;  1RUW A;  3GBQ A;  5FWB A;  1RLP C;  1UUE A;  1GRI A;  2PNI A;  1GBR A;  1AD5 A;  1T3S A;  2KRN A;  2A08 A;  1K4U S;  2HEQ A;  1N5Z A;  4RTU A;  3EHQ A;  2LP5 A;  2VWF A;  2FRW A;  3TSZ A;  3VS4 A;  1UG1 A;  2L3S A;  2DRM A;  2AKK A;  1EFN A;  1JO8 A;  1OPL A;  1UE9 A;  2YDL A;  2KT8 A;  3QWX X;  1PKT A;  3M0U A;  2X3W D;  2RQW A;  2RQR A;  2YUN A;  2HDA A;  4AFS C;  2B86 A;  3PVQ A;  3I5S A;  1H3H A;  2BZY A;  2RN8 A;  4M4Z A;  1XOV A;  3RBB B;  1FMK A;  1WA7 A;  1OV3 A;  1CSK A;  2F2X A;  4GBQ A;  1YWO A;  2EGE A;  2RPN A;  2KRS A;  2KXD A;  2DIL A;  2EQI A;  1UHC A;  1WLP B;  2H8H A;  3JV3 A;  5IH2 A;  2LQN A;  1LCK A;  1AWW A;  2RQU A;  2DX1 A;  1NEB A;  3NMZ C;  2G6F X;  4OMO A;  4CC7 A;  1X2Q A;  1ZX6 A;  3UF4 A;  2KYM A;  4Z89 A;  2YSQ A;  3M0Q A;  2KYB A;  1HJD A;  2J7I A;  2KEA A;  3KFV A;  4E6R A;  1VYV A;  2YUQ A;  2D1X A;  3R6N A;  1QWE A;  2CDT A;  3IQL A;  4AFZ C;  1X6B A;  1QKX A;  4JPB W;  2O9V A;  1AOJ A;  4J9G A;  2V1Q A;  1NYF A;  1PNJ A;  2EGA A;  3VRY A;  1GFD A;  2DL8 A;  1Z9Q A;  3EG2 A;  1WFW A;  4FSS A;  5EC7 A;  1B07 A;  2FG0 A;  1M30 A;  1WIE A;  2D8H A;  4J9H A;  1SHF A;  4AG1 C;  1ZLM A;  2XMF A;  4CC4 B;  4ORZ A;  2DLP A;  3U23 A;  4LUD A;  1GBQ A;  1ABQ A;  2EKH A;  1YWP A;  1GCQ A;  1ARK A;  5IXB A;  2L3P A;  2K2M A;  2BZX A;  1WI7 A;  4Z88 A;  1PRL C;  3NPF A;  3M0T A;  1UHF A;  2CSQ A;  2KNB B;  1Y57 A;  1SRL A;  2JM9 A;  3EG0 A;  2EYW A;  1M3A A;  4CC3 A;  3LH5 A;  1KJW A;  3VS5 A;  5ECA A;  1E7O A;  1ABO A;  2A36 A;  1H8K A;  1G83 A;  5GJV B;  4OMP A;  4J9C A;  2MOX A;  1GFC A;  1MV0 B;  2M0Y A;  3I5R A;  1OOT A;  4J9D A;  1PRM C;  1S1N A;  2K79 A;  3M0S A;  2ED1 A;  1BK2 A;  2D8J A;  4OML A;  4KRT A;  2GNC A;  1W70 A;  1T0J A;  1U3O A;  2JXB A;  5I11 A;  1I07 A;  3EGU A;  1BU1 A;  1M27 C;  3NHN A;  3TVT A;  3O5Z A;  4HVV A;  1UEC A;  2K3B A;  4RTT A;  2RF0 A;  1X27 A;  1CKA A;  1IO6 A;  4CC2 A;  2LJ0 A;  2FEI A;  2NUZ A;  2JM8 A;  2AZS A;  4Z8A A;  1A0N B;  3H0I A;  1AWO A;  3H0H A;  1WYX A;  1YNZ A;  5IXF A;  1WDX A;  1FYN A;  2HSP A;  1CKB A;  2GGR A;  2DBK A;  2CH4 W;  2L2P A;  2CUB A;  2JTE A;  1VYU A;  2JMC A;  2GTJ A;  3TSW A;  2CH4 A;  1WXU A;  1KSW A;  2EBP A;  2DVJ A;  1JEG A;  1G2B A;  2DF6 A;  1TG0 A;  2J05 A;  2L3Q A;  3SEM A;  1T0H A;  2PTK A;  5FW9 A;  2ENM A;  4IIM A;  4F17 A;  3EHR A;  1ZSG A;  1Z9Z A;  1M3B A;  2KRO A;  2FPD A;  2LJ1 A;  4HXJ A;  2OI3 A;  2DL7 A;  2EPD A;  2LX7 A;  2K6D A;  2A28 A;  1JU5 C;  2C0O A;  1GCP A;  1UJ0 A;  2BTT A;  1SRM A;  1NLO C;  2KGT A;  2AK5 A;  4RTW A;  3PE0 A;  1ZUY A;  2DMO A;  2ESW A;  2SEM A;  2V1R A;  4ESR A;  1OEB A;  3VS2 A;  1SEM A;  3ZL7 C;  5FWC A;  2FPE A;  2PZ1 A;  2YUP A;  2ABL A;  1AZE A;  4LN2 A;  3THK A;  2EW3 A;  3VS0 A;  2CSI A;  3UA6 A;  1BBZ A;  2ECZ A;  1TUC A;  3C0C A;  4OMM A;  1KIK A;  2LCS A;  4JJB A;  3UA7 A;  3M0P A;  5IHI A;  4A63 B;  1T3L A;  1W1F A;  2D0N A;  4D8K A;  1NYG A;  2HBW A;  3EG1 A;  3I9Q A;  2LNH B;  2K7A A;  1WX6 A;  1V1C A;  1UFF A;  4RTV A;  1X43 A;  2O2O A;  4LNP A;  4HVW A;  1HSQ A;  1VYT A;  5I22 A;  1QCF A;  1BB9 A;  3H0F A;  1QLY A;  2QDL A;  2YT6 A;  1JXM A;  2DRK A;  2O88 A;  4EIK A;  2EGC A;  2ROL A;  1YN8 A;  2DBM A;  2W0Z A;  2IIM A;  1K0S A;  1X6G A;  3RNJ A;  2DE0 X;  2HCK A;  1U5S A;  2KE9 A;  2EYX A;  1PHT A;  1JQQ A;  1PKS A;  1YCS B;  2DNU A;  3VS1 A;  5HCK A;  2JMA A;  2RMO A;  2MIO A;  1WXT A;  4WCI A;  2CUD A;  1J3T A;  1K76 A;  1ZBJ A;  1NG2 A;  3QWY A;  1ZUK A;  1RLQ C;  3A98 A;  2OAW A;  4AFU C;  1X2K A;  1WXB A;  1QKW A;  2O9S A;  2CT4 A;  1SHG A;  3M0R A;  2K9G A;  2FRY A; 
#chains in the Genus database with same CATH topology
 5GAO m;  2EYQ A;  2JS0 A;  3URG A;  3JB9 F;  1UGR B;  2JZ2 A;  3HRT A;  2VYT A;  2KQW A;  2HL5 C;  3OA6 A;  1VQO Q;  1ZSZ A;  4E2F B;  5GAO r;  2VGM A;  5FRO A;  3GPL A;  1NPP A;  2O31 A;  1B34 B;  5LJ5 f;  2LMJ A;  3RR6 A;  2CYZ B;  3FJP A;  9ATC B;  5L8R E;  2P4R A;  4LE9 A;  5KYN A;  2NUP A;  1K73 U;  1BKB A;  1M1G A;  3CCJ Q;  2L5Q A;  5DY9 A;  4TVR A;  1YJW Q;  2C0I A;  2J6K A;  2QA4 Q;  2C06 A;  4EDU A;  2JW4 A;  2QG9 B;  1AWJ A;  2DAQ A;  4J5Y A;  1W2B A;  2DET A;  2A3L A;  4M7A D;  4FCY A;  4C0G A;  4XAX B;  5GJW B;  2F1L A;  1BCO A;  1YI2 Q;  1OZ3 A;  4M75 G;  4XK8 E;  2QGG A;  1SF9 A;  1QP3 A;  2MWO A;  4OGE A;  1LJO A;  2DM1 A;  2DJZ A;  2NWM A;  1NJI R;  3CC4 A;  1TXQ A;  4LUE A;  3RIR A;  2CZ1 B;  3H41 A;  2X4Y A;  4M77 D;  4XTX A;  1RAB B;  1RI0 A;  3EGX B;  1SKU B;  2X3X D;  1RAA B;  2DA9 A;  5KYU B;  1SSH A;  2LZ6 B;  3WXM B;  3G71 A;  3L2V A;  1FXX A;  2XDP A;  4KT0 E;  4J9I A;  1WPY A;  2FYK A;  3D7S B;  4JRI A;  5I2M A;  3VUB A;  3BFM A;  4JZ3 A;  2CZ0 B;  3JCM b;  3KXT A;  2GQI A;  1X01 A;  4OMQ A;  4OMN A;  2LCC A;  3QYG B;  1PWT A;  4BE0 A;  3UAT A;  5KH6 A;  3FJ5 A;  4A4G A;  2VXE A;  3VS6 A;  3DLM A;  1JXO A;  4F16 A;  4MML A;  4LDY A;  4N4G A;  1D1C A;  3VJP A;  2LQW A;  3OW2 A;  3CCL T;  1G3T A;  4A4H A;  5J39 A;  3CCS A;  2AZV A;  4FYV B;  3CCE Q;  1RUW A;  3OYG A;  2EQU A;  1GBR A;  1K4U S;  3LX7 A;  2QQA A;  2E1H A;  3E9G A;  4RTU A;  2VWF A;  2QI2 A;  3DLL A;  2AKK A;  4EMK C;  1EFN A;  3OYN A;  1JO8 A;  1OPL A;  3MEU A;  2GF7 A;  3RES A;  4X9D A;  3M0U A;  3I56 A;  1M1K U;  2E65 A;  4AFS C;  1D1B A;  4M78 E;  3PVQ A;  3OYK A;  3CC2 A;  1TOV A;  1QW1 A;  3RBB B;  4A53 A;  5KYW B;  1D0Y A;  5CQY A;  1O9S A;  3X25 B;  3OYA A;  2VGN A;  2KRS A;  1P92 A;  4A4F A;  2EQI A;  1UHC A;  3JV3 A;  1SG5 A;  2F5K A;  4OVA A;  4C92 A;  1LCK A;  2E3I A;  2DX1 A;  3WVE B;  1VQK Q;  1Q82 C;  1G3Y A;  1HJD A;  4RG2 A;  2KEA A;  3KFV A;  4E6R A;  1YIJ T;  2HKN A;  1VQL T;  1MMN A;  2HKQ B;  3S3M A;  1AOJ A;  2V1Q A;  4BI4 A;  1D3B B;  1TUG B;  2QAZ A;  1PNJ A;  2EGA A;  1YJN A;  4FM4 B;  5C0M A;  3VU3 C;  2LVM A;  3EG2 A;  2QEX Q;  1IRE B;  4FSS A;  3CMA T;  2H3E B;  1OQK A;  1M5Q 1;  4FT4 A;  1PD0 A;  1SHF A;  4AG1 C;  4OMF B;  3LLR A;  1M9S A;  1RAF B;  3A8H B;  4O6J A;  2EKH A;  1M2V B;  2MI6 A;  1ARK A;  1BYM A;  1VQ9 T;  4M78 F;  3QO3 A;  4L6V 5;  1WI7 A;  4C92 E;  1QVG P;  1V76 A;  4IUR A;  3M0T A;  1UHF A;  2CSQ A;  1Y57 A;  1UEB A;  1D09 B;  2QYZ A;  1M3A A;  4XTW A;  1IGQ A;  2FHD A;  4ZTF A;  2RB6 A;  2YRV A;  1QVG S;  4M78 C;  1HXD A;  3OYE A;  3O8V A;  5ECA A;  1VQP T;  4PJO G;  2MOX A;  3JCM X;  2AT1 B;  4NOY A;  1Q7Y C;  3I5R A;  4QVZ A;  2ZPE B;  3GLX A;  3M0S A;  4FYX B;  2V26 A;  4FIB A;  2DXB A;  2GNC A;  4M75 B;  4BE1 A;  4II1 A;  3BDU A;  1ZHI A;  2A7Y A;  2JXB A;  8AT1 B;  4PK4 A;  1NE8 A;  4QVC A;  2OTL A;  3OS5 A;  3TVT A;  1VQN A;  2K3B A;  4RTT A;  3C4S A;  3PGG A;  2VXF A;  1YFN A;  2DEU A;  4ME7 A;  3L2Z A;  2FZG B;  4Z8A A;  1KHC A;  3M4Y A;  1WHK A;  1FMV A;  4DBQ A;  1RAD B;  1VQ8 A;  2OAU A;  5A0G A;  2K4Y A;  4CRI A;  4PJN A;  1VYU A;  1Q82 R;  1RL2 A;  2O4X B;  2FZC B;  1N8R C;  2DVJ A;  3CCQ A;  1JEG A;  4C92 F;  1G2B A;  1MGQ A;  3S3O A;  2DF6 A;  5GAN 3;  4E7J A;  1YJ9 A;  2QK0 A;  2M0O A;  4IIM A;  4F17 A;  3JCM J;  3OMG A;  3M5A A;  1M90 U;  2XKO C;  2KRO A;  2DFU A;  4C92 C;  5KCO A;  1G3S A;  1BI2 A;  5LJ3 g;  2LX7 A;  2K6D A;  4E7K A;  1JU5 C;  1KD1 C;  1GCP A;  3SWN C;  2BTT A;  2P4T A;  4RTW A;  4LDW A;  1C6V X;  2RJD A;  4BUG A;  4LDU A;  2HSE B;  3FEO A;  1TH7 A;  3CME T;  1VQM A;  3L42 A;  3OYY A;  5CR2 A;  2EW3 A;  1R77 A;  3UA6 A;  1ZSZ B;  3CCR A;  3CCV A;  1TUC A;  4OMM A;  1KIK A;  5LJ3 f;  2QQR A;  3M0P A;  2MWP A;  2QAS A;  4D6W A;  2XIC A;  3A8O B;  1JJ2 P;  1T3L A;  1W1F A;  2D0N A;  1NYG A;  2LNH B;  2ZPF B;  1V1C A;  2RI3 A;  2ZCF B;  1Q7Y R;  4DBF A;  3CCL Q;  1QCF A;  5M9O A;  1QLY A;  1JJ2 S;  2NUP B;  2QDL A;  1B7T A;  4J7F A;  3Q1J A;  3QYH B;  2O88 A;  4EIK A;  4ANJ A;  1R8O B;  1K8A U;  3RNJ A;  2QGF B;  1U5S A;  3HTR A;  2LTO A;  1FMW A;  3L2Q A;  3G6E T;  4DOW A;  4GLK A;  3QJ6 A;  1JQQ A;  2XDD A;  4F7U A;  1RAH B;  5D7U A;  1G8X A;  3CD6 T;  5IN1 A;  4L59 A;  2LX9 A;  2X4J A;  2CP3 A;  4MZM A;  3UDC A;  3T9N A;  2CUD A;  2ZPG B;  1ZBJ A;  2X51 A;  3V8L A;  1QCN A;  3EGD A;  2E64 A;  4F04 B;  4KGZ B;  3FC3 A;  3VYG A;  1VQ7 A;  2CGH A;  1N8R R;  1PD1 A;  2EJ9 A;  2FVU A;  2YHT A;  2MYS A;  2DVE A;  3BW1 A;  3M9Q A;  3ULR B;  4OP0 A;  1YIT T;  3E19 A;  1UDL A;  1U06 A;  2YLC A;  3MKD A;  2M16 A;  1K9M C;  2Y4Y A;  1UGV A;  1M2V A;  1YIJ Q;  1I1J A;  1KD1 R;  3JRZ A;  2QQ9 A;  1VQL Q;  4AG2 C;  4F7U E;  2HD0 A;  4BI3 A;  5FRM A;  3MCA B;  1YHQ A;  4RTZ A;  1WHL A;  1ZA1 B;  3JB9 J;  2GCX A;  4J9E A;  4KGV B;  1TSF A;  3FB9 A;  5CKF A;  3MEV A;  1AEY A;  2YLB A;  4PJL A;  1NLP C;  3CMA Q;  3JCM d;  2D9T A;  5GMK j;  4B9W A;  2R5A A;  1B3Q A;  5GAM e;  4IIO A;  3ASK A;  2JTF A;  1S72 A;  2DTO A;  5GAO p;  4IUP A;  1H64 1;  3AT1 B;  1I0C A;  3SFM A;  2ED0 A;  1VQ9 Q;  2VVK A;  3CQT A;  2IVW A;  1AVZ C;  1E6G A;  4JJD A;  2JN0 A;  5GMK h;  3RUX A;  2CP7 A;  2J06 A;  4ZGJ B;  1GXI E;  4FW2 A;  2EIF A;  2DL3 A;  4Y92 A;  4M7A G;  2RQT A;  2KRM A;  3LWH A;  1E6H A;  1VQP Q;  2C0T A;  2ZAE A;  3JCM Q;  4AFQ C;  5FU6 C;  4X1V A;  1X75 C;  2YXY A;  3MO8 A;  5KCH A;  3F70 A;  3M59 A;  4ZNX A;  2CT3 A;  2AHJ B;  3H9N A;  3QKJ A;  3CCE A;  3X26 B;  5CKD A;  5GAM j;  4Y91 A;  3QDR B;  2KVQ G;  1UJY A;  4M77 G;  2SRC A;  2K5I A;  2RHI A;  2KMT A;  2LQ8 A;  2O4X A;  3H8Z A;  1QVF P;  2GFA A;  4LDV A;  1I81 A;  1X6O A;  4F7U F;  5IHK A;  2KBT A;  4BAC A;  3I35 A;  3M56 A;  1QVF S;  4M75 E;  1NJI U;  4PJM A;  3QG1 A;  1QWF A;  3CCU A;  4JZ4 A;  2EWN A;  2XU8 A;  3S6W A;  4HKE A;  2D6F A;  4Y28 E;  3JSC A;  1IXD A;  3EAE A;  3E2U A;  4R56 A;  3EG9 A;  2DL4 A;  1K9M R;  5FU7 B;  1ACM B;  5FRN A;  2PNI A;  4AT1 B;  2Y4X A;  1MMA A;  2EQM A;  3EHQ A;  2LP5 A;  3TSZ A;  4QQG A;  1BI0 A;  3CXC A;  3JAM E;  1UE9 A;  3QII A;  3ZFJ A;  4JLG A;  1PKT A;  2PQW A;  4FSX A;  4A54 A;  8ATC B;  4ZN3 A;  2DPP B;  2YUN A;  2HDA A;  3PIO A;  1Q86 C;  3OS1 A;  3OYC A;  1BI3 A;  5LJ3 e;  4JDS A;  4E7I A;  1HYO A;  2RJE A;  3CC4 T;  1XOV A;  4XQ3 A;  1OV3 A;  2F2X A;  3HP9 A;  1K73 C;  3CME Q;  3C94 A;  3RMS A;  3L2U A;  3JCM P;  2WSC E;  3CC7 A;  4HCC A;  5GAN d;  2DIL A;  4HA8 A;  3G71 T;  3VV0 A;  5GAO n;  3PMT A;  1IZ6 A;  1NEB A;  2DD4 A;  3NMZ C;  1X2Q A;  2E10 A;  3UF4 A;  4M75 F;  2PUK B;  2DZ9 A;  2YSQ A;  3M0Q A;  1RAE B;  4C8Q G;  2YUQ A;  3R6N A;  2DIQ A;  3FIF A;  3P8D A;  4RKU E;  1TS9 A;  3GNF B;  1D0X A;  1QKX A;  4M75 C;  2O9V A;  4J9G A;  3L1A A;  1GFD A;  2DL8 A;  3HFN A;  5C6S A;  3J81 E;  3CCS T;  1VQ5 A;  4PNO A;  4J9H A;  2XMF A;  4M7D D;  4ORZ A;  5GAN e;  3CD6 Q;  2HAX A;  4LUD A;  1GBQ A;  1Y7X A;  4P5N A;  4OB1 B;  1YWP A;  4PJJ A;  1GCQ A;  5IXB A;  3NTI A;  2BIV A;  2K2M A;  5GAN 7;  2BZX A;  1N6A A;  2DXU A;  1MMG A;  1PRL C;  2MK5 A;  5HKC A;  1LPL A;  3OYD A;  3I56 T;  4WF2 A;  3CBO A;  3OY9 A;  4PJO A;  3PIP A;  1E7O A;  2DIG A;  3CC2 T;  3V7R A;  1G83 A;  5GJV B;  4FW1 A;  3RMQ A;  2JVV A;  4IUV A;  3J80 E;  3QDF A;  1YIT Q;  3LGL A;  4J9D A;  5GMK m;  1W4S A;  2LT4 A;  3MHX A;  5GAN j;  2CZ6 B;  4XTY A;  4OML A;  1BCM A;  4OF1 A;  1Q86 R;  3NFC A;  1T0J A;  4M7A B;  3OS0 A;  3ZEH A;  5FU6 B;  1I07 A;  2QQB A;  2LRQ A;  3NHN A;  3LH0 A;  4MMK A;  2VB6 A;  1VIE A;  1K73 R;  4LXC A;  1X27 A;  2YRD A;  1CKA A;  1IO6 A;  5KYX A;  1I5L A;  1PSF A;  3MEW A;  2Z0W A;  2ZPI B;  3V7S A;  4J6X A;  1F1B B;  1MNE A;  1ZSZ C;  4ZGE B;  5CKE A;  5HK0 A;  3JB9 D;  1WYX A;  2OTJ A;  1WDX A;  1YJN T;  4KGX B;  1FYN A;  4PJO E;  1CKB A;  2BE7 D;  2EJG A;  2DBK A;  2CH4 W;  3ZBD A;  2JTE A;  2L8D A;  3L2R A;  2E41 A;  3V8J A;  1KG1 A;  5CKH A;  3BY7 A;  4F7U B;  1TG0 A;  3OYH A;  2J05 A;  1YBY A;  2X4X A;  3SEM A;  2PTK A;  2R57 A;  4C8Q D;  3G4S A;  4PFP A;  3EHR A;  4ZTJ A;  2FPD A;  2LJ1 A;  4HXJ A;  2OI3 A;  4AMC A;  2A28 A;  2RO0 A;  3EGD B;  2KI7 A;  3CBM A;  1UJ0 A;  2RJF A;  2HNI A;  3PE0 A;  1Q82 U;  2K5L A;  2QXF A;  1D0Z A;  4N4I A;  1VQ4 A;  1AZE A;  2ZGW A;  4LN2 A;  4DQ2 A;  3VS0 A;  2CSI A;  4HT8 A;  3C0C A;  5GAO q;  1KQS P;  2ZPH B;  2LCS A;  3RKW A;  3UA7 A;  1LNX A;  3GP8 A;  2OTL T;  2RHY A;  2RK1 A;  4J6Y A;  4D8K A;  1VQN T;  2HBW A;  3EG1 A;  2RHX A;  5EG2 A;  3V7C A;  1WX6 A;  2HQE A;  1Q81 U;  2O2O A;  4V2S A;  1KQS S;  3MP8 A;  2LCL A;  4JS4 A;  4PJO F;  1EX4 A;  2RJC A;  1JXM A;  2YT6 A;  3OYI A;  4PKC C;  2H3J A;  2X35 A;  4E7S A;  3CCM A;  2W0Z A;  1PCX A;  5LJ5 e;  1K0S A;  4N0A A;  1X6G A;  1M4Z A;  1VQ8 T;  3QUI A;  1DJ7 B;  3CPW P;  3RKY A;  4PJO C;  2QQS A;  2EYX A;  3WVD B;  3FRN A;  2COW A;  2E70 A;  2RI2 A;  3CBP A;  3RKX A;  1RAG B;  5CIU A;  3CPW S;  3CCQ T;  4B6M A;  2JMA A;  3NTK A;  4XTU A;  3J7A F;  1QVP A;  1YJ9 T;  2FZK B;  4C5E A;  1Q7Y U;  3GIB A;  3CC4 Q;  3DB3 A;  2OAW A;  4HT9 A;  2O01 E;  3MP1 A;  5CO7 A;  4BY6 B;  1X2K A;  1WXB A;  3M54 A;  1QKW A;  2CT4 A;  1SHG A;  2FRY A;  3G71 Q;  5LJ5 j;  2KY9 A;  2RNA A;  2K3X A;  3EFR A;  1K1Z A;  5GAN 5;  4LD9 K;  2DYB A;  3VRZ A;  2J6F A;  2L89 A;  1SPK A;  1VQM T;  3OMC A;  4BD3 A;  2RD1 A;  3OS2 A;  2A37 A;  4OGC A;  1M3C A;  3CCR T;  3CCV T;  4PL6 A;  4DBR A;  2VKN A;  2EYZ A;  3MJX A;  3VYH B;  1BIA A;  1EZZ B;  3HL8 A;  3REA B;  2MCN A;  1H92 A;  4R0K A;  1K9A A;  3H6Z A;  5CCA A;  3OYL A;  4HVU A;  3CCS Q;  1M90 C;  4DEY A;  1K0X A;  2J6O A;  2HL3 A;  1BIB A;  2V8J A;  2JT4 A;  3OYJ A;  3EG9 B;  3PTA A;  1GL5 A;  4KUL A;  1OZ2 A;  2COY A;  2L3R A;  2RA2 A;  1AWX A;  2RHU A;  4RTY A;  4K11 A;  2WSF E;  2RI5 A;  3SB2 A;  2D0Q B;  1KD1 U;  1KFZ A;  4M7A A;  1W2B P;  3MPU B;  3VS3 A;  3LYI A;  5FU7 C;  4E7L A;  3M53 A;  2PVD B;  5DM7 R;  1MUZ A;  2CP6 A;  2FO0 A;  2HZY A;  4RTX A;  4HCB A;  1M8V A;  1QQJ A;  3CC2 Q;  1W2B S;  2M51 A;  1YP5 A;  1X69 A;  3A5Z B;  5HY6 A;  1RI9 A;  1NM7 A;  4FL6 A;  4JRK A;  2EYY A;  3OSV A;  4LDX A;  4O5V A;  1VQ7 T;  1FWZ A;  1UTI A;  3SHW A;  3I55 A;  4M77 A;  4QW2 A;  1ZUU A;  1VQ6 A;  4HCZ A;  2FPF A;  4M78 D;  1K8A C;  3HKS A;  4F14 A;  2PVO B;  4HCK A;  1VQO A;  3NGP A;  5A0D A;  4N0A C;  2NUT A;  2YUO A;  1W6X A;  4EMH A;  4DEX A;  4J9B A;  1NEG A;  1OX8 A;  5AT1 B;  1M2O A;  4M7A E;  2XG8 D;  1YHQ T;  5A0L A;  2MMP A;  4JJC A;  1OU9 A;  1YJN Q;  2CS7 A;  2L0A A;  5CVI A;  3ER0 A;  3CCJ A;  5IAY A;  4FYY B;  1YJW A;  1WQ7 A;  4OB0 B;  3P8H A;  3GBQ A;  5FWB A;  1RLP C;  5GAM d;  2QA4 A;  3OW2 P;  1U1S A;  4ELZ C;  1QMC A;  5A2Q E;  1S72 T;  1AD5 A;  1T3S A;  2KRN A;  2A08 A;  1N5Z A;  3EFO A;  1ZA2 B;  4M77 E;  2FRW A;  1UG1 A;  3OW2 S;  3MEA A;  2KT8 A;  3GF5 A;  4OB3 B;  1N9S A;  5D6Y A;  1M90 R;  2PU9 B;  2RQW A;  2RQR A;  1YI2 A;  1H3Z A;  3I5S A;  1H3H A;  3JCM W;  2E3H A;  1V29 B;  3INZ A;  4PJO B;  2DKG A;  2RN8 A;  2JNG A;  4M4Z A;  3LWI A;  1XJW B;  4E7Z A;  3JB9 H;  1LOJ A;  1KK7 A;  1K9M U;  1CSK A;  4X9C A;  2K5F A;  1YWO A;  2M02 A;  3CCE T;  3CEY A;  2I2L A;  2KXD A;  2XID A;  4VUB A;  4C92 D;  1WLP B;  2H8H A;  5IH2 A;  2LQN A;  3OBW A;  2E12 A;  2OTL Q;  2RQU A;  2P84 A;  1VQN Q;  4OMO A;  4XU1 A;  4CC7 A;  1ZX6 A;  4C8Q A;  1R0B G;  2KYM A;  1ZQ1 A;  3A1P A;  3CPF A;  2KYB A;  4XU0 A;  4M7A F;  2J7I A;  1VYV A;  1QWE A;  2CDT A;  3IQL A;  3P8B B;  2HBP A;  1X6B A;  1MMD A;  1U1T A;  5KYX B;  2DZC A;  3CCU T;  5KYY A;  4M7A C;  3HPW A;  1VQ8 Q;  1WHJ A;  3VRY A;  5D6W A;  4A4E A;  3M4G A;  1K8A R;  1WFW A;  5AYF A;  1B07 A;  1KQS A;  4M77 F;  2FG0 A;  1M30 A;  2EFI A;  4JLI A;  5J3B A;  1XNI A;  2M9U A;  4CC4 B;  3EH1 A;  3CCQ Q;  1I5O B;  2DLP A;  3U23 A;  2WSE E;  2OX7 A;  2EJF A;  2E5Q A;  5GMK i;  1YJ9 Q;  2DD5 A;  1ABQ A;  1QVG A;  3R6O A;  4M77 C;  4WTO B;  4M7D G;  3UT1 A;  2F5T X;  2CP0 A;  2ZZD A;  2IG0 A;  2DTI A;  4C5I A;  2KNB B;  2JM9 A;  3RDV A;  4C8Q E;  3LH5 A;  4CC3 A;  5GAM h;  5LJ3 d;  3VS5 A;  3HSB A;  2A36 A;  1H8K A;  4OMP A;  2M0Y A;  3JCM c;  1OOT A;  1KC8 C;  5J26 A;  1PRM C;  1S1N A;  1VQM Q;  2K79 A;  3CC7 T;  1Y07 A;  2ED1 A;  1BK2 A;  4DOV A;  5FLX E;  3CCR Q;  3CCV Q;  5LL6 S;  1U3O A;  2LC4 A;  4C0D B;  3EGU A;  1BU1 A;  4KBM B;  4HVV A;  1VQK A;  1IRX A;  4MZP A;  3JCM h;  5KE3 A;  4JRQ A;  4XU2 A;  2K3Y A;  3EH2 A;  4C5G A;  2JM8 A;  2GFU A;  2AZS A;  4IUQ A;  1A0N B;  2NYS A;  3H0I A;  1YNZ A;  5IXF A;  2HSP A;  4C0F A;  2GGR A;  3L2W A;  3SDZ A;  1WHM A;  2L2P A;  1VQ5 T;  7AT1 B;  2QEX A;  2GTJ A;  3TSW A;  2CH4 A;  3JB9 G;  1Q86 U;  3X28 B;  1KSW A;  1AHJ B;  1OUL A;  1WJS A;  2L3Q A;  1T0H A;  1WGS A;  5FW9 A;  1M1F A;  4C8Q F;  1Z9Z A;  1KQ2 A;  2DL7 A;  2K57 A;  2V8I A;  1IHV A;  3GOX A;  1VQ7 Q;  2FB7 A;  4J8O A;  4C8Q C;  3X20 B;  5LJ3 j;  4J83 A;  1MND A;  1SRM A;  1NLO C;  3KUF A;  1WNL A;  1ZUY A;  2DMO A;  2ESW A;  2HQX A;  2SEM A;  3E9F A;  4ZN1 A;  4Z02 A;  1OEB A;  3G6E Q;  4QQD A;  2MAM A;  5FWC A;  4KH1 B;  2FPE A;  2PZ1 A;  4C5H A;  5GAN 4;  1UGP B;  2JJ9 A;  1JJ2 A;  1UGQ B;  3TEE A;  4PLI A;  4BY6 C;  1BBZ A;  5LJ3 h;  4IUT A;  1JRI A;  2LQK A;  5IHI A;  4RMO A;  1YHQ Q;  1QP2 A;  1PM3 A;  4OB2 B;  2K7A A;  4RTV A;  1X43 A;  4HVW A;  2E4H A;  1I4K 1;  1KC8 R;  3N5B B;  3H0F A;  5CKB A;  5GAO l;  1RAI B;  1TTH B;  3M57 A;  2EGC A;  1VIF A;  1S72 Q;  1WJQ A;  2IIM A;  2OTJ T;  2DTH A;  2HCK A;  2JOY A;  1Y71 A;  4M78 A;  3G7Z A;  4C0Z A;  1YCS B;  3A8M B;  1VOM A;  3AHU A;  2CZ7 B;  2RMO A;  2MIO A;  4WCI A;  1J3T A;  1K76 A;  2WAC A;  5D6X A;  2G3R A;  3QWY A;  4J7I A;  1VUB A;  1ZUK A;  3G4S T;  1RLQ C;  2DEQ A;  4B9X A;  2K2V A;  5GAN h;  1WHG A;  2K9G A;  1M1K C;  2X9H A;  4M77 B;  3UPU A;  1AT1 B;  2VUB A;  4M7D B;  2DK3 A;  3TU4 K;  1AZG B;  2GBQ A;  5GAN 6;  2F2W A;  1VQ4 T;  5GAN 2;  2XD0 A;  3HRU A;  4NS5 A;  2I0N A;  2KSS A;  2KAF A;  3PVL A;  2NUT B;  3V8K A;  2KXC A;  2LNV A;  3CCU Q;  2CP2 A;  2P0Q A;  1Q95 G;  2JS2 A;  4E7H A;  1VA7 A;  3VS7 A;  3CCL A;  2F2V A;  1WJR A;  4QVD A;  1BI1 A;  3NTH A;  2DER A;  2E5K A;  1C0M A;  2BZ8 A;  2P0P A;  3CCM T;  5CQX A;  2ZPB B;  5LJ5 d;  3REB B;  1OPK A;  4KH0 B;  1WHH A;  1M8M A;  5L23 A;  2OJ2 A;  3LW5 E;  3EG3 A;  4M75 D;  2LJ3 A;  3EFO B;  3SWN A;  1JBM A;  2Y90 A;  4ELY C;  3QHS A;  1OU8 A;  3GNG A;  2W10 A;  4D8D A;  4QT7 A;  3X24 B;  1NPR A;  3BDL A;  1PC0 A;  5GMK l;  2AKL A;  2EVR A;  2RK2 A;  2NLU A;  3ME9 A;  4BDZ A;  1TWB A;  3PT9 A;  4R55 A;  5GAM g;  4RCB A;  1GCQ C;  3OYB A;  1Q81 C;  3CC7 Q;  4MDW A;  1QCO A;  2ROT A;  1C1A A;  2KR3 A;  1Y96 B;  3HHT B;  3PFS A;  2KT1 A;  1QVF A;  1NZ9 A;  1HD3 A;  2CRE A;  4XU3 A;  3G1J A;  2ATC B;  1TUD A;  4J9F A;  5HK3 A;  1NBE B;  4PFZ A;  4C8Q B;  1B34 A;  4M78 G;  1Y0M A;  1WQW A;  3TQ7 P;  1YIJ A;  2YWW A;  5GAM f;  3KBG A;  2GTO A;  1VQL A;  1KQ1 A;  1M1K R;  2FL7 A;  2DL5 A;  3JB9 I;  4MZT A;  1PSE A;  2VAS A;  3JCM g;  3QZ5 B;  3TRE A;  2DJQ A;  1MV3 A;  5DLQ E;  5KYY B;  1VQ5 Q;  2PUO B;  2RQV A;  5IHN A;  3VUZ A;  3CMA A;  2MF2 A;  4GLM A;  4RUG A;  2V8K A;  1I8F A;  1UUE A;  2AIR B;  1GRI A;  3PNW C;  3A8G B;  3C12 A;  4KUI A;  2HEQ A;  2QDY B;  2HQH A;  1XTD A;  3MET A;  3VS4 A;  2L3S A;  2DRM A;  4KUD K;  2DO3 A;  1VQ9 A;  3S3N A;  2YDL A;  4BB7 A;  3QWX X;  3JCM f;  1UB4 A;  2X3W D;  3CXC P;  4CI0 C;  2B86 A;  2HMA A;  5LJ5 h;  2CKK A;  2BZY A;  3A8L B;  1R0C B;  2X4W A;  1VQP A;  3CXC S;  1SSF A;  2KK4 A;  3EGX A;  1FMK A;  1WA7 A;  1XQH A;  1N8R U;  4GBQ A;  4DA4 A;  2EGE A;  5KYU A;  4IKF A;  3I55 T;  2RPN A;  3OQ5 A;  3JCM V;  1VQ6 T;  4FU6 A;  2XHC A;  4FYW B;  4EMG A;  3TCJ A;  2IPO B;  1AWW A;  5I21 A;  4C92 G;  2G6F X;  4QQ6 A;  4NL3 A;  4ATO A;  1VQO T;  4Z89 A;  2E6N A;  5DLO A;  2D1X A;  2XI9 A;  3I56 Q;  2EAY A;  1Q81 R;  3UWN A;  2XDB A;  4AFZ C;  2QTX A;  4JRP A;  1N27 A;  4GY5 A;  4JPB W;  2OTJ Q;  2LT1 A;  4EMK B;  1NYF A;  4PFO A;  4C0D C;  2CP5 A;  3CCJ T;  4PLL A;  1Z9Q A;  1YJW T;  5EC7 A;  4RCC A;  3E1S A;  1WIE A;  2D8H A;  1YCY A;  2QA4 T;  1ZLM A;  3OYF A;  4DBH A;  4LD6 A;  3M55 A;  5CAI A;  4M7D A;  4YTL A;  3SD4 A;  2L3P A;  3RER A;  3G4S Q;  3M58 A;  2A0F B;  2GQV A;  4Z88 A;  3NPF A;  2M1H A;  1SRL A;  4PJO D;  1N9R A;  2EYW A;  3EG0 A;  1YI2 T;  2LDM A;  2BE9 B;  1KJW A;  5GAN 8;  2BUD A;  1ABO A;  4IUU A;  1RAC B;  2P0K A;  5KYW A;  4FT2 A;  4J9C A;  1GFC A;  1MV0 B;  2YRC A;  2VV5 A;  3VKI A;  5GAN g;  2DXT A;  6AT1 B;  3QBY A;  1VQ4 Q;  3CME A;  2RH2 A;  2DYI A;  1JB0 E;  3BE3 A;  2D8J A;  4KRT A;  1W70 A;  4JJN K;  2EKO A;  5I11 A;  1M27 C;  3O5Z A;  1UEC A;  4M7D E;  3DKM A;  2RF0 A;  1OYX A;  4NL2 A;  4BDY A;  4CC2 A;  5GMK e;  2LJ0 A;  3DB4 A;  2FEI A;  3HRS A;  5GAN f;  2JTM A;  1D3B A;  1G5V A;  3CCM Q;  2NUZ A;  5IT9 E;  2DXC A;  1FX7 A;  2JUF A;  1AWO A;  3H0H A;  4EPC A;  4XTV A;  3G6E A;  2CUB A;  2JMC A;  1Y96 A;  2XK0 A;  1WXU A;  1IHW A;  2EBP A;  4J6W A;  4M78 B;  1OX9 A;  3CD6 A;  4QKU A;  1O75 A;  4UC4 A;  2B8A A;  2RHZ A;  1IGU A;  2ENM A;  4BI8 B;  2PVG B;  1TU0 B;  1OI1 A;  1ZSG A;  3QJY A;  1M3B A;  4MDX A;  4JS5 A;  3QXE B;  5I2S A;  3OBY A;  2EPD A;  2C0O A;  4BE2 A;  4E47 A;  4JUV A;  3FLG A;  2KGT A;  2AK5 A;  1LVK A;  1KHI A;  1IB8 A;  2V1R A;  4ESR A;  1EIF A;  3VS2 A;  3OYM A;  3QPH A;  1SEM A;  2BKD N;  3ZL7 C;  1YIT A;  3HFO A;  1HK9 A;  3QZ9 B;  3OSS C;  4M75 A;  2YUP A;  2ABL A;  3EFS A;  2COZ A;  3THK A;  3QSU A;  4N4H A;  4M7D F;  2ECZ A;  5KE2 A;  4JJB A;  2VC8 A;  3MP6 A;  2RM4 A;  4A63 B;  1U8R A;  4A4K A;  3I9Q A;  4X34 A;  1VQK T;  1UFF A;  4M7D C;  4LNP A;  1MHN A;  1PG5 B;  1HSQ A;  1VYT A;  5I22 A;  1BB9 A;  3JCM e;  2R5M A;  2DRK A;  3CPW A;  2ROL A;  1YN8 A;  2DBM A;  3C95 A;  2F69 A;  2DE0 X;  1NJI C;  4C92 B;  2KE9 A;  2QEX T;  4Q5W A;  1PHT A;  3PMI A;  1PKS A;  1WZO A;  1G3W A;  2EQK A;  3SWN B;  2DNU A;  3VS1 A;  5HCK A;  2MPX C;  2E6Z A;  4F7U G;  1WXT A;  4RG8 A;  5CK9 A;  4ZGD B;  1ZBX A;  1KC8 U;  1NG2 A;  3FDR A;  4L5G A;  3OB9 A;  1UGS B;  2QTV A;  3A98 A;  4AFU C;  3I55 Q;  5LJ5 g;  2KDS A;  2EQJ A;  2O9S A;  1D1A A;  3M0R A;  4EMK A;  1VQ6 Q;  3LGF A;  4XTZ A;  2R58 A; 
#chains in the Genus database with same CATH homology
 2RNA A;  2JS0 A;  1K1Z A;  3ULR B;  2DYB A;  3VRZ A;  2J6F A;  1AZG B;  2GBQ A;  1SPK A;  1U06 A;  1UDL A;  2F2W A;  2A37 A;  1UGV A;  1M3C A;  2I0N A;  2O31 A;  1I1J A;  3PVL A;  2KXC A;  2VKN A;  2EYZ A;  4AG2 C;  2LMJ A;  3REA B;  4RTZ A;  2MCN A;  1H92 A;  4R0K A;  1K9A A;  2JS2 A;  2P4R A;  4LE9 A;  4J9E A;  1AEY A;  1VA7 A;  3VS7 A;  4HVU A;  1NLP C;  2C0I A;  2F2V A;  2J6K A;  4DEY A;  2E5K A;  1K0X A;  2J6O A;  1B3Q A;  2BZ8 A;  2JT4 A;  4IIO A;  2JW4 A;  3REB B;  1GL5 A;  1AWJ A;  1OPK A;  1M8M A;  5L23 A;  2OJ2 A;  1AWX A;  1I0C A;  3EG3 A;  2ED0 A;  4RTY A;  4K11 A;  2LJ3 A;  2VVK A;  3CQT A;  1AVZ C;  1E6G A;  4JJD A;  1KFZ A;  2J06 A;  5GJW B;  4D8D A;  2W10 A;  4QT7 A;  3VS3 A;  2DL3 A;  4Y92 A;  1MUZ A;  2RQT A;  2KRM A;  2FO0 A;  4RTX A;  1E6H A;  2C0T A;  2DM1 A;  4AFQ C;  2M51 A;  1YP5 A;  4X1V A;  1X69 A;  2NWM A;  2AKL A;  1RI9 A;  4LUE A;  2EVR A;  1NM7 A;  3H41 A;  4ZNX A;  2CT3 A;  2EYY A;  1GCQ C;  1UTI A;  3SHW A;  2X3X D;  2ROT A;  1ZUU A;  2KR3 A;  1UJY A;  2DA9 A;  1SSH A;  2LZ6 B;  2KT1 A;  2SRC A;  4J9I A;  1HD3 A;  2CRE A;  2FPF A;  4F14 A;  1TUD A;  4J9F A;  4JZ3 A;  4HCK A;  2GQI A;  3NGP A;  5IHK A;  4OMQ A;  2KBT A;  4OMN A;  2YUO A;  1PWT A;  1W6X A;  3UAT A;  4DEX A;  1Y0M A;  3I35 A;  4J9B A;  1NEG A;  2GTO A;  3FJ5 A;  3VS6 A;  2DL5 A;  1JXO A;  1QWF A;  4JJC A;  4JZ4 A;  4F16 A;  2DJQ A;  2L0A A;  1MV3 A;  2LQW A;  2RQV A;  5IHN A;  2AZV A;  4GLM A;  4RUG A;  2DL4 A;  1RUW A;  3GBQ A;  5FWB A;  1RLP C;  1UUE A;  1GRI A;  2PNI A;  1GBR A;  1AD5 A;  1T3S A;  2KRN A;  2A08 A;  1K4U S;  2HEQ A;  1N5Z A;  4RTU A;  3EHQ A;  2LP5 A;  2VWF A;  2FRW A;  3TSZ A;  3VS4 A;  1UG1 A;  2L3S A;  2DRM A;  2AKK A;  1EFN A;  1JO8 A;  1OPL A;  1UE9 A;  2YDL A;  2KT8 A;  3QWX X;  1PKT A;  3M0U A;  2X3W D;  2RQW A;  2RQR A;  2YUN A;  2HDA A;  4AFS C;  2B86 A;  3PVQ A;  3I5S A;  1H3H A;  2BZY A;  2RN8 A;  4M4Z A;  1XOV A;  3RBB B;  1FMK A;  1WA7 A;  1OV3 A;  1CSK A;  2F2X A;  4GBQ A;  1YWO A;  2EGE A;  2RPN A;  2KRS A;  2KXD A;  2DIL A;  2EQI A;  1UHC A;  1WLP B;  2H8H A;  3JV3 A;  5IH2 A;  2LQN A;  1LCK A;  1AWW A;  2RQU A;  2DX1 A;  1NEB A;  3NMZ C;  2G6F X;  4OMO A;  4CC7 A;  1X2Q A;  1ZX6 A;  3UF4 A;  2KYM A;  4Z89 A;  2YSQ A;  3M0Q A;  2KYB A;  1HJD A;  2J7I A;  2KEA A;  3KFV A;  4E6R A;  1VYV A;  2YUQ A;  2D1X A;  3R6N A;  1QWE A;  2CDT A;  3IQL A;  4AFZ C;  1X6B A;  1QKX A;  4JPB W;  2O9V A;  1AOJ A;  4J9G A;  2V1Q A;  1NYF A;  1PNJ A;  2EGA A;  3VRY A;  1GFD A;  2DL8 A;  1Z9Q A;  3EG2 A;  1WFW A;  4FSS A;  5EC7 A;  1B07 A;  2FG0 A;  1M30 A;  1WIE A;  2D8H A;  4J9H A;  1SHF A;  4AG1 C;  1ZLM A;  2XMF A;  4CC4 B;  4ORZ A;  2DLP A;  3U23 A;  4LUD A;  1GBQ A;  1ABQ A;  2EKH A;  1YWP A;  1GCQ A;  1ARK A;  5IXB A;  2L3P A;  2K2M A;  2BZX A;  1WI7 A;  4Z88 A;  1PRL C;  3NPF A;  3M0T A;  1UHF A;  2CSQ A;  2KNB B;  1Y57 A;  1SRL A;  2JM9 A;  3EG0 A;  2EYW A;  1M3A A;  4CC3 A;  3LH5 A;  1KJW A;  3VS5 A;  5ECA A;  1E7O A;  1ABO A;  2A36 A;  1H8K A;  1G83 A;  5GJV B;  4OMP A;  4J9C A;  2MOX A;  1GFC A;  1MV0 B;  2M0Y A;  3I5R A;  1OOT A;  4J9D A;  1PRM C;  1S1N A;  2K79 A;  3M0S A;  2ED1 A;  1BK2 A;  2D8J A;  4OML A;  4KRT A;  2GNC A;  1W70 A;  1T0J A;  1U3O A;  2JXB A;  5I11 A;  1I07 A;  3EGU A;  1BU1 A;  1M27 C;  3NHN A;  3TVT A;  3O5Z A;  4HVV A;  1UEC A;  2K3B A;  4RTT A;  2RF0 A;  1X27 A;  1CKA A;  1IO6 A;  4CC2 A;  2LJ0 A;  2FEI A;  2NUZ A;  2JM8 A;  2AZS A;  4Z8A A;  1A0N B;  3H0I A;  1AWO A;  3H0H A;  1WYX A;  1YNZ A;  5IXF A;  1WDX A;  1FYN A;  2HSP A;  1CKB A;  2GGR A;  2DBK A;  2CH4 W;  2L2P A;  2CUB A;  2JTE A;  1VYU A;  2JMC A;  2GTJ A;  3TSW A;  2CH4 A;  1WXU A;  1KSW A;  2EBP A;  2DVJ A;  1JEG A;  1G2B A;  2DF6 A;  1TG0 A;  2J05 A;  2L3Q A;  3SEM A;  1T0H A;  2PTK A;  5FW9 A;  2ENM A;  4IIM A;  4F17 A;  3EHR A;  1ZSG A;  1Z9Z A;  1M3B A;  2KRO A;  2FPD A;  2LJ1 A;  4HXJ A;  2OI3 A;  2DL7 A;  2EPD A;  2LX7 A;  2K6D A;  2A28 A;  1JU5 C;  2C0O A;  1GCP A;  1UJ0 A;  2BTT A;  1SRM A;  1NLO C;  2KGT A;  2AK5 A;  4RTW A;  3PE0 A;  1ZUY A;  2DMO A;  2ESW A;  2SEM A;  2V1R A;  4ESR A;  1OEB A;  3VS2 A;  1SEM A;  3ZL7 C;  5FWC A;  2FPE A;  2PZ1 A;  2YUP A;  2ABL A;  1AZE A;  4LN2 A;  3THK A;  2EW3 A;  3VS0 A;  2CSI A;  3UA6 A;  1BBZ A;  2ECZ A;  1TUC A;  3C0C A;  4OMM A;  1KIK A;  2LCS A;  4JJB A;  3UA7 A;  3M0P A;  5IHI A;  4A63 B;  1T3L A;  1W1F A;  2D0N A;  4D8K A;  1NYG A;  2HBW A;  3EG1 A;  3I9Q A;  2LNH B;  2K7A A;  1WX6 A;  1V1C A;  1UFF A;  4RTV A;  1X43 A;  2O2O A;  4LNP A;  4HVW A;  1HSQ A;  1VYT A;  5I22 A;  1QCF A;  1BB9 A;  3H0F A;  1QLY A;  2QDL A;  2YT6 A;  1JXM A;  2DRK A;  2O88 A;  4EIK A;  2EGC A;  2ROL A;  1YN8 A;  2DBM A;  2W0Z A;  2IIM A;  1K0S A;  1X6G A;  3RNJ A;  2DE0 X;  2HCK A;  1U5S A;  2KE9 A;  2EYX A;  1PHT A;  1JQQ A;  1PKS A;  1YCS B;  2DNU A;  3VS1 A;  5HCK A;  2JMA A;  2RMO A;  2MIO A;  1WXT A;  4WCI A;  2CUD A;  1J3T A;  1K76 A;  1ZBJ A;  1NG2 A;  3QWY A;  1ZUK A;  1RLQ C;  3A98 A;  2OAW A;  4AFU C;  1X2K A;  1WXB A;  1QKW A;  2O9S A;  2CT4 A;  1SHG A;  3M0R A;  2K9G A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...