2BZMA

Solution structure of the primary host recognition region of complement factor h
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
129
Chain Sequence
EAEFGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Disease-Associated Sequence Variations Congregate in a Polyanion Recognition Patch on Human Factor H Revealed in Three-Dimensional Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2bzmA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2bzmA02
3R62A 1VVCA 1U5MA 2YRAA 3OP8A 1CKLA 4PZ5A 5HYUB 1HFIA 2RLQA 4LOSA 3SW0X 5HYTB 1UOTP 1GKGA 2IZ4A 2KMSA 3CALA 4LOTA 2WIIC 2BZMA 4B2RA 4K12A 2XRDA 4MUCA 2EHFA 1SRZA 3EJHA 4AYDA 1E88A 3ZD1A 1LY2A 4J38B 3M7PA 1G4FA 4WJG2 2YBYA 1OJWA 1MD8A 4CSYA 2B5ID 1GPZA 1E8BA 2W80A 3ZD2A 1NWVA 4AYIA 5HYPA 5I0QB 2UWNA 3GXEA 3INBC 1H2QP 1OK9A 2IZ3A 1HFHA 1Q3XA 1TPMA 4ONTD 2XWBF 1OK3A 3IX0A 4DJZA 2O39C 2RL0A 3KXVA 1HCCA 3ERBA 3L89M 1TPGA 3O8EB 3MQLA 1Z92B 1VVDA 2LOJA 4AYMA 4C16A 2JRAA 4B2SA 1H04P 1OK2A 2MCZA 5HZPB 4ZH1D 2A55A 2ERJA 1H2PP 2RKZA 5FO8C 4A5WB 3RJ3D 4AYEA 3OXUD 3IU3I 5JPMG 1FBRA 4JHSA 1MD7A 1OK1A 2QY0A 1O9AA 1H03P 1QO6A 2CG6A 1G4GA 4KKDA 1PPQA 3NFPI 3TVJA 3GOVA 3T5OA 1GKNA 2XWJI 1TPNA 2RKYA 1ZJKA 2XRBA 2KRIA 1GHQB 4IGDA 4YNXA 2CG7A 2EC3A 4FXGG 1OJYA 1QUBA 2JGXA 3KZJA 3OEDC 2XQWC 2W81A 1SS2A 1C1ZA 2CKUA 1ELVA 2G7IA 1QGBA 1OJVA 4F4OC 2MCYA 2RLPA 1E5GA 3ZRZA 2JGWA 2V8EA
chains in the Genus database with same CATH superfamily
3R62A 1VVCA 1U5MA 2YRAA 3OP8A 1CKLA 4APLA 4PZ5A 5HYUB 1HFIA 2RLQA 4LOSA 3SW0X 5HYTB 1UOTP 1GKGA 2IZ4A 4N7EA 2KMSA 4PO7A 3NJAA 2ZYCA 3CALA 4LOTA 2WIIC 2Y8TA 2BZMA 3FGRA 4B2RA 4K12A 2XRDA 4MUCA 2EHFA 1SRZA 3ZLEA 3EJHA 4AYDA 1E88A 3ZD1A 1LY2A 4J38B 3M7PA 1G4FA 4WJG2 2YBYA 1OJWA 4BWCA 1MD8A 4CSYA 2B5ID 1GPZA 3ZLDA 1E8BA 5DN4A 2W80A 3ZD2A 1NWVA 4AYIA 5HYPA 4MSLA 5I0QB 2UWNA 3GXEA 3INBC 1H2QP 1OK9A 2IZ3A 1HFHA 1Q3XA 1TPMA 4ONTD 2XWBF 1OK3A 3IX0A 4DJZA 2X2ZA 2O39C 2RL0A 3KXVA 1HCCA 3ERBA 3L89M 1TPGA 3O8EB 3MQLA 1Z92B 1VVDA 2LOJA 4AYMA 4C16A 2JRAA 4B2SA 1H04P 1OK2A 2MCZA 5HZPB 4ZH1D 2A55A 2ERJA 1H2PP 2RKZA 5FO8C 4A5WB 3RJ3D 4AYEA 3OXUD 3IU3I 5JPMG 1FBRA 4JHSA 1MD7A 1OK1A 2QY0A 1O9AA 1H03P 1QO6A 2CG6A 4YIZA 1G4GA 1RLHA 3FGTA 4KKDA 5DN5A 1PPQA 3NFPI 3TVJA 3WSXA 3GOVA 3T5OA 2I2LA 1GKNA 2XWJI 1TPNA 2RKYA 3VWOA 1ZJKA 2XRBA 2KRIA 3K3TA 1GHQB 4IGDA 4YNXA 2CG7A 2EC3A 4FXGG 1OJYA 1QUBA 2Y8SA 3WSYA 2JGXA 3KZJA 2Y8RA 3OEDC 2XQWC 2W81A 3CI0J 1SS2A 1C1ZA 2CKUA 1ELVA 2G7IA 1QGBA 1OJVA 4F4OC 2MCYA 2RLPA 3F6KA 1E5GA 3ZRZA 2JGWA 2V8EA
chains in the Genus database with same CATH topology
3R62A 1VVCA 1U5MA 2YRAA 3OP8A 1CKLA 4PZ5A 5HYUB 1HFIA 2RLQA 4LOSA 3SW0X 5HYTB 1UOTP 1GKGA 2IZ4A 2KMSA 3CALA 4LOTA 2WIIC 2BZMA 4B2RA 4K12A 2XRDA 4MUCA 2EHFA 1SRZA 3EJHA 4AYDA 1E88A 3ZD1A 1LY2A 4J38B 3M7PA 1G4FA 4WJG2 2YBYA 1OJWA 1MD8A 4CSYA 2B5ID 1GPZA 1E8BA 2W80A 3ZD2A 1NWVA 4AYIA 5HYPA 5I0QB 2UWNA 3GXEA 3INBC 1H2QP 1OK9A 2IZ3A 1HFHA 1Q3XA 1TPMA 4ONTD 2XWBF 1OK3A 3IX0A 4DJZA 2O39C 2RL0A 3KXVA 1HCCA 3ERBA 3L89M 1TPGA 3O8EB 3MQLA 1Z92B 1VVDA 2LOJA 4AYMA 4C16A 2JRAA 4B2SA 1H04P 1OK2A 2MCZA 5HZPB 4ZH1D 2A55A 2ERJA 1H2PP 2RKZA 5FO8C 4A5WB 3RJ3D 4AYEA 3OXUD 3IU3I 5JPMG 1FBRA 4JHSA 1MD7A 1OK1A 2QY0A 1O9AA 1H03P 1QO6A 2CG6A 1G4GA 4KKDA 1PPQA 3NFPI 3TVJA 3GOVA 3T5OA 1GKNA 2XWJI 1TPNA 2RKYA 1ZJKA 2XRBA 2KRIA 1GHQB 4IGDA 4YNXA 2CG7A 2EC3A 4FXGG 1OJYA 1QUBA 2JGXA 3KZJA 3OEDC 2XQWC 2W81A 1SS2A 1C1ZA 2CKUA 1ELVA 2G7IA 1QGBA 1OJVA 4F4OC 2MCYA 2RLPA 1E5GA 3ZRZA 2JGWA 2V8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R62 A;  1VVC A;  1U5M A;  2YRA A;  3OP8 A;  1CKL A;  4PZ5 A;  5HYU B;  1HFI A;  2RLQ A;  4LOS A;  3SW0 X;  5HYT B;  1UOT P;  1GKG A;  2IZ4 A;  2KMS A;  3CAL A;  4LOT A;  2WII C;  2BZM A;  4B2R A;  4K12 A;  2XRD A;  4MUC A;  2EHF A;  1SRZ A;  3EJH A;  4AYD A;  1E88 A;  3ZD1 A;  1LY2 A;  4J38 B;  3M7P A;  1G4F A;  4WJG 2;  2YBY A;  1OJW A;  1MD8 A;  4CSY A;  2B5I D;  1GPZ A;  1E8B A;  2W80 A;  3ZD2 A;  1NWV A;  4AYI A;  5HYP A;  5I0Q B;  2UWN A;  3GXE A;  3INB C;  1H2Q P;  1OK9 A;  2IZ3 A;  1HFH A;  1Q3X A;  1TPM A;  4ONT D;  2XWB F;  1OK3 A;  3IX0 A;  4DJZ A;  2O39 C;  2RL0 A;  3KXV A;  1HCC A;  3ERB A;  3L89 M;  1TPG A;  3O8E B;  3MQL A;  1Z92 B;  1VVD A;  2LOJ A;  4AYM A;  4C16 A;  2JRA A;  4B2S A;  1H04 P;  1OK2 A;  2MCZ A;  5HZP B;  4ZH1 D;  2A55 A;  2ERJ A;  1H2P P;  2RKZ A;  5FO8 C;  4A5W B;  3RJ3 D;  4AYE A;  3OXU D;  3IU3 I;  5JPM G;  1FBR A;  4JHS A;  1MD7 A;  1OK1 A;  2QY0 A;  1O9A A;  1H03 P;  1QO6 A;  2CG6 A;  1G4G A;  4KKD A;  1PPQ A;  3NFP I;  3TVJ A;  3GOV A;  3T5O A;  1GKN A;  2XWJ I;  1TPN A;  2RKY A;  1ZJK A;  2XRB A;  2KRI A;  1GHQ B;  4IGD A;  4YNX A;  2CG7 A;  2EC3 A;  4FXG G;  1OJY A;  1QUB A;  2JGX A;  3KZJ A;  3OED C;  2XQW C;  2W81 A;  1SS2 A;  1C1Z A;  2CKU A;  1ELV A;  2G7I A;  1QGB A;  1OJV A;  4F4O C;  2MCY A;  2RLP A;  1E5G A;  3ZRZ A;  2JGW A;  2V8E A; 
#chains in the Genus database with same CATH topology
 3R62 A;  1VVC A;  1U5M A;  2YRA A;  3OP8 A;  1CKL A;  4APL A;  4PZ5 A;  5HYU B;  1HFI A;  2RLQ A;  4LOS A;  3SW0 X;  5HYT B;  1UOT P;  1GKG A;  2IZ4 A;  4N7E A;  2KMS A;  4PO7 A;  3NJA A;  2ZYC A;  3CAL A;  4LOT A;  2WII C;  2Y8T A;  2BZM A;  3FGR A;  4B2R A;  4K12 A;  2XRD A;  4MUC A;  2EHF A;  1SRZ A;  3ZLE A;  3EJH A;  4AYD A;  1E88 A;  3ZD1 A;  1LY2 A;  4J38 B;  3M7P A;  1G4F A;  4WJG 2;  2YBY A;  1OJW A;  4BWC A;  1MD8 A;  4CSY A;  2B5I D;  1GPZ A;  3ZLD A;  1E8B A;  5DN4 A;  2W80 A;  3ZD2 A;  1NWV A;  4AYI A;  5HYP A;  4MSL A;  5I0Q B;  2UWN A;  3GXE A;  3INB C;  1H2Q P;  1OK9 A;  2IZ3 A;  1HFH A;  1Q3X A;  1TPM A;  4ONT D;  2XWB F;  1OK3 A;  3IX0 A;  4DJZ A;  2X2Z A;  2O39 C;  2RL0 A;  3KXV A;  1HCC A;  3ERB A;  3L89 M;  1TPG A;  3O8E B;  3MQL A;  1Z92 B;  1VVD A;  2LOJ A;  4AYM A;  4C16 A;  2JRA A;  4B2S A;  1H04 P;  1OK2 A;  2MCZ A;  5HZP B;  4ZH1 D;  2A55 A;  2ERJ A;  1H2P P;  2RKZ A;  5FO8 C;  4A5W B;  3RJ3 D;  4AYE A;  3OXU D;  3IU3 I;  5JPM G;  1FBR A;  4JHS A;  1MD7 A;  1OK1 A;  2QY0 A;  1O9A A;  1H03 P;  1QO6 A;  2CG6 A;  4YIZ A;  1G4G A;  1RLH A;  3FGT A;  4KKD A;  5DN5 A;  1PPQ A;  3NFP I;  3TVJ A;  3WSX A;  3GOV A;  3T5O A;  2I2L A;  1GKN A;  2XWJ I;  1TPN A;  2RKY A;  3VWO A;  1ZJK A;  2XRB A;  2KRI A;  3K3T A;  1GHQ B;  4IGD A;  4YNX A;  2CG7 A;  2EC3 A;  4FXG G;  1OJY A;  1QUB A;  2Y8S A;  3WSY A;  2JGX A;  3KZJ A;  2Y8R A;  3OED C;  2XQW C;  2W81 A;  3CI0 J;  1SS2 A;  1C1Z A;  2CKU A;  1ELV A;  2G7I A;  1QGB A;  1OJV A;  4F4O C;  2MCY A;  2RLP A;  3F6K A;  1E5G A;  3ZRZ A;  2JGW A;  2V8E A; 
#chains in the Genus database with same CATH homology
 3R62 A;  1VVC A;  1U5M A;  2YRA A;  3OP8 A;  1CKL A;  4PZ5 A;  5HYU B;  1HFI A;  2RLQ A;  4LOS A;  3SW0 X;  5HYT B;  1UOT P;  1GKG A;  2IZ4 A;  2KMS A;  3CAL A;  4LOT A;  2WII C;  2BZM A;  4B2R A;  4K12 A;  2XRD A;  4MUC A;  2EHF A;  1SRZ A;  3EJH A;  4AYD A;  1E88 A;  3ZD1 A;  1LY2 A;  4J38 B;  3M7P A;  1G4F A;  4WJG 2;  2YBY A;  1OJW A;  1MD8 A;  4CSY A;  2B5I D;  1GPZ A;  1E8B A;  2W80 A;  3ZD2 A;  1NWV A;  4AYI A;  5HYP A;  5I0Q B;  2UWN A;  3GXE A;  3INB C;  1H2Q P;  1OK9 A;  2IZ3 A;  1HFH A;  1Q3X A;  1TPM A;  4ONT D;  2XWB F;  1OK3 A;  3IX0 A;  4DJZ A;  2O39 C;  2RL0 A;  3KXV A;  1HCC A;  3ERB A;  3L89 M;  1TPG A;  3O8E B;  3MQL A;  1Z92 B;  1VVD A;  2LOJ A;  4AYM A;  4C16 A;  2JRA A;  4B2S A;  1H04 P;  1OK2 A;  2MCZ A;  5HZP B;  4ZH1 D;  2A55 A;  2ERJ A;  1H2P P;  2RKZ A;  5FO8 C;  4A5W B;  3RJ3 D;  4AYE A;  3OXU D;  3IU3 I;  5JPM G;  1FBR A;  4JHS A;  1MD7 A;  1OK1 A;  2QY0 A;  1O9A A;  1H03 P;  1QO6 A;  2CG6 A;  1G4G A;  4KKD A;  1PPQ A;  3NFP I;  3TVJ A;  3GOV A;  3T5O A;  1GKN A;  2XWJ I;  1TPN A;  2RKY A;  1ZJK A;  2XRB A;  2KRI A;  1GHQ B;  4IGD A;  4YNX A;  2CG7 A;  2EC3 A;  4FXG G;  1OJY A;  1QUB A;  2JGX A;  3KZJ A;  3OED C;  2XQW C;  2W81 A;  1SS2 A;  1C1Z A;  2CKU A;  1ELV A;  2G7I A;  1QGB A;  1OJV A;  4F4O C;  2MCY A;  2RLP A;  1E5G A;  3ZRZ A;  2JGW A;  2V8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...