2BZMA

Solution structure of the primary host recognition region of complement factor h
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
129
structure length
129
Chain Sequence
EAEFGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Disease-Associated Sequence Variations Congregate in a Polyanion Recognition Patch on Human Factor H Revealed in Three-Dimensional Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2bzmA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2bzmA02
1TPNA 4AYMA 2CG6A 2G7IA 4LOSA 2JRAA 1HFIA 2RLPA 3TVJA 2V8EA 1H2PP 3GXEA 2QY0A 1E5GA 2CG7A 1NWVA 1FBRA 1HCCA 1UOTP 2CKUA 4FXGG 3SW0X 3OP8A 3NFPI 3OEDC 2XRDA 3T5OA 2MCZA 2RLQA 3M7PA 1E8BA 4CSYA 2A55A 4A5WB 1G4FA 1QO6A 5FO8C 1LY2A 1MD7A 4J38B 2B5ID 4AYDA 1GKGA 4AYIA 2EC3A 1ZJKA 2BZMA 1G4GA 2XRBA 2W81A 3O8EB 3EJHA 3ZD2A 3INBC 4ZH1D 3RJ3D 1OJYA 1HFHA 3MQLA 2KRIA 1Z92B 1U5MA 2ERJA 3IX0A 1H04P 2EHFA 1MD8A 1OJVA 2UWNA 4DJZA 1OK1A 4ONTD 5I0QB 1GKNA 3ERBA 4B2SA 2YRAA 3OXUD 1SS2A 4YNXA 3ZRZA 1VVCA 1GPZA 2O39C 1O9AA 1OK3A 2JGXA 1VVDA 1QUBA 5JPMG 2XWJI 4KKDA 1TPGA 3L89M 5HYTB 1QGBA 1OK9A 2KMSA 2LOJA 2RL0A 1C1ZA 5HYUB 2W80A 1SRZA 1GHQB 4JHSA 5HYPA 5HZPB 4LOTA 3GOVA 4IGDA 4MUCA 2IZ3A 1H2QP 3KXVA 1ELVA 1Q3XA 2RKYA 4K12A 1PPQA 4C16A 1OJWA 3CALA 2RKZA 1CKLA 4PZ5A 2IZ4A 2JGWA 1TPMA 3R62A 1E88A 4AYEA 2XWBF 2WIIC 4B2RA 3ZD1A 2YBYA 1OK2A 3IU3I 2MCYA 4WJG2 1H03P 4F4OC 2XQWC 3KZJA
chains in the Genus database with same CATH superfamily
1TPNA 4APLA 4AYMA 2CG6A 2G7IA 4LOSA 2JRAA 1HFIA 2RLPA 3TVJA 2Y8RA 3F6KA 2V8EA 1H2PP 3GXEA 1RLHA 2QY0A 1E5GA 2CG7A 1NWVA 2X2ZA 1FBRA 1HCCA 1UOTP 2CKUA 4FXGG 3SW0X 3OP8A 3NFPI 3OEDC 2XRDA 3T5OA 2MCZA 2RLQA 3M7PA 1E8BA 4CSYA 2A55A 4A5WB 1G4FA 1QO6A 5FO8C 1LY2A 1MD7A 4YIZA 4J38B 2B5ID 4AYDA 1GKGA 4AYIA 2EC3A 1ZJKA 2BZMA 1G4GA 2XRBA 2W81A 3O8EB 3EJHA 3ZD2A 3K3TA 3INBC 4ZH1D 3RJ3D 1OJYA 1HFHA 3VWOA 3MQLA 2KRIA 1Z92B 2ZYCA 1U5MA 3FGRA 2ERJA 3NJAA 3IX0A 1H04P 3ZLEA 2EHFA 3CI0J 1MD8A 1OJVA 2UWNA 4DJZA 1OK1A 4ONTD 5I0QB 1GKNA 3ERBA 2Y8SA 4B2SA 2YRAA 3OXUD 1SS2A 4YNXA 5DN4A 1VVCA 3ZRZA 1GPZA 2O39C 1O9AA 1OK3A 3WSYA 2JGXA 1VVDA 1QUBA 5JPMG 2XWJI 4BWCA 4KKDA 1TPGA 3L89M 5HYTB 1QGBA 1OK9A 2KMSA 2LOJA 2RL0A 1C1ZA 5HYUB 2W80A 3FGTA 1SRZA 1GHQB 2I2LA 4JHSA 5HYPA 5HZPB 4LOTA 3GOVA 4IGDA 4MUCA 2IZ3A 1H2QP 4N7EA 3KXVA 3ZLDA 1ELVA 1Q3XA 5DN5A 2RKYA 4K12A 1PPQA 4C16A 1OJWA 3CALA 2RKZA 1CKLA 4PZ5A 2IZ4A 2JGWA 1TPMA 3R62A 1E88A 4AYEA 2XWBF 2WIIC 4B2RA 2Y8TA 3ZD1A 2YBYA 1OK2A 3IU3I 2MCYA 4WJG2 3WSXA 1H03P 4PO7A 4F4OC 4MSLA 2XQWC 3KZJA
chains in the Genus database with same CATH topology
1TPNA 4AYMA 2CG6A 2G7IA 4LOSA 2JRAA 1HFIA 2RLPA 3TVJA 2V8EA 1H2PP 3GXEA 2QY0A 1E5GA 2CG7A 1NWVA 1FBRA 1HCCA 1UOTP 2CKUA 4FXGG 3SW0X 3OP8A 3NFPI 3OEDC 2XRDA 3T5OA 2MCZA 2RLQA 3M7PA 1E8BA 4CSYA 2A55A 4A5WB 1G4FA 1QO6A 5FO8C 1LY2A 1MD7A 4J38B 2B5ID 4AYDA 1GKGA 4AYIA 2EC3A 1ZJKA 2BZMA 1G4GA 2XRBA 2W81A 3O8EB 3EJHA 3ZD2A 3INBC 4ZH1D 3RJ3D 1OJYA 1HFHA 3MQLA 2KRIA 1Z92B 1U5MA 2ERJA 3IX0A 1H04P 2EHFA 1MD8A 1OJVA 2UWNA 4DJZA 1OK1A 4ONTD 5I0QB 1GKNA 3ERBA 4B2SA 2YRAA 3OXUD 1SS2A 4YNXA 3ZRZA 1VVCA 1GPZA 2O39C 1O9AA 1OK3A 2JGXA 1VVDA 1QUBA 5JPMG 2XWJI 4KKDA 1TPGA 3L89M 5HYTB 1QGBA 1OK9A 2KMSA 2LOJA 2RL0A 1C1ZA 5HYUB 2W80A 1SRZA 1GHQB 4JHSA 5HYPA 5HZPB 4LOTA 3GOVA 4IGDA 4MUCA 2IZ3A 1H2QP 3KXVA 1ELVA 1Q3XA 2RKYA 4K12A 1PPQA 4C16A 1OJWA 3CALA 2RKZA 1CKLA 4PZ5A 2IZ4A 2JGWA 1TPMA 3R62A 1E88A 4AYEA 2XWBF 2WIIC 4B2RA 3ZD1A 2YBYA 1OK2A 3IU3I 2MCYA 4WJG2 1H03P 4F4OC 2XQWC 3KZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TPN A;  4AYM A;  2CG6 A;  2G7I A;  4LOS A;  2JRA A;  1HFI A;  2RLP A;  3TVJ A;  2V8E A;  1H2P P;  3GXE A;  2QY0 A;  1E5G A;  2CG7 A;  1NWV A;  1FBR A;  1HCC A;  1UOT P;  2CKU A;  4FXG G;  3SW0 X;  3OP8 A;  3NFP I;  3OED C;  2XRD A;  3T5O A;  2MCZ A;  2RLQ A;  3M7P A;  1E8B A;  4CSY A;  2A55 A;  4A5W B;  1G4F A;  1QO6 A;  5FO8 C;  1LY2 A;  1MD7 A;  4J38 B;  2B5I D;  4AYD A;  1GKG A;  4AYI A;  2EC3 A;  1ZJK A;  2BZM A;  1G4G A;  2XRB A;  2W81 A;  3O8E B;  3EJH A;  3ZD2 A;  3INB C;  4ZH1 D;  3RJ3 D;  1OJY A;  1HFH A;  3MQL A;  2KRI A;  1Z92 B;  1U5M A;  2ERJ A;  3IX0 A;  1H04 P;  2EHF A;  1MD8 A;  1OJV A;  2UWN A;  4DJZ A;  1OK1 A;  4ONT D;  5I0Q B;  1GKN A;  3ERB A;  4B2S A;  2YRA A;  3OXU D;  1SS2 A;  4YNX A;  3ZRZ A;  1VVC A;  1GPZ A;  2O39 C;  1O9A A;  1OK3 A;  2JGX A;  1VVD A;  1QUB A;  5JPM G;  2XWJ I;  4KKD A;  1TPG A;  3L89 M;  5HYT B;  1QGB A;  1OK9 A;  2KMS A;  2LOJ A;  2RL0 A;  1C1Z A;  5HYU B;  2W80 A;  1SRZ A;  1GHQ B;  4JHS A;  5HYP A;  5HZP B;  4LOT A;  3GOV A;  4IGD A;  4MUC A;  2IZ3 A;  1H2Q P;  3KXV A;  1ELV A;  1Q3X A;  2RKY A;  4K12 A;  1PPQ A;  4C16 A;  1OJW A;  3CAL A;  2RKZ A;  1CKL A;  4PZ5 A;  2IZ4 A;  2JGW A;  1TPM A;  3R62 A;  1E88 A;  4AYE A;  2XWB F;  2WII C;  4B2R A;  3ZD1 A;  2YBY A;  1OK2 A;  3IU3 I;  2MCY A;  4WJG 2;  1H03 P;  4F4O C;  2XQW C;  3KZJ A; 
#chains in the Genus database with same CATH topology
 1TPN A;  4APL A;  4AYM A;  2CG6 A;  2G7I A;  4LOS A;  2JRA A;  1HFI A;  2RLP A;  3TVJ A;  2Y8R A;  3F6K A;  2V8E A;  1H2P P;  3GXE A;  1RLH A;  2QY0 A;  1E5G A;  2CG7 A;  1NWV A;  2X2Z A;  1FBR A;  1HCC A;  1UOT P;  2CKU A;  4FXG G;  3SW0 X;  3OP8 A;  3NFP I;  3OED C;  2XRD A;  3T5O A;  2MCZ A;  2RLQ A;  3M7P A;  1E8B A;  4CSY A;  2A55 A;  4A5W B;  1G4F A;  1QO6 A;  5FO8 C;  1LY2 A;  1MD7 A;  4YIZ A;  4J38 B;  2B5I D;  4AYD A;  1GKG A;  4AYI A;  2EC3 A;  1ZJK A;  2BZM A;  1G4G A;  2XRB A;  2W81 A;  3O8E B;  3EJH A;  3ZD2 A;  3K3T A;  3INB C;  4ZH1 D;  3RJ3 D;  1OJY A;  1HFH A;  3VWO A;  3MQL A;  2KRI A;  1Z92 B;  2ZYC A;  1U5M A;  3FGR A;  2ERJ A;  3NJA A;  3IX0 A;  1H04 P;  3ZLE A;  2EHF A;  3CI0 J;  1MD8 A;  1OJV A;  2UWN A;  4DJZ A;  1OK1 A;  4ONT D;  5I0Q B;  1GKN A;  3ERB A;  2Y8S A;  4B2S A;  2YRA A;  3OXU D;  1SS2 A;  4YNX A;  5DN4 A;  1VVC A;  3ZRZ A;  1GPZ A;  2O39 C;  1O9A A;  1OK3 A;  3WSY A;  2JGX A;  1VVD A;  1QUB A;  5JPM G;  2XWJ I;  4BWC A;  4KKD A;  1TPG A;  3L89 M;  5HYT B;  1QGB A;  1OK9 A;  2KMS A;  2LOJ A;  2RL0 A;  1C1Z A;  5HYU B;  2W80 A;  3FGT A;  1SRZ A;  1GHQ B;  2I2L A;  4JHS A;  5HYP A;  5HZP B;  4LOT A;  3GOV A;  4IGD A;  4MUC A;  2IZ3 A;  1H2Q P;  4N7E A;  3KXV A;  3ZLD A;  1ELV A;  1Q3X A;  5DN5 A;  2RKY A;  4K12 A;  1PPQ A;  4C16 A;  1OJW A;  3CAL A;  2RKZ A;  1CKL A;  4PZ5 A;  2IZ4 A;  2JGW A;  1TPM A;  3R62 A;  1E88 A;  4AYE A;  2XWB F;  2WII C;  4B2R A;  2Y8T A;  3ZD1 A;  2YBY A;  1OK2 A;  3IU3 I;  2MCY A;  4WJG 2;  3WSX A;  1H03 P;  4PO7 A;  4F4O C;  4MSL A;  2XQW C;  3KZJ A; 
#chains in the Genus database with same CATH homology
 1TPN A;  4AYM A;  2CG6 A;  2G7I A;  4LOS A;  2JRA A;  1HFI A;  2RLP A;  3TVJ A;  2V8E A;  1H2P P;  3GXE A;  2QY0 A;  1E5G A;  2CG7 A;  1NWV A;  1FBR A;  1HCC A;  1UOT P;  2CKU A;  4FXG G;  3SW0 X;  3OP8 A;  3NFP I;  3OED C;  2XRD A;  3T5O A;  2MCZ A;  2RLQ A;  3M7P A;  1E8B A;  4CSY A;  2A55 A;  4A5W B;  1G4F A;  1QO6 A;  5FO8 C;  1LY2 A;  1MD7 A;  4J38 B;  2B5I D;  4AYD A;  1GKG A;  4AYI A;  2EC3 A;  1ZJK A;  2BZM A;  1G4G A;  2XRB A;  2W81 A;  3O8E B;  3EJH A;  3ZD2 A;  3INB C;  4ZH1 D;  3RJ3 D;  1OJY A;  1HFH A;  3MQL A;  2KRI A;  1Z92 B;  1U5M A;  2ERJ A;  3IX0 A;  1H04 P;  2EHF A;  1MD8 A;  1OJV A;  2UWN A;  4DJZ A;  1OK1 A;  4ONT D;  5I0Q B;  1GKN A;  3ERB A;  4B2S A;  2YRA A;  3OXU D;  1SS2 A;  4YNX A;  3ZRZ A;  1VVC A;  1GPZ A;  2O39 C;  1O9A A;  1OK3 A;  2JGX A;  1VVD A;  1QUB A;  5JPM G;  2XWJ I;  4KKD A;  1TPG A;  3L89 M;  5HYT B;  1QGB A;  1OK9 A;  2KMS A;  2LOJ A;  2RL0 A;  1C1Z A;  5HYU B;  2W80 A;  1SRZ A;  1GHQ B;  4JHS A;  5HYP A;  5HZP B;  4LOT A;  3GOV A;  4IGD A;  4MUC A;  2IZ3 A;  1H2Q P;  3KXV A;  1ELV A;  1Q3X A;  2RKY A;  4K12 A;  1PPQ A;  4C16 A;  1OJW A;  3CAL A;  2RKZ A;  1CKL A;  4PZ5 A;  2IZ4 A;  2JGW A;  1TPM A;  3R62 A;  1E88 A;  4AYE A;  2XWB F;  2WII C;  4B2R A;  3ZD1 A;  2YBY A;  1OK2 A;  3IU3 I;  2MCY A;  4WJG 2;  1H03 P;  4F4O C;  2XQW C;  3KZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...