2BZRA

Crystal structure of accd5 (rv3280), an acyl-coa carboxylase beta- subunit from mycobacterium tuberculosis
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
528
structure length
512
Chain Sequence
b'DIHTTAGKLAELHKRREESLHPVGEDAVEKVHAKGKLTARERIYALLDEDSFVELDALAKHRSTNFNLGEKRPLGDGVVTGYGTIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQMFITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHYAASGEQDAFDYVRELLSYLPPNNSTDAPRYQAAAPTGPIEENLTDEDLELDTLIPDSPNQPYDMHEVITRLLDDEFLEIQAGYAQNIVVGFGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTDQEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAVGFVYRQQIDKLRLRLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGNVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
publication title Structural Diversity in the Six-Fold Redundant Set of Acyl-Coa Carboxyltransferases in Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 181
structure length 512
sequence length 528
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2bzrA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2bzrA01
3R6HA 5KJPA 3IAVA 5DZKA 3QK8A 3T88A 2W3PA 2HW5A 3MFMA 4Q1IA 4EMLA 1XNWA 1RJNA 4LK5A 4WYOB 4G2RA 3OT6A 3U9RB 3H81A 4FJWD 2VSUE 2EJ5A 3I47A 1N6EA 3OMEA 3R0OA 1HZDA 3PGQA 4KD6A 4ASIA 4I42A 1W2XA 1EF8A 2FZSA 3V5IA 4JCQA 4ELSA 1N6DA 5E0NX 3HINA 4JCRA 5DUFA 3GLMA 4U1AA 2D3TA 3FDUA 2J5IA 3SLLA 4Q0GA 3GF3A 4U0HA 3RSTA 1UYRA 1XX4A 3ISAA 4L6WA 3Q7HA 5C90A 1O8UA 3KQFA 3ZW9A 3P2LA 3V5EA 5DL1A 5INFA 2VSUA 1TYFA 4DI1A 1WDKA 4K29A 3TZ3A 1J7XA 2A7KA 2VSUC 3H02A 2ZL4A 3GKBA 2NP9A 5IKLB 4IZCA 2F6QA 3P85A 4FNBA 3IB9A 5JBWA 3H0JA 5KDRB 1UIYA 3Q0GA 4NEKA 3RSIA 1NZYA 2IEXA 5E0SH 3K8XA 4K2NA 4JCTA 3TV5A 4GM2A 2QQ3A 4B3HA 3ZW8A 3H0QA 3HRXA 1JXZA 2X24A 2J5II 3KTKA 3TT6A 3Q0JA 4QFEA 2J5GA 1WDMA 3T8BA 2ZQQA 2PPYA 4GHNA 3BPPA 3RRVA 2UZFA 4ELXA 1Q52A 3GMAA 1OD4A 1PIXA 4U19A 2VSSE 1EY3A 2A81A 4JVTA 2Q35A 4FN7A 2CBYA 2F9YB 3HE2A 4ZU2A 4HNKA 4QIIA 3M6NA 2J5GD 3QWDA 4I4ZA 5INGA 2PBPA 4NNQA 4ZDBA 4ZDEA 3ZWAA 5CTCA 2J5IB 3ZWBA 4WZ8B 3KTJA 1K32A 2PG8A 5G1RA 1EF9A 2VSSA 4JOTA 3H0UA 3PE8A 3MYBA 1UYTA 4U0GH 3U9TB 5DU4A 2DUBA 2F6IA 5CTBA 3MT6A 1MJ3A 3FF6A 1ON9A 5E0SA 1TG6A 1FC9A 2VSSF 3HLN1 2GTRA 4MOUA 4RYFA 1VRGA 2Q34A 4KPKA 1XO6A 4I52A 4JJTA 3ZWCA 3T8AA 5DKPA 2F9IA 2VSUF 3IBBA 4OMRA 4QIJA 4FZWA 4Z0MA 3TVUA 4HC8A 1UYVA 3L3SA 4FZWC 4JYLA 1SZOA 4RYFH 1Q51A 4B3JA 1FC7A 4JSBA 1RJMA 4IZBA 1OD2A 1XNYA 1DUBA 5KDRA 3STAA 3TT7A 2BZRA 5DUCA 2J5SA 3JU1A 4YLHA 3TVWA 4JWVA 3T3WA 3HP0A 1UYSA 2X58A 3R9TA 2A7SA 1K39A 3DORA 4KNPA 2Q2XA 1WZ8A 4KWBA 5C9GA 1DCIA 2DEOA 3Q1TA 3QREA 1SG4A 4JYJA 4ELWA 5FUSA 4U0GA 1ON3A 2VREA 3KTHA 3PEAA 1X0UA 4L8KA 4ZDCA 4U18A 4EMPA 2ZL0A 2VX2A 3U9SB 1YG8A 4MI2A 4OLQA 4MXIA 3KTGA 4F47A 5G1SA 3BEZA 4FN8A 4FNDA 3QXZA 2WTBA 4WCZA 3TDCA 2F9YA 5DZKH 3KTIA 1XNVA 3QYRA 3PZKA 5DU6A 2ZL3A 3DJAA 3T89A 1WDLA 1FCFA 3BF0A 3NJDA 3VIVA 3R9QA 2F9IB 2ZQRA 2FW2A 1NZYB 4JFCA 5JBXA 3TLFA 3MOYA 4ZDDA 5G1QA 1N6FA 4B3IA 3G64A 5FIFA 3OC7A 5DTWA 1HNOA 3H0SA 5DU8A 3N6RB 3M6MA 3LKEA 3LAOA 4ZDFA 3K50A 3NJBA 3GF7A 3QKAA 1Y7OA 3WG5A 5MGBA 3ST9A 1PJHA 5DTPA 5INIA 4FB8A 4K3WA 3QXIA 2FBMA 3QMJA 3P5MA 3R9SA 4RCNA 1FC6A 4JCSA 4EMMA 2ZL2A 2C8TA 4IZDA 3SWXA 2CE3A 1YG6A 4OG1A 3TRRA 1HNUA
chains in the Genus database with same CATH superfamily
3R6HA 5KJPA 3IAVA 5DZKA 3QK8A 3T88A 2W3PA 2HW5A 3MFMA 4Q1IA 4EMLA 1XNWA 1RJNA 4LK5A 4WYOB 4G2RA 3OT6A 3U9RB 3H81A 4FJWD 2VSUE 2EJ5A 3I47A 1N6EA 3OMEA 3R0OA 1HZDA 3PGQA 4KD6A 4ASIA 4I42A 1W2XA 1EF8A 2FZSA 3V5IA 4JCQA 4ELSA 1N6DA 5E0NX 3HINA 4JCRA 5DUFA 3GLMA 4U1AA 2D3TA 3FDUA 2J5IA 3SLLA 4Q0GA 3GF3A 4U0HA 3RSTA 1UYRA 1XX4A 3BPTA 3ISAA 4L6WA 3Q7HA 5C90A 1O8UA 2YJGA 3KQFA 3ZW9A 3P2LA 3V5EA 5DL1A 5INFA 2VSUA 1TYFA 4DI1A 1WDKA 4K29A 3TZ3A 1J7XA 2A7KA 2VSUC 3H02A 2ZL4A 3GKBA 2NP9A 5IKLB 4IZCA 2F6QA 3P85A 4FNBA 3IB9A 5JBWA 3H0JA 5KDRB 1UIYA 3Q0GA 4NEKA 3RSIA 1NZYA 2IEXA 5E0SH 3K8XA 4K2NA 4JCTA 3TV5A 4GM2A 2QQ3A 4B3HA 3ZW8A 3H0QA 3HRXA 1JXZA 2X24A 2J5II 3KTKA 4J2UA 3TT6A 4NARA 3Q0JA 4QFEA 2J5GA 1WDMA 3T8BA 2ZQQA 2PPYA 4GHNA 3BPPA 3RRVA 2UZFA 4ELXA 1Q52A 3GMAA 1OD4A 1PIXA 4U19A 2VSSE 1EY3A 2A81A 4JVTA 2Q35A 4FN7A 2CBYA 2F9YB 3HE2A 4ZU2A 4HNKA 4QIIA 3M6NA 2J5GD 3QWDA 4I4ZA 5INGA 2PBPA 4NNQA 4ZDBA 4ZDEA 3ZWAA 5CTCA 2J5IB 3ZWBA 4WZ8B 3KTJA 1K32A 2PG8A 5G1RA 1EF9A 2VSSA 4JOTA 3H0UA 3PE8A 3MYBA 1UYTA 4U0GH 3U9TB 5DU4A 2DUBA 2F6IA 5CTBA 3MT6A 1MJ3A 3FF6A 1ON9A 5E0SA 1TG6A 1FC9A 2VSSF 3HLN1 2GTRA 4MOUA 4RYFA 1VRGA 2Q34A 4KPKA 1XO6A 4I52A 4JJTA 3ZWCA 3T8AA 5DKPA 2F9IA 2VSUF 3IBBA 4OMRA 4QIJA 4FZWA 4Z0MA 3TVUA 4HC8A 1UYVA 3L3SA 4FZWC 4JYLA 1SZOA 4RYFH 1Q51A 4B3JA 1FC7A 4JSBA 1RJMA 4IZBA 1OD2A 1XNYA 1DUBA 5KDRA 3STAA 3TT7A 2BZRA 5DUCA 2J5SA 3JU1A 4YLHA 3TVWA 4JWVA 3T3WA 3HP0A 1UYSA 2X58A 3R9TA 2A7SA 1K39A 3DORA 4KNPA 2Q2XA 1WZ8A 4HDTA 4KWBA 5C9GA 1DCIA 2DEOA 3Q1TA 3QREA 1SG4A 4JYJA 4ELWA 5FUSA 4U0GA 1ON3A 2VREA 3KTHA 3PEAA 1X0UA 4L8KA 4ZDCA 4U18A 4EMPA 2ZL0A 2VX2A 3U9SB 1YG8A 4MI2A 4OLQA 4MXIA 3KTGA 4F47A 5G1SA 3BEZA 4FN8A 4FNDA 3QXZA 2WTBA 4WCZA 3TDCA 2F9YA 5DZKH 3KTIA 1XNVA 3QYRA 3PZKA 5DU6A 2ZL3A 3DJAA 3T89A 1WDLA 1FCFA 3BF0A 3NJDA 3VIVA 3R9QA 2F9IB 2ZQRA 2FW2A 1NZYB 4JFCA 5JBXA 3TLFA 3MOYA 4ZDDA 5G1QA 1N6FA 4B3IA 3G64A 5FIFA 3OC7A 5DTWA 1HNOA 3H0SA 5DU8A 3N6RB 3M6MA 3LKEA 3LAOA 4ZDFA 3K50A 3NJBA 3GF7A 3QKAA 1Y7OA 3WG5A 5MGBA 3ST9A 1PJHA 5DTPA 5INIA 4FB8A 4K3WA 3QXIA 2FBMA 3QMJA 3P5MA 3R9SA 4RCNA 1FC6A 5HUQA 4JCSA 4EMMA 2ZL2A 2C8TA 4IZDA 3SWXA 2CE3A 1YG6A 4OG1A 3TRRA 1HNUA
chains in the Genus database with same CATH topology
3R6HA 5KJPA 3IAVA 5DZKA 3QK8A 3T88A 2W3PA 2HW5A 3MFMA 4Q1IA 4EMLA 1XNWA 1RJNA 4LK5A 4WYOB 4G2RA 3OT6A 3U9RB 3H81A 4FJWD 2VSUE 2EJ5A 3I47A 1N6EA 3OMEA 3R0OA 1HZDA 3PGQA 4KD6A 4ASIA 4I42A 1W2XA 1EF8A 2FZSA 3V5IA 4JCQA 4ELSA 1N6DA 5E0NX 3HINA 4JCRA 5DUFA 3GLMA 4U1AA 2D3TA 3FDUA 2J5IA 3SLLA 4Q0GA 3GF3A 4U0HA 3RSTA 1UYRA 1XX4A 3BPTA 3ISAA 4L6WA 3Q7HA 5C90A 1O8UA 2YJGA 3KQFA 3ZW9A 3P2LA 3V5EA 5DL1A 5INFA 2VSUA 1TYFA 4DI1A 1WDKA 4K29A 3TZ3A 1J7XA 2A7KA 2VSUC 3H02A 2ZL4A 3GKBA 2NP9A 5IKLB 4IZCA 2F6QA 3P85A 4FNBA 3IB9A 5JBWA 3H0JA 5KDRB 1UIYA 3Q0GA 4NEKA 3RSIA 1NZYA 2IEXA 5E0SH 3K8XA 4K2NA 4JCTA 3TV5A 4GM2A 2QQ3A 4B3HA 3ZW8A 3H0QA 3HRXA 1JXZA 2X24A 2J5II 3KTKA 4J2UA 3TT6A 4NARA 3Q0JA 4QFEA 2J5GA 1WDMA 3T8BA 2ZQQA 2PPYA 4GHNA 3BPPA 3RRVA 2UZFA 4ELXA 1Q52A 3GMAA 1OD4A 1PIXA 4U19A 2VSSE 1EY3A 2A81A 4JVTA 2Q35A 4FN7A 2CBYA 2F9YB 3HE2A 4ZU2A 4HNKA 4QIIA 3M6NA 2J5GD 3QWDA 4I4ZA 5INGA 2PBPA 4NNQA 4ZDBA 4ZDEA 3ZWAA 5CTCA 2J5IB 3ZWBA 4WZ8B 3KTJA 1K32A 2PG8A 5G1RA 1EF9A 2VSSA 4JOTA 3H0UA 3PE8A 3MYBA 1UYTA 4U0GH 3U9TB 5DU4A 2DUBA 2F6IA 5CTBA 3MT6A 1MJ3A 3FF6A 1ON9A 5E0SA 1TG6A 1FC9A 2VSSF 3HLN1 2GTRA 4MOUA 4RYFA 1VRGA 2Q34A 4KPKA 1XO6A 4I52A 4JJTA 3ZWCA 3T8AA 5DKPA 2F9IA 2VSUF 3IBBA 4OMRA 4QIJA 4FZWA 4Z0MA 3TVUA 4HC8A 1UYVA 3L3SA 4FZWC 4JYLA 1SZOA 4RYFH 1Q51A 4B3JA 1FC7A 4JSBA 1RJMA 4IZBA 1OD2A 1XNYA 1DUBA 5KDRA 3STAA 3TT7A 2BZRA 5DUCA 2J5SA 3JU1A 4YLHA 3TVWA 4JWVA 3T3WA 3HP0A 1UYSA 2X58A 3R9TA 2A7SA 1K39A 3DORA 4KNPA 2Q2XA 1WZ8A 4HDTA 4KWBA 5C9GA 1DCIA 2DEOA 3Q1TA 3QREA 1SG4A 4JYJA 4ELWA 5FUSA 4U0GA 1ON3A 2VREA 3KTHA 3PEAA 1X0UA 4L8KA 4ZDCA 4U18A 4EMPA 2ZL0A 2VX2A 3U9SB 1YG8A 4MI2A 4OLQA 4MXIA 3KTGA 4F47A 5G1SA 3BEZA 4FN8A 4FNDA 3QXZA 2WTBA 4WCZA 3TDCA 2F9YA 5DZKH 3KTIA 1XNVA 3QYRA 3PZKA 5DU6A 2ZL3A 3DJAA 3T89A 1WDLA 1FCFA 3BF0A 3NJDA 3VIVA 3R9QA 2F9IB 2ZQRA 2FW2A 1NZYB 4JFCA 5JBXA 3TLFA 3MOYA 4ZDDA 5G1QA 1N6FA 4B3IA 3G64A 5FIFA 3OC7A 5DTWA 1HNOA 3H0SA 5DU8A 3N6RB 3M6MA 3LKEA 3LAOA 4ZDFA 3K50A 3NJBA 3GF7A 3QKAA 1Y7OA 3WG5A 5MGBA 3ST9A 1PJHA 5DTPA 5INIA 4FB8A 4K3WA 3QXIA 2FBMA 3QMJA 3P5MA 3R9SA 4RCNA 1FC6A 5HUQA 4JCSA 4EMMA 2ZL2A 2C8TA 4IZDA 3SWXA 2CE3A 1YG6A 4OG1A 3TRRA 1HNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6H A;  5KJP A;  3IAV A;  5DZK A;  3QK8 A;  3T88 A;  2W3P A;  2HW5 A;  3MFM A;  4Q1I A;  4EML A;  1XNW A;  1RJN A;  4LK5 A;  4WYO B;  4G2R A;  3OT6 A;  3U9R B;  3H81 A;  4FJW D;  2VSU E;  2EJ5 A;  3I47 A;  1N6E A;  3OME A;  3R0O A;  1HZD A;  3PGQ A;  4KD6 A;  4ASI A;  4I42 A;  1W2X A;  1EF8 A;  2FZS A;  3V5I A;  4JCQ A;  4ELS A;  1N6D A;  5E0N X;  3HIN A;  4JCR A;  5DUF A;  3GLM A;  4U1A A;  2D3T A;  3FDU A;  2J5I A;  3SLL A;  4Q0G A;  3GF3 A;  4U0H A;  3RST A;  1UYR A;  1XX4 A;  3ISA A;  4L6W A;  3Q7H A;  5C90 A;  1O8U A;  3KQF A;  3ZW9 A;  3P2L A;  3V5E A;  5DL1 A;  5INF A;  2VSU A;  1TYF A;  4DI1 A;  1WDK A;  4K29 A;  3TZ3 A;  1J7X A;  2A7K A;  2VSU C;  3H02 A;  2ZL4 A;  3GKB A;  2NP9 A;  5IKL B;  4IZC A;  2F6Q A;  3P85 A;  4FNB A;  3IB9 A;  5JBW A;  3H0J A;  5KDR B;  1UIY A;  3Q0G A;  4NEK A;  3RSI A;  1NZY A;  2IEX A;  5E0S H;  3K8X A;  4K2N A;  4JCT A;  3TV5 A;  4GM2 A;  2QQ3 A;  4B3H A;  3ZW8 A;  3H0Q A;  3HRX A;  1JXZ A;  2X24 A;  2J5I I;  3KTK A;  3TT6 A;  3Q0J A;  4QFE A;  2J5G A;  1WDM A;  3T8B A;  2ZQQ A;  2PPY A;  4GHN A;  3BPP A;  3RRV A;  2UZF A;  4ELX A;  1Q52 A;  3GMA A;  1OD4 A;  1PIX A;  4U19 A;  2VSS E;  1EY3 A;  2A81 A;  4JVT A;  2Q35 A;  4FN7 A;  2CBY A;  2F9Y B;  3HE2 A;  4ZU2 A;  4HNK A;  4QII A;  3M6N A;  2J5G D;  3QWD A;  4I4Z A;  5ING A;  2PBP A;  4NNQ A;  4ZDB A;  4ZDE A;  3ZWA A;  5CTC A;  2J5I B;  3ZWB A;  4WZ8 B;  3KTJ A;  1K32 A;  2PG8 A;  5G1R A;  1EF9 A;  2VSS A;  4JOT A;  3H0U A;  3PE8 A;  3MYB A;  1UYT A;  4U0G H;  3U9T B;  5DU4 A;  2DUB A;  2F6I A;  5CTB A;  3MT6 A;  1MJ3 A;  3FF6 A;  1ON9 A;  5E0S A;  1TG6 A;  1FC9 A;  2VSS F;  3HLN 1;  2GTR A;  4MOU A;  4RYF A;  1VRG A;  2Q34 A;  4KPK A;  1XO6 A;  4I52 A;  4JJT A;  3ZWC A;  3T8A A;  5DKP A;  2F9I A;  2VSU F;  3IBB A;  4OMR A;  4QIJ A;  4FZW A;  4Z0M A;  3TVU A;  4HC8 A;  1UYV A;  3L3S A;  4FZW C;  4JYL A;  1SZO A;  4RYF H;  1Q51 A;  4B3J A;  1FC7 A;  4JSB A;  1RJM A;  4IZB A;  1OD2 A;  1XNY A;  1DUB A;  5KDR A;  3STA A;  3TT7 A;  2BZR A;  5DUC A;  2J5S A;  3JU1 A;  4YLH A;  3TVW A;  4JWV A;  3T3W A;  3HP0 A;  1UYS A;  2X58 A;  3R9T A;  2A7S A;  1K39 A;  3DOR A;  4KNP A;  2Q2X A;  1WZ8 A;  4KWB A;  5C9G A;  1DCI A;  2DEO A;  3Q1T A;  3QRE A;  1SG4 A;  4JYJ A;  4ELW A;  5FUS A;  4U0G A;  1ON3 A;  2VRE A;  3KTH A;  3PEA A;  1X0U A;  4L8K A;  4ZDC A;  4U18 A;  4EMP A;  2ZL0 A;  2VX2 A;  3U9S B;  1YG8 A;  4MI2 A;  4OLQ A;  4MXI A;  3KTG A;  4F47 A;  5G1S A;  3BEZ A;  4FN8 A;  4FND A;  3QXZ A;  2WTB A;  4WCZ A;  3TDC A;  2F9Y A;  5DZK H;  3KTI A;  1XNV A;  3QYR A;  3PZK A;  5DU6 A;  2ZL3 A;  3DJA A;  3T89 A;  1WDL A;  1FCF A;  3BF0 A;  3NJD A;  3VIV A;  3R9Q A;  2F9I B;  2ZQR A;  2FW2 A;  1NZY B;  4JFC A;  5JBX A;  3TLF A;  3MOY A;  4ZDD A;  5G1Q A;  1N6F A;  4B3I A;  3G64 A;  5FIF A;  3OC7 A;  5DTW A;  1HNO A;  3H0S A;  5DU8 A;  3N6R B;  3M6M A;  3LKE A;  3LAO A;  4ZDF A;  3K50 A;  3NJB A;  3GF7 A;  3QKA A;  1Y7O A;  3WG5 A;  5MGB A;  3ST9 A;  1PJH A;  5DTP A;  5INI A;  4FB8 A;  4K3W A;  3QXI A;  2FBM A;  3QMJ A;  3P5M A;  3R9S A;  4RCN A;  1FC6 A;  4JCS A;  4EMM A;  2ZL2 A;  2C8T A;  4IZD A;  3SWX A;  2CE3 A;  1YG6 A;  4OG1 A;  3TRR A;  1HNU A; 
#chains in the Genus database with same CATH topology
 3R6H A;  5KJP A;  3IAV A;  5DZK A;  3QK8 A;  3T88 A;  2W3P A;  2HW5 A;  3MFM A;  4Q1I A;  4EML A;  1XNW A;  1RJN A;  4LK5 A;  4WYO B;  4G2R A;  3OT6 A;  3U9R B;  3H81 A;  4FJW D;  2VSU E;  2EJ5 A;  3I47 A;  1N6E A;  3OME A;  3R0O A;  1HZD A;  3PGQ A;  4KD6 A;  4ASI A;  4I42 A;  1W2X A;  1EF8 A;  2FZS A;  3V5I A;  4JCQ A;  4ELS A;  1N6D A;  5E0N X;  3HIN A;  4JCR A;  5DUF A;  3GLM A;  4U1A A;  2D3T A;  3FDU A;  2J5I A;  3SLL A;  4Q0G A;  3GF3 A;  4U0H A;  3RST A;  1UYR A;  1XX4 A;  3BPT A;  3ISA A;  4L6W A;  3Q7H A;  5C90 A;  1O8U A;  2YJG A;  3KQF A;  3ZW9 A;  3P2L A;  3V5E A;  5DL1 A;  5INF A;  2VSU A;  1TYF A;  4DI1 A;  1WDK A;  4K29 A;  3TZ3 A;  1J7X A;  2A7K A;  2VSU C;  3H02 A;  2ZL4 A;  3GKB A;  2NP9 A;  5IKL B;  4IZC A;  2F6Q A;  3P85 A;  4FNB A;  3IB9 A;  5JBW A;  3H0J A;  5KDR B;  1UIY A;  3Q0G A;  4NEK A;  3RSI A;  1NZY A;  2IEX A;  5E0S H;  3K8X A;  4K2N A;  4JCT A;  3TV5 A;  4GM2 A;  2QQ3 A;  4B3H A;  3ZW8 A;  3H0Q A;  3HRX A;  1JXZ A;  2X24 A;  2J5I I;  3KTK A;  4J2U A;  3TT6 A;  4NAR A;  3Q0J A;  4QFE A;  2J5G A;  1WDM A;  3T8B A;  2ZQQ A;  2PPY A;  4GHN A;  3BPP A;  3RRV A;  2UZF A;  4ELX A;  1Q52 A;  3GMA A;  1OD4 A;  1PIX A;  4U19 A;  2VSS E;  1EY3 A;  2A81 A;  4JVT A;  2Q35 A;  4FN7 A;  2CBY A;  2F9Y B;  3HE2 A;  4ZU2 A;  4HNK A;  4QII A;  3M6N A;  2J5G D;  3QWD A;  4I4Z A;  5ING A;  2PBP A;  4NNQ A;  4ZDB A;  4ZDE A;  3ZWA A;  5CTC A;  2J5I B;  3ZWB A;  4WZ8 B;  3KTJ A;  1K32 A;  2PG8 A;  5G1R A;  1EF9 A;  2VSS A;  4JOT A;  3H0U A;  3PE8 A;  3MYB A;  1UYT A;  4U0G H;  3U9T B;  5DU4 A;  2DUB A;  2F6I A;  5CTB A;  3MT6 A;  1MJ3 A;  3FF6 A;  1ON9 A;  5E0S A;  1TG6 A;  1FC9 A;  2VSS F;  3HLN 1;  2GTR A;  4MOU A;  4RYF A;  1VRG A;  2Q34 A;  4KPK A;  1XO6 A;  4I52 A;  4JJT A;  3ZWC A;  3T8A A;  5DKP A;  2F9I A;  2VSU F;  3IBB A;  4OMR A;  4QIJ A;  4FZW A;  4Z0M A;  3TVU A;  4HC8 A;  1UYV A;  3L3S A;  4FZW C;  4JYL A;  1SZO A;  4RYF H;  1Q51 A;  4B3J A;  1FC7 A;  4JSB A;  1RJM A;  4IZB A;  1OD2 A;  1XNY A;  1DUB A;  5KDR A;  3STA A;  3TT7 A;  2BZR A;  5DUC A;  2J5S A;  3JU1 A;  4YLH A;  3TVW A;  4JWV A;  3T3W A;  3HP0 A;  1UYS A;  2X58 A;  3R9T A;  2A7S A;  1K39 A;  3DOR A;  4KNP A;  2Q2X A;  1WZ8 A;  4HDT A;  4KWB A;  5C9G A;  1DCI A;  2DEO A;  3Q1T A;  3QRE A;  1SG4 A;  4JYJ A;  4ELW A;  5FUS A;  4U0G A;  1ON3 A;  2VRE A;  3KTH A;  3PEA A;  1X0U A;  4L8K A;  4ZDC A;  4U18 A;  4EMP A;  2ZL0 A;  2VX2 A;  3U9S B;  1YG8 A;  4MI2 A;  4OLQ A;  4MXI A;  3KTG A;  4F47 A;  5G1S A;  3BEZ A;  4FN8 A;  4FND A;  3QXZ A;  2WTB A;  4WCZ A;  3TDC A;  2F9Y A;  5DZK H;  3KTI A;  1XNV A;  3QYR A;  3PZK A;  5DU6 A;  2ZL3 A;  3DJA A;  3T89 A;  1WDL A;  1FCF A;  3BF0 A;  3NJD A;  3VIV A;  3R9Q A;  2F9I B;  2ZQR A;  2FW2 A;  1NZY B;  4JFC A;  5JBX A;  3TLF A;  3MOY A;  4ZDD A;  5G1Q A;  1N6F A;  4B3I A;  3G64 A;  5FIF A;  3OC7 A;  5DTW A;  1HNO A;  3H0S A;  5DU8 A;  3N6R B;  3M6M A;  3LKE A;  3LAO A;  4ZDF A;  3K50 A;  3NJB A;  3GF7 A;  3QKA A;  1Y7O A;  3WG5 A;  5MGB A;  3ST9 A;  1PJH A;  5DTP A;  5INI A;  4FB8 A;  4K3W A;  3QXI A;  2FBM A;  3QMJ A;  3P5M A;  3R9S A;  4RCN A;  1FC6 A;  5HUQ A;  4JCS A;  4EMM A;  2ZL2 A;  2C8T A;  4IZD A;  3SWX A;  2CE3 A;  1YG6 A;  4OG1 A;  3TRR A;  1HNU A; 
#chains in the Genus database with same CATH homology
 3R6H A;  5KJP A;  3IAV A;  5DZK A;  3QK8 A;  3T88 A;  2W3P A;  2HW5 A;  3MFM A;  4Q1I A;  4EML A;  1XNW A;  1RJN A;  4LK5 A;  4WYO B;  4G2R A;  3OT6 A;  3U9R B;  3H81 A;  4FJW D;  2VSU E;  2EJ5 A;  3I47 A;  1N6E A;  3OME A;  3R0O A;  1HZD A;  3PGQ A;  4KD6 A;  4ASI A;  4I42 A;  1W2X A;  1EF8 A;  2FZS A;  3V5I A;  4JCQ A;  4ELS A;  1N6D A;  5E0N X;  3HIN A;  4JCR A;  5DUF A;  3GLM A;  4U1A A;  2D3T A;  3FDU A;  2J5I A;  3SLL A;  4Q0G A;  3GF3 A;  4U0H A;  3RST A;  1UYR A;  1XX4 A;  3BPT A;  3ISA A;  4L6W A;  3Q7H A;  5C90 A;  1O8U A;  2YJG A;  3KQF A;  3ZW9 A;  3P2L A;  3V5E A;  5DL1 A;  5INF A;  2VSU A;  1TYF A;  4DI1 A;  1WDK A;  4K29 A;  3TZ3 A;  1J7X A;  2A7K A;  2VSU C;  3H02 A;  2ZL4 A;  3GKB A;  2NP9 A;  5IKL B;  4IZC A;  2F6Q A;  3P85 A;  4FNB A;  3IB9 A;  5JBW A;  3H0J A;  5KDR B;  1UIY A;  3Q0G A;  4NEK A;  3RSI A;  1NZY A;  2IEX A;  5E0S H;  3K8X A;  4K2N A;  4JCT A;  3TV5 A;  4GM2 A;  2QQ3 A;  4B3H A;  3ZW8 A;  3H0Q A;  3HRX A;  1JXZ A;  2X24 A;  2J5I I;  3KTK A;  4J2U A;  3TT6 A;  4NAR A;  3Q0J A;  4QFE A;  2J5G A;  1WDM A;  3T8B A;  2ZQQ A;  2PPY A;  4GHN A;  3BPP A;  3RRV A;  2UZF A;  4ELX A;  1Q52 A;  3GMA A;  1OD4 A;  1PIX A;  4U19 A;  2VSS E;  1EY3 A;  2A81 A;  4JVT A;  2Q35 A;  4FN7 A;  2CBY A;  2F9Y B;  3HE2 A;  4ZU2 A;  4HNK A;  4QII A;  3M6N A;  2J5G D;  3QWD A;  4I4Z A;  5ING A;  2PBP A;  4NNQ A;  4ZDB A;  4ZDE A;  3ZWA A;  5CTC A;  2J5I B;  3ZWB A;  4WZ8 B;  3KTJ A;  1K32 A;  2PG8 A;  5G1R A;  1EF9 A;  2VSS A;  4JOT A;  3H0U A;  3PE8 A;  3MYB A;  1UYT A;  4U0G H;  3U9T B;  5DU4 A;  2DUB A;  2F6I A;  5CTB A;  3MT6 A;  1MJ3 A;  3FF6 A;  1ON9 A;  5E0S A;  1TG6 A;  1FC9 A;  2VSS F;  3HLN 1;  2GTR A;  4MOU A;  4RYF A;  1VRG A;  2Q34 A;  4KPK A;  1XO6 A;  4I52 A;  4JJT A;  3ZWC A;  3T8A A;  5DKP A;  2F9I A;  2VSU F;  3IBB A;  4OMR A;  4QIJ A;  4FZW A;  4Z0M A;  3TVU A;  4HC8 A;  1UYV A;  3L3S A;  4FZW C;  4JYL A;  1SZO A;  4RYF H;  1Q51 A;  4B3J A;  1FC7 A;  4JSB A;  1RJM A;  4IZB A;  1OD2 A;  1XNY A;  1DUB A;  5KDR A;  3STA A;  3TT7 A;  2BZR A;  5DUC A;  2J5S A;  3JU1 A;  4YLH A;  3TVW A;  4JWV A;  3T3W A;  3HP0 A;  1UYS A;  2X58 A;  3R9T A;  2A7S A;  1K39 A;  3DOR A;  4KNP A;  2Q2X A;  1WZ8 A;  4HDT A;  4KWB A;  5C9G A;  1DCI A;  2DEO A;  3Q1T A;  3QRE A;  1SG4 A;  4JYJ A;  4ELW A;  5FUS A;  4U0G A;  1ON3 A;  2VRE A;  3KTH A;  3PEA A;  1X0U A;  4L8K A;  4ZDC A;  4U18 A;  4EMP A;  2ZL0 A;  2VX2 A;  3U9S B;  1YG8 A;  4MI2 A;  4OLQ A;  4MXI A;  3KTG A;  4F47 A;  5G1S A;  3BEZ A;  4FN8 A;  4FND A;  3QXZ A;  2WTB A;  4WCZ A;  3TDC A;  2F9Y A;  5DZK H;  3KTI A;  1XNV A;  3QYR A;  3PZK A;  5DU6 A;  2ZL3 A;  3DJA A;  3T89 A;  1WDL A;  1FCF A;  3BF0 A;  3NJD A;  3VIV A;  3R9Q A;  2F9I B;  2ZQR A;  2FW2 A;  1NZY B;  4JFC A;  5JBX A;  3TLF A;  3MOY A;  4ZDD A;  5G1Q A;  1N6F A;  4B3I A;  3G64 A;  5FIF A;  3OC7 A;  5DTW A;  1HNO A;  3H0S A;  5DU8 A;  3N6R B;  3M6M A;  3LKE A;  3LAO A;  4ZDF A;  3K50 A;  3NJB A;  3GF7 A;  3QKA A;  1Y7O A;  3WG5 A;  5MGB A;  3ST9 A;  1PJH A;  5DTP A;  5INI A;  4FB8 A;  4K3W A;  3QXI A;  2FBM A;  3QMJ A;  3P5M A;  3R9S A;  4RCN A;  1FC6 A;  5HUQ A;  4JCS A;  4EMM A;  2ZL2 A;  2C8T A;  4IZD A;  3SWX A;  2CE3 A;  1YG6 A;  4OG1 A;  3TRR A;  1HNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...