2BZYA

Homodimer of crkl-sh3c domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
PVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRK-LIKE PROTEIN
publication title The C-Terminal SH3 Domain of Crkl as a Dynamic Dimerization Module Transiently Exposing a Nuclear Export Signal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 5
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bzyA00
3ZL7C 1YN8A 1M30A 1AEYA 3M0SA 4IIMA 1AVZC 3PVLA 1N5ZA 1AWOA 1PKTA 4AG2C 1W70A 2KYBA 1NEGA 1SHFA 1YP5A 2A28A 2EW3A 3H0HA 1U3OA 5IHKA 2LQWA 2JMCA 2RMOA 2RPNA 1YCSB 1B3QA 3RBBB 1W1FA 2RQRA 2MCNA 4A63B 1QWFA 1H92A 2EYYA 1HSQA 1K0XA 1I1JA 4LUEA 4JJDA 2CH4A 1K1ZA 2CREA 2CSIA 2LJ3A 2W0ZA 1V1CA 2VKNA 2LP5A 2LNHB 2HDAA 2RQTA 1M3CA 4E6RA 2DBKA 3JV3A 1UJ0A 2LMJA 2EGCA 2K3BA 1JO8A 2L3PA 2HSPA 2CH4W 3EG1A 1K0SA 2DL5A 2F2WA 2AKKA 2KXDA 1ZBJA 2G6FX 1G2BA 2J6FA 3C0CA 4FSSA 2SRCA 1AWJA 1B07A 2MIOA 4HVWA 2DL4A 5IXFA 3VRZA 1T3SA 2NUZA 4KRTA 2YSQA 2JMAA 4JZ4A 2O2OA 1UG1A 2FRYA 2QDLA 2BTTA 1E6GA 1AZGB 2HEQA 2FPDA 1Y0MA 2YDLA 4RUGA 1S1NA 1E7OA 1JU5C 4QT7A 1AD5A 1KFZA 5ECAA 1SPKA 4LNPA 2DRMA 3EGUA 4RTXA 1CKAA 3NPFA 4GBQA 1Z9QA 2JS2A 2HCKA 2L0AA 4J9HA 4J9DA 4J9IA 1RI9A 1ZUYA 5IXBA 2EYZA 2LQNA 2KR3A 3NHNA 4IIOA 1EFNA 3CQTA 1U5SA 2C0OA 2DF6A 1NYFA 2RF0A 2GBQA 3M0TA 4AFUC 2D8JA 4R0KA 2YUNA 1T3LA 2JTEA 1Z9ZA 1UJYA 3FJ5A 2VVKA 3UA7A 2HBWA 1FYNA 4HVVA 2XMFA 2KGTA 1WIEA 5FWCA 2O31A 3NMZC 2FG0A 1PKSA 3TVTA 3REBB 5HCKA 4AFSC 2K9GA 1X2QA 1I0CA 4CC7A 1UECA 1E6HA 2F2VA 1ZUUA 4OMNA 2EKHA 2C0TA 2ROLA 3EHRA 1WLPB 5IHNA 2I0NA 4OMOA 5FW9A 1M3BA 4D8DA 2GQIA 2EVRA 3RNJA 2O88A 1Y57A 2YUOA 1SHGA 1JXOA 2FRWA 4J9FA 4AFZC 1X6GA 2LX7A 3I5SA 1AOJA 1LCKA 1WXBA 4JZ3A 4Y92A 1GCQC 2O9SA 4ESRA 1AWXA 4F17A 2X3WD 2PZ1A 2DVJA 3VS4A 1NLPC 2ED1A 2AZVA 2AK5A 4RTWA 1RUWA 2LJ1A 3VS3A 2B86A 2RQVA 4OMQA 3VRYA 1M27C 3GBQA 2LCSA 1CKBA 4CC2A 2CUDA 2OI3A 3LH5A 4J9CA 2A08A 2KNBB 4ZNXA 2DMOA 4CC4B 3UF4A 2O9VA 2F2XA 3VS2A 1HD3A 4DEXA 1NEBA 3M0RA 2KT8A 3UATA 1WXUA 1SEMA 2AZSA 2ED0A 3SHWA 2W10A 2ROTA 2DM1A 1CSKA 3IQLA 3TSZA 3THKA 4X1VA 3PE0A 2OJ2A 2YT6A 2DLPA 2RNAA 1T0HA 2EGAA 3A98A 4F16A 1H8KA 1QKXA 2E5KA 1X2KA 2JM9A 4LN2A 2FPEA 2EYWA 2ENMA 2GTOA 2L2PA 5FWBA 1BB9A 2EPDA 1MUZA 4HCKA 1TUDA 1MV3A 2ECZA 2KEAA 2CT4A 1UHFA 2DA9A 1K9AA 2KRSA 2CUBA 3QWXX 1J3TA 1GBRA 2BZYA 2KT1A 3H0IA 4RTYA 4Z88A 3NGPA 4HXJA 1GBQA 5L23A 2FO0A 3EG3A 2L3QA 1UFFA 2GTJA 3QWYA 2ABLA 2EBPA 1GCPA 3ULRB 1PRMC 1KJWA 1W6XA 1QKWA 4HVUA 3VS5A 4CC3A 2EYXA 2CSQA 1H3HA 3EG2A 4LUDA 3REAB 5EC7A 2LJ0A 2DL7A 2J05A 2K2MA 2FEIA 2VWFA 2DRKA 3R6NA 1X43A 2P4RA 2DX1A 1TG0A 1VYUA 2DBMA 1OPKA 1WFWA 1VYTA 4RTVA 1JEGA 1HJDA 1A0NB 3I9QA 4AFQC 1BU1A 2KYMA 1NM7A 4Z8AA 1RLPC 1ARKA 2H8HA 1SSHA 1QLYA 3KFVA 1AZEA 1UDLA 1X6BA 2X3XD 1UUEA 4OMLA 2EGEA 2GGRA 3I35A 1VA7A 2J6KA 3PVQA 3UA6A 1SRLA 3VS0A 2ESWA 3M0PA 2GNCA 1PHTA 4J9EA 2K79A 2KROA 1WA7A 3U23A 1RLQC 2D0NA 3H0FA 1JQQA 5I11A 4J9GA 4RTTA 1NLOC 1IO6A 1TUCA 2JW4A 4JPBW 4M4ZA 2JT4A 1M3AA 2DL8A 1K4US 2D1XA 1NYGA 1PNJA 1WI7A 2PTKA 1NG2A 1XOVA 2A36A 2MOXA 2OAWA 4RTZA 1UHCA 2J7IA 4OMMA 5GJVB 3VS1A 1M8MA 1AWWA 2V1QA 2K6DA 2BZXA 4F14A 1OEBA 4RTUA 1U06A 1KIKA 1UE9A 2EQIA 4GLMA 2M51A 1K76A 1YWOA 2DE0X 2DILA 3VS7A 1WXTA 4JJBA 5IHIA 1QWEA 1ZUKA 2DJQA 3M0QA 1VYVA 1SRMA 2NWMA 3SEMA 1GFDA 1GCQA 2IIMA 2RN8A 2PNIA 4K11A 1BK2A 1OPLA 1X27A 1BBZA 1WDXA 2YUPA 2CT3A 1G83A 1T0JA 1ABOA 1I07A 1OV3A 4AG1C 2JS0A 2KBTA 2KRNA 1ABQA 1WYXA 2LZ6B 1ZLMA 1GRIA 4JJCA 1GFCA 1X69A 3O5ZA 1MV0B 2CDTA 1UGVA 2J06A 2KXCA 5IH2A 1YNZA 1ZSGA 1GL5A 3VS6A 2KE9A 1PRLC 2V1RA 2K7AA 2DNUA 2AKLA 1WX6A 3EHQA 2M0YA 2JXBA 4Z89A 3H41A 1JXMA 2BZ8A 1PWTA 2A37A 4EIKA 2YUQA 4WCIA 1KSWA 2D8HA 2C0IA 1QCFA 2FPFA 1YWPA 5I22A 2RQWA 3I5RA 4DEYA 2SEMA 4OMPA 2JM8A 1OOTA 3TSWA 3M0UA 4J9BA 2DL3A 1UTIA 2DYBA 2J6OA 5GJWB 2RQUA 3EG0A 1ZX6A 4ORZA 4D8KA 2KRMA 1FMKA 2L3SA 4LE9A
chains in the Genus database with same CATH superfamily
4HT9A 1NBEB 4IIMA 1AVZC 1LJOA 3M5AA 3CMET 4M7AB 1NEGA 2IVWA 3CBOA 4F7UB 3JB9I 3JCMQ 4C8QA 3OQ5A 2JMCA 4C92B 5FLXE 2RQRA 1QWFA 2RHYA 3VUZA 5KYWB 1M8VA 1H92A 1HSQA 3H9NA 4IUVA 2YRCA 3I55T 4X9CA 3CD6Q 2CP6A 2CREA 1M9SA 1KD1R 2CSIA 3JCMh 2CP0A 2LNHB 2KAFA 4E6RA 3CCEA 2DBKA 1PC0A 5GAMh 1JO8A 1PSFA 2V26A 2AKKA 2KXDA 1G2BA 5CIUA 3H8ZA 4XTXA 5LJ5f 2QA4Q 1KC8C 1C0MA 3HKSA 2DL4A 5IXFA 3NFCA 3VRZA 3OS1A 4DOVA 3MEWA 2NUZA 5KE3A 1E6GA 3H6ZA 1N8RC 1M1KU 1Y0MA 3PFSA 2YDLA 1VQ6A 1Y71A 4J6WA 3VYHB 1ZA2B 1IRXA 3TCJA 2RI3A 3CCVQ 3CC7T 2YHTA 3TREA 4J83A 4M7AA 1CKAA 4GBQA 1Z9QA 4M75E 2HCKA 4F7UA 3UWNA 3JCMc 3TEEA 4J9IA 4ZN1A 5KH6A 2OTLQ 1Y96B 5FU7C 4IURA 5IXBA 5KYWA 1VQPA 2KR3A 4GLKA 1OYXA 3NHNA 1EFNA 2LQKA 2V8IA 3CQTA 4AFUC 2DJZA 2HL3A 3J7AF 5CCAA 3OBYA 2XMFA 3OBWA 4NS5A 1I5LA 3L2RA 4M77A 3NMZC 1JJ2S 4HCBA 2RO0A 2OTJT 4RKUE 1B34A 2NYSA 3CCQA 1PD0A 1OULA 1GXIE 3SFMA 1X2QA 2P0PA 4LDWA 1QVPA 2RB6A 1WHLA 4PFOA 1UECA 3CPWS 1E6HA 2EKHA 1BYMA 2DETA 2ROLA 3CCQQ 1JB0E 1WLPB 4OMOA 4D8DA 2FZCB 3MPUB 2EVRA 2LT4A 3RNJA 3JCMe 1Y57A 2YUOA 5GANh 3G7ZA 4AFZC 1X6GA 2LX7A 4E7ZA 3V7SA 1AOJA 3JCMW 1YCYA 4FIBA 3CC7A 1K9MR 1AWXA 2ZCFB 4F17A 2X3WD 2DVJA 2P4TA 2M1HA 3VS4A 2AZVA 3WVEB 2XK0A 3RDVA 3SD4A 4RTWA 3CC4Q 2QQBA 1VQNQ 2LCLA 3CCUT 2RI5A 2KK4A 1RACB 3S3MA 4OMQA 3WXMB 1JJ2A 3FRNA 2LCSA 1S72A 1VQOQ 4FW1A 2CUDA 2G3RA 4FSXA 4ME7A 2E70A 4ZNXA 3CPWA 2F2XA 3CPFA 1S72Q 2ED0A 2V8JA 3G1JA 2OTJA 2R58A 2W10A 1Q86U 5LJ3g 3IQLA 3URGA 3JB9H 3S3OA 4X1VA 5AT1B 2XKOC 2YT6A 3DKMA 9ATCB 1QVFS 2DO3A 1VQMQ 2YXYA 3HFNA 1LVKA 2EGAA 1U1TA 1H8KA 4PLLA 4LN2A 8ATCB 1EX4A 4P5NA 1TWBA 1VQKA 4PFPA 4A53A 2L2PA 5FWBA 4NL2A 4RG2A 3QYHB 4HCKA 1VQ5T 3BE3A 4M75D 1G8XA 4C8QC 2F1LA 3QWXX 1GBRA 5LJ5h 2EJGA 1J3TA 3CCSA 1Q7YC 2K57A 1GBQA 2FO0A 3LGFA 2DXCA 2KQWA 1PRMC 3ULRB 4HVUA 1QKWA 3EGXB 1KQSA 1TXQA 1D0ZA 4CC3A 5CKEA 2JNGA 1K8AC 2EYXA 2CSQA 3REAB 1MMGA 1FXXA 2VWFA 4PJOE 3R6NA 1X43A 2DX1A 5GANe 3QDRB 4QQDA 4BACA 4E7KA 2DBMA 1OPKA 4J6XA 1QVFA 4FYXB 1AT1B 3HP9A 3ME9A 4M78D 1JEGA 3HRTA 3EG9A 3SWNB 2MWOA 3CCLT 1A0NB 3I56Q 3CC2Q 4BI3A 4FT4A 3HRSA 3EFOB 2H8HA 2NUTA 1X6BA 2LNVA 2VGNA 2EGEA 4M75B 1VA7A 2J6KA 2ESWA 3VV0A 2GNCA 2R57A 3QZ9B 4CI0C 1NE8A 3OY9A 2K79A 1MHNA 2RI2A 3TQ7P 4RCCA 1JQQA 1IREB 4M7AC 2E3IA 2A3LA 2IPOB 1TUGB 3OS2A 4RTTA 1NLOC 2E5QA 3PT9A 1ACMB 1M3AA 5EG2A 2DL8A 1K4US 2XDPA 1UB4A 1RAGB 1KC8U 3OMCA 1WI7A 2PTKA 1VQ7Q 4KBMB 4EDUA 1ZSZA 4EMGA 1NG2A 1XOVA 2MOXA 2MMPA 4ZGEB 1MGQA 4HA8A 2J7IA 4OMMA 3VS1A 1M8MA 1N8RU 1YIJA 2YWWA 1YJNA 4M7DD 2L89A 2K6DA 4M78B 3L2WA 4RTUA 4C92G 1UE9A 4M77C 1KIKA 1SKUB 3RIRA 1NPRA 1QWEA 2QTVA 3CCMQ 2DJQA 1AHJB 3AHUA 1VYVA 3CCLA 4M7AE 2NWMA 3SWNA 3PGGA 1M90C 2PNIA 2P0KA 1WDXA 3EFOA 2X9HA 1OV3A 4PK4A 2XIDA 1ABQA 2EFIA 5A2QE 3OYFA 4A4KA 5I2MA 2CDTA 2J06A 1ZSGA 3VS6A 1WJQA 3Q1JA 2K7AA 3HTRA 1R0CB 2AKLA 2JN0A 2MI6A 3D7SB 3VYGA 2O01E 3M4GA 1QW1A 1PWTA 4M77E 4EIKA 2YUQA 4WCIA 2QEXT 2PQWA 3QO3A 2C0IA 2GF7A 4M7DB 4PJOD 1B7TA 5HK0A 4DEYA 4OMPA 4IUUA 3LWIA 4MDXA 3CXCP 5HK3A 2KI7A 4IUQA 3M54A 1IZ6A 2KRMA 5GMKe 4M78A 2L3SA 4B9WA 3P8BB 1PSEA 2QTXA 3PTAA 4LD6A 1QMCA 2KYBA 4FYVB 3A8LB 3LGLA 4XU3A 1YP5A 4OGEA 3WVDB 2E6NA 3JCMg 4LXCA 3OYHA 2RPNA 2MCNA 2D6FA 2HZYA 3LWHA 1I1JA 5GAMg 4J5YA 2HL5C 2GFUA 3M53A 1V1CA 5GMKi 1YJ9T 2HDAA 2RQTA 4A54A 2LMJA 2L3PA 4PJOB 2DL5A 1JRIA 1ZBJA 4Q5WA 2G6FX 5CQYA 3C0CA 4BI4A 1TOVA 2SRCA 2E1HA 3PMTA 1T3SA 1Q86R 4M7DA 2P84A 4BDZA 2MAMA 1Q81C 2JMAA 1Q82C 4YTLA 3PMIA 2HEQA 2FPDA 4XK8E 4ELYC 3X25B 3CD6T 4RUGA 1MMDA 4QT7A 5LL6S 4GY5A 4M7AD 1AD5A 3N5BB 4OVAA 1KFZA 2BE7D 1XQHA 2DRMA 1UGSB 4QQGA 4QVDA 3FJPA 4A4HA 4R56A 4DBRA 2JZ2A 3OS5A 1RI9A 2X4JA 3GNFB 2LQNA 4ZGDB 5D7UA 2EWNA 2AHJB 2Z0WA 2DF6A 3J81E 3M0TA 2GBQA 1G3WA 3OYDA 1UJYA 4M77D 2PVOB 1YJ9A 3M58A 4PLIA 2HBWA 3QIIA 1HK9A 1WIEA 1VQLQ 1I8FA 4CRIA 1VQ6T 4B9XA 3E2UA 4EMKB 3REBB 4R55A 2QAZA 2QYZA 2K9GA 5GANg 1I0CA 3QBYA 3A5ZB 4CC7A 1K73U 1KHCA 3OYEA 3EHRA 2E3HA 2I0NA 5FW9A 5KYXB 1D3BA 1PM3A 2BUDA 3CD6A 2DPPB 2FRWA 1D1CA 2HBPA 4DQ2A 3VJPA 1EZZB 3R6OA 1VQPT 3SWNC 4Y92A 3MEVA 4MZPA 3RR6A 2HKNA 5KCHA 1TS9A 2ZZDA 2ED1A 3CCRQ 5IT9E 3JRZA 5CK9A 4J7IA 5FROA 3FEOA 1RAAB 4M75C 3C12A 2LJ1A 2LDMA 4M77B 2QA4A 3SB2A 3VS3A 2B86A 1B34B 4AMCA 3JB9G 1CKBA 3CCQT 2QGGA 1ZBXA 3MP6A 3UDCA 2OI3A 1BCOA 4J9CA 4OB0B 5DLQE 4F04B 4E7JA 4CC4B 2O9VA 3GPLA 4DEXA 1YHQQ 3T9NA 3M0RA 4FCYA 3UATA 2AZSA 2DXUA 1M90U 4QW2A 3CCVA 4EMKA 3TSZA 4N0AA 3PE0A 4C5HA 1OZ3A 2PUOB 3BFMA 2VUBA 4C5IA 4C92F 3GNGA 4M78C 5LJ5g 2E5KA 1X2KA 1VQ4Q 2OTLA 1H3ZA 5KYXA 5KYUA 2ENMA 2MPXC 3SDZA 1VQOT 2DD5A 1TUDA 4MDWA 1MV3A 2ECZA 2ZPIB 1UHFA 2XDDA 3G6EQ 2DA9A 3MCAB 2CUBA 3H0IA 1S72T 3JCMb 1BI2A 4D6WA 3C4SA 2PVGB 1QVGS 2ABLA 1PD1A 3CMEQ 1G3SA 1KJWA 3VS5A 1RADB 1H3HA 2LJ0A 2DL7A 1VQMT 1YITQ 4OB1B 2HQEA 4N4GA 4DA4A 5GMKj 4M78E 1W4SA 1M1GA 2HSEB 2XI9A 1KQ2A 3GP8A 2JJ9A 1KK7A 1OX9A 1QQJA 3FDRA 1HJDA 1VQKT 3NTIA 4M7DC 3DLLA 3M57A 8AT1B 1BU1A 1BCMA 1RLPC 1M4ZA 1ARKA 1SSHA 3QHSA 5GAMe 1JBMA 1O75A 2X3XD 1MMAA 3A8HB 2GGRA 3CC4A 3CCST 3UA6A 4X9DA 4C5GA 3M0PA 1VQNA 4DBQA 1QCOA 1IGQA 4J9EA 2KROA 1QVGA 2DKGA 4ZN3A 1VQOA 4HCCA 1NPPA 2EJFA 4KUIA 5I11A 3CMAQ 2JW4A 4JPBW 4M4ZA 3JCMJ 2JT4A 1TU0B 1IHWA 2D9TA 1UEBA 3M59A 4EPCA 5LJ3j 2DFUA 2DERA 2ZPFB 1KQSS 1NYGA 1PNJA 3I56T 4XTZA 2RJEA 1OI1A 3CC2T 3JCMX 2BIVA 3EG9B 4M7DE 2CP3A 1Q82U 2A36A 5I2SA 3ZBDA 1VQMA 1AWWA 4ZGJB 2CP2A 5LJ3d 5D6XA 3KXTA 1OEBA 4HKEA 2X4WA 2NUTB 4PJOC 4TVRA 1K76A 1YWOA 2DILA 3VS7A 1FX7A 4C0FA 1ZUKA 4L5GA 1RI0A 1P92A 5A0DA 3SEMA 1GCQA 3BY7A 2MWPA 2RN8A 1JJ2P 1OPLA 1SSFA 1BBZA 2WSEE 1ZA1B 2M9UA 2HD0A 4DOWA 2FVUA 2RJCA 2I2LA 4IUTA 3CPWP 1WYXA 2LZ6B 4MMLA 1Q95G 1GRIA 2WSCE 4OF1A 1X69A 2E64A 2VXFA 1MV0B 1ZSZB 5IH2A 3CCJA 2HNIA 1GL5A 1O9SA 3OS0A 3HL8A 3OW2S 1G3YA 4LDUA 1WX6A 3EHQA 2M0YA 1ZHIA 3H41A 1YIJT 1YJNT 1JXMA 2BZ8A 1M1FA 2KY9A 4II1A 3CCJQ 4C8QG 3JCMV 1QCFA 3M9QA 1YWPA 4OB2B 3I56A 2JTFA 2CZ6B 1OZ2A 5I22A 1QP2A 3CC2A 2EKOA 2LCCA 2F5KA 2SEMA 1K73R 1OOTA 3TSWA 5CKFA 3OSSC 1UTIA 2RD1A 1DJ7B 4D8KA 4ORZA 1FMKA 4J8OA 1BI3A 3RERA 3DB4A 3CCUQ 3ZL7C 1YN8A 2EJ9A 5DY9A 3RMSA 2QQAA 2CS7A 3PVLA 1N5ZA 1AWOA 4EMKC 3NTKA 3ASKA 5CAIA 1W2BS 1NJIC 1KQSP 2A28A 3H0HA 4N0AC 1TSFA 4LDYA 4XQ3A 5IHKA 2LQWA 3V7RA 1B3QA 2FYKA 2IG0A 3JSCA 2QQSA 5M9OA 4E7LA 1W1FA 2EYYA 1WHMA 1K0XA 2KSSA 3OW2A 3L2VA 3OYYA 3A8MB 1K1ZA 1VQ7A 2JUFA 5KYNA 3QUIA 2LJ3A 1QVFP 3KUFA 1Y07A 2W0ZA 3QDFA 2LP5A 4DBHA 2R5MA 2COZA 3JV3A 1N27A 1UJ0A 2L3RA 2XG8D 2CH4W 3EG1A 1K0SA 2F2WA 4M7AG 4PJNA 4C5EA 2Y90A 1VQ5Q 4Z02A 4OP0A 4F7UG 2O4XA 5HKCA 2RJDA 3CCMA 5GAOp 2MIOA 3CEYA 1M1KR 3JB9F 1FMWA 4KGVB 1M90R 3VU3C 4KRTA 1R77A 2YRVA 4BY6B 3EGDB 3FLGA 2O2OA 1UG1A 2FRYA 5KCOA 5LJ5e 2BTTA 3QZ5B 3OYLA 1W2BA 2COWA 4RMOA 3OMGA 2B8AA 5GAN4 2Y4YA 1SG5A 1S1NA 3RKYA 1E7OA 1JU5C 4QVCA 4XTYA 2CZ7B 4L6V5 5J3BA 4XU2A 3EGUA 4DBFA 1RAEB 3NPFA 2HKQB 4FL6A 2L0AA 2ZAEA 2YLCA 3MO8A 2GCXA 2ZGWA 4J9DA 5C0MA 5GAN6 3X20B 2XD0A 5IN1A 4JJNK 3UPUA 2EYZA 4IIOA 1U5SA 4C0DB 2D8JA 2QGFB 4L59A 2YUNA 1T3LA 3FJ5A 3L2UA 2VVKA 3UA7A 1VOMA 1FYNA 2CZ1B 1YI2Q 2KGTA 4BDYA 4N4HA 2LX9A 2RHZA 5L8RE 3OSVA 3UT1A 3V7CA 1ZUUA 4JLIA 4XTWA 5CKDA 1VQ9Q 2C0TA 5GAMj 2DAQA 4KULA 3EGDA 2GQIA 4PJMA 2DYIA 3JCMd 1M2VB 1RABB 1KQ1A 1SHGA 1JXOA 5FRMA 2M16A 5C6SA 3I5SA 1X01A 5GAMd 3G71Q 3RUXA 3V8LA 4HT8A 1GCQC 2O9SA 3L42A 4AT1B 4ESRA 4E7HA 1PG5B 1R8OB 2QI2A 1WHHA 1RL2A 1NLPC 4JS4A 3M56A 1VQLT 4ANJA 3JAME 4XTUA 5GAN7 2AK5A 1KG1A 2XDBA 2FHDA 1N6AA 2F5TX 4JRKA 3META 3F70A 3X24B 5D6YA 3VRYA 3GBQA 1Q82R 4CC2A 1RAFB 3QYGB 1WZOA 3L1AA 2D0QB 3LH5A 4V2SA 1YJWA 4E7IA 2FZKB 5GAOm 2A08A 2KNBB 2DMOA 3UF4A 1D3BB 4WF2A 3VS2A 1NEBA 1M5Q1 2NLUA 1YJWQ 2QASA 2ROTA 1CSKA 3DB3A 2E65A 5GAOr 2CGHA 1FMVA 2QG9B 2DLPA 3CCRT 1D1BA 4XU0A 3A98A 2QEXQ 4J7FA 1UGRB 2JM9A 1Q7YU 5HY6A 2CKKA 2EQJA 2FPEA 2EYWA 2GTOA 1M2VA 1BB9A 2EPDA 1MUZA 1WJRA 5CVIA 2QA4T 2KEAA 3RMQA 1K8AU 1OU9A 1D0XA 3PNWC 1K9AA 2H3JA 2KT1A 3OYAA 1QP3A 2R5AA 4HXJA 1F1BB 3EG3A 3NTHA 4PJOF 1VQLA 2L3QA 3QWYA 5GANj 2EBPA 1VQ8A 3OYIA 3ER0A 3EG2A 5EC7A 2HAXA 5DLOA 1VQ8Q 1ZSZC 2J05A 2FEIA 3CCVT 2XHCA 2DRKA 2ATCB 2VB6A 2RA2A 2WSFE 2FZGB 2P0QA 2P4RA 5GANd 1TG0A 2RHUA 4C8QF 1VYUA 4JDSA 4EMHA 3QSUA 1LOJA 1NJIU 3MKDA 4RTVA 1H641 3MJXA 2X35A 5KYUB 2OTLT 1OX8A 3G6ET 3HPWA 2RM4A 3I9QA 2A7YA 1NM7A 2EIFA 4Z8AA 2YLBA 3C95A 1QLYA 3KFVA 3CCRA 2YRDA 1AZEA 1UDLA 3M4YA 1UUEA 2AIRB 1UGPB 3G4SQ 2M02A 2ZPEB 4UC4A 1WQ7A 3U23A 4Y91A 1YITT 1RLQC 3RESA 3QKJA 1KC8R 1IO6A 4BD3A 3JCMP 3TU4K 1YHQA 2E12A 3EH1A 1N8RR 5CR2A 2D1XA 2JTMA 4MMKA 4J6YA 2KMTA 1IXDA 2VASA 2NUPB 3EFSA 1SF9A 1KD1C 4RTZA 5LJ5j 4M75G 2LVMA 5GJVB 2M0OA 1I4K1 2LC4A 2V1QA 3CCEQ 2BZXA 4M7AF 1VQ4A 4F7UF 1MMNA 4GLMA 2M51A 3HHTB 2DE0X 3QJYA 5GAOl 1WXTA 3HSBA 4B6MA 4LDVA 5LJ5d 2Y4XA 3CC4T 1BIBA 4BI8B 1VQNT 3E9GA 2JOYA 3G6EA 3CMAT 3QXEB 1GFDA 3GLXA 6AT1B 2K4YA 1G3TA 2IIMA 4BY6C 1BK2A 1ZQ1A 2CT3A 1OU8A 2EQUA 1ABOA 2DZCA 1VQ6Q 2JS0A 3CMEA 4O5VA 4LDXA 2OX7A 1IB8A 4M77F 5GAN3 4M78G 2K5FA 4JJCA 1GFCA 2KXCA 1YITA 2HQXA 5GAN5 4VUBA 4C92A 2V1RA 4PJLA 3X26B 2JXBA 4Z89A 3I55A 2E4HA 1VUBA 4QVZA 1U8RA 2EQKA 4O6JA 1VQPQ 3I55Q 2FPFA 1R0BG 2RH2A 3L2QA 3EAEA 5CQXA 4C0DC 3FIFA 5GAOq 2DK3A 3GIBA 1N9SA 3M0UA 2NUPA 4J9BA 2DL3A 2L8DA 2DIQA 1XNIA 5FU6B 3EG0A 1FWZA 1YBYA 1ZX6A 1QCNA 3LW5E 3V8KA 4LE9A 1M30A 1AEYA 3M0SA 1PKTA 4AG2C 2L5QA 1W70A 2DTIA 5KE2A 1SHFA 2RK2A 2EW3A 4HCZA 1U3OA 2PVDB 3FC3A 4PL6A 3CMAA 2MK5A 2RMOA 1YCSB 3CCJT 3RBBB 2PUKB 2QK0A 4A63B 5DM7R 2HQHA 4M7DG 4PKCC 3C94A 4LUEA 4JJDA 3EFRA 2K5LA 2CH4A 1VIEA 1XJWB 4FM4B 1WHJA 2VC8A 3MP8A 2VKNA 2VXEA 3RKWA 1IHVA 1BKBA 1M3CA 3CC7Q 2EYQA 3S6WA 1Q81U 5LJ3f 2EGCA 1K9MC 2K3BA 2C06A 2HSPA 2VYTA 2LQ8A 1Y96A 4BUGA 4E47A 2J6FA 4FSSA 1WHGA 1AWJA 1B07A 4HVWA 3PIPA 2DTOA 4QQ6A 3OYGA 4FYWB 3QJ6A 1C6VX 5AYFA 3BDUA 3LYIA 4XU1A 2YSQA 4JZ4A 1QVGP 2QDLA 5GMKm 1X75C 1AZGB 2LT1A 1Q7YR 1I5OB 1BI1A 5GAN2 4NL3A 3JB9D 4IKFA 2OTJQ 5ECAA 5IAYA 1SPKA 3OYNA 2RHIA 4LNPA 4WTOB 1VQ7T 3LLRA 4PJOG 4ZTJA 4XAXB 1K8AR 4RTXA 4MZTA 2JS2A 4J9HA 3EH2A 1HXDA 2DXBA 4IUPA 1ZUYA 1VQKQ 4KGXB 1WPYA 1WHKA 2O4XB 2C0OA 4E7SA 1NYFA 2CP7A 2RF0A 3CCMT 4R0KA 2JTEA 1Z9ZA 3ZFJA 2MYSA 4HVVA 3MEAA 3CCSQ 5GAN8 2DEQA 2CZ0B 3CCUA 2QQRA 5FWCA 2O31A 4LD9K 2FG0A 1PKSA 1NJIR 5GAOn 3TVTA 1U1SA 5HCKA 4AFSC 7AT1B 3CBPA 4JRPA 4KGZB 2F2VA 4OMNA 1Y7XA 4C0ZA 4QKUA 5IHNA 3OYBA 1M3BA 1BI0A 2O88A 2XICA 2GQVA 2A0FB 2CYZB 3QPHA 2E41A 4J9FA 4NOYA 4C8QE 3A8OB 1K73C 1LCKA 3P8DA 1WXBA 4JZ3A 4A4FA 1YI2T 1D1AA 2ZPBB 2ZPHB 2PZ1A 1TTHB 2WACA 3O8VA 4PFZA 3AT1B 2COYA 3VUBA 3MHXA 2KDSA 2DXTA 5GMKh 1VQ5A 2LTOA 4KH0B 3CXCS 1RUWA 4JRIA 2GFAA 3PIOA 1KD1U 3OYCA 2OAUA 1C1AA 2RQVA 1HYOA 3OYMA 4C92C 1RAHB 1M27C 1VQ9T 1IGUA 1LPLA 1N9RA 2EAYA 1XTDA 4C0GA 1HD3A 3EGXA 2KT8A 2QQ9A 1WXUA 1SEMA 3G71T 3OW2P 3SHWA 2DM1A 4M75F 2VGMA 2XU8A 1D09B 4E2FB 2RHXA 3CBMA 3THKA 2OJ2A 2RNAA 1YIJQ 4OMFB 1YJNQ 2E10A 4M77G 1T0HA 4F16A 1QKXA 4OB3B 3KBGA 2BE9B 4FU6A 5GMKl 5FU7B 5I21A 1M1KC 5LJ3h 4PJJA 4F7UE 1PCXA 2AT1B 2KVQG 2FL7A 4C92E 2K5IA 3MEUA 2CT4A 3CXCA 1VIFA 3CCLQ 3QG1A 2KRSA 5J26A 2BZYA 2X4XA 1YI2A 4RTYA 4Z88A 1OQKA 1WQWA 2BKDN 3NGPA 4M75A 4Y28E 1D0YA 5L23A 2JVVA 1UFFA 2GTJA 1YJWT 1X6OA 1W2BP 4PNOA 1GCPA 1W6XA 4M78F 3GOXA 3HRUA 5FRNA 5J39A 4LUDA 1LNXA 4ELZC 3P8HA 2CP5A 1RAIB 1VQ9A 2K2MA 4JUVA 2DVEA 2RK1A 3JCMf 4BE2A 1NZ9A 2X4YA 1WFWA 1VYTA 4KH1B 1TH7A 4RCBA 4XTVA 4MZMA 2X51A 3G71A 5GAMf 3E19A 4AFQC 2KYMA 3X28B 4C8QD 3S3NA 3MP1A 5FU6C 3INZA 4OMLA 3I35A 2QXFA 3PVQA 1SRLA 3A1PA 3VS0A 1EIFA 5KYYB 5CKHA 1PHTA 1WA7A 1WNLA 2E6ZA 1VQ8T 2V8KA 2D0NA 3H0FA 2QDYB 1K9MU 3A8GB 4J9GA 2FB7A 2RJFA 4X34A 1TUCA 3RKXA 4M7DF 4N4IA 1Q81R 5D6WA 5CO7A 3GF5A 1MNEA 4ATOA 3OA6A 4OGCA 1M2OA 4RG8A 2OAWA 1UHCA 1V76A 2MF2A 2PU9B 2K2VA 4JLGA 3E9FA 1I81A 3G4ST 5LJ3e 2QEXA 4F14A 1U06A 2DTHA 2EQMA 3VKIA 2EQIA 2ZPGB 3J80E 4JJBA 5IHIA 1WJSA 3LX7A 3M0QA 2H3EB 4C8QB 1G5VA 1SRMA 3FB9A 3OYJA 1Q86C 4ZTFA 2LRQA 4K11A 1X27A 3BW1A 1YFNA 3E1SA 2YUPA 2DEUA 2DD4A 1G83A 1T0JA 1I07A 4KT0E 4AG1C 4A4EA 4KUDK 2KBTA 2KRNA 4A4GA 4C92D 1ZLMA 2DZ9A 1YHQT 1BIAA 5KYYA 3O5ZA 1UGVA 4BE1A 1YNZA 1KHIA 3CCET 2KE9A 1PRLC 4FYYB 2DNUA 2K3XA 3L2ZA 5GANf 3HFOA 2A37A 3OB9A 3DLMA 1KSWA 5CKBA 4JRQA 3BDLA 2D8HA 3ZEHA 1VQ4T 3LH0A 1MNDA 4FW2A 2F69A 1V29B 1UGQB 3JB9J 2RQWA 3I5RA 2HMAA 2JM8A 3V8JA 2K3YA 1WGSA 5A0GA 2DIGA 2VV5A 1YJ9Q 2DYBA 4JS5A 4PJOA 2J6OA 3M55A 5GJWB 2RQUA 3G4SA 4BB7A 4BE0A 3OYKA 5A0LA 4FT2A
chains in the Genus database with same CATH topology
3ZL7C 1YN8A 1M30A 1AEYA 3M0SA 4IIMA 1AVZC 3PVLA 1N5ZA 1AWOA 1PKTA 4AG2C 1W70A 2KYBA 1NEGA 1SHFA 1YP5A 2A28A 2EW3A 3H0HA 1U3OA 5IHKA 2LQWA 2JMCA 2RMOA 2RPNA 1YCSB 1B3QA 3RBBB 1W1FA 2RQRA 2MCNA 4A63B 1QWFA 1H92A 2EYYA 1HSQA 1K0XA 1I1JA 4LUEA 4JJDA 2CH4A 1K1ZA 2CREA 2CSIA 2LJ3A 2W0ZA 1V1CA 2VKNA 2LP5A 2LNHB 2HDAA 2RQTA 1M3CA 4E6RA 2DBKA 3JV3A 1UJ0A 2LMJA 2EGCA 2K3BA 1JO8A 2L3PA 2HSPA 2CH4W 3EG1A 1K0SA 2DL5A 2F2WA 2AKKA 2KXDA 1ZBJA 2G6FX 1G2BA 2J6FA 3C0CA 4FSSA 2SRCA 1AWJA 1B07A 2MIOA 4HVWA 2DL4A 5IXFA 3VRZA 1T3SA 2NUZA 4KRTA 2YSQA 2JMAA 4JZ4A 2O2OA 1UG1A 2FRYA 2QDLA 2BTTA 1E6GA 1AZGB 2HEQA 2FPDA 1Y0MA 2YDLA 4RUGA 1S1NA 1E7OA 1JU5C 4QT7A 1AD5A 1KFZA 5ECAA 1SPKA 4LNPA 2DRMA 3EGUA 4RTXA 1CKAA 3NPFA 4GBQA 1Z9QA 2JS2A 2HCKA 2L0AA 4J9HA 4J9DA 4J9IA 1RI9A 1ZUYA 5IXBA 2EYZA 2LQNA 2KR3A 3NHNA 4IIOA 1EFNA 3CQTA 1U5SA 2C0OA 2DF6A 1NYFA 2RF0A 2GBQA 3M0TA 4AFUC 2D8JA 4R0KA 2YUNA 1T3LA 2JTEA 1Z9ZA 1UJYA 3FJ5A 2VVKA 3UA7A 2HBWA 1FYNA 4HVVA 2XMFA 2KGTA 1WIEA 5FWCA 2O31A 3NMZC 2FG0A 1PKSA 3TVTA 3REBB 5HCKA 4AFSC 2K9GA 1X2QA 1I0CA 4CC7A 1UECA 1E6HA 2F2VA 1ZUUA 4OMNA 2EKHA 2C0TA 2ROLA 3EHRA 1WLPB 5IHNA 2I0NA 4OMOA 5FW9A 1M3BA 4D8DA 2GQIA 2EVRA 3RNJA 2O88A 1Y57A 2YUOA 1SHGA 1JXOA 2FRWA 4J9FA 4AFZC 1X6GA 2LX7A 3I5SA 1AOJA 1LCKA 1WXBA 4JZ3A 4Y92A 1GCQC 2O9SA 4ESRA 1AWXA 4F17A 2X3WD 2PZ1A 2DVJA 3VS4A 1NLPC 2ED1A 2AZVA 2AK5A 4RTWA 1RUWA 2LJ1A 3VS3A 2B86A 2RQVA 4OMQA 3VRYA 1M27C 3GBQA 2LCSA 1CKBA 4CC2A 2CUDA 2OI3A 3LH5A 4J9CA 2A08A 2KNBB 4ZNXA 2DMOA 4CC4B 3UF4A 2O9VA 2F2XA 3VS2A 1HD3A 4DEXA 1NEBA 3M0RA 2KT8A 3UATA 1WXUA 1SEMA 2AZSA 2ED0A 3SHWA 2W10A 2ROTA 2DM1A 1CSKA 3IQLA 3TSZA 3THKA 4X1VA 3PE0A 2OJ2A 2YT6A 2DLPA 2RNAA 1T0HA 2EGAA 3A98A 4F16A 1H8KA 1QKXA 2E5KA 1X2KA 2JM9A 4LN2A 2FPEA 2EYWA 2ENMA 2GTOA 2L2PA 5FWBA 1BB9A 2EPDA 1MUZA 4HCKA 1TUDA 1MV3A 2ECZA 2KEAA 2CT4A 1UHFA 2DA9A 1K9AA 2KRSA 2CUBA 3QWXX 1J3TA 1GBRA 2BZYA 2KT1A 3H0IA 4RTYA 4Z88A 3NGPA 4HXJA 1GBQA 5L23A 2FO0A 3EG3A 2L3QA 1UFFA 2GTJA 3QWYA 2ABLA 2EBPA 1GCPA 3ULRB 1PRMC 1KJWA 1W6XA 1QKWA 4HVUA 3VS5A 4CC3A 2EYXA 2CSQA 1H3HA 3EG2A 4LUDA 3REAB 5EC7A 2LJ0A 2DL7A 2J05A 2K2MA 2FEIA 2VWFA 2DRKA 3R6NA 1X43A 2P4RA 2DX1A 1TG0A 1VYUA 2DBMA 1OPKA 1WFWA 1VYTA 4RTVA 1JEGA 1HJDA 1A0NB 3I9QA 4AFQC 1BU1A 2KYMA 1NM7A 4Z8AA 1RLPC 1ARKA 2H8HA 1SSHA 1QLYA 3KFVA 1AZEA 1UDLA 1X6BA 2X3XD 1UUEA 4OMLA 2EGEA 2GGRA 3I35A 1VA7A 2J6KA 3PVQA 3UA6A 1SRLA 3VS0A 2ESWA 3M0PA 2GNCA 1PHTA 4J9EA 2K79A 2KROA 1WA7A 3U23A 1RLQC 2D0NA 3H0FA 1JQQA 5I11A 4J9GA 4RTTA 1NLOC 1IO6A 1TUCA 2JW4A 4JPBW 4M4ZA 2JT4A 1M3AA 2DL8A 1K4US 2D1XA 1NYGA 1PNJA 1WI7A 2PTKA 1NG2A 1XOVA 2A36A 2MOXA 2OAWA 4RTZA 1UHCA 2J7IA 4OMMA 5GJVB 3VS1A 1M8MA 1AWWA 2V1QA 2K6DA 2BZXA 4F14A 1OEBA 4RTUA 1U06A 1KIKA 1UE9A 2EQIA 4GLMA 2M51A 1K76A 1YWOA 2DE0X 2DILA 3VS7A 1WXTA 4JJBA 5IHIA 1QWEA 1ZUKA 2DJQA 3M0QA 1VYVA 1SRMA 2NWMA 3SEMA 1GFDA 1GCQA 2IIMA 2RN8A 2PNIA 4K11A 1BK2A 1OPLA 1X27A 1BBZA 1WDXA 2YUPA 2CT3A 1G83A 1T0JA 1ABOA 1I07A 1OV3A 4AG1C 2JS0A 2KBTA 2KRNA 1ABQA 1WYXA 2LZ6B 1ZLMA 1GRIA 4JJCA 1GFCA 1X69A 3O5ZA 1MV0B 2CDTA 1UGVA 2J06A 2KXCA 5IH2A 1YNZA 1ZSGA 1GL5A 3VS6A 2KE9A 1PRLC 2V1RA 2K7AA 2DNUA 2AKLA 1WX6A 3EHQA 2M0YA 2JXBA 4Z89A 3H41A 1JXMA 2BZ8A 1PWTA 2A37A 4EIKA 2YUQA 4WCIA 1KSWA 2D8HA 2C0IA 1QCFA 2FPFA 1YWPA 5I22A 2RQWA 3I5RA 4DEYA 2SEMA 4OMPA 2JM8A 1OOTA 3TSWA 3M0UA 4J9BA 2DL3A 1UTIA 2DYBA 2J6OA 5GJWB 2RQUA 3EG0A 1ZX6A 4ORZA 4D8KA 2KRMA 1FMKA 2L3SA 4LE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZL7 C;  1YN8 A;  1M30 A;  1AEY A;  3M0S A;  4IIM A;  1AVZ C;  3PVL A;  1N5Z A;  1AWO A;  1PKT A;  4AG2 C;  1W70 A;  2KYB A;  1NEG A;  1SHF A;  1YP5 A;  2A28 A;  2EW3 A;  3H0H A;  1U3O A;  5IHK A;  2LQW A;  2JMC A;  2RMO A;  2RPN A;  1YCS B;  1B3Q A;  3RBB B;  1W1F A;  2RQR A;  2MCN A;  4A63 B;  1QWF A;  1H92 A;  2EYY A;  1HSQ A;  1K0X A;  1I1J A;  4LUE A;  4JJD A;  2CH4 A;  1K1Z A;  2CRE A;  2CSI A;  2LJ3 A;  2W0Z A;  1V1C A;  2VKN A;  2LP5 A;  2LNH B;  2HDA A;  2RQT A;  1M3C A;  4E6R A;  2DBK A;  3JV3 A;  1UJ0 A;  2LMJ A;  2EGC A;  2K3B A;  1JO8 A;  2L3P A;  2HSP A;  2CH4 W;  3EG1 A;  1K0S A;  2DL5 A;  2F2W A;  2AKK A;  2KXD A;  1ZBJ A;  2G6F X;  1G2B A;  2J6F A;  3C0C A;  4FSS A;  2SRC A;  1AWJ A;  1B07 A;  2MIO A;  4HVW A;  2DL4 A;  5IXF A;  3VRZ A;  1T3S A;  2NUZ A;  4KRT A;  2YSQ A;  2JMA A;  4JZ4 A;  2O2O A;  1UG1 A;  2FRY A;  2QDL A;  2BTT A;  1E6G A;  1AZG B;  2HEQ A;  2FPD A;  1Y0M A;  2YDL A;  4RUG A;  1S1N A;  1E7O A;  1JU5 C;  4QT7 A;  1AD5 A;  1KFZ A;  5ECA A;  1SPK A;  4LNP A;  2DRM A;  3EGU A;  4RTX A;  1CKA A;  3NPF A;  4GBQ A;  1Z9Q A;  2JS2 A;  2HCK A;  2L0A A;  4J9H A;  4J9D A;  4J9I A;  1RI9 A;  1ZUY A;  5IXB A;  2EYZ A;  2LQN A;  2KR3 A;  3NHN A;  4IIO A;  1EFN A;  3CQT A;  1U5S A;  2C0O A;  2DF6 A;  1NYF A;  2RF0 A;  2GBQ A;  3M0T A;  4AFU C;  2D8J A;  4R0K A;  2YUN A;  1T3L A;  2JTE A;  1Z9Z A;  1UJY A;  3FJ5 A;  2VVK A;  3UA7 A;  2HBW A;  1FYN A;  4HVV A;  2XMF A;  2KGT A;  1WIE A;  5FWC A;  2O31 A;  3NMZ C;  2FG0 A;  1PKS A;  3TVT A;  3REB B;  5HCK A;  4AFS C;  2K9G A;  1X2Q A;  1I0C A;  4CC7 A;  1UEC A;  1E6H A;  2F2V A;  1ZUU A;  4OMN A;  2EKH A;  2C0T A;  2ROL A;  3EHR A;  1WLP B;  5IHN A;  2I0N A;  4OMO A;  5FW9 A;  1M3B A;  4D8D A;  2GQI A;  2EVR A;  3RNJ A;  2O88 A;  1Y57 A;  2YUO A;  1SHG A;  1JXO A;  2FRW A;  4J9F A;  4AFZ C;  1X6G A;  2LX7 A;  3I5S A;  1AOJ A;  1LCK A;  1WXB A;  4JZ3 A;  4Y92 A;  1GCQ C;  2O9S A;  4ESR A;  1AWX A;  4F17 A;  2X3W D;  2PZ1 A;  2DVJ A;  3VS4 A;  1NLP C;  2ED1 A;  2AZV A;  2AK5 A;  4RTW A;  1RUW A;  2LJ1 A;  3VS3 A;  2B86 A;  2RQV A;  4OMQ A;  3VRY A;  1M27 C;  3GBQ A;  2LCS A;  1CKB A;  4CC2 A;  2CUD A;  2OI3 A;  3LH5 A;  4J9C A;  2A08 A;  2KNB B;  4ZNX A;  2DMO A;  4CC4 B;  3UF4 A;  2O9V A;  2F2X A;  3VS2 A;  1HD3 A;  4DEX A;  1NEB A;  3M0R A;  2KT8 A;  3UAT A;  1WXU A;  1SEM A;  2AZS A;  2ED0 A;  3SHW A;  2W10 A;  2ROT A;  2DM1 A;  1CSK A;  3IQL A;  3TSZ A;  3THK A;  4X1V A;  3PE0 A;  2OJ2 A;  2YT6 A;  2DLP A;  2RNA A;  1T0H A;  2EGA A;  3A98 A;  4F16 A;  1H8K A;  1QKX A;  2E5K A;  1X2K A;  2JM9 A;  4LN2 A;  2FPE A;  2EYW A;  2ENM A;  2GTO A;  2L2P A;  5FWB A;  1BB9 A;  2EPD A;  1MUZ A;  4HCK A;  1TUD A;  1MV3 A;  2ECZ A;  2KEA A;  2CT4 A;  1UHF A;  2DA9 A;  1K9A A;  2KRS A;  2CUB A;  3QWX X;  1J3T A;  1GBR A;  2BZY A;  2KT1 A;  3H0I A;  4RTY A;  4Z88 A;  3NGP A;  4HXJ A;  1GBQ A;  5L23 A;  2FO0 A;  3EG3 A;  2L3Q A;  1UFF A;  2GTJ A;  3QWY A;  2ABL A;  2EBP A;  1GCP A;  3ULR B;  1PRM C;  1KJW A;  1W6X A;  1QKW A;  4HVU A;  3VS5 A;  4CC3 A;  2EYX A;  2CSQ A;  1H3H A;  3EG2 A;  4LUD A;  3REA B;  5EC7 A;  2LJ0 A;  2DL7 A;  2J05 A;  2K2M A;  2FEI A;  2VWF A;  2DRK A;  3R6N A;  1X43 A;  2P4R A;  2DX1 A;  1TG0 A;  1VYU A;  2DBM A;  1OPK A;  1WFW A;  1VYT A;  4RTV A;  1JEG A;  1HJD A;  1A0N B;  3I9Q A;  4AFQ C;  1BU1 A;  2KYM A;  1NM7 A;  4Z8A A;  1RLP C;  1ARK A;  2H8H A;  1SSH A;  1QLY A;  3KFV A;  1AZE A;  1UDL A;  1X6B A;  2X3X D;  1UUE A;  4OML A;  2EGE A;  2GGR A;  3I35 A;  1VA7 A;  2J6K A;  3PVQ A;  3UA6 A;  1SRL A;  3VS0 A;  2ESW A;  3M0P A;  2GNC A;  1PHT A;  4J9E A;  2K79 A;  2KRO A;  1WA7 A;  3U23 A;  1RLQ C;  2D0N A;  3H0F A;  1JQQ A;  5I11 A;  4J9G A;  4RTT A;  1NLO C;  1IO6 A;  1TUC A;  2JW4 A;  4JPB W;  4M4Z A;  2JT4 A;  1M3A A;  2DL8 A;  1K4U S;  2D1X A;  1NYG A;  1PNJ A;  1WI7 A;  2PTK A;  1NG2 A;  1XOV A;  2A36 A;  2MOX A;  2OAW A;  4RTZ A;  1UHC A;  2J7I A;  4OMM A;  5GJV B;  3VS1 A;  1M8M A;  1AWW A;  2V1Q A;  2K6D A;  2BZX A;  4F14 A;  1OEB A;  4RTU A;  1U06 A;  1KIK A;  1UE9 A;  2EQI A;  4GLM A;  2M51 A;  1K76 A;  1YWO A;  2DE0 X;  2DIL A;  3VS7 A;  1WXT A;  4JJB A;  5IHI A;  1QWE A;  1ZUK A;  2DJQ A;  3M0Q A;  1VYV A;  1SRM A;  2NWM A;  3SEM A;  1GFD A;  1GCQ A;  2IIM A;  2RN8 A;  2PNI A;  4K11 A;  1BK2 A;  1OPL A;  1X27 A;  1BBZ A;  1WDX A;  2YUP A;  2CT3 A;  1G83 A;  1T0J A;  1ABO A;  1I07 A;  1OV3 A;  4AG1 C;  2JS0 A;  2KBT A;  2KRN A;  1ABQ A;  1WYX A;  2LZ6 B;  1ZLM A;  1GRI A;  4JJC A;  1GFC A;  1X69 A;  3O5Z A;  1MV0 B;  2CDT A;  1UGV A;  2J06 A;  2KXC A;  5IH2 A;  1YNZ A;  1ZSG A;  1GL5 A;  3VS6 A;  2KE9 A;  1PRL C;  2V1R A;  2K7A A;  2DNU A;  2AKL A;  1WX6 A;  3EHQ A;  2M0Y A;  2JXB A;  4Z89 A;  3H41 A;  1JXM A;  2BZ8 A;  1PWT A;  2A37 A;  4EIK A;  2YUQ A;  4WCI A;  1KSW A;  2D8H A;  2C0I A;  1QCF A;  2FPF A;  1YWP A;  5I22 A;  2RQW A;  3I5R A;  4DEY A;  2SEM A;  4OMP A;  2JM8 A;  1OOT A;  3TSW A;  3M0U A;  4J9B A;  2DL3 A;  1UTI A;  2DYB A;  2J6O A;  5GJW B;  2RQU A;  3EG0 A;  1ZX6 A;  4ORZ A;  4D8K A;  2KRM A;  1FMK A;  2L3S A;  4LE9 A; 
#chains in the Genus database with same CATH topology
 4HT9 A;  1NBE B;  4IIM A;  1AVZ C;  1LJO A;  3M5A A;  3CME T;  4M7A B;  1NEG A;  2IVW A;  3CBO A;  4F7U B;  3JB9 I;  3JCM Q;  4C8Q A;  3OQ5 A;  2JMC A;  4C92 B;  5FLX E;  2RQR A;  1QWF A;  2RHY A;  3VUZ A;  5KYW B;  1M8V A;  1H92 A;  1HSQ A;  3H9N A;  4IUV A;  2YRC A;  3I55 T;  4X9C A;  3CD6 Q;  2CP6 A;  2CRE A;  1M9S A;  1KD1 R;  2CSI A;  3JCM h;  2CP0 A;  2LNH B;  2KAF A;  4E6R A;  3CCE A;  2DBK A;  1PC0 A;  5GAM h;  1JO8 A;  1PSF A;  2V26 A;  2AKK A;  2KXD A;  1G2B A;  5CIU A;  3H8Z A;  4XTX A;  5LJ5 f;  2QA4 Q;  1KC8 C;  1C0M A;  3HKS A;  2DL4 A;  5IXF A;  3NFC A;  3VRZ A;  3OS1 A;  4DOV A;  3MEW A;  2NUZ A;  5KE3 A;  1E6G A;  3H6Z A;  1N8R C;  1M1K U;  1Y0M A;  3PFS A;  2YDL A;  1VQ6 A;  1Y71 A;  4J6W A;  3VYH B;  1ZA2 B;  1IRX A;  3TCJ A;  2RI3 A;  3CCV Q;  3CC7 T;  2YHT A;  3TRE A;  4J83 A;  4M7A A;  1CKA A;  4GBQ A;  1Z9Q A;  4M75 E;  2HCK A;  4F7U A;  3UWN A;  3JCM c;  3TEE A;  4J9I A;  4ZN1 A;  5KH6 A;  2OTL Q;  1Y96 B;  5FU7 C;  4IUR A;  5IXB A;  5KYW A;  1VQP A;  2KR3 A;  4GLK A;  1OYX A;  3NHN A;  1EFN A;  2LQK A;  2V8I A;  3CQT A;  4AFU C;  2DJZ A;  2HL3 A;  3J7A F;  5CCA A;  3OBY A;  2XMF A;  3OBW A;  4NS5 A;  1I5L A;  3L2R A;  4M77 A;  3NMZ C;  1JJ2 S;  4HCB A;  2RO0 A;  2OTJ T;  4RKU E;  1B34 A;  2NYS A;  3CCQ A;  1PD0 A;  1OUL A;  1GXI E;  3SFM A;  1X2Q A;  2P0P A;  4LDW A;  1QVP A;  2RB6 A;  1WHL A;  4PFO A;  1UEC A;  3CPW S;  1E6H A;  2EKH A;  1BYM A;  2DET A;  2ROL A;  3CCQ Q;  1JB0 E;  1WLP B;  4OMO A;  4D8D A;  2FZC B;  3MPU B;  2EVR A;  2LT4 A;  3RNJ A;  3JCM e;  1Y57 A;  2YUO A;  5GAN h;  3G7Z A;  4AFZ C;  1X6G A;  2LX7 A;  4E7Z A;  3V7S A;  1AOJ A;  3JCM W;  1YCY A;  4FIB A;  3CC7 A;  1K9M R;  1AWX A;  2ZCF B;  4F17 A;  2X3W D;  2DVJ A;  2P4T A;  2M1H A;  3VS4 A;  2AZV A;  3WVE B;  2XK0 A;  3RDV A;  3SD4 A;  4RTW A;  3CC4 Q;  2QQB A;  1VQN Q;  2LCL A;  3CCU T;  2RI5 A;  2KK4 A;  1RAC B;  3S3M A;  4OMQ A;  3WXM B;  1JJ2 A;  3FRN A;  2LCS A;  1S72 A;  1VQO Q;  4FW1 A;  2CUD A;  2G3R A;  4FSX A;  4ME7 A;  2E70 A;  4ZNX A;  3CPW A;  2F2X A;  3CPF A;  1S72 Q;  2ED0 A;  2V8J A;  3G1J A;  2OTJ A;  2R58 A;  2W10 A;  1Q86 U;  5LJ3 g;  3IQL A;  3URG A;  3JB9 H;  3S3O A;  4X1V A;  5AT1 B;  2XKO C;  2YT6 A;  3DKM A;  9ATC B;  1QVF S;  2DO3 A;  1VQM Q;  2YXY A;  3HFN A;  1LVK A;  2EGA A;  1U1T A;  1H8K A;  4PLL A;  4LN2 A;  8ATC B;  1EX4 A;  4P5N A;  1TWB A;  1VQK A;  4PFP A;  4A53 A;  2L2P A;  5FWB A;  4NL2 A;  4RG2 A;  3QYH B;  4HCK A;  1VQ5 T;  3BE3 A;  4M75 D;  1G8X A;  4C8Q C;  2F1L A;  3QWX X;  1GBR A;  5LJ5 h;  2EJG A;  1J3T A;  3CCS A;  1Q7Y C;  2K57 A;  1GBQ A;  2FO0 A;  3LGF A;  2DXC A;  2KQW A;  1PRM C;  3ULR B;  4HVU A;  1QKW A;  3EGX B;  1KQS A;  1TXQ A;  1D0Z A;  4CC3 A;  5CKE A;  2JNG A;  1K8A C;  2EYX A;  2CSQ A;  3REA B;  1MMG A;  1FXX A;  2VWF A;  4PJO E;  3R6N A;  1X43 A;  2DX1 A;  5GAN e;  3QDR B;  4QQD A;  4BAC A;  4E7K A;  2DBM A;  1OPK A;  4J6X A;  1QVF A;  4FYX B;  1AT1 B;  3HP9 A;  3ME9 A;  4M78 D;  1JEG A;  3HRT A;  3EG9 A;  3SWN B;  2MWO A;  3CCL T;  1A0N B;  3I56 Q;  3CC2 Q;  4BI3 A;  4FT4 A;  3HRS A;  3EFO B;  2H8H A;  2NUT A;  1X6B A;  2LNV A;  2VGN A;  2EGE A;  4M75 B;  1VA7 A;  2J6K A;  2ESW A;  3VV0 A;  2GNC A;  2R57 A;  3QZ9 B;  4CI0 C;  1NE8 A;  3OY9 A;  2K79 A;  1MHN A;  2RI2 A;  3TQ7 P;  4RCC A;  1JQQ A;  1IRE B;  4M7A C;  2E3I A;  2A3L A;  2IPO B;  1TUG B;  3OS2 A;  4RTT A;  1NLO C;  2E5Q A;  3PT9 A;  1ACM B;  1M3A A;  5EG2 A;  2DL8 A;  1K4U S;  2XDP A;  1UB4 A;  1RAG B;  1KC8 U;  3OMC A;  1WI7 A;  2PTK A;  1VQ7 Q;  4KBM B;  4EDU A;  1ZSZ A;  4EMG A;  1NG2 A;  1XOV A;  2MOX A;  2MMP A;  4ZGE B;  1MGQ A;  4HA8 A;  2J7I A;  4OMM A;  3VS1 A;  1M8M A;  1N8R U;  1YIJ A;  2YWW A;  1YJN A;  4M7D D;  2L89 A;  2K6D A;  4M78 B;  3L2W A;  4RTU A;  4C92 G;  1UE9 A;  4M77 C;  1KIK A;  1SKU B;  3RIR A;  1NPR A;  1QWE A;  2QTV A;  3CCM Q;  2DJQ A;  1AHJ B;  3AHU A;  1VYV A;  3CCL A;  4M7A E;  2NWM A;  3SWN A;  3PGG A;  1M90 C;  2PNI A;  2P0K A;  1WDX A;  3EFO A;  2X9H A;  1OV3 A;  4PK4 A;  2XID A;  1ABQ A;  2EFI A;  5A2Q E;  3OYF A;  4A4K A;  5I2M A;  2CDT A;  2J06 A;  1ZSG A;  3VS6 A;  1WJQ A;  3Q1J A;  2K7A A;  3HTR A;  1R0C B;  2AKL A;  2JN0 A;  2MI6 A;  3D7S B;  3VYG A;  2O01 E;  3M4G A;  1QW1 A;  1PWT A;  4M77 E;  4EIK A;  2YUQ A;  4WCI A;  2QEX T;  2PQW A;  3QO3 A;  2C0I A;  2GF7 A;  4M7D B;  4PJO D;  1B7T A;  5HK0 A;  4DEY A;  4OMP A;  4IUU A;  3LWI A;  4MDX A;  3CXC P;  5HK3 A;  2KI7 A;  4IUQ A;  3M54 A;  1IZ6 A;  2KRM A;  5GMK e;  4M78 A;  2L3S A;  4B9W A;  3P8B B;  1PSE A;  2QTX A;  3PTA A;  4LD6 A;  1QMC A;  2KYB A;  4FYV B;  3A8L B;  3LGL A;  4XU3 A;  1YP5 A;  4OGE A;  3WVD B;  2E6N A;  3JCM g;  4LXC A;  3OYH A;  2RPN A;  2MCN A;  2D6F A;  2HZY A;  3LWH A;  1I1J A;  5GAM g;  4J5Y A;  2HL5 C;  2GFU A;  3M53 A;  1V1C A;  5GMK i;  1YJ9 T;  2HDA A;  2RQT A;  4A54 A;  2LMJ A;  2L3P A;  4PJO B;  2DL5 A;  1JRI A;  1ZBJ A;  4Q5W A;  2G6F X;  5CQY A;  3C0C A;  4BI4 A;  1TOV A;  2SRC A;  2E1H A;  3PMT A;  1T3S A;  1Q86 R;  4M7D A;  2P84 A;  4BDZ A;  2MAM A;  1Q81 C;  2JMA A;  1Q82 C;  4YTL A;  3PMI A;  2HEQ A;  2FPD A;  4XK8 E;  4ELY C;  3X25 B;  3CD6 T;  4RUG A;  1MMD A;  4QT7 A;  5LL6 S;  4GY5 A;  4M7A D;  1AD5 A;  3N5B B;  4OVA A;  1KFZ A;  2BE7 D;  1XQH A;  2DRM A;  1UGS B;  4QQG A;  4QVD A;  3FJP A;  4A4H A;  4R56 A;  4DBR A;  2JZ2 A;  3OS5 A;  1RI9 A;  2X4J A;  3GNF B;  2LQN A;  4ZGD B;  5D7U A;  2EWN A;  2AHJ B;  2Z0W A;  2DF6 A;  3J81 E;  3M0T A;  2GBQ A;  1G3W A;  3OYD A;  1UJY A;  4M77 D;  2PVO B;  1YJ9 A;  3M58 A;  4PLI A;  2HBW A;  3QII A;  1HK9 A;  1WIE A;  1VQL Q;  1I8F A;  4CRI A;  1VQ6 T;  4B9X A;  3E2U A;  4EMK B;  3REB B;  4R55 A;  2QAZ A;  2QYZ A;  2K9G A;  5GAN g;  1I0C A;  3QBY A;  3A5Z B;  4CC7 A;  1K73 U;  1KHC A;  3OYE A;  3EHR A;  2E3H A;  2I0N A;  5FW9 A;  5KYX B;  1D3B A;  1PM3 A;  2BUD A;  3CD6 A;  2DPP B;  2FRW A;  1D1C A;  2HBP A;  4DQ2 A;  3VJP A;  1EZZ B;  3R6O A;  1VQP T;  3SWN C;  4Y92 A;  3MEV A;  4MZP A;  3RR6 A;  2HKN A;  5KCH A;  1TS9 A;  2ZZD A;  2ED1 A;  3CCR Q;  5IT9 E;  3JRZ A;  5CK9 A;  4J7I A;  5FRO A;  3FEO A;  1RAA B;  4M75 C;  3C12 A;  2LJ1 A;  2LDM A;  4M77 B;  2QA4 A;  3SB2 A;  3VS3 A;  2B86 A;  1B34 B;  4AMC A;  3JB9 G;  1CKB A;  3CCQ T;  2QGG A;  1ZBX A;  3MP6 A;  3UDC A;  2OI3 A;  1BCO A;  4J9C A;  4OB0 B;  5DLQ E;  4F04 B;  4E7J A;  4CC4 B;  2O9V A;  3GPL A;  4DEX A;  1YHQ Q;  3T9N A;  3M0R A;  4FCY A;  3UAT A;  2AZS A;  2DXU A;  1M90 U;  4QW2 A;  3CCV A;  4EMK A;  3TSZ A;  4N0A A;  3PE0 A;  4C5H A;  1OZ3 A;  2PUO B;  3BFM A;  2VUB A;  4C5I A;  4C92 F;  3GNG A;  4M78 C;  5LJ5 g;  2E5K A;  1X2K A;  1VQ4 Q;  2OTL A;  1H3Z A;  5KYX A;  5KYU A;  2ENM A;  2MPX C;  3SDZ A;  1VQO T;  2DD5 A;  1TUD A;  4MDW A;  1MV3 A;  2ECZ A;  2ZPI B;  1UHF A;  2XDD A;  3G6E Q;  2DA9 A;  3MCA B;  2CUB A;  3H0I A;  1S72 T;  3JCM b;  1BI2 A;  4D6W A;  3C4S A;  2PVG B;  1QVG S;  2ABL A;  1PD1 A;  3CME Q;  1G3S A;  1KJW A;  3VS5 A;  1RAD B;  1H3H A;  2LJ0 A;  2DL7 A;  1VQM T;  1YIT Q;  4OB1 B;  2HQE A;  4N4G A;  4DA4 A;  5GMK j;  4M78 E;  1W4S A;  1M1G A;  2HSE B;  2XI9 A;  1KQ2 A;  3GP8 A;  2JJ9 A;  1KK7 A;  1OX9 A;  1QQJ A;  3FDR A;  1HJD A;  1VQK T;  3NTI A;  4M7D C;  3DLL A;  3M57 A;  8AT1 B;  1BU1 A;  1BCM A;  1RLP C;  1M4Z A;  1ARK A;  1SSH A;  3QHS A;  5GAM e;  1JBM A;  1O75 A;  2X3X D;  1MMA A;  3A8H B;  2GGR A;  3CC4 A;  3CCS T;  3UA6 A;  4X9D A;  4C5G A;  3M0P A;  1VQN A;  4DBQ A;  1QCO A;  1IGQ A;  4J9E A;  2KRO A;  1QVG A;  2DKG A;  4ZN3 A;  1VQO A;  4HCC A;  1NPP A;  2EJF A;  4KUI A;  5I11 A;  3CMA Q;  2JW4 A;  4JPB W;  4M4Z A;  3JCM J;  2JT4 A;  1TU0 B;  1IHW A;  2D9T A;  1UEB A;  3M59 A;  4EPC A;  5LJ3 j;  2DFU A;  2DER A;  2ZPF B;  1KQS S;  1NYG A;  1PNJ A;  3I56 T;  4XTZ A;  2RJE A;  1OI1 A;  3CC2 T;  3JCM X;  2BIV A;  3EG9 B;  4M7D E;  2CP3 A;  1Q82 U;  2A36 A;  5I2S A;  3ZBD A;  1VQM A;  1AWW A;  4ZGJ B;  2CP2 A;  5LJ3 d;  5D6X A;  3KXT A;  1OEB A;  4HKE A;  2X4W A;  2NUT B;  4PJO C;  4TVR A;  1K76 A;  1YWO A;  2DIL A;  3VS7 A;  1FX7 A;  4C0F A;  1ZUK A;  4L5G A;  1RI0 A;  1P92 A;  5A0D A;  3SEM A;  1GCQ A;  3BY7 A;  2MWP A;  2RN8 A;  1JJ2 P;  1OPL A;  1SSF A;  1BBZ A;  2WSE E;  1ZA1 B;  2M9U A;  2HD0 A;  4DOW A;  2FVU A;  2RJC A;  2I2L A;  4IUT A;  3CPW P;  1WYX A;  2LZ6 B;  4MML A;  1Q95 G;  1GRI A;  2WSC E;  4OF1 A;  1X69 A;  2E64 A;  2VXF A;  1MV0 B;  1ZSZ B;  5IH2 A;  3CCJ A;  2HNI A;  1GL5 A;  1O9S A;  3OS0 A;  3HL8 A;  3OW2 S;  1G3Y A;  4LDU A;  1WX6 A;  3EHQ A;  2M0Y A;  1ZHI A;  3H41 A;  1YIJ T;  1YJN T;  1JXM A;  2BZ8 A;  1M1F A;  2KY9 A;  4II1 A;  3CCJ Q;  4C8Q G;  3JCM V;  1QCF A;  3M9Q A;  1YWP A;  4OB2 B;  3I56 A;  2JTF A;  2CZ6 B;  1OZ2 A;  5I22 A;  1QP2 A;  3CC2 A;  2EKO A;  2LCC A;  2F5K A;  2SEM A;  1K73 R;  1OOT A;  3TSW A;  5CKF A;  3OSS C;  1UTI A;  2RD1 A;  1DJ7 B;  4D8K A;  4ORZ A;  1FMK A;  4J8O A;  1BI3 A;  3RER A;  3DB4 A;  3CCU Q;  3ZL7 C;  1YN8 A;  2EJ9 A;  5DY9 A;  3RMS A;  2QQA A;  2CS7 A;  3PVL A;  1N5Z A;  1AWO A;  4EMK C;  3NTK A;  3ASK A;  5CAI A;  1W2B S;  1NJI C;  1KQS P;  2A28 A;  3H0H A;  4N0A C;  1TSF A;  4LDY A;  4XQ3 A;  5IHK A;  2LQW A;  3V7R A;  1B3Q A;  2FYK A;  2IG0 A;  3JSC A;  2QQS A;  5M9O A;  4E7L A;  1W1F A;  2EYY A;  1WHM A;  1K0X A;  2KSS A;  3OW2 A;  3L2V A;  3OYY A;  3A8M B;  1K1Z A;  1VQ7 A;  2JUF A;  5KYN A;  3QUI A;  2LJ3 A;  1QVF P;  3KUF A;  1Y07 A;  2W0Z A;  3QDF A;  2LP5 A;  4DBH A;  2R5M A;  2COZ A;  3JV3 A;  1N27 A;  1UJ0 A;  2L3R A;  2XG8 D;  2CH4 W;  3EG1 A;  1K0S A;  2F2W A;  4M7A G;  4PJN A;  4C5E A;  2Y90 A;  1VQ5 Q;  4Z02 A;  4OP0 A;  4F7U G;  2O4X A;  5HKC A;  2RJD A;  3CCM A;  5GAO p;  2MIO A;  3CEY A;  1M1K R;  3JB9 F;  1FMW A;  4KGV B;  1M90 R;  3VU3 C;  4KRT A;  1R77 A;  2YRV A;  4BY6 B;  3EGD B;  3FLG A;  2O2O A;  1UG1 A;  2FRY A;  5KCO A;  5LJ5 e;  2BTT A;  3QZ5 B;  3OYL A;  1W2B A;  2COW A;  4RMO A;  3OMG A;  2B8A A;  5GAN 4;  2Y4Y A;  1SG5 A;  1S1N A;  3RKY A;  1E7O A;  1JU5 C;  4QVC A;  4XTY A;  2CZ7 B;  4L6V 5;  5J3B A;  4XU2 A;  3EGU A;  4DBF A;  1RAE B;  3NPF A;  2HKQ B;  4FL6 A;  2L0A A;  2ZAE A;  2YLC A;  3MO8 A;  2GCX A;  2ZGW A;  4J9D A;  5C0M A;  5GAN 6;  3X20 B;  2XD0 A;  5IN1 A;  4JJN K;  3UPU A;  2EYZ A;  4IIO A;  1U5S A;  4C0D B;  2D8J A;  2QGF B;  4L59 A;  2YUN A;  1T3L A;  3FJ5 A;  3L2U A;  2VVK A;  3UA7 A;  1VOM A;  1FYN A;  2CZ1 B;  1YI2 Q;  2KGT A;  4BDY A;  4N4H A;  2LX9 A;  2RHZ A;  5L8R E;  3OSV A;  3UT1 A;  3V7C A;  1ZUU A;  4JLI A;  4XTW A;  5CKD A;  1VQ9 Q;  2C0T A;  5GAM j;  2DAQ A;  4KUL A;  3EGD A;  2GQI A;  4PJM A;  2DYI A;  3JCM d;  1M2V B;  1RAB B;  1KQ1 A;  1SHG A;  1JXO A;  5FRM A;  2M16 A;  5C6S A;  3I5S A;  1X01 A;  5GAM d;  3G71 Q;  3RUX A;  3V8L A;  4HT8 A;  1GCQ C;  2O9S A;  3L42 A;  4AT1 B;  4ESR A;  4E7H A;  1PG5 B;  1R8O B;  2QI2 A;  1WHH A;  1RL2 A;  1NLP C;  4JS4 A;  3M56 A;  1VQL T;  4ANJ A;  3JAM E;  4XTU A;  5GAN 7;  2AK5 A;  1KG1 A;  2XDB A;  2FHD A;  1N6A A;  2F5T X;  4JRK A;  3MET A;  3F70 A;  3X24 B;  5D6Y A;  3VRY A;  3GBQ A;  1Q82 R;  4CC2 A;  1RAF B;  3QYG B;  1WZO A;  3L1A A;  2D0Q B;  3LH5 A;  4V2S A;  1YJW A;  4E7I A;  2FZK B;  5GAO m;  2A08 A;  2KNB B;  2DMO A;  3UF4 A;  1D3B B;  4WF2 A;  3VS2 A;  1NEB A;  1M5Q 1;  2NLU A;  1YJW Q;  2QAS A;  2ROT A;  1CSK A;  3DB3 A;  2E65 A;  5GAO r;  2CGH A;  1FMV A;  2QG9 B;  2DLP A;  3CCR T;  1D1B A;  4XU0 A;  3A98 A;  2QEX Q;  4J7F A;  1UGR B;  2JM9 A;  1Q7Y U;  5HY6 A;  2CKK A;  2EQJ A;  2FPE A;  2EYW A;  2GTO A;  1M2V A;  1BB9 A;  2EPD A;  1MUZ A;  1WJR A;  5CVI A;  2QA4 T;  2KEA A;  3RMQ A;  1K8A U;  1OU9 A;  1D0X A;  3PNW C;  1K9A A;  2H3J A;  2KT1 A;  3OYA A;  1QP3 A;  2R5A A;  4HXJ A;  1F1B B;  3EG3 A;  3NTH A;  4PJO F;  1VQL A;  2L3Q A;  3QWY A;  5GAN j;  2EBP A;  1VQ8 A;  3OYI A;  3ER0 A;  3EG2 A;  5EC7 A;  2HAX A;  5DLO A;  1VQ8 Q;  1ZSZ C;  2J05 A;  2FEI A;  3CCV T;  2XHC A;  2DRK A;  2ATC B;  2VB6 A;  2RA2 A;  2WSF E;  2FZG B;  2P0Q A;  2P4R A;  5GAN d;  1TG0 A;  2RHU A;  4C8Q F;  1VYU A;  4JDS A;  4EMH A;  3QSU A;  1LOJ A;  1NJI U;  3MKD A;  4RTV A;  1H64 1;  3MJX A;  2X35 A;  5KYU B;  2OTL T;  1OX8 A;  3G6E T;  3HPW A;  2RM4 A;  3I9Q A;  2A7Y A;  1NM7 A;  2EIF A;  4Z8A A;  2YLB A;  3C95 A;  1QLY A;  3KFV A;  3CCR A;  2YRD A;  1AZE A;  1UDL A;  3M4Y A;  1UUE A;  2AIR B;  1UGP B;  3G4S Q;  2M02 A;  2ZPE B;  4UC4 A;  1WQ7 A;  3U23 A;  4Y91 A;  1YIT T;  1RLQ C;  3RES A;  3QKJ A;  1KC8 R;  1IO6 A;  4BD3 A;  3JCM P;  3TU4 K;  1YHQ A;  2E12 A;  3EH1 A;  1N8R R;  5CR2 A;  2D1X A;  2JTM A;  4MMK A;  4J6Y A;  2KMT A;  1IXD A;  2VAS A;  2NUP B;  3EFS A;  1SF9 A;  1KD1 C;  4RTZ A;  5LJ5 j;  4M75 G;  2LVM A;  5GJV B;  2M0O A;  1I4K 1;  2LC4 A;  2V1Q A;  3CCE Q;  2BZX A;  4M7A F;  1VQ4 A;  4F7U F;  1MMN A;  4GLM A;  2M51 A;  3HHT B;  2DE0 X;  3QJY A;  5GAO l;  1WXT A;  3HSB A;  4B6M A;  4LDV A;  5LJ5 d;  2Y4X A;  3CC4 T;  1BIB A;  4BI8 B;  1VQN T;  3E9G A;  2JOY A;  3G6E A;  3CMA T;  3QXE B;  1GFD A;  3GLX A;  6AT1 B;  2K4Y A;  1G3T A;  2IIM A;  4BY6 C;  1BK2 A;  1ZQ1 A;  2CT3 A;  1OU8 A;  2EQU A;  1ABO A;  2DZC A;  1VQ6 Q;  2JS0 A;  3CME A;  4O5V A;  4LDX A;  2OX7 A;  1IB8 A;  4M77 F;  5GAN 3;  4M78 G;  2K5F A;  4JJC A;  1GFC A;  2KXC A;  1YIT A;  2HQX A;  5GAN 5;  4VUB A;  4C92 A;  2V1R A;  4PJL A;  3X26 B;  2JXB A;  4Z89 A;  3I55 A;  2E4H A;  1VUB A;  4QVZ A;  1U8R A;  2EQK A;  4O6J A;  1VQP Q;  3I55 Q;  2FPF A;  1R0B G;  2RH2 A;  3L2Q A;  3EAE A;  5CQX A;  4C0D C;  3FIF A;  5GAO q;  2DK3 A;  3GIB A;  1N9S A;  3M0U A;  2NUP A;  4J9B A;  2DL3 A;  2L8D A;  2DIQ A;  1XNI A;  5FU6 B;  3EG0 A;  1FWZ A;  1YBY A;  1ZX6 A;  1QCN A;  3LW5 E;  3V8K A;  4LE9 A;  1M30 A;  1AEY A;  3M0S A;  1PKT A;  4AG2 C;  2L5Q A;  1W70 A;  2DTI A;  5KE2 A;  1SHF A;  2RK2 A;  2EW3 A;  4HCZ A;  1U3O A;  2PVD B;  3FC3 A;  4PL6 A;  3CMA A;  2MK5 A;  2RMO A;  1YCS B;  3CCJ T;  3RBB B;  2PUK B;  2QK0 A;  4A63 B;  5DM7 R;  2HQH A;  4M7D G;  4PKC C;  3C94 A;  4LUE A;  4JJD A;  3EFR A;  2K5L A;  2CH4 A;  1VIE A;  1XJW B;  4FM4 B;  1WHJ A;  2VC8 A;  3MP8 A;  2VKN A;  2VXE A;  3RKW A;  1IHV A;  1BKB A;  1M3C A;  3CC7 Q;  2EYQ A;  3S6W A;  1Q81 U;  5LJ3 f;  2EGC A;  1K9M C;  2K3B A;  2C06 A;  2HSP A;  2VYT A;  2LQ8 A;  1Y96 A;  4BUG A;  4E47 A;  2J6F A;  4FSS A;  1WHG A;  1AWJ A;  1B07 A;  4HVW A;  3PIP A;  2DTO A;  4QQ6 A;  3OYG A;  4FYW B;  3QJ6 A;  1C6V X;  5AYF A;  3BDU A;  3LYI A;  4XU1 A;  2YSQ A;  4JZ4 A;  1QVG P;  2QDL A;  5GMK m;  1X75 C;  1AZG B;  2LT1 A;  1Q7Y R;  1I5O B;  1BI1 A;  5GAN 2;  4NL3 A;  3JB9 D;  4IKF A;  2OTJ Q;  5ECA A;  5IAY A;  1SPK A;  3OYN A;  2RHI A;  4LNP A;  4WTO B;  1VQ7 T;  3LLR A;  4PJO G;  4ZTJ A;  4XAX B;  1K8A R;  4RTX A;  4MZT A;  2JS2 A;  4J9H A;  3EH2 A;  1HXD A;  2DXB A;  4IUP A;  1ZUY A;  1VQK Q;  4KGX B;  1WPY A;  1WHK A;  2O4X B;  2C0O A;  4E7S A;  1NYF A;  2CP7 A;  2RF0 A;  3CCM T;  4R0K A;  2JTE A;  1Z9Z A;  3ZFJ A;  2MYS A;  4HVV A;  3MEA A;  3CCS Q;  5GAN 8;  2DEQ A;  2CZ0 B;  3CCU A;  2QQR A;  5FWC A;  2O31 A;  4LD9 K;  2FG0 A;  1PKS A;  1NJI R;  5GAO n;  3TVT A;  1U1S A;  5HCK A;  4AFS C;  7AT1 B;  3CBP A;  4JRP A;  4KGZ B;  2F2V A;  4OMN A;  1Y7X A;  4C0Z A;  4QKU A;  5IHN A;  3OYB A;  1M3B A;  1BI0 A;  2O88 A;  2XIC A;  2GQV A;  2A0F B;  2CYZ B;  3QPH A;  2E41 A;  4J9F A;  4NOY A;  4C8Q E;  3A8O B;  1K73 C;  1LCK A;  3P8D A;  1WXB A;  4JZ3 A;  4A4F A;  1YI2 T;  1D1A A;  2ZPB B;  2ZPH B;  2PZ1 A;  1TTH B;  2WAC A;  3O8V A;  4PFZ A;  3AT1 B;  2COY A;  3VUB A;  3MHX A;  2KDS A;  2DXT A;  5GMK h;  1VQ5 A;  2LTO A;  4KH0 B;  3CXC S;  1RUW A;  4JRI A;  2GFA A;  3PIO A;  1KD1 U;  3OYC A;  2OAU A;  1C1A A;  2RQV A;  1HYO A;  3OYM A;  4C92 C;  1RAH B;  1M27 C;  1VQ9 T;  1IGU A;  1LPL A;  1N9R A;  2EAY A;  1XTD A;  4C0G A;  1HD3 A;  3EGX A;  2KT8 A;  2QQ9 A;  1WXU A;  1SEM A;  3G71 T;  3OW2 P;  3SHW A;  2DM1 A;  4M75 F;  2VGM A;  2XU8 A;  1D09 B;  4E2F B;  2RHX A;  3CBM A;  3THK A;  2OJ2 A;  2RNA A;  1YIJ Q;  4OMF B;  1YJN Q;  2E10 A;  4M77 G;  1T0H A;  4F16 A;  1QKX A;  4OB3 B;  3KBG A;  2BE9 B;  4FU6 A;  5GMK l;  5FU7 B;  5I21 A;  1M1K C;  5LJ3 h;  4PJJ A;  4F7U E;  1PCX A;  2AT1 B;  2KVQ G;  2FL7 A;  4C92 E;  2K5I A;  3MEU A;  2CT4 A;  3CXC A;  1VIF A;  3CCL Q;  3QG1 A;  2KRS A;  5J26 A;  2BZY A;  2X4X A;  1YI2 A;  4RTY A;  4Z88 A;  1OQK A;  1WQW A;  2BKD N;  3NGP A;  4M75 A;  4Y28 E;  1D0Y A;  5L23 A;  2JVV A;  1UFF A;  2GTJ A;  1YJW T;  1X6O A;  1W2B P;  4PNO A;  1GCP A;  1W6X A;  4M78 F;  3GOX A;  3HRU A;  5FRN A;  5J39 A;  4LUD A;  1LNX A;  4ELZ C;  3P8H A;  2CP5 A;  1RAI B;  1VQ9 A;  2K2M A;  4JUV A;  2DVE A;  2RK1 A;  3JCM f;  4BE2 A;  1NZ9 A;  2X4Y A;  1WFW A;  1VYT A;  4KH1 B;  1TH7 A;  4RCB A;  4XTV A;  4MZM A;  2X51 A;  3G71 A;  5GAM f;  3E19 A;  4AFQ C;  2KYM A;  3X28 B;  4C8Q D;  3S3N A;  3MP1 A;  5FU6 C;  3INZ A;  4OML A;  3I35 A;  2QXF A;  3PVQ A;  1SRL A;  3A1P A;  3VS0 A;  1EIF A;  5KYY B;  5CKH A;  1PHT A;  1WA7 A;  1WNL A;  2E6Z A;  1VQ8 T;  2V8K A;  2D0N A;  3H0F A;  2QDY B;  1K9M U;  3A8G B;  4J9G A;  2FB7 A;  2RJF A;  4X34 A;  1TUC A;  3RKX A;  4M7D F;  4N4I A;  1Q81 R;  5D6W A;  5CO7 A;  3GF5 A;  1MNE A;  4ATO A;  3OA6 A;  4OGC A;  1M2O A;  4RG8 A;  2OAW A;  1UHC A;  1V76 A;  2MF2 A;  2PU9 B;  2K2V A;  4JLG A;  3E9F A;  1I81 A;  3G4S T;  5LJ3 e;  2QEX A;  4F14 A;  1U06 A;  2DTH A;  2EQM A;  3VKI A;  2EQI A;  2ZPG B;  3J80 E;  4JJB A;  5IHI A;  1WJS A;  3LX7 A;  3M0Q A;  2H3E B;  4C8Q B;  1G5V A;  1SRM A;  3FB9 A;  3OYJ A;  1Q86 C;  4ZTF A;  2LRQ A;  4K11 A;  1X27 A;  3BW1 A;  1YFN A;  3E1S A;  2YUP A;  2DEU A;  2DD4 A;  1G83 A;  1T0J A;  1I07 A;  4KT0 E;  4AG1 C;  4A4E A;  4KUD K;  2KBT A;  2KRN A;  4A4G A;  4C92 D;  1ZLM A;  2DZ9 A;  1YHQ T;  1BIA A;  5KYY A;  3O5Z A;  1UGV A;  4BE1 A;  1YNZ A;  1KHI A;  3CCE T;  2KE9 A;  1PRL C;  4FYY B;  2DNU A;  2K3X A;  3L2Z A;  5GAN f;  3HFO A;  2A37 A;  3OB9 A;  3DLM A;  1KSW A;  5CKB A;  4JRQ A;  3BDL A;  2D8H A;  3ZEH A;  1VQ4 T;  3LH0 A;  1MND A;  4FW2 A;  2F69 A;  1V29 B;  1UGQ B;  3JB9 J;  2RQW A;  3I5R A;  2HMA A;  2JM8 A;  3V8J A;  2K3Y A;  1WGS A;  5A0G A;  2DIG A;  2VV5 A;  1YJ9 Q;  2DYB A;  4JS5 A;  4PJO A;  2J6O A;  3M55 A;  5GJW B;  2RQU A;  3G4S A;  4BB7 A;  4BE0 A;  3OYK A;  5A0L A;  4FT2 A; 
#chains in the Genus database with same CATH homology
 3ZL7 C;  1YN8 A;  1M30 A;  1AEY A;  3M0S A;  4IIM A;  1AVZ C;  3PVL A;  1N5Z A;  1AWO A;  1PKT A;  4AG2 C;  1W70 A;  2KYB A;  1NEG A;  1SHF A;  1YP5 A;  2A28 A;  2EW3 A;  3H0H A;  1U3O A;  5IHK A;  2LQW A;  2JMC A;  2RMO A;  2RPN A;  1YCS B;  1B3Q A;  3RBB B;  1W1F A;  2RQR A;  2MCN A;  4A63 B;  1QWF A;  1H92 A;  2EYY A;  1HSQ A;  1K0X A;  1I1J A;  4LUE A;  4JJD A;  2CH4 A;  1K1Z A;  2CRE A;  2CSI A;  2LJ3 A;  2W0Z A;  1V1C A;  2VKN A;  2LP5 A;  2LNH B;  2HDA A;  2RQT A;  1M3C A;  4E6R A;  2DBK A;  3JV3 A;  1UJ0 A;  2LMJ A;  2EGC A;  2K3B A;  1JO8 A;  2L3P A;  2HSP A;  2CH4 W;  3EG1 A;  1K0S A;  2DL5 A;  2F2W A;  2AKK A;  2KXD A;  1ZBJ A;  2G6F X;  1G2B A;  2J6F A;  3C0C A;  4FSS A;  2SRC A;  1AWJ A;  1B07 A;  2MIO A;  4HVW A;  2DL4 A;  5IXF A;  3VRZ A;  1T3S A;  2NUZ A;  4KRT A;  2YSQ A;  2JMA A;  4JZ4 A;  2O2O A;  1UG1 A;  2FRY A;  2QDL A;  2BTT A;  1E6G A;  1AZG B;  2HEQ A;  2FPD A;  1Y0M A;  2YDL A;  4RUG A;  1S1N A;  1E7O A;  1JU5 C;  4QT7 A;  1AD5 A;  1KFZ A;  5ECA A;  1SPK A;  4LNP A;  2DRM A;  3EGU A;  4RTX A;  1CKA A;  3NPF A;  4GBQ A;  1Z9Q A;  2JS2 A;  2HCK A;  2L0A A;  4J9H A;  4J9D A;  4J9I A;  1RI9 A;  1ZUY A;  5IXB A;  2EYZ A;  2LQN A;  2KR3 A;  3NHN A;  4IIO A;  1EFN A;  3CQT A;  1U5S A;  2C0O A;  2DF6 A;  1NYF A;  2RF0 A;  2GBQ A;  3M0T A;  4AFU C;  2D8J A;  4R0K A;  2YUN A;  1T3L A;  2JTE A;  1Z9Z A;  1UJY A;  3FJ5 A;  2VVK A;  3UA7 A;  2HBW A;  1FYN A;  4HVV A;  2XMF A;  2KGT A;  1WIE A;  5FWC A;  2O31 A;  3NMZ C;  2FG0 A;  1PKS A;  3TVT A;  3REB B;  5HCK A;  4AFS C;  2K9G A;  1X2Q A;  1I0C A;  4CC7 A;  1UEC A;  1E6H A;  2F2V A;  1ZUU A;  4OMN A;  2EKH A;  2C0T A;  2ROL A;  3EHR A;  1WLP B;  5IHN A;  2I0N A;  4OMO A;  5FW9 A;  1M3B A;  4D8D A;  2GQI A;  2EVR A;  3RNJ A;  2O88 A;  1Y57 A;  2YUO A;  1SHG A;  1JXO A;  2FRW A;  4J9F A;  4AFZ C;  1X6G A;  2LX7 A;  3I5S A;  1AOJ A;  1LCK A;  1WXB A;  4JZ3 A;  4Y92 A;  1GCQ C;  2O9S A;  4ESR A;  1AWX A;  4F17 A;  2X3W D;  2PZ1 A;  2DVJ A;  3VS4 A;  1NLP C;  2ED1 A;  2AZV A;  2AK5 A;  4RTW A;  1RUW A;  2LJ1 A;  3VS3 A;  2B86 A;  2RQV A;  4OMQ A;  3VRY A;  1M27 C;  3GBQ A;  2LCS A;  1CKB A;  4CC2 A;  2CUD A;  2OI3 A;  3LH5 A;  4J9C A;  2A08 A;  2KNB B;  4ZNX A;  2DMO A;  4CC4 B;  3UF4 A;  2O9V A;  2F2X A;  3VS2 A;  1HD3 A;  4DEX A;  1NEB A;  3M0R A;  2KT8 A;  3UAT A;  1WXU A;  1SEM A;  2AZS A;  2ED0 A;  3SHW A;  2W10 A;  2ROT A;  2DM1 A;  1CSK A;  3IQL A;  3TSZ A;  3THK A;  4X1V A;  3PE0 A;  2OJ2 A;  2YT6 A;  2DLP A;  2RNA A;  1T0H A;  2EGA A;  3A98 A;  4F16 A;  1H8K A;  1QKX A;  2E5K A;  1X2K A;  2JM9 A;  4LN2 A;  2FPE A;  2EYW A;  2ENM A;  2GTO A;  2L2P A;  5FWB A;  1BB9 A;  2EPD A;  1MUZ A;  4HCK A;  1TUD A;  1MV3 A;  2ECZ A;  2KEA A;  2CT4 A;  1UHF A;  2DA9 A;  1K9A A;  2KRS A;  2CUB A;  3QWX X;  1J3T A;  1GBR A;  2BZY A;  2KT1 A;  3H0I A;  4RTY A;  4Z88 A;  3NGP A;  4HXJ A;  1GBQ A;  5L23 A;  2FO0 A;  3EG3 A;  2L3Q A;  1UFF A;  2GTJ A;  3QWY A;  2ABL A;  2EBP A;  1GCP A;  3ULR B;  1PRM C;  1KJW A;  1W6X A;  1QKW A;  4HVU A;  3VS5 A;  4CC3 A;  2EYX A;  2CSQ A;  1H3H A;  3EG2 A;  4LUD A;  3REA B;  5EC7 A;  2LJ0 A;  2DL7 A;  2J05 A;  2K2M A;  2FEI A;  2VWF A;  2DRK A;  3R6N A;  1X43 A;  2P4R A;  2DX1 A;  1TG0 A;  1VYU A;  2DBM A;  1OPK A;  1WFW A;  1VYT A;  4RTV A;  1JEG A;  1HJD A;  1A0N B;  3I9Q A;  4AFQ C;  1BU1 A;  2KYM A;  1NM7 A;  4Z8A A;  1RLP C;  1ARK A;  2H8H A;  1SSH A;  1QLY A;  3KFV A;  1AZE A;  1UDL A;  1X6B A;  2X3X D;  1UUE A;  4OML A;  2EGE A;  2GGR A;  3I35 A;  1VA7 A;  2J6K A;  3PVQ A;  3UA6 A;  1SRL A;  3VS0 A;  2ESW A;  3M0P A;  2GNC A;  1PHT A;  4J9E A;  2K79 A;  2KRO A;  1WA7 A;  3U23 A;  1RLQ C;  2D0N A;  3H0F A;  1JQQ A;  5I11 A;  4J9G A;  4RTT A;  1NLO C;  1IO6 A;  1TUC A;  2JW4 A;  4JPB W;  4M4Z A;  2JT4 A;  1M3A A;  2DL8 A;  1K4U S;  2D1X A;  1NYG A;  1PNJ A;  1WI7 A;  2PTK A;  1NG2 A;  1XOV A;  2A36 A;  2MOX A;  2OAW A;  4RTZ A;  1UHC A;  2J7I A;  4OMM A;  5GJV B;  3VS1 A;  1M8M A;  1AWW A;  2V1Q A;  2K6D A;  2BZX A;  4F14 A;  1OEB A;  4RTU A;  1U06 A;  1KIK A;  1UE9 A;  2EQI A;  4GLM A;  2M51 A;  1K76 A;  1YWO A;  2DE0 X;  2DIL A;  3VS7 A;  1WXT A;  4JJB A;  5IHI A;  1QWE A;  1ZUK A;  2DJQ A;  3M0Q A;  1VYV A;  1SRM A;  2NWM A;  3SEM A;  1GFD A;  1GCQ A;  2IIM A;  2RN8 A;  2PNI A;  4K11 A;  1BK2 A;  1OPL A;  1X27 A;  1BBZ A;  1WDX A;  2YUP A;  2CT3 A;  1G83 A;  1T0J A;  1ABO A;  1I07 A;  1OV3 A;  4AG1 C;  2JS0 A;  2KBT A;  2KRN A;  1ABQ A;  1WYX A;  2LZ6 B;  1ZLM A;  1GRI A;  4JJC A;  1GFC A;  1X69 A;  3O5Z A;  1MV0 B;  2CDT A;  1UGV A;  2J06 A;  2KXC A;  5IH2 A;  1YNZ A;  1ZSG A;  1GL5 A;  3VS6 A;  2KE9 A;  1PRL C;  2V1R A;  2K7A A;  2DNU A;  2AKL A;  1WX6 A;  3EHQ A;  2M0Y A;  2JXB A;  4Z89 A;  3H41 A;  1JXM A;  2BZ8 A;  1PWT A;  2A37 A;  4EIK A;  2YUQ A;  4WCI A;  1KSW A;  2D8H A;  2C0I A;  1QCF A;  2FPF A;  1YWP A;  5I22 A;  2RQW A;  3I5R A;  4DEY A;  2SEM A;  4OMP A;  2JM8 A;  1OOT A;  3TSW A;  3M0U A;  4J9B A;  2DL3 A;  1UTI A;  2DYB A;  2J6O A;  5GJW B;  2RQU A;  3EG0 A;  1ZX6 A;  4ORZ A;  4D8K A;  2KRM A;  1FMK A;  2L3S A;  4LE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...