2BZYA

Homodimer of crkl-sh3c domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
b'PVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRK-LIKE PROTEIN
publication title The C-Terminal SH3 Domain of Crkl as a Dynamic Dimerization Module Transiently Exposing a Nuclear Export Signal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
total genus 5
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bzyA00
2A08A 5HCKA 2DYBA 3PVQA 2O9SA 3NPFA 4JPBW 2K2MA 2OAWA 1UHFA 2RQWA 2I0NA 3EG0A 2GGRA 2RPNA 1QKWA 2J6KA 3H0FA 3VS5A 1Y0MA 2GNCA 1KJWA 2DM1A 1AZEA 4Y92A 2KNBB 1AWWA 2J6FA 2LQWA 2AZVA 2CUDA 2F2VA 4RTVA 2DVJA 1UHCA 2DL3A 3M0UA 1T0HA 1XOVA 3VS6A 2KBTA 2A36A 2F2XA 2EPDA 2JTEA 2ENMA 2YUOA 2VWFA 2DA9A 2L3PA 1SSHA 2JXBA 3M0QA 1YNZA 4RTYA 2W0ZA 2KYMA 1W1FA 2DL5A 1UE9A 1ABQA 4ORZA 2VVKA 1JXMA 3VS0A 3I35A 3H41A 4DEYA 4AFUC 1PRMC 3EHQA 3ULRB 2BZ8A 2BTTA 1PWTA 2GTOA 1TG0A 2CDTA 1ZSGA 1WIEA 1NYFA 1Z9QA 1T0JA 2DNUA 1RLQC 1EFNA 1U3OA 1UECA 3PVLA 2KEAA 4J9BA 3UA7A 1GL5A 2W10A 4AFQC 1ZUYA 1X6BA 4Z88A 3I9QA 4ESRA 5IHNA 2KRNA 2YUQA 1E6GA 1HSQA 1NM7A 5I22A 3O5ZA 1WI7A 1U06A 4CC7A 1S1NA 2ESWA 2LMJA 2O2OA 4OMQA 2EKHA 4KRTA 4IIOA 2RQTA 1AWJA 1QWEA 1RI9A 1Z9ZA 4Z8AA 1PKTA 2JS2A 5IH2A 1OPLA 1OV3A 1T3SA 4LE9A 4WCIA 1OPKA 1QCFA 1GBRA 2GTJA 2X3XD 2BZYA 2LQNA 1NLOC 2KXDA 3NHNA 1UG1A 1UGVA 4RTTA 4HCKA 2HCKA 2HDAA 1H92A 4F14A 4HVUA 4OMNA 3KFVA 1AEYA 2MCNA 5GJWB 2JM9A 1X69A 2CSIA 2LCSA 2JMCA 1SEMA 2XMFA 5IHIA 3UA6A 2HEQA 1WYXA 3EG3A 4IIMA 4CC2A 2X3WD 1JU5C 1QLYA 2RN8A 2HBWA 2DE0X 2RMOA 2FPFA 4D8KA 2SEMA 1LCKA 3A98A 2DL8A 3M0RA 5FWCA 1WA7A 3TSWA 1QWFA 1AD5A 3RNJA 4RTWA 2H8HA 2YSQA 1T3LA 1HD3A 1E7OA 1ZLMA 1MV3A 2CREA 4R0KA 1HJDA 2IIMA 2V1QA 4X1VA 2DX1A 2EW3A 2DRKA 4OMOA 1PHTA 1ZUKA 3IQLA 3I5RA 4E6RA 1ZBJA 2O31A 2RQVA 1K1ZA 1K0XA 4JJDA 2FRWA 1SHGA 1GFCA 2DILA 1M3CA 3EG2A 2M0YA 3U23A 2YUNA 3REBB 3ZL7C 1FYNA 1CKAA 4OMMA 3EGUA 1M8MA 4RTZA 2ECZA 2G6FX 2JS0A 1H3HA 1WXBA 4J9GA 2ABLA 2LX7A 2M51A 1GCPA 1AVZC 2DLPA 2LZ6B 1UUEA 2CT3A 1X2KA 2F2WA 1CKBA 1ZX6A 4F17A 1UFFA 2B86A 2A28A 1OOTA 2DBMA 2JW4A 2K79A 2RF0A 2DRMA 2OJ2A 4RTXA 4OMLA 2DJQA 1BB9A 3VS2A 2AZSA 2KE9A 1UJ0A 1W6XA 3SEMA 1PNJA 2CH4W 1A0NB 5EC7A 4J9FA 3H0HA 4HVVA 3R6NA 2ROLA 5IHKA 4LN2A 2A37A 2L3QA 1X27A 2KR3A 5FWBA 1CSKA 1Y57A 5FW9A 1BBZA 1U5SA 3M0PA 2PTKA 1JEGA 2LP5A 4HVWA 3VRZA 3CQTA 1M27C 2V1RA 2J7IA 2LJ3A 2OI3A 4J9HA 3SHWA 2O88A 2QDLA 3JV3A 1JQQA 2GBQA 4GBQA 2K9GA 2C0OA 1MV0B 2LJ0A 1X6GA 2EYYA 1TUDA 1NEGA 1PRLC 1ZUUA 2E5KA 2LNHB 2L3SA 2PNIA 1WLPB 2PZ1A 1W70A 2EYWA 2DBKA 2MOXA 1JXOA 2JMAA 2NWMA 2EYZA 2SRCA 4JZ3A 2D8HA 2O9VA 4CC3A 2K6DA 1YP5A 1SHFA 1K0SA 2J05A 3PE0A 4GLMA 2CH4A 2HSPA 2K7AA 1SPKA 1WFWA 2C0IA 2P4RA 4FSSA 4K11A 2D8JA 2EQIA 3VS4A 1NYGA 1IO6A 2KGTA 2J06A 5GJVB 1PKSA 2FPEA 3VRYA 5ECAA 1M3BA 4J9CA 4AG1C 4LUEA 1NEBA 4A63B 4Z89A 3I5SA 1I0CA 3M0SA 1KIKA 3UATA 2YUPA 4RUGA 1G2BA 1GRIA 2GQIA 1FMKA 1K76A 2MIOA 2FEIA 2ED0A 2KYBA 4J9DA 1VYVA 1YCSB 1YWPA 3QWXX 1WXTA 4D8DA 2YDLA 4CC4B 1WX6A 1GCQC 2EGCA 3H0IA 1SRLA 3VS1A 2DMOA 2VKNA 3TVTA 3M0TA 2DF6A 2AKKA 2RQUA 3UF4A 2EGEA 2BZXA 3TSZA 3EG1A 1TUCA 2EYXA 5I11A 3VS3A 2L0AA 1X43A 1RUWA 3EHRA 2RQRA 1VYUA 1N5ZA 2FO0A 2EGAA 1UTIA 2ED1A 1KFZA 1SRMA 3C0CA 4LNPA 4RTUA 1AOJA 1OEBA 1QKXA 1B3QA 1BK2A 4LUDA 4HXJA 1K4US 1UJYA 1I07A 1MUZA 3REAB 2CUBA 1UDLA 1WXUA 4M4ZA 4AFSC 4OMPA 1BU1A 1V1CA 1VYTA 1M3AA 2KT8A 4AG2C 1H8KA 3FJ5A 2KT1A 2ROTA 1GBQA 1RLPC 2D0NA 1K9AA 2FPDA 2KRMA 2KROA 2L2PA 5IXFA 1AWXA 3NMZC 2D1XA 4J9EA 1ABOA 1VA7A 2KRSA 2J6OA 2EBPA 2EVRA 2AKLA 2JM8A 1M30A 1ARKA 2FG0A 4JJBA 3THKA 3LH5A 1J3TA 1YWOA 4J9IA 2JT4A 1AWOA 2C0TA 1AZGB 1KSWA 5IXBA 2K3BA 2YT6A 2LJ1A 1B07A 2RNAA 1I1JA 2NUZA 2DL4A 1JO8A 1NLPC 4AFZC 3QWYA 4ZNXA 3VS7A 1WDXA 4F16A 2AK5A 4QT7A 3RBBB 4EIKA 1E6HA 3GBQA 4DEXA 2CT4A 1GFDA 4JJCA 1GCQA 3NGPA 4JZ4A 2KXCA 1YN8A 1NG2A 2DL7A 2CSQA 5L23A 2FRYA 1G83A 1X2QA
chains in the Genus database with same CATH superfamily
3PVQA 4M75D 3NPFA 4JPBW 3JCMe 2A0FB 1C0MA 5DLQE 3CCSQ 2ZPIB 1W2BA 4M7AF 2RQWA 2I0NA 3MEVA 1OU9A 2GNCA 3X26B 4IUPA 2MI6A 5GAN7 2DM1A 1M90U 1ZQ1A 3OBYA 1AWWA 2JOYA 3JCMP 3G71T 1UHCA 1T0HA 2V8KA 1XOVA 4D6WA 2V8JA 2KBTA 4JRIA 4XAXB 1D0ZA 4M78D 2VWFA 2DA9A 3LWHA 4KULA 3OYBA 3QO3A 1U8RA 2LQ8A 3CD6T 2MF2A 1W1FA 3M54A 5L8RE 1S72Q 4VUBA 1YJ9A 3HP9A 1R8OB 3VS0A 4JLIA 3I35A 2GQVA 3H41A 4R55A 2KVQG 4AFUC 2OTJQ 1WJSA 4XTVA 2BTTA 3FJPA 5LJ3f 1PWTA 1M1KC 4DBHA 4M75A 1WIEA 2CZ0B 1T0JA 3QG1A 3RR6A 4FSXA 4M7DG 4J9BA 2QK0A 2LTOA 3CCQT 1ZUYA 4LDYA 3V7RA 4RMOA 4KBMB 1RAAB 2DD4A 4OB1B 1VQ6Q 4M7DE 5GAOm 5CKDA 5HK3A 2FL7A 1TH7A 5FU7B 2O2OA 3TQ7P 4OMQA 3NTHA 2FZCB 2HAXA 2RQTA 3C12A 2O4XA 2P84A 2HBPA 2CP5A 2JN0A 4M78A 2Y4XA 3CPFA 2VUBA 1T3SA 4ELZC 2DXCA 4WCIA 3X25B 4MZTA 4ZN1A 1Q81C 3SFMA 3VJPA 4BY6B 2LQNA 4A54A 2KXDA 1N8RC 3NHNA 3V8LA 1UG1A 1AT1B 1UGVA 4RTTA 4HCKA 1JB0E 2HDAA 3TCJA 5LJ5d 4HVUA 4OMNA 2PUOB 1GXIE 1IZ6A 2RH2A 2MCNA 1KC8U 2JTFA 3QYGB 1WYXA 1VOMA 4CC2A 2HL5C 2EQJA 2DERA 4XU2A 2RN8A 1NPRA 2HBWA 3V7SA 3CCEQ 2DE0X 1WHMA 5LJ5g 3CCMQ 1KQ2A 3A98A 1VQ4Q 1VQ7Q 5GAN6 4A53A 4DOVA 1WHJA 3E1SA 4M75G 3RNJA 2DZCA 2H8HA 1VQ5A 1MV3A 3QXEB 1QVPA 2IIMA 2V1QA 5KCOA 1VUBA 4XU3A 4M7DC 1RAGB 4M75E 4E6RA 3L2VA 2RQVA 4FW2A 4JJDA 1SHGA 1HK9A 2DILA 2E5QA 3U23A 2YUNA 4JRKA 4NS5A 3L2ZA 2ECZA 3CPWS 1YJWT 3OYHA 3CC7T 7AT1B 4J9GA 4A4HA 1TUGB 2RHIA 4DBRA 3CCRA 4M78G 1YHQA 3FRNA 1AVZC 1EX4A 5C0MA 1LOJA 1PM3A 2LX9A 3HKSA 4C8QA 2M9UA 2E3IA 4M78E 1G3SA 3HSBA 2DBMA 3A1PA 2JW4A 2RF0A 3HHTB 3JCMf 4A4GA 1R0BG 2RJEA 4OMLA 3VS2A 2AZSA 2KE9A 1UJ0A 5CAIA 3OYCA 5KE3A 1QVGS 4J8OA 1QCOA 2R58A 4X9DA 3BY7A 3VUBA 1B34B 1TOVA 1VQPQ 4HVVA 3JCMV 3GIBA 1YIJT 5GAN3 1IB8A 5LJ5f 5FWBA 5FW9A 3C95A 1LPLA 1ACMB 2F1LA 3EH2A 1X75C 2LP5A 3HFOA 5GMKh 3VRZA 3CQTA 3L2WA 1BIBA 4FT2A 4E7LA 2ATCB 2BKDN 4M75C 4A4FA 2QDLA 5DM7R 2DKGA 2MK5A 2VASA 3HL8A 1PD1A 1K8AC 2K9GA 2LJ0A 1WQWA 3RMQA 2EYYA 1TUDA 2NYSA 3V7CA 2L3SA 2EAYA 1KC8C 2EYWA 1JXOA 2JMAA 2SRCA 4FYWB 2HD0A 1YP5A 2F5TX 1IHVA 3PE0A 3X20B 2EIFA 2HSPA 4M7AB 1Q82R 1SPKA 2X9HA 4FSSA 3P8DA 4J6XA 4JDSA 1NYGA 2KGTA 4C5HA 1VQMA 2J06A 3VRYA 2OTJT 4M78C 3O8VA 1M3BA 2L8DA 1SF9A 5GAMd 2YRCA 4A63B 3M0SA 1WZOA 2YUPA 3S3OA 4JRQA 2EYQA 2MIOA 4J9DA 1IREB 2ED0A 4DA4A 2YXYA 1WXTA 2QTXA 4CC4B 1K9MU 2R5AA 5CKFA 1D3BA 3SD4A 1G3TA 2EGCA 3VS1A 2VKNA 2XKOC 3CMAA 3TVTA 3I56Q 1WHGA 2DF6A 5GAMg 2EGEA 2L5QA 4QQDA 3SWNB 1TUCA 5I11A 5KYNA 3G4SA 2L0AA 5GAOr 3JCMX 3OW2P 5GAMj 2EGAA 2COWA 3C0CA 2MYSA 5CR2A 4MZMA 5J3BA 1OEBA 3MHXA 3JAME 3JB9I 1OX9A 4LUDA 1U1TA 5GANh 3OYJA 3RKYA 1ZSZB 2ZGWA 1I8FA 3G71Q 4C5IA 2IPOB 3LWIA 2RM4A 3QDRB 4PKCC 4AFSC 1AHJB 5KYWA 1V1CA 4XU1A 3PMIA 2JVVA 1EIFA 2D0NA 1YJNA 1K9AA 2FPDA 2KRMA 5KH6A 2L2PA 2FVUA 3CC2T 3CD6Q 1UGPB 2D1XA 3QHSA 2VGNA 4J6YA 3OBWA 4BE1A 2EBPA 4FM4B 2EVRA 2AKLA 2LT4A 4PJOA 4F7UA 3HTRA 4V2SA 2OAUA 1TXQA 2RI5A 3QSUA 1J3TA 4J9IA 2OTLA 4M7DF 2B8AA 2GF7A 1N9SA 1AWOA 1KSWA 3CCLT 4C92D 1Q86U 5GANe 3EGDB 3CCQQ 1B07A 2NUZA 4EMKA 4IKFA 2QQRA 3QWYA 1MNDA 4N4HA 1U1SA 1EZZB 1OI1A 4LDXA 1VQ9A 1E6HA 3GBQA 4LDVA 1GCQA 3NGPA 1MMDA 4JZ4A 1NG2A 5M9OA 2MWOA 2FRYA 1HD3A 1FXXA 2F69A 4L5GA 5HCKA 3M56A 5GAOp 2X4WA 2K2MA 2OAWA 2K5LA 3G6ET 3CCSA 3V8JA 3EG0A 2GGRA 2RPNA 3H0FA 3VS5A 3OYNA 1KJWA 3L42A 3M53A 2QYZA 2ZAEA 4IUTA 4LDWA 2F2VA 4DOWA 1K9MC 1Y96A 2DVJA 3SB2A 1M2VB 4X34A 5FU6C 3CC4A 4Y91A 4O5VA 3VS6A 1QP3A 2RJDA 5A0GA 2KK4A 2F2XA 1M5Q1 2H3EB 2LC4A 4FCYA 2ENMA 2YUOA 3WVDB 1I5OB 2L3PA 3GF5A 3QJYA 4KT0E 1QVFP 3OS2A 2KYMA 1BYMA 1IGUA 3JCMb 2DL5A 1UE9A 1XTDA 1S72A 4ORZA 4MDXA 4M75F 4RCCA 3OS5A 5J39A 3ULRB 2BZ8A 3EG9B 1OQKA 1NBEB 1KD1U 5AT1B 3I55T 1ZSGA 1VQNT 2V8IA 1NYFA 1X6OA 2H3JA 4XTWA 3UA7A 3RESA 2KDSA 1O75A 2VXFA 3X28B 4PJLA 2LCCA 5IHNA 3CCVA 1PD0A 1Q82U 5LJ3d 1PG5B 2JJ9A 2YUQA 1VQ6A 4M78F 1RI0A 5I22A 1WI7A 2D0QB 1U06A 1YJWQ 3CC7Q 4CC7A 1S1NA 2ESWA 2LMJA 1MMNA 4KRTA 4IIOA 1SKUB 2MPXC 4Z8AA 1PKTA 3A8LB 3JSCA 3CXCS 3RUXA 5IH2A 5LJ3g 1OPLA 1N27A 1RADB 2GTJA 2D9TA 3NTKA 4CRIA 4QKUA 1Q7YC 2X3XD 3QKJA 2CZ1B 1UGRB 5CQYA 4E7HA 5CVIA 5AYFA 1VQ5T 4C92G 2NLUA 3KFVA 1AEYA 3CMEA 1YIJQ 2JM9A 1WHLA 2JMCA 2Y90A 2PQWA 2HEQA 2LT1A 1D09B 4N0AA 1SG5A 1JU5C 3N5BB 4C92E 2FPFA 2YRVA 1D1AA 2M02A 2DL8A 3JCMJ 2K5FA 1NPPA 3M0RA 1PCXA 1TWBA 1QWFA 4RTWA 2E64A 3ASKA 3CCRT 4BACA 1T3LA 4TVRA 1RAHB 4PLLA 1QVFA 5GMKi 2YWWA 2EW3A 2DRKA 3CBMA 1ZUKA 1NJIR 4EMHA 3I5RA 2XHCA 2O31A 1PSEA 3EAEA 2FRWA 3G7ZA 1GFCA 2MAMA 3EG2A 2WACA 1QMCA 2JTMA 5FRMA 3ZL7C 1FYNA 2RJCA 2WSFE 5GANf 2E6NA 3MEWA 4C8QF 2DD5A 1H3HA 4C0DC 5FRNA 2GFAA 2ABLA 5GAN5 2HMAA 2M51A 2KY9A 1GCPA 2DLPA 2BE7D 3H8ZA 1MNEA 1KD1C 1X2KA 3JB9H 5D7UA 8AT1B 4PLIA 4HCBA 1RAFB 3C4SA 1OOTA 2FHDA 2CP6A 2P0KA 2WSEE 3OA6A 2HZYA 3PIOA 1OYXA 1W6XA 4YTLA 1H3ZA 2CH4W 4C92C 4QQGA 3AT1B 3H0HA 2GFUA 1VQPA 2ROLA 2X51A 4M7DB 1BBZA 1M8VA 1U5SA 3M0PA 3JCMd 1JEGA 4L59A 2V1RA 2J7IA 4CI0C 4M77D 2YHTA 2DVEA 1JBMA 2E1HA 4EMGA 2M1HA 1K73R 1VQMT 1G5VA 4BDZA 2ZZDA 1D0YA 2DTIA 4O6JA 3JCMg 3EGXA 1X6GA 2E65A 1UGSB 3MCAB 3CC2Q 1VQKA 3A5ZB 2PNIA 2PZ1A 1W70A 2DXUA 2DBKA 2MOXA 2EYZA 4JZ3A 2D8HA 2O9VA 4C8QD 3NTIA 3M59A 4OP0A 2CP7A 3OS1A 2ZPGB 4PNOA 2X35A 2K7AA 2PVOB 4JS5A 3KUFA 1M90C 2EQIA 3VS4A 4EPCA 1IO6A 2RHYA 1IXDA 5GJVB 3CCLQ 4GY5A 5LJ5j 4BUGA 2DAQA 3I5SA 3WXMB 1I0CA 3UATA 4UC4A 2EKOA 3OSVA 1FMKA 1MHNA 1HYOA 1YCSB 5A0LA 4F04B 4OB2B 4WF2A 1VQLT 2A3LA 1SRLA 4M77A 2DMOA 2EJFA 2QA4T 1VQOA 2ZPBB 3I56A 3M0TA 2A7YA 4MMLA 1WJQA 4PJMA 4M75B 8ATCB 2FB7A 2IVWA 2RI2A 4N0AC 2EYXA 1YJNT 3G6EQ 1X43A 3J80E 4Z02A 1Y07A 2KQWA 2D6FA 3QJ6A 4XTXA 5J26A 3OYFA 2ZCFB 3FIFA 4A4EA 5D6XA 4C0ZA 2JUFA 1KFZA 2KMTA 1QKXA 4LXCA 1BK2A 2CP3A 1UJYA 5GAMe 3UT1A 1MUZA 3TEEA 1VQ8T 3REAB 2QTVA 2CZ7B 3G71A 4OMPA 1M3AA 4PJOF 3X24B 4AG2C 2KT1A 2ROTA 4F7UF 1GBQA 4M78B 2KROA 4BI4A 1YFNA 1JRIA 2DZ9A 3CD6A 2HQEA 4J9EA 2DTOA 2J6OA 1QW1A 4XTUA 4A4KA 1WNLA 2G3RA 2JM8A 1VQ9T 4IUVA 2FG0A 4ZN3A 3THKA 3LH5A 3CCUT 4PJJA 1N9RA 2AIRB 4PJNA 3I55Q 2AT1B 2WSCE 1YI2A 1VQNQ 1TTHB 3VU3C 3FEOA 1AZGB 1D0XA 2K3BA 2YT6A 3MPUB 2LJ1A 3CCQA 2DIQA 1I1JA 4HKEA 1JO8A 4AFZC 4F16A 3VS7A 4BI8B 4QT7A 3CCJT 3RBBB 4E7SA 4M77G 1XQHA 4EIKA 3MKDA 2XIDA 4C0FA 2BUDA 3INZA 2MWPA 5DY9A 4II1A 4DEXA 5D6YA 1M1KR 3CC4T 2CSQA 4M77E 4HCCA 5KYXB 3OW2S 2DYBA 1ZBXA 4LDUA 2NUTB 4NL2A 1WHKA 1YITT 1UHFA 4C8QG 1QKWA 3DB4A 1Y0MA 2FZKB 3EFOA 5KE2A 3QBYA 2KNBB 2X4XA 4PJOD 4C92F 2QGFB 2J6FA 2QQBA 2R5MA 2K3YA 4C8QE 1VQ5Q 3MO8A 2DL3A 3CBPA 5EG2A 2CP2A 1IHWA 4AMCA 2A36A 1RABB 3C94A 3NFCA 3DLLA 4KGZB 2RK1A 3VV0A 3JB9G 1D1BA 3ZEHA 1SSHA 2JXBA 2LVMA 3M0QA 2RO0A 4RTYA 2W0ZA 1Q81R 1M1FA 1C1AA 1ZA2B 3CCVT 1WHHA 3MJXA 1N8RR 4DQ2A 1ABQA 2CYZB 1JXMA 5GAOn 3S6WA 2QQ9A 1K73U 1PRMC 3LGFA 3M9QA 3M4YA 2CKKA 1BI2A 3CCRQ 1TG0A 2CDTA 4BB7A 4ELYC 3MP6A 1Z9QA 1RLQC 1EFNA 4C5EA 1C6VX 2W10A 2QQAA 4AFQC 2QGGA 5GAOq 1X6BA 3I9QA 4HA8A 5KYUA 4M77C 5KYYA 3QUIA 1E6GA 1NM7A 2O01E 4ATOA 4E47A 3EG9A 3CC7A 3JCMW 2EKHA 3CMET 3LW5E 4BE2A 5A2QE 5FU6B 4L6V5 4N4GA 5GAN4 2K2VA 3M58A 5FLXE 4C8QC 1W2BS 1OV3A 1X01A 4LE9A 1KQSP 1OPKA 1QCFA 3RDVA 1GBRA 5FROA 2BZYA 2NUPB 2HCKA 3P8HA 3OYEA 3CBOA 1H92A 1QVGA 1MMGA 4F14A 3E9FA 3KXTA 2QXFA 2XICA 1QVFS 1M4ZA 1DJ7B 2QEXA 2P0QA 1X69A 1Q95G 1XJWB 2CSIA 1SEMA 2XMFA 5IHIA 3UA6A 4IURA 2X3WD 4XTYA 3GNGA 1QLYA 5GMKj 2CGHA 2RMOA 3URGA 1WQ7A 1YJ9T 2SEMA 1LCKA 4R56A 3UDCA 1WA7A 3TSWA 3FLGA 1OULA 1VQMQ 2DO3A 2HQHA 1FMWA 3QIIA 4IUQA 2CREA 3GNFB 2L89A 4OGEA 4XQ3A 4KUIA 1ZBJA 1RAIB 1K0XA 4PJOG 3EFSA 1SSFA 4F7UG 4ZTFA 2M0YA 1WGSA 3ME9A 3REBB 4E7KA 3KBGA 5KCHA 3OYAA 2EWNA 3EGUA 5KYWB 1FMVA 1M8MA 4RTZA 1K8AR 2KI7A 4PJOE 2G6FX 2JS0A 3LH0A 2OTJA 2XD0A 4FW1A 1JJ2P 2XDDA 3M57A 1PSFA 4F7UE 4HT9A 3G4SQ 1I81A 2CP0A 2LDMA 2LX7A 1KC8R 2LZ6B 4PL6A 1UUEA 5GMKl 1PC0A 3MEUA 3OYDA 1ZX6A 2M16A 2RI3A 1UFFA 5GANd 2B86A 3OQ5A 4BI3A 3E2UA 3S3NA 1VQLQ 3L2RA 2YLBA 2QA4Q 4RTXA 1BB9A 4BE0A 1IGQA 4E7ZA 1NZ9A 3SEMA 6AT1B 1PNJA 1TS9A 2PU9B 3ER0A 5EC7A 1M9SA 1YJNQ 4J9FA 2MMPA 1W4SA 5IHKA 5GANg 1VQKT 1KQSA 2L3QA 1LVKA 2QI2A 2QQSA 1X27A 2KR3A 1CSKA 1Y57A 3P8BB 4MZPA 2PTKA 2KSSA 1Q86C 4HVWA 5HK0A 2COYA 2PVGB 2LJ3A 1G3YA 1VQ8Q 3SHWA 5LJ3j 2O88A 5I21A 1KHCA 4KGXB 1JQQA 1Y7XA 2GBQA 4GBQA 2C0OA 4C0DB 5LJ5h 1NEGA 2E5KA 2LNHB 1N8RU 2LNVA 4PJOC 2YRDA 1VQ9Q 2K6DA 3CCEA 2HQXA 1OX8A 3OYIA 1G8XA 1VQOT 3CCMA 1Y96B 3CCUQ 1VQ4A 1VQ7A 2R57A 4K11A 1KG1A 1HXDA 2D8JA 4PFPA 4HCZA 2FPEA 5ECAA 3CCLA 4J9CA 4C92B 1TSFA 4LUEA 1KQ1A 1YHQT 4M77F 4B9WA 4EMKC 2E70A 4OF1A 3HPWA 2F5KA 1GRIA 3CCJQ 1BI1A 2QASA 3CXCP 2RK2A 2GQIA 1N6AA 2FEIA 1VYVA 1YWPA 3VUZA 3OSSC 5LJ5e 5IT9E 1GCQC 1WX6A 3H0IA 1JJ2A 3PGGA 3CC4Q 2AKKA 1VIEA 2KAFA 2BZXA 3EG1A 1D1CA 3G6EA 1YITQ 1VIFA 2RQRA 5CIUA 1VYUA 2L3RA 3E9GA 1ZA1B 2ED1A 1SRMA 4LNPA 1BI0A 4QVDA 3QYHB 1B3QA 1K4US 4HXJA 2ZPHB 1I07A 2VV5A 1BKBA 2M0OA 2C06A 2EFIA 3JB9F 1WXUA 3EFRA 1YI2T 1Q82C 2RB6A 1BU1A 1VYTA 2K5IA 1H8KA 1RLPC 5GAOl 3CEYA 3CCVQ 3FDRA 3JB9J 3OYMA 1QQJA 3PIPA 2DYIA 1M30A 1K9MR 4M7AD 1OZ2A 5IN1A 1V76A 3BDUA 3I55A 1VQNA 1FX7A 5D6WA 4J7FA 2HKNA 5LL6S 1B34A 3QZ9B 2JZ2A 3OMGA 4RCBA 1NLPC 2DJZA 2E41A 4ZNXA 4KH0B 3SDZA 1R0CB 1I5LA 1BCOA 3OS0A 1K8AU 3BFMA 1GFDA 4JJCA 4ME7A 9ATCB 3CMAT 3CMEQ 2A08A 2RD1A 1M1GA 2O9SA 3LYIA 2VGMA 3CXCA 3G4ST 1M2OA 5GAMh 3E19A 4LD6A 2J6KA 3JB9D 3UPUA 2QDYB 1AZEA 3HFNA 4Y92A 2VB6A 4WTOB 2LQWA 2AZVA 2E4HA 2EJ9A 2CUDA 1P92A 4RTVA 5FU7C 4M7AA 4FIBA 4N4IA 3M0UA 5HY6A 3OMCA 4XU0A 3MP1A 4OB0B 5KYXA 2DETA 2LCLA 2EPDA 2JTEA 2NUTA 1Q86R 3OY9A 3J7AF 5CKEA 1YNZA 2QAZA 1Q7YR 4MDWA 4BY6C 1YJ9Q 2VVKA 4MMKA 2HNIA 1OU8A 3RKXA 4DEYA 3EHQA 1RAEB 2GTOA 1YCYA 4J5YA 4FYYB 2OTLT 2K4YA 4QW2A 2O4XB 2DNUA 3SWNA 4LD9K 1U3OA 1UECA 3PVLA 2KEAA 4X9CA 1GL5A 4JRPA 4Z88A 4ESRA 3LX7A 2XDBA 1FWZA 1LJOA 4J7IA 2KRNA 1HSQA 3O5ZA 5CCAA 1ZSZA 4E7IA 2HKQB 3GP8A 2DXBA 3TU4K 3S3MA 1WPYA 3EGXB 3UWNA 5HKCA 2QEXT 4JS4A 1AWJA 4P5NA 1QWEA 3PMTA 3MP8A 3RMSA 1RI9A 3CPWP 1Z9ZA 1NJIU 2JS2A 2DEUA 3CCST 5CO7A 3VYGA 2X4JA 1MGQA 3OB9A 4FYXB 3R6OA 1MMAA 3RKWA 1RACB 5CQXA 1NLOC 4M7AG 3QPHA 3OYKA 1IRXA 4OMFB 5GJWB 2EJGA 1KD1R 4M7AE 2Z0WA 1VQKQ 2LCSA 1QVGP 4RKUE 4JUVA 2DXTA 3EG3A 4IIMA 3Q1JA 3EGDA 3ZFJA 2LQKA 2V26A 4D8KA 1S72T 3A8GB 3BDLA 3HRSA 4OB3B 3JCMQ 4M77B 2COZA 2XDPA 2PUKB 3TREA 5FWCA 4JJNK 2NUPA 1AD5A 4E7JA 1G3WA 1H641 5GMKe 4RG8A 2FYKA 2YSQA 4R0KA 5GAN8 1E7OA 1ZLMA 3H6ZA 3DKMA 1HJDA 2IG0A 4RG2A 3OYYA 4X1VA 2DX1A 5CKBA 1B7TA 4OMOA 1PHTA 3IQLA 1YBYA 1K1ZA 4C8QB 1Y71A 4BDYA 2GCXA 2OX7A 1NE8A 3PTAA 2YLCA 1M3CA 2Y4YA 1VQOQ 3LLRA 1CKAA 1VQ6T 4OMMA 4AT1B 2LRQA 1M2VA 1WXBA 3JRZA 2XI9A 1YHQQ 1KQSS 4IUUA 2XK0A 4FYVB 4XK8E 4KUDK 2CT3A 1XNIA 3M55A 2DPPB 2F2WA 1CKBA 4GLKA 4F17A 2A28A 4NL3A 3PT9A 2K79A 4M7AC 1VQLA 2JNGA 2DRMA 3A8MB 2QA4A 1M90R 2OJ2A 3FC3A 2DJQA 3G1JA 1UB4A 5LJ3h 4QVCA 3L2UA 3M5AA 2BIVA 2K57A 3PFSA 1YJWA 3CPWA 1A0NB 2DTHA 4FL6A 4JLGA 2DK3A 2RHXA 3R6NA 1BCMA 4LN2A 2A37A 3EH1A 1WJRA 3L2QA 2P0PA 4ZTJA 2RA2A 4DBQA 1V29B 2ZPFB 1NJIC 3CCET 5CKHA 3GOXA 1M27C 3HRUA 5DLOA 3OYGA 3CCMT 4B6MA 1VQ4T 1VQ7T 1VQ8A 4PFZA 3VYHB 2OI3A 3DLMA 3LGLA 1YI2Q 4J9HA 1RL2A 4FT4A 3SWNC 4B9XA 3JV3A 3GLXA 4EDUA 1ZHIA 1MV0B 4ZGDB 1ZUUA 1PRLC 5I2MA 1Q7YU 1UGQB 1YIJA 3RIRA 2E6ZA 5LJ3e 1WLPB 2HL3A 5GAMf 2VXEA 3EFOB 3H9NA 2NWMA 2EQMA 2FZGB 4CC3A 4C5GA 4HT8A 1O9SA 1ZSZC 4OGCA 4ZGJB 2EQKA 1SHFA 1D3BB 1K0SA 2J05A 1JJ2S 4GLMA 2CH4A 3QDFA 2RHZA 3CCUA 1WFWA 2C0IA 2P4RA 4DBFA 2DIGA 1PKSA 4PFOA 1LNXA 1QCNA 3A8HB 4AG1C 2DEQA 5CK9A 3AHUA 3BE3A 1F1BB 4QVZA 1NEBA 2RHUA 4PK4A 4Z89A 2XU8A 1KIKA 4RUGA 2E12A 1G2BA 3WVEB 3CCJA 4E2FB 1K76A 1W2BP 2KYBA 3QWXX 1TU0B 4D8DA 2YDLA 2VC8A 3CMAQ 2QG9B 3ZBDA 3BW1A 2RQUA 3GPLA 2AHJB 3UF4A 3OW2A 2I2LA 4FU6A 3TSZA 4C92A 1K73C 4QQ6A 3VS3A 1VQPT 1YITA 1RUWA 2CZ6B 2EQUA 3EHRA 2P4TA 3HRTA 2BE9B 2ZPEB 4J83A 1N5ZA 2FO0A 5KYUB 1KK7A 2HSEB 4M7DD 5KYYB 1UTIA 1R77A 4RTUA 4PJOB 3DB3A 1AOJA 4F7UB 2DFUA 5GMKm 3D7SB 2CUBA 1UDLA 4NOYA 1M1KU 3MEAA 4M4ZA 3M4GA 3PNWC 1QP2A 5IAYA 4Q5WA 2KT8A 3FJ5A 3RERA 2XG8D 2VYTA 3T9NA 5IXFA 1AWXA 3NMZC 3F70A 4XTZA 1BIAA 3L1AA 4KGVB 4C0GA 1ABOA 1VA7A 3VKIA 4EMKB 2KRSA 2E3HA 3OYLA 3QZ5B 3JCMc 3JCMh 1ARKA 5GANj 3A8OB 4JJBA 1OZ3A 3J81E 4OVAA 1YWOA 4BD3A 2OTLQ 4Y28E 5A0DA 2JT4A 1UEBA 1KHIA 2C0TA 4KH1B 5IXBA 4ZGEB 1Q81U 3V8KA 2RNAA 4ANJA 2RJFA 5C6SA 3CC2A 2DL4A 4J6WA 1WDXA 4M7DA 2E10A 2AK5A 1BI3A 1I4K1 2K3XA 2CT4A 2PVDB 2CS7A 5I2SA 3META 5GAN2 3I56T 2KXCA 1YN8A 3FB9A 2DL7A 5L23A 2QEXQ 1G83A 2X4YA 1X2QA
chains in the Genus database with same CATH topology
2A08A 5HCKA 2DYBA 3PVQA 2O9SA 3NPFA 4JPBW 2K2MA 2OAWA 1UHFA 2RQWA 2I0NA 3EG0A 2GGRA 2RPNA 1QKWA 2J6KA 3H0FA 3VS5A 1Y0MA 2GNCA 1KJWA 2DM1A 1AZEA 4Y92A 2KNBB 1AWWA 2J6FA 2LQWA 2AZVA 2CUDA 2F2VA 4RTVA 2DVJA 1UHCA 2DL3A 3M0UA 1T0HA 1XOVA 3VS6A 2KBTA 2A36A 2F2XA 2EPDA 2JTEA 2ENMA 2YUOA 2VWFA 2DA9A 2L3PA 1SSHA 2JXBA 3M0QA 1YNZA 4RTYA 2W0ZA 2KYMA 1W1FA 2DL5A 1UE9A 1ABQA 4ORZA 2VVKA 1JXMA 3VS0A 3I35A 3H41A 4DEYA 4AFUC 1PRMC 3EHQA 3ULRB 2BZ8A 2BTTA 1PWTA 2GTOA 1TG0A 2CDTA 1ZSGA 1WIEA 1NYFA 1Z9QA 1T0JA 2DNUA 1RLQC 1EFNA 1U3OA 1UECA 3PVLA 2KEAA 4J9BA 3UA7A 1GL5A 2W10A 4AFQC 1ZUYA 1X6BA 4Z88A 3I9QA 4ESRA 5IHNA 2KRNA 2YUQA 1E6GA 1HSQA 1NM7A 5I22A 3O5ZA 1WI7A 1U06A 4CC7A 1S1NA 2ESWA 2LMJA 2O2OA 4OMQA 2EKHA 4KRTA 4IIOA 2RQTA 1AWJA 1QWEA 1RI9A 1Z9ZA 4Z8AA 1PKTA 2JS2A 5IH2A 1OPLA 1OV3A 1T3SA 4LE9A 4WCIA 1OPKA 1QCFA 1GBRA 2GTJA 2X3XD 2BZYA 2LQNA 1NLOC 2KXDA 3NHNA 1UG1A 1UGVA 4RTTA 4HCKA 2HCKA 2HDAA 1H92A 4F14A 4HVUA 4OMNA 3KFVA 1AEYA 2MCNA 5GJWB 2JM9A 1X69A 2CSIA 2LCSA 2JMCA 1SEMA 2XMFA 5IHIA 3UA6A 2HEQA 1WYXA 3EG3A 4IIMA 4CC2A 2X3WD 1JU5C 1QLYA 2RN8A 2HBWA 2DE0X 2RMOA 2FPFA 4D8KA 2SEMA 1LCKA 3A98A 2DL8A 3M0RA 5FWCA 1WA7A 3TSWA 1QWFA 1AD5A 3RNJA 4RTWA 2H8HA 2YSQA 1T3LA 1HD3A 1E7OA 1ZLMA 1MV3A 2CREA 4R0KA 1HJDA 2IIMA 2V1QA 4X1VA 2DX1A 2EW3A 2DRKA 4OMOA 1PHTA 1ZUKA 3IQLA 3I5RA 4E6RA 1ZBJA 2O31A 2RQVA 1K1ZA 1K0XA 4JJDA 2FRWA 1SHGA 1GFCA 2DILA 1M3CA 3EG2A 2M0YA 3U23A 2YUNA 3REBB 3ZL7C 1FYNA 1CKAA 4OMMA 3EGUA 1M8MA 4RTZA 2ECZA 2G6FX 2JS0A 1H3HA 1WXBA 4J9GA 2ABLA 2LX7A 2M51A 1GCPA 1AVZC 2DLPA 2LZ6B 1UUEA 2CT3A 1X2KA 2F2WA 1CKBA 1ZX6A 4F17A 1UFFA 2B86A 2A28A 1OOTA 2DBMA 2JW4A 2K79A 2RF0A 2DRMA 2OJ2A 4RTXA 4OMLA 2DJQA 1BB9A 3VS2A 2AZSA 2KE9A 1UJ0A 1W6XA 3SEMA 1PNJA 2CH4W 1A0NB 5EC7A 4J9FA 3H0HA 4HVVA 3R6NA 2ROLA 5IHKA 4LN2A 2A37A 2L3QA 1X27A 2KR3A 5FWBA 1CSKA 1Y57A 5FW9A 1BBZA 1U5SA 3M0PA 2PTKA 1JEGA 2LP5A 4HVWA 3VRZA 3CQTA 1M27C 2V1RA 2J7IA 2LJ3A 2OI3A 4J9HA 3SHWA 2O88A 2QDLA 3JV3A 1JQQA 2GBQA 4GBQA 2K9GA 2C0OA 1MV0B 2LJ0A 1X6GA 2EYYA 1TUDA 1NEGA 1PRLC 1ZUUA 2E5KA 2LNHB 2L3SA 2PNIA 1WLPB 2PZ1A 1W70A 2EYWA 2DBKA 2MOXA 1JXOA 2JMAA 2NWMA 2EYZA 2SRCA 4JZ3A 2D8HA 2O9VA 4CC3A 2K6DA 1YP5A 1SHFA 1K0SA 2J05A 3PE0A 4GLMA 2CH4A 2HSPA 2K7AA 1SPKA 1WFWA 2C0IA 2P4RA 4FSSA 4K11A 2D8JA 2EQIA 3VS4A 1NYGA 1IO6A 2KGTA 2J06A 5GJVB 1PKSA 2FPEA 3VRYA 5ECAA 1M3BA 4J9CA 4AG1C 4LUEA 1NEBA 4A63B 4Z89A 3I5SA 1I0CA 3M0SA 1KIKA 3UATA 2YUPA 4RUGA 1G2BA 1GRIA 2GQIA 1FMKA 1K76A 2MIOA 2FEIA 2ED0A 2KYBA 4J9DA 1VYVA 1YCSB 1YWPA 3QWXX 1WXTA 4D8DA 2YDLA 4CC4B 1WX6A 1GCQC 2EGCA 3H0IA 1SRLA 3VS1A 2DMOA 2VKNA 3TVTA 3M0TA 2DF6A 2AKKA 2RQUA 3UF4A 2EGEA 2BZXA 3TSZA 3EG1A 1TUCA 2EYXA 5I11A 3VS3A 2L0AA 1X43A 1RUWA 3EHRA 2RQRA 1VYUA 1N5ZA 2FO0A 2EGAA 1UTIA 2ED1A 1KFZA 1SRMA 3C0CA 4LNPA 4RTUA 1AOJA 1OEBA 1QKXA 1B3QA 1BK2A 4LUDA 4HXJA 1K4US 1UJYA 1I07A 1MUZA 3REAB 2CUBA 1UDLA 1WXUA 4M4ZA 4AFSC 4OMPA 1BU1A 1V1CA 1VYTA 1M3AA 2KT8A 4AG2C 1H8KA 3FJ5A 2KT1A 2ROTA 1GBQA 1RLPC 2D0NA 1K9AA 2FPDA 2KRMA 2KROA 2L2PA 5IXFA 1AWXA 3NMZC 2D1XA 4J9EA 1ABOA 1VA7A 2KRSA 2J6OA 2EBPA 2EVRA 2AKLA 2JM8A 1M30A 1ARKA 2FG0A 4JJBA 3THKA 3LH5A 1J3TA 1YWOA 4J9IA 2JT4A 1AWOA 2C0TA 1AZGB 1KSWA 5IXBA 2K3BA 2YT6A 2LJ1A 1B07A 2RNAA 1I1JA 2NUZA 2DL4A 1JO8A 1NLPC 4AFZC 3QWYA 4ZNXA 3VS7A 1WDXA 4F16A 2AK5A 4QT7A 3RBBB 4EIKA 1E6HA 3GBQA 4DEXA 2CT4A 1GFDA 4JJCA 1GCQA 3NGPA 4JZ4A 2KXCA 1YN8A 1NG2A 2DL7A 2CSQA 5L23A 2FRYA 1G83A 1X2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  5HCK A;  2DYB A;  3PVQ A;  2O9S A;  3NPF A;  4JPB W;  2K2M A;  2OAW A;  1UHF A;  2RQW A;  2I0N A;  3EG0 A;  2GGR A;  2RPN A;  1QKW A;  2J6K A;  3H0F A;  3VS5 A;  1Y0M A;  2GNC A;  1KJW A;  2DM1 A;  1AZE A;  4Y92 A;  2KNB B;  1AWW A;  2J6F A;  2LQW A;  2AZV A;  2CUD A;  2F2V A;  4RTV A;  2DVJ A;  1UHC A;  2DL3 A;  3M0U A;  1T0H A;  1XOV A;  3VS6 A;  2KBT A;  2A36 A;  2F2X A;  2EPD A;  2JTE A;  2ENM A;  2YUO A;  2VWF A;  2DA9 A;  2L3P A;  1SSH A;  2JXB A;  3M0Q A;  1YNZ A;  4RTY A;  2W0Z A;  2KYM A;  1W1F A;  2DL5 A;  1UE9 A;  1ABQ A;  4ORZ A;  2VVK A;  1JXM A;  3VS0 A;  3I35 A;  3H41 A;  4DEY A;  4AFU C;  1PRM C;  3EHQ A;  3ULR B;  2BZ8 A;  2BTT A;  1PWT A;  2GTO A;  1TG0 A;  2CDT A;  1ZSG A;  1WIE A;  1NYF A;  1Z9Q A;  1T0J A;  2DNU A;  1RLQ C;  1EFN A;  1U3O A;  1UEC A;  3PVL A;  2KEA A;  4J9B A;  3UA7 A;  1GL5 A;  2W10 A;  4AFQ C;  1ZUY A;  1X6B A;  4Z88 A;  3I9Q A;  4ESR A;  5IHN A;  2KRN A;  2YUQ A;  1E6G A;  1HSQ A;  1NM7 A;  5I22 A;  3O5Z A;  1WI7 A;  1U06 A;  4CC7 A;  1S1N A;  2ESW A;  2LMJ A;  2O2O A;  4OMQ A;  2EKH A;  4KRT A;  4IIO A;  2RQT A;  1AWJ A;  1QWE A;  1RI9 A;  1Z9Z A;  4Z8A A;  1PKT A;  2JS2 A;  5IH2 A;  1OPL A;  1OV3 A;  1T3S A;  4LE9 A;  4WCI A;  1OPK A;  1QCF A;  1GBR A;  2GTJ A;  2X3X D;  2BZY A;  2LQN A;  1NLO C;  2KXD A;  3NHN A;  1UG1 A;  1UGV A;  4RTT A;  4HCK A;  2HCK A;  2HDA A;  1H92 A;  4F14 A;  4HVU A;  4OMN A;  3KFV A;  1AEY A;  2MCN A;  5GJW B;  2JM9 A;  1X69 A;  2CSI A;  2LCS A;  2JMC A;  1SEM A;  2XMF A;  5IHI A;  3UA6 A;  2HEQ A;  1WYX A;  3EG3 A;  4IIM A;  4CC2 A;  2X3W D;  1JU5 C;  1QLY A;  2RN8 A;  2HBW A;  2DE0 X;  2RMO A;  2FPF A;  4D8K A;  2SEM A;  1LCK A;  3A98 A;  2DL8 A;  3M0R A;  5FWC A;  1WA7 A;  3TSW A;  1QWF A;  1AD5 A;  3RNJ A;  4RTW A;  2H8H A;  2YSQ A;  1T3L A;  1HD3 A;  1E7O A;  1ZLM A;  1MV3 A;  2CRE A;  4R0K A;  1HJD A;  2IIM A;  2V1Q A;  4X1V A;  2DX1 A;  2EW3 A;  2DRK A;  4OMO A;  1PHT A;  1ZUK A;  3IQL A;  3I5R A;  4E6R A;  1ZBJ A;  2O31 A;  2RQV A;  1K1Z A;  1K0X A;  4JJD A;  2FRW A;  1SHG A;  1GFC A;  2DIL A;  1M3C A;  3EG2 A;  2M0Y A;  3U23 A;  2YUN A;  3REB B;  3ZL7 C;  1FYN A;  1CKA A;  4OMM A;  3EGU A;  1M8M A;  4RTZ A;  2ECZ A;  2G6F X;  2JS0 A;  1H3H A;  1WXB A;  4J9G A;  2ABL A;  2LX7 A;  2M51 A;  1GCP A;  1AVZ C;  2DLP A;  2LZ6 B;  1UUE A;  2CT3 A;  1X2K A;  2F2W A;  1CKB A;  1ZX6 A;  4F17 A;  1UFF A;  2B86 A;  2A28 A;  1OOT A;  2DBM A;  2JW4 A;  2K79 A;  2RF0 A;  2DRM A;  2OJ2 A;  4RTX A;  4OML A;  2DJQ A;  1BB9 A;  3VS2 A;  2AZS A;  2KE9 A;  1UJ0 A;  1W6X A;  3SEM A;  1PNJ A;  2CH4 W;  1A0N B;  5EC7 A;  4J9F A;  3H0H A;  4HVV A;  3R6N A;  2ROL A;  5IHK A;  4LN2 A;  2A37 A;  2L3Q A;  1X27 A;  2KR3 A;  5FWB A;  1CSK A;  1Y57 A;  5FW9 A;  1BBZ A;  1U5S A;  3M0P A;  2PTK A;  1JEG A;  2LP5 A;  4HVW A;  3VRZ A;  3CQT A;  1M27 C;  2V1R A;  2J7I A;  2LJ3 A;  2OI3 A;  4J9H A;  3SHW A;  2O88 A;  2QDL A;  3JV3 A;  1JQQ A;  2GBQ A;  4GBQ A;  2K9G A;  2C0O A;  1MV0 B;  2LJ0 A;  1X6G A;  2EYY A;  1TUD A;  1NEG A;  1PRL C;  1ZUU A;  2E5K A;  2LNH B;  2L3S A;  2PNI A;  1WLP B;  2PZ1 A;  1W70 A;  2EYW A;  2DBK A;  2MOX A;  1JXO A;  2JMA A;  2NWM A;  2EYZ A;  2SRC A;  4JZ3 A;  2D8H A;  2O9V A;  4CC3 A;  2K6D A;  1YP5 A;  1SHF A;  1K0S A;  2J05 A;  3PE0 A;  4GLM A;  2CH4 A;  2HSP A;  2K7A A;  1SPK A;  1WFW A;  2C0I A;  2P4R A;  4FSS A;  4K11 A;  2D8J A;  2EQI A;  3VS4 A;  1NYG A;  1IO6 A;  2KGT A;  2J06 A;  5GJV B;  1PKS A;  2FPE A;  3VRY A;  5ECA A;  1M3B A;  4J9C A;  4AG1 C;  4LUE A;  1NEB A;  4A63 B;  4Z89 A;  3I5S A;  1I0C A;  3M0S A;  1KIK A;  3UAT A;  2YUP A;  4RUG A;  1G2B A;  1GRI A;  2GQI A;  1FMK A;  1K76 A;  2MIO A;  2FEI A;  2ED0 A;  2KYB A;  4J9D A;  1VYV A;  1YCS B;  1YWP A;  3QWX X;  1WXT A;  4D8D A;  2YDL A;  4CC4 B;  1WX6 A;  1GCQ C;  2EGC A;  3H0I A;  1SRL A;  3VS1 A;  2DMO A;  2VKN A;  3TVT A;  3M0T A;  2DF6 A;  2AKK A;  2RQU A;  3UF4 A;  2EGE A;  2BZX A;  3TSZ A;  3EG1 A;  1TUC A;  2EYX A;  5I11 A;  3VS3 A;  2L0A A;  1X43 A;  1RUW A;  3EHR A;  2RQR A;  1VYU A;  1N5Z A;  2FO0 A;  2EGA A;  1UTI A;  2ED1 A;  1KFZ A;  1SRM A;  3C0C A;  4LNP A;  4RTU A;  1AOJ A;  1OEB A;  1QKX A;  1B3Q A;  1BK2 A;  4LUD A;  4HXJ A;  1K4U S;  1UJY A;  1I07 A;  1MUZ A;  3REA B;  2CUB A;  1UDL A;  1WXU A;  4M4Z A;  4AFS C;  4OMP A;  1BU1 A;  1V1C A;  1VYT A;  1M3A A;  2KT8 A;  4AG2 C;  1H8K A;  3FJ5 A;  2KT1 A;  2ROT A;  1GBQ A;  1RLP C;  2D0N A;  1K9A A;  2FPD A;  2KRM A;  2KRO A;  2L2P A;  5IXF A;  1AWX A;  3NMZ C;  2D1X A;  4J9E A;  1ABO A;  1VA7 A;  2KRS A;  2J6O A;  2EBP A;  2EVR A;  2AKL A;  2JM8 A;  1M30 A;  1ARK A;  2FG0 A;  4JJB A;  3THK A;  3LH5 A;  1J3T A;  1YWO A;  4J9I A;  2JT4 A;  1AWO A;  2C0T A;  1AZG B;  1KSW A;  5IXB A;  2K3B A;  2YT6 A;  2LJ1 A;  1B07 A;  2RNA A;  1I1J A;  2NUZ A;  2DL4 A;  1JO8 A;  1NLP C;  4AFZ C;  3QWY A;  4ZNX A;  3VS7 A;  1WDX A;  4F16 A;  2AK5 A;  4QT7 A;  3RBB B;  4EIK A;  1E6H A;  3GBQ A;  4DEX A;  2CT4 A;  1GFD A;  4JJC A;  1GCQ A;  3NGP A;  4JZ4 A;  2KXC A;  1YN8 A;  1NG2 A;  2DL7 A;  2CSQ A;  5L23 A;  2FRY A;  1G83 A;  1X2Q A; 
#chains in the Genus database with same CATH topology
 3PVQ A;  4M75 D;  3NPF A;  4JPB W;  3JCM e;  2A0F B;  1C0M A;  5DLQ E;  3CCS Q;  2ZPI B;  1W2B A;  4M7A F;  2RQW A;  2I0N A;  3MEV A;  1OU9 A;  2GNC A;  3X26 B;  4IUP A;  2MI6 A;  5GAN 7;  2DM1 A;  1M90 U;  1ZQ1 A;  3OBY A;  1AWW A;  2JOY A;  3JCM P;  3G71 T;  1UHC A;  1T0H A;  2V8K A;  1XOV A;  4D6W A;  2V8J A;  2KBT A;  4JRI A;  4XAX B;  1D0Z A;  4M78 D;  2VWF A;  2DA9 A;  3LWH A;  4KUL A;  3OYB A;  3QO3 A;  1U8R A;  2LQ8 A;  3CD6 T;  2MF2 A;  1W1F A;  3M54 A;  5L8R E;  1S72 Q;  4VUB A;  1YJ9 A;  3HP9 A;  1R8O B;  3VS0 A;  4JLI A;  3I35 A;  2GQV A;  3H41 A;  4R55 A;  2KVQ G;  4AFU C;  2OTJ Q;  1WJS A;  4XTV A;  2BTT A;  3FJP A;  5LJ3 f;  1PWT A;  1M1K C;  4DBH A;  4M75 A;  1WIE A;  2CZ0 B;  1T0J A;  3QG1 A;  3RR6 A;  4FSX A;  4M7D G;  4J9B A;  2QK0 A;  2LTO A;  3CCQ T;  1ZUY A;  4LDY A;  3V7R A;  4RMO A;  4KBM B;  1RAA B;  2DD4 A;  4OB1 B;  1VQ6 Q;  4M7D E;  5GAO m;  5CKD A;  5HK3 A;  2FL7 A;  1TH7 A;  5FU7 B;  2O2O A;  3TQ7 P;  4OMQ A;  3NTH A;  2FZC B;  2HAX A;  2RQT A;  3C12 A;  2O4X A;  2P84 A;  2HBP A;  2CP5 A;  2JN0 A;  4M78 A;  2Y4X A;  3CPF A;  2VUB A;  1T3S A;  4ELZ C;  2DXC A;  4WCI A;  3X25 B;  4MZT A;  4ZN1 A;  1Q81 C;  3SFM A;  3VJP A;  4BY6 B;  2LQN A;  4A54 A;  2KXD A;  1N8R C;  3NHN A;  3V8L A;  1UG1 A;  1AT1 B;  1UGV A;  4RTT A;  4HCK A;  1JB0 E;  2HDA A;  3TCJ A;  5LJ5 d;  4HVU A;  4OMN A;  2PUO B;  1GXI E;  1IZ6 A;  2RH2 A;  2MCN A;  1KC8 U;  2JTF A;  3QYG B;  1WYX A;  1VOM A;  4CC2 A;  2HL5 C;  2EQJ A;  2DER A;  4XU2 A;  2RN8 A;  1NPR A;  2HBW A;  3V7S A;  3CCE Q;  2DE0 X;  1WHM A;  5LJ5 g;  3CCM Q;  1KQ2 A;  3A98 A;  1VQ4 Q;  1VQ7 Q;  5GAN 6;  4A53 A;  4DOV A;  1WHJ A;  3E1S A;  4M75 G;  3RNJ A;  2DZC A;  2H8H A;  1VQ5 A;  1MV3 A;  3QXE B;  1QVP A;  2IIM A;  2V1Q A;  5KCO A;  1VUB A;  4XU3 A;  4M7D C;  1RAG B;  4M75 E;  4E6R A;  3L2V A;  2RQV A;  4FW2 A;  4JJD A;  1SHG A;  1HK9 A;  2DIL A;  2E5Q A;  3U23 A;  2YUN A;  4JRK A;  4NS5 A;  3L2Z A;  2ECZ A;  3CPW S;  1YJW T;  3OYH A;  3CC7 T;  7AT1 B;  4J9G A;  4A4H A;  1TUG B;  2RHI A;  4DBR A;  3CCR A;  4M78 G;  1YHQ A;  3FRN A;  1AVZ C;  1EX4 A;  5C0M A;  1LOJ A;  1PM3 A;  2LX9 A;  3HKS A;  4C8Q A;  2M9U A;  2E3I A;  4M78 E;  1G3S A;  3HSB A;  2DBM A;  3A1P A;  2JW4 A;  2RF0 A;  3HHT B;  3JCM f;  4A4G A;  1R0B G;  2RJE A;  4OML A;  3VS2 A;  2AZS A;  2KE9 A;  1UJ0 A;  5CAI A;  3OYC A;  5KE3 A;  1QVG S;  4J8O A;  1QCO A;  2R58 A;  4X9D A;  3BY7 A;  3VUB A;  1B34 B;  1TOV A;  1VQP Q;  4HVV A;  3JCM V;  3GIB A;  1YIJ T;  5GAN 3;  1IB8 A;  5LJ5 f;  5FWB A;  5FW9 A;  3C95 A;  1LPL A;  1ACM B;  2F1L A;  3EH2 A;  1X75 C;  2LP5 A;  3HFO A;  5GMK h;  3VRZ A;  3CQT A;  3L2W A;  1BIB A;  4FT2 A;  4E7L A;  2ATC B;  2BKD N;  4M75 C;  4A4F A;  2QDL A;  5DM7 R;  2DKG A;  2MK5 A;  2VAS A;  3HL8 A;  1PD1 A;  1K8A C;  2K9G A;  2LJ0 A;  1WQW A;  3RMQ A;  2EYY A;  1TUD A;  2NYS A;  3V7C A;  2L3S A;  2EAY A;  1KC8 C;  2EYW A;  1JXO A;  2JMA A;  2SRC A;  4FYW B;  2HD0 A;  1YP5 A;  2F5T X;  1IHV A;  3PE0 A;  3X20 B;  2EIF A;  2HSP A;  4M7A B;  1Q82 R;  1SPK A;  2X9H A;  4FSS A;  3P8D A;  4J6X A;  4JDS A;  1NYG A;  2KGT A;  4C5H A;  1VQM A;  2J06 A;  3VRY A;  2OTJ T;  4M78 C;  3O8V A;  1M3B A;  2L8D A;  1SF9 A;  5GAM d;  2YRC A;  4A63 B;  3M0S A;  1WZO A;  2YUP A;  3S3O A;  4JRQ A;  2EYQ A;  2MIO A;  4J9D A;  1IRE B;  2ED0 A;  4DA4 A;  2YXY A;  1WXT A;  2QTX A;  4CC4 B;  1K9M U;  2R5A A;  5CKF A;  1D3B A;  3SD4 A;  1G3T A;  2EGC A;  3VS1 A;  2VKN A;  2XKO C;  3CMA A;  3TVT A;  3I56 Q;  1WHG A;  2DF6 A;  5GAM g;  2EGE A;  2L5Q A;  4QQD A;  3SWN B;  1TUC A;  5I11 A;  5KYN A;  3G4S A;  2L0A A;  5GAO r;  3JCM X;  3OW2 P;  5GAM j;  2EGA A;  2COW A;  3C0C A;  2MYS A;  5CR2 A;  4MZM A;  5J3B A;  1OEB A;  3MHX A;  3JAM E;  3JB9 I;  1OX9 A;  4LUD A;  1U1T A;  5GAN h;  3OYJ A;  3RKY A;  1ZSZ B;  2ZGW A;  1I8F A;  3G71 Q;  4C5I A;  2IPO B;  3LWI A;  2RM4 A;  3QDR B;  4PKC C;  4AFS C;  1AHJ B;  5KYW A;  1V1C A;  4XU1 A;  3PMI A;  2JVV A;  1EIF A;  2D0N A;  1YJN A;  1K9A A;  2FPD A;  2KRM A;  5KH6 A;  2L2P A;  2FVU A;  3CC2 T;  3CD6 Q;  1UGP B;  2D1X A;  3QHS A;  2VGN A;  4J6Y A;  3OBW A;  4BE1 A;  2EBP A;  4FM4 B;  2EVR A;  2AKL A;  2LT4 A;  4PJO A;  4F7U A;  3HTR A;  4V2S A;  2OAU A;  1TXQ A;  2RI5 A;  3QSU A;  1J3T A;  4J9I A;  2OTL A;  4M7D F;  2B8A A;  2GF7 A;  1N9S A;  1AWO A;  1KSW A;  3CCL T;  4C92 D;  1Q86 U;  5GAN e;  3EGD B;  3CCQ Q;  1B07 A;  2NUZ A;  4EMK A;  4IKF A;  2QQR A;  3QWY A;  1MND A;  4N4H A;  1U1S A;  1EZZ B;  1OI1 A;  4LDX A;  1VQ9 A;  1E6H A;  3GBQ A;  4LDV A;  1GCQ A;  3NGP A;  1MMD A;  4JZ4 A;  1NG2 A;  5M9O A;  2MWO A;  2FRY A;  1HD3 A;  1FXX A;  2F69 A;  4L5G A;  5HCK A;  3M56 A;  5GAO p;  2X4W A;  2K2M A;  2OAW A;  2K5L A;  3G6E T;  3CCS A;  3V8J A;  3EG0 A;  2GGR A;  2RPN A;  3H0F A;  3VS5 A;  3OYN A;  1KJW A;  3L42 A;  3M53 A;  2QYZ A;  2ZAE A;  4IUT A;  4LDW A;  2F2V A;  4DOW A;  1K9M C;  1Y96 A;  2DVJ A;  3SB2 A;  1M2V B;  4X34 A;  5FU6 C;  3CC4 A;  4Y91 A;  4O5V A;  3VS6 A;  1QP3 A;  2RJD A;  5A0G A;  2KK4 A;  2F2X A;  1M5Q 1;  2H3E B;  2LC4 A;  4FCY A;  2ENM A;  2YUO A;  3WVD B;  1I5O B;  2L3P A;  3GF5 A;  3QJY A;  4KT0 E;  1QVF P;  3OS2 A;  2KYM A;  1BYM A;  1IGU A;  3JCM b;  2DL5 A;  1UE9 A;  1XTD A;  1S72 A;  4ORZ A;  4MDX A;  4M75 F;  4RCC A;  3OS5 A;  5J39 A;  3ULR B;  2BZ8 A;  3EG9 B;  1OQK A;  1NBE B;  1KD1 U;  5AT1 B;  3I55 T;  1ZSG A;  1VQN T;  2V8I A;  1NYF A;  1X6O A;  2H3J A;  4XTW A;  3UA7 A;  3RES A;  2KDS A;  1O75 A;  2VXF A;  3X28 B;  4PJL A;  2LCC A;  5IHN A;  3CCV A;  1PD0 A;  1Q82 U;  5LJ3 d;  1PG5 B;  2JJ9 A;  2YUQ A;  1VQ6 A;  4M78 F;  1RI0 A;  5I22 A;  1WI7 A;  2D0Q B;  1U06 A;  1YJW Q;  3CC7 Q;  4CC7 A;  1S1N A;  2ESW A;  2LMJ A;  1MMN A;  4KRT A;  4IIO A;  1SKU B;  2MPX C;  4Z8A A;  1PKT A;  3A8L B;  3JSC A;  3CXC S;  3RUX A;  5IH2 A;  5LJ3 g;  1OPL A;  1N27 A;  1RAD B;  2GTJ A;  2D9T A;  3NTK A;  4CRI A;  4QKU A;  1Q7Y C;  2X3X D;  3QKJ A;  2CZ1 B;  1UGR B;  5CQY A;  4E7H A;  5CVI A;  5AYF A;  1VQ5 T;  4C92 G;  2NLU A;  3KFV A;  1AEY A;  3CME A;  1YIJ Q;  2JM9 A;  1WHL A;  2JMC A;  2Y90 A;  2PQW A;  2HEQ A;  2LT1 A;  1D09 B;  4N0A A;  1SG5 A;  1JU5 C;  3N5B B;  4C92 E;  2FPF A;  2YRV A;  1D1A A;  2M02 A;  2DL8 A;  3JCM J;  2K5F A;  1NPP A;  3M0R A;  1PCX A;  1TWB A;  1QWF A;  4RTW A;  2E64 A;  3ASK A;  3CCR T;  4BAC A;  1T3L A;  4TVR A;  1RAH B;  4PLL A;  1QVF A;  5GMK i;  2YWW A;  2EW3 A;  2DRK A;  3CBM A;  1ZUK A;  1NJI R;  4EMH A;  3I5R A;  2XHC A;  2O31 A;  1PSE A;  3EAE A;  2FRW A;  3G7Z A;  1GFC A;  2MAM A;  3EG2 A;  2WAC A;  1QMC A;  2JTM A;  5FRM A;  3ZL7 C;  1FYN A;  2RJC A;  2WSF E;  5GAN f;  2E6N A;  3MEW A;  4C8Q F;  2DD5 A;  1H3H A;  4C0D C;  5FRN A;  2GFA A;  2ABL A;  5GAN 5;  2HMA A;  2M51 A;  2KY9 A;  1GCP A;  2DLP A;  2BE7 D;  3H8Z A;  1MNE A;  1KD1 C;  1X2K A;  3JB9 H;  5D7U A;  8AT1 B;  4PLI A;  4HCB A;  1RAF B;  3C4S A;  1OOT A;  2FHD A;  2CP6 A;  2P0K A;  2WSE E;  3OA6 A;  2HZY A;  3PIO A;  1OYX A;  1W6X A;  4YTL A;  1H3Z A;  2CH4 W;  4C92 C;  4QQG A;  3AT1 B;  3H0H A;  2GFU A;  1VQP A;  2ROL A;  2X51 A;  4M7D B;  1BBZ A;  1M8V A;  1U5S A;  3M0P A;  3JCM d;  1JEG A;  4L59 A;  2V1R A;  2J7I A;  4CI0 C;  4M77 D;  2YHT A;  2DVE A;  1JBM A;  2E1H A;  4EMG A;  2M1H A;  1K73 R;  1VQM T;  1G5V A;  4BDZ A;  2ZZD A;  1D0Y A;  2DTI A;  4O6J A;  3JCM g;  3EGX A;  1X6G A;  2E65 A;  1UGS B;  3MCA B;  3CC2 Q;  1VQK A;  3A5Z B;  2PNI A;  2PZ1 A;  1W70 A;  2DXU A;  2DBK A;  2MOX A;  2EYZ A;  4JZ3 A;  2D8H A;  2O9V A;  4C8Q D;  3NTI A;  3M59 A;  4OP0 A;  2CP7 A;  3OS1 A;  2ZPG B;  4PNO A;  2X35 A;  2K7A A;  2PVO B;  4JS5 A;  3KUF A;  1M90 C;  2EQI A;  3VS4 A;  4EPC A;  1IO6 A;  2RHY A;  1IXD A;  5GJV B;  3CCL Q;  4GY5 A;  5LJ5 j;  4BUG A;  2DAQ A;  3I5S A;  3WXM B;  1I0C A;  3UAT A;  4UC4 A;  2EKO A;  3OSV A;  1FMK A;  1MHN A;  1HYO A;  1YCS B;  5A0L A;  4F04 B;  4OB2 B;  4WF2 A;  1VQL T;  2A3L A;  1SRL A;  4M77 A;  2DMO A;  2EJF A;  2QA4 T;  1VQO A;  2ZPB B;  3I56 A;  3M0T A;  2A7Y A;  4MML A;  1WJQ A;  4PJM A;  4M75 B;  8ATC B;  2FB7 A;  2IVW A;  2RI2 A;  4N0A C;  2EYX A;  1YJN T;  3G6E Q;  1X43 A;  3J80 E;  4Z02 A;  1Y07 A;  2KQW A;  2D6F A;  3QJ6 A;  4XTX A;  5J26 A;  3OYF A;  2ZCF B;  3FIF A;  4A4E A;  5D6X A;  4C0Z A;  2JUF A;  1KFZ A;  2KMT A;  1QKX A;  4LXC A;  1BK2 A;  2CP3 A;  1UJY A;  5GAM e;  3UT1 A;  1MUZ A;  3TEE A;  1VQ8 T;  3REA B;  2QTV A;  2CZ7 B;  3G71 A;  4OMP A;  1M3A A;  4PJO F;  3X24 B;  4AG2 C;  2KT1 A;  2ROT A;  4F7U F;  1GBQ A;  4M78 B;  2KRO A;  4BI4 A;  1YFN A;  1JRI A;  2DZ9 A;  3CD6 A;  2HQE A;  4J9E A;  2DTO A;  2J6O A;  1QW1 A;  4XTU A;  4A4K A;  1WNL A;  2G3R A;  2JM8 A;  1VQ9 T;  4IUV A;  2FG0 A;  4ZN3 A;  3THK A;  3LH5 A;  3CCU T;  4PJJ A;  1N9R A;  2AIR B;  4PJN A;  3I55 Q;  2AT1 B;  2WSC E;  1YI2 A;  1VQN Q;  1TTH B;  3VU3 C;  3FEO A;  1AZG B;  1D0X A;  2K3B A;  2YT6 A;  3MPU B;  2LJ1 A;  3CCQ A;  2DIQ A;  1I1J A;  4HKE A;  1JO8 A;  4AFZ C;  4F16 A;  3VS7 A;  4BI8 B;  4QT7 A;  3CCJ T;  3RBB B;  4E7S A;  4M77 G;  1XQH A;  4EIK A;  3MKD A;  2XID A;  4C0F A;  2BUD A;  3INZ A;  2MWP A;  5DY9 A;  4II1 A;  4DEX A;  5D6Y A;  1M1K R;  3CC4 T;  2CSQ A;  4M77 E;  4HCC A;  5KYX B;  3OW2 S;  2DYB A;  1ZBX A;  4LDU A;  2NUT B;  4NL2 A;  1WHK A;  1YIT T;  1UHF A;  4C8Q G;  1QKW A;  3DB4 A;  1Y0M A;  2FZK B;  3EFO A;  5KE2 A;  3QBY A;  2KNB B;  2X4X A;  4PJO D;  4C92 F;  2QGF B;  2J6F A;  2QQB A;  2R5M A;  2K3Y A;  4C8Q E;  1VQ5 Q;  3MO8 A;  2DL3 A;  3CBP A;  5EG2 A;  2CP2 A;  1IHW A;  4AMC A;  2A36 A;  1RAB B;  3C94 A;  3NFC A;  3DLL A;  4KGZ B;  2RK1 A;  3VV0 A;  3JB9 G;  1D1B A;  3ZEH A;  1SSH A;  2JXB A;  2LVM A;  3M0Q A;  2RO0 A;  4RTY A;  2W0Z A;  1Q81 R;  1M1F A;  1C1A A;  1ZA2 B;  3CCV T;  1WHH A;  3MJX A;  1N8R R;  4DQ2 A;  1ABQ A;  2CYZ B;  1JXM A;  5GAO n;  3S6W A;  2QQ9 A;  1K73 U;  1PRM C;  3LGF A;  3M9Q A;  3M4Y A;  2CKK A;  1BI2 A;  3CCR Q;  1TG0 A;  2CDT A;  4BB7 A;  4ELY C;  3MP6 A;  1Z9Q A;  1RLQ C;  1EFN A;  4C5E A;  1C6V X;  2W10 A;  2QQA A;  4AFQ C;  2QGG A;  5GAO q;  1X6B A;  3I9Q A;  4HA8 A;  5KYU A;  4M77 C;  5KYY A;  3QUI A;  1E6G A;  1NM7 A;  2O01 E;  4ATO A;  4E47 A;  3EG9 A;  3CC7 A;  3JCM W;  2EKH A;  3CME T;  3LW5 E;  4BE2 A;  5A2Q E;  5FU6 B;  4L6V 5;  4N4G A;  5GAN 4;  2K2V A;  3M58 A;  5FLX E;  4C8Q C;  1W2B S;  1OV3 A;  1X01 A;  4LE9 A;  1KQS P;  1OPK A;  1QCF A;  3RDV A;  1GBR A;  5FRO A;  2BZY A;  2NUP B;  2HCK A;  3P8H A;  3OYE A;  3CBO A;  1H92 A;  1QVG A;  1MMG A;  4F14 A;  3E9F A;  3KXT A;  2QXF A;  2XIC A;  1QVF S;  1M4Z A;  1DJ7 B;  2QEX A;  2P0Q A;  1X69 A;  1Q95 G;  1XJW B;  2CSI A;  1SEM A;  2XMF A;  5IHI A;  3UA6 A;  4IUR A;  2X3W D;  4XTY A;  3GNG A;  1QLY A;  5GMK j;  2CGH A;  2RMO A;  3URG A;  1WQ7 A;  1YJ9 T;  2SEM A;  1LCK A;  4R56 A;  3UDC A;  1WA7 A;  3TSW A;  3FLG A;  1OUL A;  1VQM Q;  2DO3 A;  2HQH A;  1FMW A;  3QII A;  4IUQ A;  2CRE A;  3GNF B;  2L89 A;  4OGE A;  4XQ3 A;  4KUI A;  1ZBJ A;  1RAI B;  1K0X A;  4PJO G;  3EFS A;  1SSF A;  4F7U G;  4ZTF A;  2M0Y A;  1WGS A;  3ME9 A;  3REB B;  4E7K A;  3KBG A;  5KCH A;  3OYA A;  2EWN A;  3EGU A;  5KYW B;  1FMV A;  1M8M A;  4RTZ A;  1K8A R;  2KI7 A;  4PJO E;  2G6F X;  2JS0 A;  3LH0 A;  2OTJ A;  2XD0 A;  4FW1 A;  1JJ2 P;  2XDD A;  3M57 A;  1PSF A;  4F7U E;  4HT9 A;  3G4S Q;  1I81 A;  2CP0 A;  2LDM A;  2LX7 A;  1KC8 R;  2LZ6 B;  4PL6 A;  1UUE A;  5GMK l;  1PC0 A;  3MEU A;  3OYD A;  1ZX6 A;  2M16 A;  2RI3 A;  1UFF A;  5GAN d;  2B86 A;  3OQ5 A;  4BI3 A;  3E2U A;  3S3N A;  1VQL Q;  3L2R A;  2YLB A;  2QA4 Q;  4RTX A;  1BB9 A;  4BE0 A;  1IGQ A;  4E7Z A;  1NZ9 A;  3SEM A;  6AT1 B;  1PNJ A;  1TS9 A;  2PU9 B;  3ER0 A;  5EC7 A;  1M9S A;  1YJN Q;  4J9F A;  2MMP A;  1W4S A;  5IHK A;  5GAN g;  1VQK T;  1KQS A;  2L3Q A;  1LVK A;  2QI2 A;  2QQS A;  1X27 A;  2KR3 A;  1CSK A;  1Y57 A;  3P8B B;  4MZP A;  2PTK A;  2KSS A;  1Q86 C;  4HVW A;  5HK0 A;  2COY A;  2PVG B;  2LJ3 A;  1G3Y A;  1VQ8 Q;  3SHW A;  5LJ3 j;  2O88 A;  5I21 A;  1KHC A;  4KGX B;  1JQQ A;  1Y7X A;  2GBQ A;  4GBQ A;  2C0O A;  4C0D B;  5LJ5 h;  1NEG A;  2E5K A;  2LNH B;  1N8R U;  2LNV A;  4PJO C;  2YRD A;  1VQ9 Q;  2K6D A;  3CCE A;  2HQX A;  1OX8 A;  3OYI A;  1G8X A;  1VQO T;  3CCM A;  1Y96 B;  3CCU Q;  1VQ4 A;  1VQ7 A;  2R57 A;  4K11 A;  1KG1 A;  1HXD A;  2D8J A;  4PFP A;  4HCZ A;  2FPE A;  5ECA A;  3CCL A;  4J9C A;  4C92 B;  1TSF A;  4LUE A;  1KQ1 A;  1YHQ T;  4M77 F;  4B9W A;  4EMK C;  2E70 A;  4OF1 A;  3HPW A;  2F5K A;  1GRI A;  3CCJ Q;  1BI1 A;  2QAS A;  3CXC P;  2RK2 A;  2GQI A;  1N6A A;  2FEI A;  1VYV A;  1YWP A;  3VUZ A;  3OSS C;  5LJ5 e;  5IT9 E;  1GCQ C;  1WX6 A;  3H0I A;  1JJ2 A;  3PGG A;  3CC4 Q;  2AKK A;  1VIE A;  2KAF A;  2BZX A;  3EG1 A;  1D1C A;  3G6E A;  1YIT Q;  1VIF A;  2RQR A;  5CIU A;  1VYU A;  2L3R A;  3E9G A;  1ZA1 B;  2ED1 A;  1SRM A;  4LNP A;  1BI0 A;  4QVD A;  3QYH B;  1B3Q A;  1K4U S;  4HXJ A;  2ZPH B;  1I07 A;  2VV5 A;  1BKB A;  2M0O A;  2C06 A;  2EFI A;  3JB9 F;  1WXU A;  3EFR A;  1YI2 T;  1Q82 C;  2RB6 A;  1BU1 A;  1VYT A;  2K5I A;  1H8K A;  1RLP C;  5GAO l;  3CEY A;  3CCV Q;  3FDR A;  3JB9 J;  3OYM A;  1QQJ A;  3PIP A;  2DYI A;  1M30 A;  1K9M R;  4M7A D;  1OZ2 A;  5IN1 A;  1V76 A;  3BDU A;  3I55 A;  1VQN A;  1FX7 A;  5D6W A;  4J7F A;  2HKN A;  5LL6 S;  1B34 A;  3QZ9 B;  2JZ2 A;  3OMG A;  4RCB A;  1NLP C;  2DJZ A;  2E41 A;  4ZNX A;  4KH0 B;  3SDZ A;  1R0C B;  1I5L A;  1BCO A;  3OS0 A;  1K8A U;  3BFM A;  1GFD A;  4JJC A;  4ME7 A;  9ATC B;  3CMA T;  3CME Q;  2A08 A;  2RD1 A;  1M1G A;  2O9S A;  3LYI A;  2VGM A;  3CXC A;  3G4S T;  1M2O A;  5GAM h;  3E19 A;  4LD6 A;  2J6K A;  3JB9 D;  3UPU A;  2QDY B;  1AZE A;  3HFN A;  4Y92 A;  2VB6 A;  4WTO B;  2LQW A;  2AZV A;  2E4H A;  2EJ9 A;  2CUD A;  1P92 A;  4RTV A;  5FU7 C;  4M7A A;  4FIB A;  4N4I A;  3M0U A;  5HY6 A;  3OMC A;  4XU0 A;  3MP1 A;  4OB0 B;  5KYX A;  2DET A;  2LCL A;  2EPD A;  2JTE A;  2NUT A;  1Q86 R;  3OY9 A;  3J7A F;  5CKE A;  1YNZ A;  2QAZ A;  1Q7Y R;  4MDW A;  4BY6 C;  1YJ9 Q;  2VVK A;  4MMK A;  2HNI A;  1OU8 A;  3RKX A;  4DEY A;  3EHQ A;  1RAE B;  2GTO A;  1YCY A;  4J5Y A;  4FYY B;  2OTL T;  2K4Y A;  4QW2 A;  2O4X B;  2DNU A;  3SWN A;  4LD9 K;  1U3O A;  1UEC A;  3PVL A;  2KEA A;  4X9C A;  1GL5 A;  4JRP A;  4Z88 A;  4ESR A;  3LX7 A;  2XDB A;  1FWZ A;  1LJO A;  4J7I A;  2KRN A;  1HSQ A;  3O5Z A;  5CCA A;  1ZSZ A;  4E7I A;  2HKQ B;  3GP8 A;  2DXB A;  3TU4 K;  3S3M A;  1WPY A;  3EGX B;  3UWN A;  5HKC A;  2QEX T;  4JS4 A;  1AWJ A;  4P5N A;  1QWE A;  3PMT A;  3MP8 A;  3RMS A;  1RI9 A;  3CPW P;  1Z9Z A;  1NJI U;  2JS2 A;  2DEU A;  3CCS T;  5CO7 A;  3VYG A;  2X4J A;  1MGQ A;  3OB9 A;  4FYX B;  3R6O A;  1MMA A;  3RKW A;  1RAC B;  5CQX A;  1NLO C;  4M7A G;  3QPH A;  3OYK A;  1IRX A;  4OMF B;  5GJW B;  2EJG A;  1KD1 R;  4M7A E;  2Z0W A;  1VQK Q;  2LCS A;  1QVG P;  4RKU E;  4JUV A;  2DXT A;  3EG3 A;  4IIM A;  3Q1J A;  3EGD A;  3ZFJ A;  2LQK A;  2V26 A;  4D8K A;  1S72 T;  3A8G B;  3BDL A;  3HRS A;  4OB3 B;  3JCM Q;  4M77 B;  2COZ A;  2XDP A;  2PUK B;  3TRE A;  5FWC A;  4JJN K;  2NUP A;  1AD5 A;  4E7J A;  1G3W A;  1H64 1;  5GMK e;  4RG8 A;  2FYK A;  2YSQ A;  4R0K A;  5GAN 8;  1E7O A;  1ZLM A;  3H6Z A;  3DKM A;  1HJD A;  2IG0 A;  4RG2 A;  3OYY A;  4X1V A;  2DX1 A;  5CKB A;  1B7T A;  4OMO A;  1PHT A;  3IQL A;  1YBY A;  1K1Z A;  4C8Q B;  1Y71 A;  4BDY A;  2GCX A;  2OX7 A;  1NE8 A;  3PTA A;  2YLC A;  1M3C A;  2Y4Y A;  1VQO Q;  3LLR A;  1CKA A;  1VQ6 T;  4OMM A;  4AT1 B;  2LRQ A;  1M2V A;  1WXB A;  3JRZ A;  2XI9 A;  1YHQ Q;  1KQS S;  4IUU A;  2XK0 A;  4FYV B;  4XK8 E;  4KUD K;  2CT3 A;  1XNI A;  3M55 A;  2DPP B;  2F2W A;  1CKB A;  4GLK A;  4F17 A;  2A28 A;  4NL3 A;  3PT9 A;  2K79 A;  4M7A C;  1VQL A;  2JNG A;  2DRM A;  3A8M B;  2QA4 A;  1M90 R;  2OJ2 A;  3FC3 A;  2DJQ A;  3G1J A;  1UB4 A;  5LJ3 h;  4QVC A;  3L2U A;  3M5A A;  2BIV A;  2K57 A;  3PFS A;  1YJW A;  3CPW A;  1A0N B;  2DTH A;  4FL6 A;  4JLG A;  2DK3 A;  2RHX A;  3R6N A;  1BCM A;  4LN2 A;  2A37 A;  3EH1 A;  1WJR A;  3L2Q A;  2P0P A;  4ZTJ A;  2RA2 A;  4DBQ A;  1V29 B;  2ZPF B;  1NJI C;  3CCE T;  5CKH A;  3GOX A;  1M27 C;  3HRU A;  5DLO A;  3OYG A;  3CCM T;  4B6M A;  1VQ4 T;  1VQ7 T;  1VQ8 A;  4PFZ A;  3VYH B;  2OI3 A;  3DLM A;  3LGL A;  1YI2 Q;  4J9H A;  1RL2 A;  4FT4 A;  3SWN C;  4B9X A;  3JV3 A;  3GLX A;  4EDU A;  1ZHI A;  1MV0 B;  4ZGD B;  1ZUU A;  1PRL C;  5I2M A;  1Q7Y U;  1UGQ B;  1YIJ A;  3RIR A;  2E6Z A;  5LJ3 e;  1WLP B;  2HL3 A;  5GAM f;  2VXE A;  3EFO B;  3H9N A;  2NWM A;  2EQM A;  2FZG B;  4CC3 A;  4C5G A;  4HT8 A;  1O9S A;  1ZSZ C;  4OGC A;  4ZGJ B;  2EQK A;  1SHF A;  1D3B B;  1K0S A;  2J05 A;  1JJ2 S;  4GLM A;  2CH4 A;  3QDF A;  2RHZ A;  3CCU A;  1WFW A;  2C0I A;  2P4R A;  4DBF A;  2DIG A;  1PKS A;  4PFO A;  1LNX A;  1QCN A;  3A8H B;  4AG1 C;  2DEQ A;  5CK9 A;  3AHU A;  3BE3 A;  1F1B B;  4QVZ A;  1NEB A;  2RHU A;  4PK4 A;  4Z89 A;  2XU8 A;  1KIK A;  4RUG A;  2E12 A;  1G2B A;  3WVE B;  3CCJ A;  4E2F B;  1K76 A;  1W2B P;  2KYB A;  3QWX X;  1TU0 B;  4D8D A;  2YDL A;  2VC8 A;  3CMA Q;  2QG9 B;  3ZBD A;  3BW1 A;  2RQU A;  3GPL A;  2AHJ B;  3UF4 A;  3OW2 A;  2I2L A;  4FU6 A;  3TSZ A;  4C92 A;  1K73 C;  4QQ6 A;  3VS3 A;  1VQP T;  1YIT A;  1RUW A;  2CZ6 B;  2EQU A;  3EHR A;  2P4T A;  3HRT A;  2BE9 B;  2ZPE B;  4J83 A;  1N5Z A;  2FO0 A;  5KYU B;  1KK7 A;  2HSE B;  4M7D D;  5KYY B;  1UTI A;  1R77 A;  4RTU A;  4PJO B;  3DB3 A;  1AOJ A;  4F7U B;  2DFU A;  5GMK m;  3D7S B;  2CUB A;  1UDL A;  4NOY A;  1M1K U;  3MEA A;  4M4Z A;  3M4G A;  3PNW C;  1QP2 A;  5IAY A;  4Q5W A;  2KT8 A;  3FJ5 A;  3RER A;  2XG8 D;  2VYT A;  3T9N A;  5IXF A;  1AWX A;  3NMZ C;  3F70 A;  4XTZ A;  1BIA A;  3L1A A;  4KGV B;  4C0G A;  1ABO A;  1VA7 A;  3VKI A;  4EMK B;  2KRS A;  2E3H A;  3OYL A;  3QZ5 B;  3JCM c;  3JCM h;  1ARK A;  5GAN j;  3A8O B;  4JJB A;  1OZ3 A;  3J81 E;  4OVA A;  1YWO A;  4BD3 A;  2OTL Q;  4Y28 E;  5A0D A;  2JT4 A;  1UEB A;  1KHI A;  2C0T A;  4KH1 B;  5IXB A;  4ZGE B;  1Q81 U;  3V8K A;  2RNA A;  4ANJ A;  2RJF A;  5C6S A;  3CC2 A;  2DL4 A;  4J6W A;  1WDX A;  4M7D A;  2E10 A;  2AK5 A;  1BI3 A;  1I4K 1;  2K3X A;  2CT4 A;  2PVD B;  2CS7 A;  5I2S A;  3MET A;  5GAN 2;  3I56 T;  2KXC A;  1YN8 A;  3FB9 A;  2DL7 A;  5L23 A;  2QEX Q;  1G83 A;  2X4Y A;  1X2Q A; 
#chains in the Genus database with same CATH homology
 2A08 A;  5HCK A;  2DYB A;  3PVQ A;  2O9S A;  3NPF A;  4JPB W;  2K2M A;  2OAW A;  1UHF A;  2RQW A;  2I0N A;  3EG0 A;  2GGR A;  2RPN A;  1QKW A;  2J6K A;  3H0F A;  3VS5 A;  1Y0M A;  2GNC A;  1KJW A;  2DM1 A;  1AZE A;  4Y92 A;  2KNB B;  1AWW A;  2J6F A;  2LQW A;  2AZV A;  2CUD A;  2F2V A;  4RTV A;  2DVJ A;  1UHC A;  2DL3 A;  3M0U A;  1T0H A;  1XOV A;  3VS6 A;  2KBT A;  2A36 A;  2F2X A;  2EPD A;  2JTE A;  2ENM A;  2YUO A;  2VWF A;  2DA9 A;  2L3P A;  1SSH A;  2JXB A;  3M0Q A;  1YNZ A;  4RTY A;  2W0Z A;  2KYM A;  1W1F A;  2DL5 A;  1UE9 A;  1ABQ A;  4ORZ A;  2VVK A;  1JXM A;  3VS0 A;  3I35 A;  3H41 A;  4DEY A;  4AFU C;  1PRM C;  3EHQ A;  3ULR B;  2BZ8 A;  2BTT A;  1PWT A;  2GTO A;  1TG0 A;  2CDT A;  1ZSG A;  1WIE A;  1NYF A;  1Z9Q A;  1T0J A;  2DNU A;  1RLQ C;  1EFN A;  1U3O A;  1UEC A;  3PVL A;  2KEA A;  4J9B A;  3UA7 A;  1GL5 A;  2W10 A;  4AFQ C;  1ZUY A;  1X6B A;  4Z88 A;  3I9Q A;  4ESR A;  5IHN A;  2KRN A;  2YUQ A;  1E6G A;  1HSQ A;  1NM7 A;  5I22 A;  3O5Z A;  1WI7 A;  1U06 A;  4CC7 A;  1S1N A;  2ESW A;  2LMJ A;  2O2O A;  4OMQ A;  2EKH A;  4KRT A;  4IIO A;  2RQT A;  1AWJ A;  1QWE A;  1RI9 A;  1Z9Z A;  4Z8A A;  1PKT A;  2JS2 A;  5IH2 A;  1OPL A;  1OV3 A;  1T3S A;  4LE9 A;  4WCI A;  1OPK A;  1QCF A;  1GBR A;  2GTJ A;  2X3X D;  2BZY A;  2LQN A;  1NLO C;  2KXD A;  3NHN A;  1UG1 A;  1UGV A;  4RTT A;  4HCK A;  2HCK A;  2HDA A;  1H92 A;  4F14 A;  4HVU A;  4OMN A;  3KFV A;  1AEY A;  2MCN A;  5GJW B;  2JM9 A;  1X69 A;  2CSI A;  2LCS A;  2JMC A;  1SEM A;  2XMF A;  5IHI A;  3UA6 A;  2HEQ A;  1WYX A;  3EG3 A;  4IIM A;  4CC2 A;  2X3W D;  1JU5 C;  1QLY A;  2RN8 A;  2HBW A;  2DE0 X;  2RMO A;  2FPF A;  4D8K A;  2SEM A;  1LCK A;  3A98 A;  2DL8 A;  3M0R A;  5FWC A;  1WA7 A;  3TSW A;  1QWF A;  1AD5 A;  3RNJ A;  4RTW A;  2H8H A;  2YSQ A;  1T3L A;  1HD3 A;  1E7O A;  1ZLM A;  1MV3 A;  2CRE A;  4R0K A;  1HJD A;  2IIM A;  2V1Q A;  4X1V A;  2DX1 A;  2EW3 A;  2DRK A;  4OMO A;  1PHT A;  1ZUK A;  3IQL A;  3I5R A;  4E6R A;  1ZBJ A;  2O31 A;  2RQV A;  1K1Z A;  1K0X A;  4JJD A;  2FRW A;  1SHG A;  1GFC A;  2DIL A;  1M3C A;  3EG2 A;  2M0Y A;  3U23 A;  2YUN A;  3REB B;  3ZL7 C;  1FYN A;  1CKA A;  4OMM A;  3EGU A;  1M8M A;  4RTZ A;  2ECZ A;  2G6F X;  2JS0 A;  1H3H A;  1WXB A;  4J9G A;  2ABL A;  2LX7 A;  2M51 A;  1GCP A;  1AVZ C;  2DLP A;  2LZ6 B;  1UUE A;  2CT3 A;  1X2K A;  2F2W A;  1CKB A;  1ZX6 A;  4F17 A;  1UFF A;  2B86 A;  2A28 A;  1OOT A;  2DBM A;  2JW4 A;  2K79 A;  2RF0 A;  2DRM A;  2OJ2 A;  4RTX A;  4OML A;  2DJQ A;  1BB9 A;  3VS2 A;  2AZS A;  2KE9 A;  1UJ0 A;  1W6X A;  3SEM A;  1PNJ A;  2CH4 W;  1A0N B;  5EC7 A;  4J9F A;  3H0H A;  4HVV A;  3R6N A;  2ROL A;  5IHK A;  4LN2 A;  2A37 A;  2L3Q A;  1X27 A;  2KR3 A;  5FWB A;  1CSK A;  1Y57 A;  5FW9 A;  1BBZ A;  1U5S A;  3M0P A;  2PTK A;  1JEG A;  2LP5 A;  4HVW A;  3VRZ A;  3CQT A;  1M27 C;  2V1R A;  2J7I A;  2LJ3 A;  2OI3 A;  4J9H A;  3SHW A;  2O88 A;  2QDL A;  3JV3 A;  1JQQ A;  2GBQ A;  4GBQ A;  2K9G A;  2C0O A;  1MV0 B;  2LJ0 A;  1X6G A;  2EYY A;  1TUD A;  1NEG A;  1PRL C;  1ZUU A;  2E5K A;  2LNH B;  2L3S A;  2PNI A;  1WLP B;  2PZ1 A;  1W70 A;  2EYW A;  2DBK A;  2MOX A;  1JXO A;  2JMA A;  2NWM A;  2EYZ A;  2SRC A;  4JZ3 A;  2D8H A;  2O9V A;  4CC3 A;  2K6D A;  1YP5 A;  1SHF A;  1K0S A;  2J05 A;  3PE0 A;  4GLM A;  2CH4 A;  2HSP A;  2K7A A;  1SPK A;  1WFW A;  2C0I A;  2P4R A;  4FSS A;  4K11 A;  2D8J A;  2EQI A;  3VS4 A;  1NYG A;  1IO6 A;  2KGT A;  2J06 A;  5GJV B;  1PKS A;  2FPE A;  3VRY A;  5ECA A;  1M3B A;  4J9C A;  4AG1 C;  4LUE A;  1NEB A;  4A63 B;  4Z89 A;  3I5S A;  1I0C A;  3M0S A;  1KIK A;  3UAT A;  2YUP A;  4RUG A;  1G2B A;  1GRI A;  2GQI A;  1FMK A;  1K76 A;  2MIO A;  2FEI A;  2ED0 A;  2KYB A;  4J9D A;  1VYV A;  1YCS B;  1YWP A;  3QWX X;  1WXT A;  4D8D A;  2YDL A;  4CC4 B;  1WX6 A;  1GCQ C;  2EGC A;  3H0I A;  1SRL A;  3VS1 A;  2DMO A;  2VKN A;  3TVT A;  3M0T A;  2DF6 A;  2AKK A;  2RQU A;  3UF4 A;  2EGE A;  2BZX A;  3TSZ A;  3EG1 A;  1TUC A;  2EYX A;  5I11 A;  3VS3 A;  2L0A A;  1X43 A;  1RUW A;  3EHR A;  2RQR A;  1VYU A;  1N5Z A;  2FO0 A;  2EGA A;  1UTI A;  2ED1 A;  1KFZ A;  1SRM A;  3C0C A;  4LNP A;  4RTU A;  1AOJ A;  1OEB A;  1QKX A;  1B3Q A;  1BK2 A;  4LUD A;  4HXJ A;  1K4U S;  1UJY A;  1I07 A;  1MUZ A;  3REA B;  2CUB A;  1UDL A;  1WXU A;  4M4Z A;  4AFS C;  4OMP A;  1BU1 A;  1V1C A;  1VYT A;  1M3A A;  2KT8 A;  4AG2 C;  1H8K A;  3FJ5 A;  2KT1 A;  2ROT A;  1GBQ A;  1RLP C;  2D0N A;  1K9A A;  2FPD A;  2KRM A;  2KRO A;  2L2P A;  5IXF A;  1AWX A;  3NMZ C;  2D1X A;  4J9E A;  1ABO A;  1VA7 A;  2KRS A;  2J6O A;  2EBP A;  2EVR A;  2AKL A;  2JM8 A;  1M30 A;  1ARK A;  2FG0 A;  4JJB A;  3THK A;  3LH5 A;  1J3T A;  1YWO A;  4J9I A;  2JT4 A;  1AWO A;  2C0T A;  1AZG B;  1KSW A;  5IXB A;  2K3B A;  2YT6 A;  2LJ1 A;  1B07 A;  2RNA A;  1I1J A;  2NUZ A;  2DL4 A;  1JO8 A;  1NLP C;  4AFZ C;  3QWY A;  4ZNX A;  3VS7 A;  1WDX A;  4F16 A;  2AK5 A;  4QT7 A;  3RBB B;  4EIK A;  1E6H A;  3GBQ A;  4DEX A;  2CT4 A;  1GFD A;  4JJC A;  1GCQ A;  3NGP A;  4JZ4 A;  2KXC A;  1YN8 A;  1NG2 A;  2DL7 A;  2CSQ A;  5L23 A;  2FRY A;  1G83 A;  1X2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...