2BZYA

Homodimer of crkl-sh3c domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
PVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-Terminal SH3 Domain of Crkl as a Dynamic Dimerization Module Transiently Exposing a Nuclear Export Signal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sh3 domain
molecule keywords CRK-LIKE PROTEIN
total genus 5
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2bzyA00
1BBZA 1YP5A 2CSQA 1X69A 4OMMA 2PNIA 2GNCA 2EBPA 1GCQA 4M4ZA 2D8HA 1IO6A 2K6DA 2KR3A 4CC4B 2KXCA 2KYBA 2L2PA 3H0FA 4LUEA 1CKBA 4RTYA 1I07A 3FJ5A 2GGRA 2CUBA 2OAWA 5IXFA 3QWXX 2JT4A 2KT8A 2RN8A 4CC7A 2D1XA 1VA7A 4KRTA 1WYXA 2LJ0A 2X3XD 4OMNA 1G83A 3EG3A 3IQLA 4GBQA 1JQQA 1B3QA 2DRKA 2DM1A 4WCIA 2K3BA 4OMQA 5ECAA 2VKNA 2LJ1A 2JS0A 1W1FA 3TVTA 1YCSB 2EYZA 3VRYA 2DL8A 2FPEA 2YT6A 1MV3A 2KNBB 1AZGB 1H8KA 1I1JA 1NLPC 1M8MA 2DMOA 2J7IA 1LCKA 1YWOA 2HDAA 1HSQA 2JXBA 1WA7A 1OPKA 1N5ZA 2K7AA 2LZ6B 1X2KA 1K9AA 1K0SA 4ZNXA 4Z8AA 1BB9A 1SRLA 1PKSA 5L23A 1GFDA 1WXUA 2A08A 1TG0A 3EHQA 1FMKA 4D8DA 1W70A 2FPFA 3CQTA 1V1CA 1WXTA 3REBB 1OOTA 3KFVA 5HCKA 3UA7A 1U3OA 1GCPA 1QWFA 2D0NA 2RQTA 2LJ3A 2PZ1A 1ZUYA 2O2OA 1JEGA 2PTKA 4HVUA 2YDLA 4J9BA 3I35A 2FRYA 2YUPA 1UGVA 1UHCA 2MOXA 1X43A 2NWMA 1GRIA 4Y92A 2GQIA 2F2VA 2CT3A 1JU5C 4K11A 3VS3A 1NYGA 2ED0A 4D8KA 1ZX6A 1S1NA 2CH4W 1UE9A 5FWCA 2HEQA 1M30A 1K0XA 2DL3A 2HSPA 2X3WD 2JMCA 1FYNA 4RTXA 1WXBA 5IHKA 3RNJA 1GBRA 3H41A 4Z89A 2FG0A 3H0HA 2KRMA 2LX7A 2BZYA 4AFZC 2EGAA 1VYVA 3GBQA 1U5SA 2FPDA 2KBTA 2XMFA 4JJCA 3PE0A 4J9CA 3EG0A 5IXBA 1UDLA 1UTIA 4F14A 1OPLA 1K4US 2EGEA 4LE9A 1ABOA 1UJ0A 2DILA 3VS4A 2IIMA 2DE0X 4JPBW 3I5SA 3VRZA 5FWBA 1KIKA 2O9VA 2OI3A 2BZXA 3JV3A 4OMLA 1E6GA 1SEMA 1VYTA 3M0RA 3REAB 2K79A 2LMJA 1AOJA 2EYYA 3PVLA 2K2MA 2A37A 3RBBB 1TUDA 2KYMA 2YUOA 5FW9A 2D8JA 1X6GA 1BU1A 2ABLA 3SEMA 2CUDA 3M0PA 2J6KA 1ZUKA 2J6OA 1SSHA 1QKWA 1JXOA 2SEMA 2KRNA 4GLMA 2EW3A 1QKXA 3NPFA 1Z9ZA 1OV3A 2L3QA 4AG2C 2KE9A 1U06A 1PNJA 2KT1A 2J05A 3I9QA 1SHGA 2J6FA 2G6FX 1M3BA 4FSSA 2EYWA 2OJ2A 3VS6A 1RI9A 4EIKA 2RQRA 3UF4A 1RUWA 2GTJA 2KROA 5IHNA 1PRMC 4J9GA 2VWFA 3M0UA 1ZBJA 1X2QA 1PWTA 4HCKA 4J9DA 5GJWB 4F16A 1UJYA 4E6RA 2CSIA 1UECA 1Z9QA 1QCFA 2ENMA 4Z88A 1T0JA 2DL5A 1KJWA 1QLYA 2CDTA 1MUZA 2DF6A 2KRSA 1GCQC 3QWYA 2EKHA 4RTVA 2DVJA 3C0CA 2KXDA 1RLPC 2O9SA 2JTEA 4CC2A 5EC7A 1NG2A 1AD5A 2W10A 1X6BA 1CSKA 4JJDA 4LN2A 4RTZA 1SRMA 2B86A 1TUCA 2EVRA 1AWOA 2CT4A 4A63B 1ARKA 1GL5A 1WI7A 5GJVB 2A36A 2C0OA 2QDLA 1UFFA 3TSZA 1Y57A 2V1QA 3EHRA 2DX1A 3EG1A 1ZSGA 2MCNA 3M0TA 1AWJA 2CH4A 2JS2A 2LP5A 1XOVA 1GFCA 2E5KA 2O31A 1YWPA 1BK2A 1KSWA 1WIEA 3PVQA 4OMPA 1H3HA 1AWXA 5I22A 1UHFA 1NEBA 1ZLMA 2GBQA 4HXJA 4IIOA 1HJDA 1YN8A 1WFWA 4AFSC 4DEYA 1I0CA 1ABQA 2LQNA 1UUEA 3VS0A 2V1RA 1T0HA 4OMOA 4RTUA 3VS5A 2SRCA 1K1ZA 2BZ8A 4LNPA 1G2BA 2K9GA 1AVZC 3LH5A 4F17A 2L3PA 3VS1A 3O5ZA 2I0NA 2DA9A 2EPDA 4QT7A 2JW4A 1AEYA 2AKKA 1GBQA 1NLOC 3M0SA 5IH2A 1CKAA 2RF0A 1NEGA 1YNZA 2KEAA 3TSWA 3THKA 3H0IA 1KFZA 2KGTA 2DNUA 3I5RA 3NMZC 3ULRB 2DLPA 4RTTA 1AZEA 2C0IA 5IHIA 2MIOA 2F2XA 1T3SA 2JMAA 3NGPA 1WX6A 1M3CA 2HCKA 2HBWA 2P4RA 4J9EA 1NM7A 4ESRA 1E6HA 3U23A 1X27A 2DYBA 1M3AA 1RLQC 2RMOA 3VS2A 2FO0A 3SHWA 2J06A 2O88A 2RQWA 4J9HA 1ZUUA 3EG2A 2C0TA 2VVKA 2RQVA 2RQUA 3UATA 2ROLA 2LQWA 4ORZA 2JM8A 2FRWA 2LNHB 3R6NA 2EYXA 1JO8A 2YUQA 2GTOA 4JZ4A 2DBKA 1A0NB 2RPNA 1PHTA 2DL7A 2DL4A 1J3TA 2NUZA 2DJQA 2CREA 2A28A 2ROTA 1E7OA 2W0ZA 4RTWA 3UA6A 1SHFA 3A98A 1OEBA 4RUGA 4AFUC 1QWEA 4AFQC 4JJBA 4JZ3A 2YUNA 4AG1C 3M0QA 4R0KA 2AK5A 1UG1A 1NYFA 2ESWA 2AKLA 2F2WA 4IIMA 2EQIA 1H92A 1EFNA 2AZSA 4J9IA 4HVWA 2EGCA 1WLPB 2ED1A 1VYUA 3ZL7C 2L3SA 1M27C 4CC3A 1MV0B 1W6XA 2RNAA 2YSQA 2DRMA 2H8HA 2DBMA 3VS7A 1HD3A 2JM9A 4DEXA 4LUDA 4J9FA 2FEIA 1JXMA 1AWWA 3EGUA 1T3LA 4HVVA 1SPKA 1PKTA 1Y0MA 4X1VA 2ECZA 2M51A 2L0AA 2AZVA 2BTTA 1PRLC 3NHNA 1K76A 5I11A 2M0YA 1WDXA 2LCSA 1B07A
chains in the Genus database with same CATH superfamily
2MF2A 3Q1JA 2GNCA 1ZBXA 2VASA 3C95A 4QW2A 2EWNA 3CXCS 1IO6A 2K6DA 3KUFA 1M1GA 2KYBA 3LLRA 4BB7A 2L2PA 3OA6A 2L89A 3L2VA 1CKBA 4RTYA 4E7JA 2DZ9A 1NJIR 2OAWA 1P92A 2XG8D 3I56T 4CC7A 2RN8A 1PSEA 4JLGA 2DTOA 3LW5E 4ME7A 2P4TA 1G83A 1JQQA 3FRNA 4A4KA 3CBMA 1Q86R 1FWZA 2DM1A 2K3BA 3CCQA 2LJ1A 1WHKA 4EMKA 1JJ2A 1W1FA 1VQNT 1VQKA 2DL8A 1VQ5A 1MV3A 3M59A 1Y07A 1H8KA 1I1JA 2DMOA 1VQOT 5GANg 5IAYA 1WA7A 1OPKA 1N5ZA 2LZ6B 1K9AA 2ZPFB 3CC7Q 2CP3A 5L23A 1JRIA 2D9TA 1TG0A 4D8DA 2CKKA 5LJ5f 1W70A 2DO3A 4ZTJA 4R56A 1OU9A 2V26A 2LJ3A 3OMCA 4OGEA 2KVQG 1M1KR 4M75D 2FRYA 5CKBA 2YUPA 1UGVA 5GAN3 3OS0A 4RMOA 5DY9A 1AHJB 2F2VA 1JU5C 4BUGA 4XQ3A 2DERA 2GFAA 1VQ6Q 2ED0A 2E41A 1ZX6A 1S1NA 4IUUA 4WF2A 5DLOA 2HEQA 2HSPA 5GMKj 4M7AG 1WXBA 1C1AA 3RNJA 5LJ3g 2KRMA 4PJJA 4AFZC 1YBYA 3ER0A 3EGDB 1EIFA 3CC7A 1F1BB 3GBQA 2KBTA 4JRIA 2XMFA 5GAOp 5C6SA 1UTIA 5GAN4 3EGDA 1M9SA 4LE9A 2DILA 5CO7A 3OYNA 2DE0X 1PCXA 3RKXA 3V7SA 5LJ3h 3OY9A 3I5SA 2G3RA 2CZ1B 5CKDA 3DB3A 3MPUB 1K9MC 2GCXA 2XICA 1E6GA 2FZGB 3CCSA 1VYTA 5FROA 2V8IA 5KCHA 2KI7A 2K2MA 2XK0A 1QCNA 1RI0A 1QVFP 4F04B 1IHVA 3PTAA 1VQNA 2J6OA 1VQ5T 1SSHA 4TVRA 1JXOA 2SEMA 5AT1B 4OB2B 1W2BA 1QKXA 3G6ET 3JCMJ 3NPFA 1OV3A 3JCMg 1YIJA 3CD6A 1PNJA 2KT1A 3I9QA 1SHGA 2J6FA 3AT1B 6AT1B 1Q7YC 1G3TA 2K57A 4BD3A 4FSSA 3VS6A 1W2BS 4J9GA 2EJ9A 2VWFA 3M0UA 2EQJA 3OYAA 1YJNT 4HCKA 4J9DA 5FRMA 4E6RA 2FHDA 1Z9QA 4Z88A 1T0JA 3CCLQ 3QWYA 3CBPA 2MWPA 4O5VA 5L8RE 3BDLA 1N8RR 2DJZA 1U8RA 4CC2A 2EKOA 2AIRB 1AD5A 1CSKA 4JJDA 3RUXA 3JB9H 1WJRA 1YHQQ 4RTZA 1SRMA 4ZGDB 5CVIA 4RCBA 1AWOA 1SKUB 3V7RA 4EMHA 1Y71A 2QDLA 1VUBA 1PM3A 2DFUA 3URGA 4B9WA 4BDZA 1X6OA 2COYA 1O75A 2CH4A 1KK7A 2YXYA 5FU6B 2V8JA 1BK2A 1S72Q 4OGCA 3JCMX 1QVFA 4OMPA 2QQAA 3CCMA 1H3HA 4J6WA 1UHFA 2DEQA 2MPXC 4MZMA 2GBQA 5GAN7 4IIOA 4IUVA 2JJ9A 5GANh 1HJDA 3OYCA 2ZZDA 2CP7A 1YN8A 1VIEA 3EG9B 1VQLQ 3EH1A 4C92C 2COWA 4B9XA 2DAQA 4BY6C 1T0HA 4ATOA 2QAZA 2QTXA 5GAMj 4L59A 4M75B 3H6ZA 1VQ4Q 2BZ8A 4LNPA 1OX9A 4F17A 3CC4Q 2RI2A 3VS1A 3O5ZA 2RHZA 1IGUA 2DKGA 5LJ5g 3M0SA 3JCMQ 3FLGA 1S72T 2M1HA 5IH2A 5KYUB 2RF0A 5GMKi 2KEAA 5KYXB 2IG0A 3QO3A 1WHLA 4KT0E 3THKA 5GAMh 3H0IA 4JLIA 4DOVA 2KGTA 3I5RA 1KC8C 3OBYA 2DLPA 5DM7R 3HSBA 5IHIA 4QVCA 4JJNK 1IXDA 2F2XA 1VQPT 1EZZB 1WPYA 2JMAA 4MMKA 3CMEQ 2OTJA 3R6OA 5LJ5j 4FCYA 3NGPA 4N4HA 3CCUA 4ZGJB 1OYXA 1E6HA 4BACA 1M5Q1 2JOYA 2CP6A 3E19A 1Q81R 2DYBA 4M7AF 1C0MA 2QXFA 2FO0A 4MDXA 5CKEA 5LJ5e 1VQKQ 3X26B 4KGXB 2PUKB 1ZUUA 2RJFA 2RQUA 2LTOA 4DBHA 1LOJA 2FRWA 3JCMP 1VQ6A 5GAMf 3A1PA 1JO8A 1IB8A 5FRNA 2I2LA 4JZ4A 3X20B 2QQSA 2L5QA 4OF1A 4J7FA 1N27A 4C8QG 2VGMA 4NL2A 3FIFA 3LWHA 1KD1C 4M7DG 2DL7A 1WJQA 2HAXA 3PGGA 3QSUA 2E3IA 2ROTA 3CBOA 1D0XA 3UA6A 3CCVQ 3L42A 4PLIA 1SHFA 2RJEA 4F7UA 4J7IA 4QQDA 3OS2A 2E3HA 1QWEA 4OP0A 4M77C 2YUNA 4AG1C 3CCRT 1VQMQ 4M7AB 1NPRA 3UWNA 1VQPA 2IVWA 2F2WA 4IIMA 1YI2T 3F70A 3MP6A 2RHUA 1H92A 1JJ2P 2E10A 4X34A 2ED1A 4HKEA 4DBRA 1MMDA 3OYEA 4CC3A 1MNDA 5AYFA 2YRDA 3C12A 1M2OA 5GAMd 1Q82C 3VS7A 2XU8A 1HD3A 4DEXA 4J9FA 2RJCA 1K9MU 3RKWA 2JVVA 3WVDB 1OQKA 4O6JA 4OB0B 3JAME 3D7SB 4JRPA 3NHNA 3I55Q 2EQKA 2HL5C 3PMIA 4ELZC 1RADB 1D1CA 1XJWB 1UEBA 3UT1A 4XTVA 1PC0A 2VUBA 2P0KA 1YP5A 2RM4A 1D0ZA 2LNVA 2EBPA 3C94A 1I8FA 5GAN2 1D3BA 2YHTA 5I21A 3CCJA 4CC4B 2KXCA 3VYGA 4LD9K 2HZYA 4M75A 1Y7XA 3V8JA 4PJOC 1Q95G 4HCBA 2GGRA 4R55A 3CCEA 1N8RC 2KAFA 5KE2A 4PJMA 2D1XA 2WACA 3QZ9B 4M78D 2NYSA 1B3QA 1HXDA 3PFSA 1BI3A 5ECAA 1N9RA 2JS0A 4PNOA 3RESA 1WQWA 1YHQT 3VUZA 1VQOQ 2KNBB 1VQNQ 5KYWB 1AZGB 2ZPIB 1QW1A 5HY6A 3G6EA 1M8MA 4LDYA 2EIFA 1V29B 1YWOA 2JXBA 2MK5A 1X2KA 2HL3A 3CC2A 1SRLA 4F7UG 1GFDA 4PFPA 2DETA 3QJYA 1RAEB 3CQTA 1V1CA 2QEXQ 3KFVA 2M9UA 5HCKA 4PJOG 2D0NA 4M77F 3NTKA 4DBFA 4ZN1A 2QASA 3HRUA 4AMCA 3T9NA 5LJ5h 4M77A 1VQ8T 4KBMB 2YDLA 4J9BA 1G8XA 1X43A 4XTUA 2NWMA 4KUIA 1GRIA 3SDZA 3VS3A 4HCZA 4C0GA 5CAIA 1NYGA 4ANJA 3PIOA 2COZA 4D8KA 1SG5A 2CH4W 3CC4T 3CCRA 3CCLA 2DTHA 3E1SA 1FYNA 4RTXA 4Z89A 2EQUA 4N0AC 3H0HA 4J8OA 1Q86C 2EGAA 3A8LB 3OQ5A 2YLBA 3PT9A 2X4WA 3PE0A 4J9CA 3EG0A 4F14A 1ZSZC 3CD6Q 1OPLA 2NLUA 3GNFB 3LGLA 1SF9A 2EGEA 2Y90A 4MZTA 1K9MR 2K5IA 2HKNA 5LJ5d 3TREA 1LVKA 3GNGA 5FWBA 4PJOB 1KIKA 2MYSA 2RJDA 2OI3A 2BZXA 3G71Q 3CCVT 3M9QA 2FB7A 3M0RA 2CS7A 2QTVA 4CI0C 4PLLA 4C92E 3CMAA 1VOMA 1VQ5Q 1BU1A 3HP9A 2ABLA 3V8LA 2CUDA 2ZCFB 2XIDA 3M0PA 1ZUKA 1D1BA 1Y96B 3OYKA 4GLMA 2EW3A 4HT9A 3CPWS 2KK4A 2RHYA 1D3BB 2LVMA 1BI1A 4E7ZA 5GANj 1ACMB 2E6ZA 1NJIU 3OS5A 4BI3A 3M55A 4A53A 4C5IA 3JRZA 1M2VB 4GY5A 2OJ2A 1YFNA 2RQRA 2QDYB 2KROA 1KC8R 1PRMC 4DOWA 3BY7A 4II1A 3GPLA 4C8QC 1VQ9Q 3OYDA 5KYWA 1X2QA 1X01A 2BE7D 1UJYA 2CSIA 2HBPA 4PKCC 1KJWA 2KQWA 1GCQC 4RTVA 3SWNB 2KXDA 4PJOD 2O9SA 1BCOA 3HPWA 4XAXB 2E6NA 1PG5B 1YJ9Q 2PVGB 3E2UA 1K73C 4RCCA 1KD1U 3HRTA 2FL7A 2CT4A 4A63B 5GJVB 5GANe 5GAMg 1UFFA 3TSZA 2PVDB 4J5YA 3EG1A 1NZ9A 2O4XB 1ZSGA 3M0TA 1AWJA 4M77B 2YRCA 3SFMA 2E5KA 2CZ6B 4JS4A 3CCUT 1KSWA 1YJNA 2EFIA 1NEBA 1ZLMA 4HXJA 1VQLT 3J7AF 4AFSC 2M02A 4FYVB 2YRVA 2PVOB 4C92F 2LQKA 1ABQA 2LQNA 3VS0A 3QYHB 2AHJB 1ZA2B 4FYYB 4LDWA 3QDFA 3UDCA 1G2BA 1AVZC 3LH5A 2P84A 2JNGA 1UGSB 2QGGA 3NFCA 4M77D 1UGPB 3I56Q 2ZPHB 2EPDA 4XTYA 4BY6B 5M9OA 2JW4A 5KYYB 3VKIA 4NS5A 3VJPA 4M78F 4FYWB 3JB9J 3X28B 1KFZA 3NMZC 1KQSS 4RTTA 3G4SA 3INZA 2C0IA 3V8KA 3MEWA 1T3SA 1B34A 1M90R 1RL2A 3C4SA 2MAMA 5GAOq 2OTLA 2XD0A 3OSVA 2ZPEB 2K2VA 3DKMA 2EJFA 2HBWA 3ZFJA 3L2RA 1QQJA 2WSEE 5J26A 4QQGA 3CXCP 2R5AA 1M3AA 1RLQC 4EMKC 3SHWA 2O88A 1YITQ 2C0TA 2VGNA 4M77E 2RQVA 3UATA 1VIFA 2LQWA 4Q5WA 2JM8A 5A2QE 3HHTB 4M7DD 1OULA 2LNHB 3HKSA 2JN0A 3R6NA 1LNXA 3EFRA 1W4SA 5FU6C 2E64A 2ZGWA 1Q86U 3JCMb 1K8AC 2D0QB 2DBKA 4FL6A 4CRIA 5IT9E 4MMLA 1A0NB 3G7ZA 3RKYA 2LCLA 2BUDA 1K73R 2X4JA 2W0ZA 1VQMA 1OEBA 2RI5A 2P0PA 3QG1A 1ZQ1A 2KMTA 4EMKB 2EAYA 4LD6A 2AK5A 1YIJT 1KG1A 4KH0B 4PL6A 2E5QA 2EGCA 3G1JA 3JCMf 4FW1A 1KQ2A 2L3SA 2KDSA 1M27C 1MV0B 2NUPB 3S3OA 1W6XA 2RNAA 2YSQA 2H8HA 4E7LA 1PSFA 2NUTA 2F5TX 4JS5A 3CCQT 2O4XA 3NTHA 1JXMA 1AWWA 1IREB 2JZ2A 2QQ9A 2NUPA 1T3LA 4IUQA 1PKTA 2RK2A 2M51A 3I55T 4NL3A 2EJGA 3CCLT 2XHCA 5GAOm 3CEYA 2M0YA 2LCSA 4HA8A 2CGHA 2O01E 2XDBA 3MKDA 4OMMA 1GCQA 4JUVA 1ZHIA 4IURA 1YCYA 1YJ9T 3JB9D 2QA4T 3OYGA 3H0FA 2X51A 4LUEA 5GAMe 4Y91A 2CZ0B 2DXBA 2CUBA 5IXFA 4LDUA 5D7UA 4BI4A 5D6WA 3M53A 2JT4A 2KT8A 2OAUA 5FU7C 1VQ9T 2QGFB 3OS1A 1V76A 1WYXA 1FMWA 3EG3A 3IQLA 4GBQA 3CCUQ 4FM4B 4FU6A 4WCIA 4EMGA 1YCSB 3EH2A 4BE1A 2BKDN 2YT6A 5FLXE 4C8QD 4MZPA 2R58A 3LGFA 1VQ4T 4KH1B 1LCKA 1R8OB 3LX7A 1ZSZA 4LDXA 3I55A 3H9NA 2PU9B 4ZNXA 1OX8A 3CPFA 2A08A 1M2VA 3CC7T 4E7IA 3RDVA 3FEOA 2RA2A 4M75G 3OW2P 4VUBA 1U3OA 1M4ZA 1QWFA 2QYZA 2PZ1A 1OZ3A 4M78E 2PTKA 4M7AE 2IPOB 1UHCA 2MOXA 1Q81U 3ZEHA 1QVGP 1TXQA 3RMSA 3AHUA 1WZOA 1VQPQ 3CMET 4K11A 1D0YA 3PNWC 4XTZA 2A3LA 4IUTA 5FWCA 2HD0A 4IUPA 1I81A 1K0XA 2DL3A 4FYXB 2JMCA 5LJ3e 1GBRA 2CP0A 4IKFA 3CCST 1UB4A 3M4YA 1H3ZA 4C8QA 1VYVA 1U5SA 1TS9A 1WHMA 2HQHA 5GAN6 4ZTFA 3MEAA 5IXBA 1UDLA 3CPWA 1K4US 4XU0A 1N8RU 3VYHB 4KUDK 4XTXA 2LCCA 2IIMA 3JB9F 1BIBA 4KGZB 5GAOr 2RI3A 3VRZA 2MMPA 2O9VA 4GLKA 3WVEB 4OMLA 3KXTA 1RAAB 2ATCB 3DB4A 3OBWA 3BFMA 2D6FA 5HK3A 2DIGA 4C0FA 2K79A 2EYYA 1DJ7B 2A37A 3RBBB 3JCMc 3EFSA 2KYMA 3EG9A 5FW9A 3OW2S 2D8JA 3CCSQ 3CCEQ 1YITT 2GFUA 2X35A 2F1LA 3QPHA 2RB6A 4C0DB 2J6KA 3BW1A 2GQVA 1YIJQ 1TH7A 4KULA 9ATCB 1KQSA 1D1AA 4AG2C 5GMKm 1G3WA 1HYOA 2CP2A 3M5AA 3SB2A 2G6FX 1VQ9A 5GAOn 3P8DA 1RI9A 5FU7B 4EIKA 3UF4A 2GTJA 5IHNA 3E9FA 3QXEB 1I5OB 4LDVA 4F7UE 3EGXA 4XTWA 2E70A 3QIIA 2ENMA 5I2MA 2CDTA 2M0OA 3CCET 2QA4A 2DVJA 1YITA 1RLPC 3QUIA 2JTEA 3SD4A 2W10A 1IHWA 1JJ2S 3CPWP 4C0ZA 4FIBA 4LN2A 1MHNA 1PD1A 1UGQB 4PFZA 3FJPA 3OYBA 1VQLA 2B86A 1TUCA 2AT1B 2EVRA 5KYUA 1WI7A 3QYGB 3FDRA 2K3YA 1QVFS 5HK0A 2A36A 1Y57A 2V1QA 1OU8A 2DX1A 2DEUA 1QP2A 3HFNA 2JS2A 5EG2A 1XOVA 1G3SA 1YJWQ 2DVEA 1VQ4A 4BDYA 3MHXA 1WIEA 3PVQA 1KHCA 1AWXA 2QQBA 3A5ZB 4J6XA 1JB0E 3KBGA 5A0DA 1WFWA 4DEYA 1D09B 5KYNA 2A7YA 5D6YA 1TU0B 4M78G 1UUEA 1Q7YU 4JRKA 4OMOA 1U1SA 2LX9A 3L2ZA 1KHIA 2QI2A 2SRCA 2F5KA 2ZAEA 3BE3A 3RR6A 2L3PA 2DXTA 3EFOB 2DA9A 3WXMB 3TCJA 4EPCA 3CC2Q 1AEYA 1NLOC 2CYZB 4M78C 1NEGA 1YNZA 4DA4A 5LJ3f 3TSWA 3A8OB 1VQOA 3EFOA 4C8QB 4M78A 4E47A 2R5MA 2DNUA 3ZBDA 3P8HA 2E4HA 2OTLQ 3OSSC 4C92B 3JB9G 2CZ7B 2MIOA 2OTLT 4XU2A 2QK0A 2B8AA 2VYTA 1BYMA 2K4YA 2BE9B 1VQ6T 1NPPA 2RHIA 4A4EA 1X75C 1VQ7Q 1N9SA 3A8GB 1M3CA 2HCKA 2HKQB 4PJOE 2KSSA 4E7SA 3UPUA 2P4RA 4PFOA 4J9EA 4ESRA 1RAIB 3U23A 3V7CA 5C0MA 1BCMA 5LJ3d 2RMOA 3VS2A 5HKCA 4C0DC 3CC4A 3M58A 3MP8A 1LPLA 3FC3A 2ROLA 1XNIA 3S6WA 4M7AD 1G5VA 2LDMA 3JB9I 3LYIA 3EGXB 2EYXA 2YUQA 2GTOA 2XKOC 1FMVA 4FSXA 3J80E 5KCOA 1PHTA 3QDRB 1NBEB 2DL4A 1U1TA 2NUZA 3MP1A 2VXFA 1UGRB 2R57A 2OTJQ 4RTWA 1YJNQ 4M75F 2OTJT 4BE0A 4XU3A 2L3RA 1OZ2A 4AFQC 4JJBA 4JZ3A 1GXIE 3M0QA 4JDSA 3CCJQ 4R0KA 3OYIA 1Q81C 1M1FA 5A0LA 1NYFA 3QHSA 1EFNA 1WHHA 2AZSA 4NOYA 1WLPB 3RIRA 1Q82R 1VYUA 2YWWA 5GAN8 1OI1A 3OYFA 1C6VX 3M4GA 2WSFE 2KY9A 4UC4A 4N0AA 2ZPBB 2JM9A 4LUDA 2FEIA 3VU3C 2EQMA 3JCMh 2Z0WA 4M75E 5GAN5 3ME9A 1Y0MA 5GAOl 4X1VA 2ECZA 4Y28E 5DLQE 1RAHB 2BTTA 3OW2A 4Z02A 4PK4A 2WSCE 2HQEA 1BBZA 2FVUA 2CSQA 1X69A 2PNIA 2QQRA 3SWNC 4M4ZA 2QA4Q 2D8HA 3TEEA 2KR3A 4C5EA 5GANd 4F7UB 1K73U 3QBYA 3JCMe 1G3YA 4B6MA 3JCMW 4M78B 1I07A 3FJ5A 1YJWT 3L2WA 4X9CA 1WNLA 3QWXX 4OB3B 1QVPA 1VA7A 4KRTA 1QVGS 5A0GA 2LJ0A 2X3XD 4OMNA 1XTDA 2DRKA 4A4HA 4RG2A 3JCMd 3GP8A 4OMQA 1RACB 3CMEA 2VKNA 4L6V5 1MMAA 1FXXA 4M77G 4OMFB 1VQ8Q 3TVTA 2LC4A 2VC8A 2H3EB 1Q82U 2EYZA 3VRYA 1MMNA 3LWIA 2FPEA 3NTIA 8ATCB 4JRQA 1NE8A 1WGSA 1BIAA 1NLPC 2J7IA 3QZ5B 4A4GA 1KD1R 2HDAA 1HSQA 5LL6S 2E12A 5KYYA 3CCMT 4C8QE 5CIUA 2K7AA 1IZ6A 1K0SA 2E65A 4Z8AA 1BB9A 1PKSA 4HT8A 1WXUA 1M1KC 2DPPB 3EHQA 1FMKA 3CC2T 4FT2A 4EDUA 5CKFA 4BI8B 2FPFA 2XI9A 1WXTA 3REBB 2PUOB 1OOTA 2YLCA 3UA7A 3S3MA 4D6WA 2QEXT 1GCPA 1B34B 2RQTA 2VXEA 3HTRA 1JEGA 1ZUYA 2K5LA 2O2OA 2M16A 3OYHA 1KC8U 2F69A 4HVUA 1FX7A 3I35A 4P5NA 5KYXA 1SSFA 4Y92A 1MNEA 2GQIA 1TUGB 5GANf 2CT3A 5CQYA 1ZSZB 1QP3A 3I56A 3G4ST 1S72A 2DTIA 3A8HB 3CCMQ 3S3NA 4V2SA 1BKBA 1UE9A 3ASKA 1M30A 3DLLA 2XDDA 2X3WD 2QEXA 2LQ8A 3MJXA 5IHKA 2A0FB 3H41A 4M7AC 4L5GA 2FG0A 2LX7A 2BZYA 3HFOA 3TQ7P 3X25B 4M7DE 1WQ7A 4J6YA 4FT4A 2FPDA 2LRQA 4JJCA 2DZCA 3G6EQ 3L2UA 2FZKB 4KGVB 1ABOA 2C06A 3VUBA 1UJ0A 2EYQA 3VS4A 3GIBA 3O8VA 3SWNA 3MEVA 4JPBW 1YJWA 2HSEB 3CCVA 2H3JA 1LJOA 3G4SQ 3JV3A 4OB1B 3MO8A 1SEMA 1W2BP 2OX7A 2XDPA 3L2QA 3REAB 2LMJA 1AOJA 3PVLA 5CCAA 4FW2A 2K5FA 1R77A 1TUDA 2JTFA 2YUOA 2DK3A 1X6GA 3A8MB 3SEMA 1YHQA 1YJ9A 2HNIA 1QKWA 2KRNA 1YI2Q 2HMAA 1Q7YR 3RERA 1Z9ZA 2L3QA 2RH2A 2KE9A 4C92A 5J39A 5CR2A 4M7DA 4AT1B 1U06A 3GF5A 3EAEA 2J05A 4C92G 1M3BA 3LH0A 8AT1B 2EYWA 4M7DF 5I2SA 1RUWA 2MWOA 4OVAA 4ZGEB 3BDUA 3MCAB 3QKJA 4C8QF 4M7DB 1ZBJA 1KQSP 1M90U 1EX4A 1PWTA 3GOXA 4DBQA 1VQ7A 5GJWB 4F16A 5D6XA 1UECA 1QCFA 1ZA1B 2DXCA 2DL5A 2DXUA 2LT4A 2RO0A 1QLYA 3M56A 1VQ8A 1MUZA 2DF6A 2KRSA 2EKHA 1WHGA 3C0CA 1KQ1A 3CXCA 5EC7A 1NG2A 1MGQA 1N6AA 1X6BA 1IRXA 2Y4YA 3CMAQ 4MDWA 2DIQA 4J83A 3H8ZA 1GL5A 1ARKA 2C0OA 5CK9A 3EHRA 2MCNA 3J81E 2FZCB 2CP5A 2LP5A 5GMKe 1GFCA 1Y96A 4QQ6A 1H641 2O31A 1YWPA 1I5LA 2K3XA 3OB9A 3HRSA 1B7TA 3HL8A 5I22A 1PD0A 1IGQA 3OYMA 1I0CA 3OYYA 4RG8A 2V1RA 4YTLA 3E9GA 4RTUA 3VS5A 2Y4XA 1MMGA 1K1ZA 2L8DA 3GLXA 5KE3A 3L1AA 3JCMV 1K8AR 2K9GA 3OYJA 2PQWA 1K8AU 2VB6A 3RMQA 2I0NA 2RHXA 4QT7A 5KH6A 2FYKA 2VV5A 2AKKA 1GBQA 1VQKT 1CKAA 3FB9A 4E7HA 2MI6A 4QVZA 1TTHB 3ULRB 2E1HA 3CD6T 3X24B 1AZEA 2DYIA 1TOVA 4RKUE 3PMTA 3M57A 5GMKl 1WX6A 4C92D 1VQ7T 2QG9B 3JSCA 1M8VA 1NM7A 4M7DC 1M1KU 1X27A 1BI0A 4DQ2A 4N4IA 2ZPGB 1I4K1 1HK9A 2DD5A 2J06A 1TSFA 2RQWA 4J9HA 3EG2A 2NUTB 2VVKA 1YI2A 4M7AA 2BIVA 1QVGA 5GMKh 4C5HA 2JTMA 4E2FB 4ORZA 4E7KA 3P8BB 3PIPA 4QVDA 2P0QA 1O9SA 4PJNA 2X9HA 1BI2A 5CKHA 1QCOA 2V8KA 1M90C 1R0CB 2GF7A 2RPNA 2X4XA 4PJLA 1WHJA 1J3TA 3M54A 2DJQA 2CREA 4PJOF 2A28A 1E7OA 3G71T 4M75C 4XK8E 5LJ3j 4WTOB 3A98A 3VV0A 4RUGA 4AFUC 4PJOA 4C5GA 3CCRQ 1VQMT 2DD4A 3OYLA 1AT1B 5J3BA 1JBMA 4F7UF 1UG1A 3QJ6A 3CCJT 1QMCA 2ESWA 2AKLA 5IN1A 2EQIA 2RD1A 4J9IA 4HVWA 3CMAT 1R0BG 3ZL7C 1WJSA 2JUFA 1NJIC 3TU4K 2HQXA 4LXCA 4X9DA 3G71A 2DRMA 4N4GA 3N5BB 1RABB 4A54A 2RK1A 4ELYC 3OMGA 4QKUA 2DBMA 2LT1A 4BE2A 5CQXA 3META 3EGUA 3MEUA 3CCQQ 4XU1A 4ZN3A 4HVVA 1SPKA 3DLMA 7AT1B 2L0AA 2AZVA 1RAFB 1RAGB 1PRLC 1XQHA 5I11A 1K76A 2X4YA 4HCCA 1WDXA 4A4FA 1B07A 1TWBA
chains in the Genus database with same CATH topology
1BBZA 1YP5A 2CSQA 1X69A 4OMMA 2PNIA 2GNCA 2EBPA 1GCQA 4M4ZA 2D8HA 1IO6A 2K6DA 2KR3A 4CC4B 2KXCA 2KYBA 2L2PA 3H0FA 4LUEA 1CKBA 4RTYA 1I07A 3FJ5A 2GGRA 2CUBA 2OAWA 5IXFA 3QWXX 2JT4A 2KT8A 2RN8A 4CC7A 2D1XA 1VA7A 4KRTA 1WYXA 2LJ0A 2X3XD 4OMNA 1G83A 3EG3A 3IQLA 4GBQA 1JQQA 1B3QA 2DRKA 2DM1A 4WCIA 2K3BA 4OMQA 5ECAA 2VKNA 2LJ1A 2JS0A 1W1FA 3TVTA 1YCSB 2EYZA 3VRYA 2DL8A 2FPEA 2YT6A 1MV3A 2KNBB 1AZGB 1H8KA 1I1JA 1NLPC 1M8MA 2DMOA 2J7IA 1LCKA 1YWOA 2HDAA 1HSQA 2JXBA 1WA7A 1OPKA 1N5ZA 2K7AA 2LZ6B 1X2KA 1K9AA 1K0SA 4ZNXA 4Z8AA 1BB9A 1SRLA 1PKSA 5L23A 1GFDA 1WXUA 2A08A 1TG0A 3EHQA 1FMKA 4D8DA 1W70A 2FPFA 3CQTA 1V1CA 1WXTA 3REBB 1OOTA 3KFVA 5HCKA 3UA7A 1U3OA 1GCPA 1QWFA 2D0NA 2RQTA 2LJ3A 2PZ1A 1ZUYA 2O2OA 1JEGA 2PTKA 4HVUA 2YDLA 4J9BA 3I35A 2FRYA 2YUPA 1UGVA 1UHCA 2MOXA 1X43A 2NWMA 1GRIA 4Y92A 2GQIA 2F2VA 2CT3A 1JU5C 4K11A 3VS3A 1NYGA 2ED0A 4D8KA 1ZX6A 1S1NA 2CH4W 1UE9A 5FWCA 2HEQA 1M30A 1K0XA 2DL3A 2HSPA 2X3WD 2JMCA 1FYNA 4RTXA 1WXBA 5IHKA 3RNJA 1GBRA 3H41A 4Z89A 2FG0A 3H0HA 2KRMA 2LX7A 2BZYA 4AFZC 2EGAA 1VYVA 3GBQA 1U5SA 2FPDA 2KBTA 2XMFA 4JJCA 3PE0A 4J9CA 3EG0A 5IXBA 1UDLA 1UTIA 4F14A 1OPLA 1K4US 2EGEA 4LE9A 1ABOA 1UJ0A 2DILA 3VS4A 2IIMA 2DE0X 4JPBW 3I5SA 3VRZA 5FWBA 1KIKA 2O9VA 2OI3A 2BZXA 3JV3A 4OMLA 1E6GA 1SEMA 1VYTA 3M0RA 3REAB 2K79A 2LMJA 1AOJA 2EYYA 3PVLA 2K2MA 2A37A 3RBBB 1TUDA 2KYMA 2YUOA 5FW9A 2D8JA 1X6GA 1BU1A 2ABLA 3SEMA 2CUDA 3M0PA 2J6KA 1ZUKA 2J6OA 1SSHA 1QKWA 1JXOA 2SEMA 2KRNA 4GLMA 2EW3A 1QKXA 3NPFA 1Z9ZA 1OV3A 2L3QA 4AG2C 2KE9A 1U06A 1PNJA 2KT1A 2J05A 3I9QA 1SHGA 2J6FA 2G6FX 1M3BA 4FSSA 2EYWA 2OJ2A 3VS6A 1RI9A 4EIKA 2RQRA 3UF4A 1RUWA 2GTJA 2KROA 5IHNA 1PRMC 4J9GA 2VWFA 3M0UA 1ZBJA 1X2QA 1PWTA 4HCKA 4J9DA 5GJWB 4F16A 1UJYA 4E6RA 2CSIA 1UECA 1Z9QA 1QCFA 2ENMA 4Z88A 1T0JA 2DL5A 1KJWA 1QLYA 2CDTA 1MUZA 2DF6A 2KRSA 1GCQC 3QWYA 2EKHA 4RTVA 2DVJA 3C0CA 2KXDA 1RLPC 2O9SA 2JTEA 4CC2A 5EC7A 1NG2A 1AD5A 2W10A 1X6BA 1CSKA 4JJDA 4LN2A 4RTZA 1SRMA 2B86A 1TUCA 2EVRA 1AWOA 2CT4A 4A63B 1ARKA 1GL5A 1WI7A 5GJVB 2A36A 2C0OA 2QDLA 1UFFA 3TSZA 1Y57A 2V1QA 3EHRA 2DX1A 3EG1A 1ZSGA 2MCNA 3M0TA 1AWJA 2CH4A 2JS2A 2LP5A 1XOVA 1GFCA 2E5KA 2O31A 1YWPA 1BK2A 1KSWA 1WIEA 3PVQA 4OMPA 1H3HA 1AWXA 5I22A 1UHFA 1NEBA 1ZLMA 2GBQA 4HXJA 4IIOA 1HJDA 1YN8A 1WFWA 4AFSC 4DEYA 1I0CA 1ABQA 2LQNA 1UUEA 3VS0A 2V1RA 1T0HA 4OMOA 4RTUA 3VS5A 2SRCA 1K1ZA 2BZ8A 4LNPA 1G2BA 2K9GA 1AVZC 3LH5A 4F17A 2L3PA 3VS1A 3O5ZA 2I0NA 2DA9A 2EPDA 4QT7A 2JW4A 1AEYA 2AKKA 1GBQA 1NLOC 3M0SA 5IH2A 1CKAA 2RF0A 1NEGA 1YNZA 2KEAA 3TSWA 3THKA 3H0IA 1KFZA 2KGTA 2DNUA 3I5RA 3NMZC 3ULRB 2DLPA 4RTTA 1AZEA 2C0IA 5IHIA 2MIOA 2F2XA 1T3SA 2JMAA 3NGPA 1WX6A 1M3CA 2HCKA 2HBWA 2P4RA 4J9EA 1NM7A 4ESRA 1E6HA 3U23A 1X27A 2DYBA 1M3AA 1RLQC 2RMOA 3VS2A 2FO0A 3SHWA 2J06A 2O88A 2RQWA 4J9HA 1ZUUA 3EG2A 2C0TA 2VVKA 2RQVA 2RQUA 3UATA 2ROLA 2LQWA 4ORZA 2JM8A 2FRWA 2LNHB 3R6NA 2EYXA 1JO8A 2YUQA 2GTOA 4JZ4A 2DBKA 1A0NB 2RPNA 1PHTA 2DL7A 2DL4A 1J3TA 2NUZA 2DJQA 2CREA 2A28A 2ROTA 1E7OA 2W0ZA 4RTWA 3UA6A 1SHFA 3A98A 1OEBA 4RUGA 4AFUC 1QWEA 4AFQC 4JJBA 4JZ3A 2YUNA 4AG1C 3M0QA 4R0KA 2AK5A 1UG1A 1NYFA 2ESWA 2AKLA 2F2WA 4IIMA 2EQIA 1H92A 1EFNA 2AZSA 4J9IA 4HVWA 2EGCA 1WLPB 2ED1A 1VYUA 3ZL7C 2L3SA 1M27C 4CC3A 1MV0B 1W6XA 2RNAA 2YSQA 2DRMA 2H8HA 2DBMA 3VS7A 1HD3A 2JM9A 4DEXA 4LUDA 4J9FA 2FEIA 1JXMA 1AWWA 3EGUA 1T3LA 4HVVA 1SPKA 1PKTA 1Y0MA 4X1VA 2ECZA 2M51A 2L0AA 2AZVA 2BTTA 1PRLC 3NHNA 1K76A 5I11A 2M0YA 1WDXA 2LCSA 1B07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  1YP5 A;  2CSQ A;  1X69 A;  4OMM A;  2PNI A;  2GNC A;  2EBP A;  1GCQ A;  4M4Z A;  2D8H A;  1IO6 A;  2K6D A;  2KR3 A;  4CC4 B;  2KXC A;  2KYB A;  2L2P A;  3H0F A;  4LUE A;  1CKB A;  4RTY A;  1I07 A;  3FJ5 A;  2GGR A;  2CUB A;  2OAW A;  5IXF A;  3QWX X;  2JT4 A;  2KT8 A;  2RN8 A;  4CC7 A;  2D1X A;  1VA7 A;  4KRT A;  1WYX A;  2LJ0 A;  2X3X D;  4OMN A;  1G83 A;  3EG3 A;  3IQL A;  4GBQ A;  1JQQ A;  1B3Q A;  2DRK A;  2DM1 A;  4WCI A;  2K3B A;  4OMQ A;  5ECA A;  2VKN A;  2LJ1 A;  2JS0 A;  1W1F A;  3TVT A;  1YCS B;  2EYZ A;  3VRY A;  2DL8 A;  2FPE A;  2YT6 A;  1MV3 A;  2KNB B;  1AZG B;  1H8K A;  1I1J A;  1NLP C;  1M8M A;  2DMO A;  2J7I A;  1LCK A;  1YWO A;  2HDA A;  1HSQ A;  2JXB A;  1WA7 A;  1OPK A;  1N5Z A;  2K7A A;  2LZ6 B;  1X2K A;  1K9A A;  1K0S A;  4ZNX A;  4Z8A A;  1BB9 A;  1SRL A;  1PKS A;  5L23 A;  1GFD A;  1WXU A;  2A08 A;  1TG0 A;  3EHQ A;  1FMK A;  4D8D A;  1W70 A;  2FPF A;  3CQT A;  1V1C A;  1WXT A;  3REB B;  1OOT A;  3KFV A;  5HCK A;  3UA7 A;  1U3O A;  1GCP A;  1QWF A;  2D0N A;  2RQT A;  2LJ3 A;  2PZ1 A;  1ZUY A;  2O2O A;  1JEG A;  2PTK A;  4HVU A;  2YDL A;  4J9B A;  3I35 A;  2FRY A;  2YUP A;  1UGV A;  1UHC A;  2MOX A;  1X43 A;  2NWM A;  1GRI A;  4Y92 A;  2GQI A;  2F2V A;  2CT3 A;  1JU5 C;  4K11 A;  3VS3 A;  1NYG A;  2ED0 A;  4D8K A;  1ZX6 A;  1S1N A;  2CH4 W;  1UE9 A;  5FWC A;  2HEQ A;  1M30 A;  1K0X A;  2DL3 A;  2HSP A;  2X3W D;  2JMC A;  1FYN A;  4RTX A;  1WXB A;  5IHK A;  3RNJ A;  1GBR A;  3H41 A;  4Z89 A;  2FG0 A;  3H0H A;  2KRM A;  2LX7 A;  2BZY A;  4AFZ C;  2EGA A;  1VYV A;  3GBQ A;  1U5S A;  2FPD A;  2KBT A;  2XMF A;  4JJC A;  3PE0 A;  4J9C A;  3EG0 A;  5IXB A;  1UDL A;  1UTI A;  4F14 A;  1OPL A;  1K4U S;  2EGE A;  4LE9 A;  1ABO A;  1UJ0 A;  2DIL A;  3VS4 A;  2IIM A;  2DE0 X;  4JPB W;  3I5S A;  3VRZ A;  5FWB A;  1KIK A;  2O9V A;  2OI3 A;  2BZX A;  3JV3 A;  4OML A;  1E6G A;  1SEM A;  1VYT A;  3M0R A;  3REA B;  2K79 A;  2LMJ A;  1AOJ A;  2EYY A;  3PVL A;  2K2M A;  2A37 A;  3RBB B;  1TUD A;  2KYM A;  2YUO A;  5FW9 A;  2D8J A;  1X6G A;  1BU1 A;  2ABL A;  3SEM A;  2CUD A;  3M0P A;  2J6K A;  1ZUK A;  2J6O A;  1SSH A;  1QKW A;  1JXO A;  2SEM A;  2KRN A;  4GLM A;  2EW3 A;  1QKX A;  3NPF A;  1Z9Z A;  1OV3 A;  2L3Q A;  4AG2 C;  2KE9 A;  1U06 A;  1PNJ A;  2KT1 A;  2J05 A;  3I9Q A;  1SHG A;  2J6F A;  2G6F X;  1M3B A;  4FSS A;  2EYW A;  2OJ2 A;  3VS6 A;  1RI9 A;  4EIK A;  2RQR A;  3UF4 A;  1RUW A;  2GTJ A;  2KRO A;  5IHN A;  1PRM C;  4J9G A;  2VWF A;  3M0U A;  1ZBJ A;  1X2Q A;  1PWT A;  4HCK A;  4J9D A;  5GJW B;  4F16 A;  1UJY A;  4E6R A;  2CSI A;  1UEC A;  1Z9Q A;  1QCF A;  2ENM A;  4Z88 A;  1T0J A;  2DL5 A;  1KJW A;  1QLY A;  2CDT A;  1MUZ A;  2DF6 A;  2KRS A;  1GCQ C;  3QWY A;  2EKH A;  4RTV A;  2DVJ A;  3C0C A;  2KXD A;  1RLP C;  2O9S A;  2JTE A;  4CC2 A;  5EC7 A;  1NG2 A;  1AD5 A;  2W10 A;  1X6B A;  1CSK A;  4JJD A;  4LN2 A;  4RTZ A;  1SRM A;  2B86 A;  1TUC A;  2EVR A;  1AWO A;  2CT4 A;  4A63 B;  1ARK A;  1GL5 A;  1WI7 A;  5GJV B;  2A36 A;  2C0O A;  2QDL A;  1UFF A;  3TSZ A;  1Y57 A;  2V1Q A;  3EHR A;  2DX1 A;  3EG1 A;  1ZSG A;  2MCN A;  3M0T A;  1AWJ A;  2CH4 A;  2JS2 A;  2LP5 A;  1XOV A;  1GFC A;  2E5K A;  2O31 A;  1YWP A;  1BK2 A;  1KSW A;  1WIE A;  3PVQ A;  4OMP A;  1H3H A;  1AWX A;  5I22 A;  1UHF A;  1NEB A;  1ZLM A;  2GBQ A;  4HXJ A;  4IIO A;  1HJD A;  1YN8 A;  1WFW A;  4AFS C;  4DEY A;  1I0C A;  1ABQ A;  2LQN A;  1UUE A;  3VS0 A;  2V1R A;  1T0H A;  4OMO A;  4RTU A;  3VS5 A;  2SRC A;  1K1Z A;  2BZ8 A;  4LNP A;  1G2B A;  2K9G A;  1AVZ C;  3LH5 A;  4F17 A;  2L3P A;  3VS1 A;  3O5Z A;  2I0N A;  2DA9 A;  2EPD A;  4QT7 A;  2JW4 A;  1AEY A;  2AKK A;  1GBQ A;  1NLO C;  3M0S A;  5IH2 A;  1CKA A;  2RF0 A;  1NEG A;  1YNZ A;  2KEA A;  3TSW A;  3THK A;  3H0I A;  1KFZ A;  2KGT A;  2DNU A;  3I5R A;  3NMZ C;  3ULR B;  2DLP A;  4RTT A;  1AZE A;  2C0I A;  5IHI A;  2MIO A;  2F2X A;  1T3S A;  2JMA A;  3NGP A;  1WX6 A;  1M3C A;  2HCK A;  2HBW A;  2P4R A;  4J9E A;  1NM7 A;  4ESR A;  1E6H A;  3U23 A;  1X27 A;  2DYB A;  1M3A A;  1RLQ C;  2RMO A;  3VS2 A;  2FO0 A;  3SHW A;  2J06 A;  2O88 A;  2RQW A;  4J9H A;  1ZUU A;  3EG2 A;  2C0T A;  2VVK A;  2RQV A;  2RQU A;  3UAT A;  2ROL A;  2LQW A;  4ORZ A;  2JM8 A;  2FRW A;  2LNH B;  3R6N A;  2EYX A;  1JO8 A;  2YUQ A;  2GTO A;  4JZ4 A;  2DBK A;  1A0N B;  2RPN A;  1PHT A;  2DL7 A;  2DL4 A;  1J3T A;  2NUZ A;  2DJQ A;  2CRE A;  2A28 A;  2ROT A;  1E7O A;  2W0Z A;  4RTW A;  3UA6 A;  1SHF A;  3A98 A;  1OEB A;  4RUG A;  4AFU C;  1QWE A;  4AFQ C;  4JJB A;  4JZ3 A;  2YUN A;  4AG1 C;  3M0Q A;  4R0K A;  2AK5 A;  1UG1 A;  1NYF A;  2ESW A;  2AKL A;  2F2W A;  4IIM A;  2EQI A;  1H92 A;  1EFN A;  2AZS A;  4J9I A;  4HVW A;  2EGC A;  1WLP B;  2ED1 A;  1VYU A;  3ZL7 C;  2L3S A;  1M27 C;  4CC3 A;  1MV0 B;  1W6X A;  2RNA A;  2YSQ A;  2DRM A;  2H8H A;  2DBM A;  3VS7 A;  1HD3 A;  2JM9 A;  4DEX A;  4LUD A;  4J9F A;  2FEI A;  1JXM A;  1AWW A;  3EGU A;  1T3L A;  4HVV A;  1SPK A;  1PKT A;  1Y0M A;  4X1V A;  2ECZ A;  2M51 A;  2L0A A;  2AZV A;  2BTT A;  1PRL C;  3NHN A;  1K76 A;  5I11 A;  2M0Y A;  1WDX A;  2LCS A;  1B07 A; 
#chains in the Genus database with same CATH topology
 2MF2 A;  3Q1J A;  2GNC A;  1ZBX A;  2VAS A;  3C95 A;  4QW2 A;  2EWN A;  3CXC S;  1IO6 A;  2K6D A;  3KUF A;  1M1G A;  2KYB A;  3LLR A;  4BB7 A;  2L2P A;  3OA6 A;  2L89 A;  3L2V A;  1CKB A;  4RTY A;  4E7J A;  2DZ9 A;  1NJI R;  2OAW A;  1P92 A;  2XG8 D;  3I56 T;  4CC7 A;  2RN8 A;  1PSE A;  4JLG A;  2DTO A;  3LW5 E;  4ME7 A;  2P4T A;  1G83 A;  1JQQ A;  3FRN A;  4A4K A;  3CBM A;  1Q86 R;  1FWZ A;  2DM1 A;  2K3B A;  3CCQ A;  2LJ1 A;  1WHK A;  4EMK A;  1JJ2 A;  1W1F A;  1VQN T;  1VQK A;  2DL8 A;  1VQ5 A;  1MV3 A;  3M59 A;  1Y07 A;  1H8K A;  1I1J A;  2DMO A;  1VQO T;  5GAN g;  5IAY A;  1WA7 A;  1OPK A;  1N5Z A;  2LZ6 B;  1K9A A;  2ZPF B;  3CC7 Q;  2CP3 A;  5L23 A;  1JRI A;  2D9T A;  1TG0 A;  4D8D A;  2CKK A;  5LJ5 f;  1W70 A;  2DO3 A;  4ZTJ A;  4R56 A;  1OU9 A;  2V26 A;  2LJ3 A;  3OMC A;  4OGE A;  2KVQ G;  1M1K R;  4M75 D;  2FRY A;  5CKB A;  2YUP A;  1UGV A;  5GAN 3;  3OS0 A;  4RMO A;  5DY9 A;  1AHJ B;  2F2V A;  1JU5 C;  4BUG A;  4XQ3 A;  2DER A;  2GFA A;  1VQ6 Q;  2ED0 A;  2E41 A;  1ZX6 A;  1S1N A;  4IUU A;  4WF2 A;  5DLO A;  2HEQ A;  2HSP A;  5GMK j;  4M7A G;  1WXB A;  1C1A A;  3RNJ A;  5LJ3 g;  2KRM A;  4PJJ A;  4AFZ C;  1YBY A;  3ER0 A;  3EGD B;  1EIF A;  3CC7 A;  1F1B B;  3GBQ A;  2KBT A;  4JRI A;  2XMF A;  5GAO p;  5C6S A;  1UTI A;  5GAN 4;  3EGD A;  1M9S A;  4LE9 A;  2DIL A;  5CO7 A;  3OYN A;  2DE0 X;  1PCX A;  3RKX A;  3V7S A;  5LJ3 h;  3OY9 A;  3I5S A;  2G3R A;  2CZ1 B;  5CKD A;  3DB3 A;  3MPU B;  1K9M C;  2GCX A;  2XIC A;  1E6G A;  2FZG B;  3CCS A;  1VYT A;  5FRO A;  2V8I A;  5KCH A;  2KI7 A;  2K2M A;  2XK0 A;  1QCN A;  1RI0 A;  1QVF P;  4F04 B;  1IHV A;  3PTA A;  1VQN A;  2J6O A;  1VQ5 T;  1SSH A;  4TVR A;  1JXO A;  2SEM A;  5AT1 B;  4OB2 B;  1W2B A;  1QKX A;  3G6E T;  3JCM J;  3NPF A;  1OV3 A;  3JCM g;  1YIJ A;  3CD6 A;  1PNJ A;  2KT1 A;  3I9Q A;  1SHG A;  2J6F A;  3AT1 B;  6AT1 B;  1Q7Y C;  1G3T A;  2K57 A;  4BD3 A;  4FSS A;  3VS6 A;  1W2B S;  4J9G A;  2EJ9 A;  2VWF A;  3M0U A;  2EQJ A;  3OYA A;  1YJN T;  4HCK A;  4J9D A;  5FRM A;  4E6R A;  2FHD A;  1Z9Q A;  4Z88 A;  1T0J A;  3CCL Q;  3QWY A;  3CBP A;  2MWP A;  4O5V A;  5L8R E;  3BDL A;  1N8R R;  2DJZ A;  1U8R A;  4CC2 A;  2EKO A;  2AIR B;  1AD5 A;  1CSK A;  4JJD A;  3RUX A;  3JB9 H;  1WJR A;  1YHQ Q;  4RTZ A;  1SRM A;  4ZGD B;  5CVI A;  4RCB A;  1AWO A;  1SKU B;  3V7R A;  4EMH A;  1Y71 A;  2QDL A;  1VUB A;  1PM3 A;  2DFU A;  3URG A;  4B9W A;  4BDZ A;  1X6O A;  2COY A;  1O75 A;  2CH4 A;  1KK7 A;  2YXY A;  5FU6 B;  2V8J A;  1BK2 A;  1S72 Q;  4OGC A;  3JCM X;  1QVF A;  4OMP A;  2QQA A;  3CCM A;  1H3H A;  4J6W A;  1UHF A;  2DEQ A;  2MPX C;  4MZM A;  2GBQ A;  5GAN 7;  4IIO A;  4IUV A;  2JJ9 A;  5GAN h;  1HJD A;  3OYC A;  2ZZD A;  2CP7 A;  1YN8 A;  1VIE A;  3EG9 B;  1VQL Q;  3EH1 A;  4C92 C;  2COW A;  4B9X A;  2DAQ A;  4BY6 C;  1T0H A;  4ATO A;  2QAZ A;  2QTX A;  5GAM j;  4L59 A;  4M75 B;  3H6Z A;  1VQ4 Q;  2BZ8 A;  4LNP A;  1OX9 A;  4F17 A;  3CC4 Q;  2RI2 A;  3VS1 A;  3O5Z A;  2RHZ A;  1IGU A;  2DKG A;  5LJ5 g;  3M0S A;  3JCM Q;  3FLG A;  1S72 T;  2M1H A;  5IH2 A;  5KYU B;  2RF0 A;  5GMK i;  2KEA A;  5KYX B;  2IG0 A;  3QO3 A;  1WHL A;  4KT0 E;  3THK A;  5GAM h;  3H0I A;  4JLI A;  4DOV A;  2KGT A;  3I5R A;  1KC8 C;  3OBY A;  2DLP A;  5DM7 R;  3HSB A;  5IHI A;  4QVC A;  4JJN K;  1IXD A;  2F2X A;  1VQP T;  1EZZ B;  1WPY A;  2JMA A;  4MMK A;  3CME Q;  2OTJ A;  3R6O A;  5LJ5 j;  4FCY A;  3NGP A;  4N4H A;  3CCU A;  4ZGJ B;  1OYX A;  1E6H A;  4BAC A;  1M5Q 1;  2JOY A;  2CP6 A;  3E19 A;  1Q81 R;  2DYB A;  4M7A F;  1C0M A;  2QXF A;  2FO0 A;  4MDX A;  5CKE A;  5LJ5 e;  1VQK Q;  3X26 B;  4KGX B;  2PUK B;  1ZUU A;  2RJF A;  2RQU A;  2LTO A;  4DBH A;  1LOJ A;  2FRW A;  3JCM P;  1VQ6 A;  5GAM f;  3A1P A;  1JO8 A;  1IB8 A;  5FRN A;  2I2L A;  4JZ4 A;  3X20 B;  2QQS A;  2L5Q A;  4OF1 A;  4J7F A;  1N27 A;  4C8Q G;  2VGM A;  4NL2 A;  3FIF A;  3LWH A;  1KD1 C;  4M7D G;  2DL7 A;  1WJQ A;  2HAX A;  3PGG A;  3QSU A;  2E3I A;  2ROT A;  3CBO A;  1D0X A;  3UA6 A;  3CCV Q;  3L42 A;  4PLI A;  1SHF A;  2RJE A;  4F7U A;  4J7I A;  4QQD A;  3OS2 A;  2E3H A;  1QWE A;  4OP0 A;  4M77 C;  2YUN A;  4AG1 C;  3CCR T;  1VQM Q;  4M7A B;  1NPR A;  3UWN A;  1VQP A;  2IVW A;  2F2W A;  4IIM A;  1YI2 T;  3F70 A;  3MP6 A;  2RHU A;  1H92 A;  1JJ2 P;  2E10 A;  4X34 A;  2ED1 A;  4HKE A;  4DBR A;  1MMD A;  3OYE A;  4CC3 A;  1MND A;  5AYF A;  2YRD A;  3C12 A;  1M2O A;  5GAM d;  1Q82 C;  3VS7 A;  2XU8 A;  1HD3 A;  4DEX A;  4J9F A;  2RJC A;  1K9M U;  3RKW A;  2JVV A;  3WVD B;  1OQK A;  4O6J A;  4OB0 B;  3JAM E;  3D7S B;  4JRP A;  3NHN A;  3I55 Q;  2EQK A;  2HL5 C;  3PMI A;  4ELZ C;  1RAD B;  1D1C A;  1XJW B;  1UEB A;  3UT1 A;  4XTV A;  1PC0 A;  2VUB A;  2P0K A;  1YP5 A;  2RM4 A;  1D0Z A;  2LNV A;  2EBP A;  3C94 A;  1I8F A;  5GAN 2;  1D3B A;  2YHT A;  5I21 A;  3CCJ A;  4CC4 B;  2KXC A;  3VYG A;  4LD9 K;  2HZY A;  4M75 A;  1Y7X A;  3V8J A;  4PJO C;  1Q95 G;  4HCB A;  2GGR A;  4R55 A;  3CCE A;  1N8R C;  2KAF A;  5KE2 A;  4PJM A;  2D1X A;  2WAC A;  3QZ9 B;  4M78 D;  2NYS A;  1B3Q A;  1HXD A;  3PFS A;  1BI3 A;  5ECA A;  1N9R A;  2JS0 A;  4PNO A;  3RES A;  1WQW A;  1YHQ T;  3VUZ A;  1VQO Q;  2KNB B;  1VQN Q;  5KYW B;  1AZG B;  2ZPI B;  1QW1 A;  5HY6 A;  3G6E A;  1M8M A;  4LDY A;  2EIF A;  1V29 B;  1YWO A;  2JXB A;  2MK5 A;  1X2K A;  2HL3 A;  3CC2 A;  1SRL A;  4F7U G;  1GFD A;  4PFP A;  2DET A;  3QJY A;  1RAE B;  3CQT A;  1V1C A;  2QEX Q;  3KFV A;  2M9U A;  5HCK A;  4PJO G;  2D0N A;  4M77 F;  3NTK A;  4DBF A;  4ZN1 A;  2QAS A;  3HRU A;  4AMC A;  3T9N A;  5LJ5 h;  4M77 A;  1VQ8 T;  4KBM B;  2YDL A;  4J9B A;  1G8X A;  1X43 A;  4XTU A;  2NWM A;  4KUI A;  1GRI A;  3SDZ A;  3VS3 A;  4HCZ A;  4C0G A;  5CAI A;  1NYG A;  4ANJ A;  3PIO A;  2COZ A;  4D8K A;  1SG5 A;  2CH4 W;  3CC4 T;  3CCR A;  3CCL A;  2DTH A;  3E1S A;  1FYN A;  4RTX A;  4Z89 A;  2EQU A;  4N0A C;  3H0H A;  4J8O A;  1Q86 C;  2EGA A;  3A8L B;  3OQ5 A;  2YLB A;  3PT9 A;  2X4W A;  3PE0 A;  4J9C A;  3EG0 A;  4F14 A;  1ZSZ C;  3CD6 Q;  1OPL A;  2NLU A;  3GNF B;  3LGL A;  1SF9 A;  2EGE A;  2Y90 A;  4MZT A;  1K9M R;  2K5I A;  2HKN A;  5LJ5 d;  3TRE A;  1LVK A;  3GNG A;  5FWB A;  4PJO B;  1KIK A;  2MYS A;  2RJD A;  2OI3 A;  2BZX A;  3G71 Q;  3CCV T;  3M9Q A;  2FB7 A;  3M0R A;  2CS7 A;  2QTV A;  4CI0 C;  4PLL A;  4C92 E;  3CMA A;  1VOM A;  1VQ5 Q;  1BU1 A;  3HP9 A;  2ABL A;  3V8L A;  2CUD A;  2ZCF B;  2XID A;  3M0P A;  1ZUK A;  1D1B A;  1Y96 B;  3OYK A;  4GLM A;  2EW3 A;  4HT9 A;  3CPW S;  2KK4 A;  2RHY A;  1D3B B;  2LVM A;  1BI1 A;  4E7Z A;  5GAN j;  1ACM B;  2E6Z A;  1NJI U;  3OS5 A;  4BI3 A;  3M55 A;  4A53 A;  4C5I A;  3JRZ A;  1M2V B;  4GY5 A;  2OJ2 A;  1YFN A;  2RQR A;  2QDY B;  2KRO A;  1KC8 R;  1PRM C;  4DOW A;  3BY7 A;  4II1 A;  3GPL A;  4C8Q C;  1VQ9 Q;  3OYD A;  5KYW A;  1X2Q A;  1X01 A;  2BE7 D;  1UJY A;  2CSI A;  2HBP A;  4PKC C;  1KJW A;  2KQW A;  1GCQ C;  4RTV A;  3SWN B;  2KXD A;  4PJO D;  2O9S A;  1BCO A;  3HPW A;  4XAX B;  2E6N A;  1PG5 B;  1YJ9 Q;  2PVG B;  3E2U A;  1K73 C;  4RCC A;  1KD1 U;  3HRT A;  2FL7 A;  2CT4 A;  4A63 B;  5GJV B;  5GAN e;  5GAM g;  1UFF A;  3TSZ A;  2PVD B;  4J5Y A;  3EG1 A;  1NZ9 A;  2O4X B;  1ZSG A;  3M0T A;  1AWJ A;  4M77 B;  2YRC A;  3SFM A;  2E5K A;  2CZ6 B;  4JS4 A;  3CCU T;  1KSW A;  1YJN A;  2EFI A;  1NEB A;  1ZLM A;  4HXJ A;  1VQL T;  3J7A F;  4AFS C;  2M02 A;  4FYV B;  2YRV A;  2PVO B;  4C92 F;  2LQK A;  1ABQ A;  2LQN A;  3VS0 A;  3QYH B;  2AHJ B;  1ZA2 B;  4FYY B;  4LDW A;  3QDF A;  3UDC A;  1G2B A;  1AVZ C;  3LH5 A;  2P84 A;  2JNG A;  1UGS B;  2QGG A;  3NFC A;  4M77 D;  1UGP B;  3I56 Q;  2ZPH B;  2EPD A;  4XTY A;  4BY6 B;  5M9O A;  2JW4 A;  5KYY B;  3VKI A;  4NS5 A;  3VJP A;  4M78 F;  4FYW B;  3JB9 J;  3X28 B;  1KFZ A;  3NMZ C;  1KQS S;  4RTT A;  3G4S A;  3INZ A;  2C0I A;  3V8K A;  3MEW A;  1T3S A;  1B34 A;  1M90 R;  1RL2 A;  3C4S A;  2MAM A;  5GAO q;  2OTL A;  2XD0 A;  3OSV A;  2ZPE B;  2K2V A;  3DKM A;  2EJF A;  2HBW A;  3ZFJ A;  3L2R A;  1QQJ A;  2WSE E;  5J26 A;  4QQG A;  3CXC P;  2R5A A;  1M3A A;  1RLQ C;  4EMK C;  3SHW A;  2O88 A;  1YIT Q;  2C0T A;  2VGN A;  4M77 E;  2RQV A;  3UAT A;  1VIF A;  2LQW A;  4Q5W A;  2JM8 A;  5A2Q E;  3HHT B;  4M7D D;  1OUL A;  2LNH B;  3HKS A;  2JN0 A;  3R6N A;  1LNX A;  3EFR A;  1W4S A;  5FU6 C;  2E64 A;  2ZGW A;  1Q86 U;  3JCM b;  1K8A C;  2D0Q B;  2DBK A;  4FL6 A;  4CRI A;  5IT9 E;  4MML A;  1A0N B;  3G7Z A;  3RKY A;  2LCL A;  2BUD A;  1K73 R;  2X4J A;  2W0Z A;  1VQM A;  1OEB A;  2RI5 A;  2P0P A;  3QG1 A;  1ZQ1 A;  2KMT A;  4EMK B;  2EAY A;  4LD6 A;  2AK5 A;  1YIJ T;  1KG1 A;  4KH0 B;  4PL6 A;  2E5Q A;  2EGC A;  3G1J A;  3JCM f;  4FW1 A;  1KQ2 A;  2L3S A;  2KDS A;  1M27 C;  1MV0 B;  2NUP B;  3S3O A;  1W6X A;  2RNA A;  2YSQ A;  2H8H A;  4E7L A;  1PSF A;  2NUT A;  2F5T X;  4JS5 A;  3CCQ T;  2O4X A;  3NTH A;  1JXM A;  1AWW A;  1IRE B;  2JZ2 A;  2QQ9 A;  2NUP A;  1T3L A;  4IUQ A;  1PKT A;  2RK2 A;  2M51 A;  3I55 T;  4NL3 A;  2EJG A;  3CCL T;  2XHC A;  5GAO m;  3CEY A;  2M0Y A;  2LCS A;  4HA8 A;  2CGH A;  2O01 E;  2XDB A;  3MKD A;  4OMM A;  1GCQ A;  4JUV A;  1ZHI A;  4IUR A;  1YCY A;  1YJ9 T;  3JB9 D;  2QA4 T;  3OYG A;  3H0F A;  2X51 A;  4LUE A;  5GAM e;  4Y91 A;  2CZ0 B;  2DXB A;  2CUB A;  5IXF A;  4LDU A;  5D7U A;  4BI4 A;  5D6W A;  3M53 A;  2JT4 A;  2KT8 A;  2OAU A;  5FU7 C;  1VQ9 T;  2QGF B;  3OS1 A;  1V76 A;  1WYX A;  1FMW A;  3EG3 A;  3IQL A;  4GBQ A;  3CCU Q;  4FM4 B;  4FU6 A;  4WCI A;  4EMG A;  1YCS B;  3EH2 A;  4BE1 A;  2BKD N;  2YT6 A;  5FLX E;  4C8Q D;  4MZP A;  2R58 A;  3LGF A;  1VQ4 T;  4KH1 B;  1LCK A;  1R8O B;  3LX7 A;  1ZSZ A;  4LDX A;  3I55 A;  3H9N A;  2PU9 B;  4ZNX A;  1OX8 A;  3CPF A;  2A08 A;  1M2V A;  3CC7 T;  4E7I A;  3RDV A;  3FEO A;  2RA2 A;  4M75 G;  3OW2 P;  4VUB A;  1U3O A;  1M4Z A;  1QWF A;  2QYZ A;  2PZ1 A;  1OZ3 A;  4M78 E;  2PTK A;  4M7A E;  2IPO B;  1UHC A;  2MOX A;  1Q81 U;  3ZEH A;  1QVG P;  1TXQ A;  3RMS A;  3AHU A;  1WZO A;  1VQP Q;  3CME T;  4K11 A;  1D0Y A;  3PNW C;  4XTZ A;  2A3L A;  4IUT A;  5FWC A;  2HD0 A;  4IUP A;  1I81 A;  1K0X A;  2DL3 A;  4FYX B;  2JMC A;  5LJ3 e;  1GBR A;  2CP0 A;  4IKF A;  3CCS T;  1UB4 A;  3M4Y A;  1H3Z A;  4C8Q A;  1VYV A;  1U5S A;  1TS9 A;  1WHM A;  2HQH A;  5GAN 6;  4ZTF A;  3MEA A;  5IXB A;  1UDL A;  3CPW A;  1K4U S;  4XU0 A;  1N8R U;  3VYH B;  4KUD K;  4XTX A;  2LCC A;  2IIM A;  3JB9 F;  1BIB A;  4KGZ B;  5GAO r;  2RI3 A;  3VRZ A;  2MMP A;  2O9V A;  4GLK A;  3WVE B;  4OML A;  3KXT A;  1RAA B;  2ATC B;  3DB4 A;  3OBW A;  3BFM A;  2D6F A;  5HK3 A;  2DIG A;  4C0F A;  2K79 A;  2EYY A;  1DJ7 B;  2A37 A;  3RBB B;  3JCM c;  3EFS A;  2KYM A;  3EG9 A;  5FW9 A;  3OW2 S;  2D8J A;  3CCS Q;  3CCE Q;  1YIT T;  2GFU A;  2X35 A;  2F1L A;  3QPH A;  2RB6 A;  4C0D B;  2J6K A;  3BW1 A;  2GQV A;  1YIJ Q;  1TH7 A;  4KUL A;  9ATC B;  1KQS A;  1D1A A;  4AG2 C;  5GMK m;  1G3W A;  1HYO A;  2CP2 A;  3M5A A;  3SB2 A;  2G6F X;  1VQ9 A;  5GAO n;  3P8D A;  1RI9 A;  5FU7 B;  4EIK A;  3UF4 A;  2GTJ A;  5IHN A;  3E9F A;  3QXE B;  1I5O B;  4LDV A;  4F7U E;  3EGX A;  4XTW A;  2E70 A;  3QII A;  2ENM A;  5I2M A;  2CDT A;  2M0O A;  3CCE T;  2QA4 A;  2DVJ A;  1YIT A;  1RLP C;  3QUI A;  2JTE A;  3SD4 A;  2W10 A;  1IHW A;  1JJ2 S;  3CPW P;  4C0Z A;  4FIB A;  4LN2 A;  1MHN A;  1PD1 A;  1UGQ B;  4PFZ A;  3FJP A;  3OYB A;  1VQL A;  2B86 A;  1TUC A;  2AT1 B;  2EVR A;  5KYU A;  1WI7 A;  3QYG B;  3FDR A;  2K3Y A;  1QVF S;  5HK0 A;  2A36 A;  1Y57 A;  2V1Q A;  1OU8 A;  2DX1 A;  2DEU A;  1QP2 A;  3HFN A;  2JS2 A;  5EG2 A;  1XOV A;  1G3S A;  1YJW Q;  2DVE A;  1VQ4 A;  4BDY A;  3MHX A;  1WIE A;  3PVQ A;  1KHC A;  1AWX A;  2QQB A;  3A5Z B;  4J6X A;  1JB0 E;  3KBG A;  5A0D A;  1WFW A;  4DEY A;  1D09 B;  5KYN A;  2A7Y A;  5D6Y A;  1TU0 B;  4M78 G;  1UUE A;  1Q7Y U;  4JRK A;  4OMO A;  1U1S A;  2LX9 A;  3L2Z A;  1KHI A;  2QI2 A;  2SRC A;  2F5K A;  2ZAE A;  3BE3 A;  3RR6 A;  2L3P A;  2DXT A;  3EFO B;  2DA9 A;  3WXM B;  3TCJ A;  4EPC A;  3CC2 Q;  1AEY A;  1NLO C;  2CYZ B;  4M78 C;  1NEG A;  1YNZ A;  4DA4 A;  5LJ3 f;  3TSW A;  3A8O B;  1VQO A;  3EFO A;  4C8Q B;  4M78 A;  4E47 A;  2R5M A;  2DNU A;  3ZBD A;  3P8H A;  2E4H A;  2OTL Q;  3OSS C;  4C92 B;  3JB9 G;  2CZ7 B;  2MIO A;  2OTL T;  4XU2 A;  2QK0 A;  2B8A A;  2VYT A;  1BYM A;  2K4Y A;  2BE9 B;  1VQ6 T;  1NPP A;  2RHI A;  4A4E A;  1X75 C;  1VQ7 Q;  1N9S A;  3A8G B;  1M3C A;  2HCK A;  2HKQ B;  4PJO E;  2KSS A;  4E7S A;  3UPU A;  2P4R A;  4PFO A;  4J9E A;  4ESR A;  1RAI B;  3U23 A;  3V7C A;  5C0M A;  1BCM A;  5LJ3 d;  2RMO A;  3VS2 A;  5HKC A;  4C0D C;  3CC4 A;  3M58 A;  3MP8 A;  1LPL A;  3FC3 A;  2ROL A;  1XNI A;  3S6W A;  4M7A D;  1G5V A;  2LDM A;  3JB9 I;  3LYI A;  3EGX B;  2EYX A;  2YUQ A;  2GTO A;  2XKO C;  1FMV A;  4FSX A;  3J80 E;  5KCO A;  1PHT A;  3QDR B;  1NBE B;  2DL4 A;  1U1T A;  2NUZ A;  3MP1 A;  2VXF A;  1UGR B;  2R57 A;  2OTJ Q;  4RTW A;  1YJN Q;  4M75 F;  2OTJ T;  4BE0 A;  4XU3 A;  2L3R A;  1OZ2 A;  4AFQ C;  4JJB A;  4JZ3 A;  1GXI E;  3M0Q A;  4JDS A;  3CCJ Q;  4R0K A;  3OYI A;  1Q81 C;  1M1F A;  5A0L A;  1NYF A;  3QHS A;  1EFN A;  1WHH A;  2AZS A;  4NOY A;  1WLP B;  3RIR A;  1Q82 R;  1VYU A;  2YWW A;  5GAN 8;  1OI1 A;  3OYF A;  1C6V X;  3M4G A;  2WSF E;  2KY9 A;  4UC4 A;  4N0A A;  2ZPB B;  2JM9 A;  4LUD A;  2FEI A;  3VU3 C;  2EQM A;  3JCM h;  2Z0W A;  4M75 E;  5GAN 5;  3ME9 A;  1Y0M A;  5GAO l;  4X1V A;  2ECZ A;  4Y28 E;  5DLQ E;  1RAH B;  2BTT A;  3OW2 A;  4Z02 A;  4PK4 A;  2WSC E;  2HQE A;  1BBZ A;  2FVU A;  2CSQ A;  1X69 A;  2PNI A;  2QQR A;  3SWN C;  4M4Z A;  2QA4 Q;  2D8H A;  3TEE A;  2KR3 A;  4C5E A;  5GAN d;  4F7U B;  1K73 U;  3QBY A;  3JCM e;  1G3Y A;  4B6M A;  3JCM W;  4M78 B;  1I07 A;  3FJ5 A;  1YJW T;  3L2W A;  4X9C A;  1WNL A;  3QWX X;  4OB3 B;  1QVP A;  1VA7 A;  4KRT A;  1QVG S;  5A0G A;  2LJ0 A;  2X3X D;  4OMN A;  1XTD A;  2DRK A;  4A4H A;  4RG2 A;  3JCM d;  3GP8 A;  4OMQ A;  1RAC B;  3CME A;  2VKN A;  4L6V 5;  1MMA A;  1FXX A;  4M77 G;  4OMF B;  1VQ8 Q;  3TVT A;  2LC4 A;  2VC8 A;  2H3E B;  1Q82 U;  2EYZ A;  3VRY A;  1MMN A;  3LWI A;  2FPE A;  3NTI A;  8ATC B;  4JRQ A;  1NE8 A;  1WGS A;  1BIA A;  1NLP C;  2J7I A;  3QZ5 B;  4A4G A;  1KD1 R;  2HDA A;  1HSQ A;  5LL6 S;  2E12 A;  5KYY A;  3CCM T;  4C8Q E;  5CIU A;  2K7A A;  1IZ6 A;  1K0S A;  2E65 A;  4Z8A A;  1BB9 A;  1PKS A;  4HT8 A;  1WXU A;  1M1K C;  2DPP B;  3EHQ A;  1FMK A;  3CC2 T;  4FT2 A;  4EDU A;  5CKF A;  4BI8 B;  2FPF A;  2XI9 A;  1WXT A;  3REB B;  2PUO B;  1OOT A;  2YLC A;  3UA7 A;  3S3M A;  4D6W A;  2QEX T;  1GCP A;  1B34 B;  2RQT A;  2VXE A;  3HTR A;  1JEG A;  1ZUY A;  2K5L A;  2O2O A;  2M16 A;  3OYH A;  1KC8 U;  2F69 A;  4HVU A;  1FX7 A;  3I35 A;  4P5N A;  5KYX A;  1SSF A;  4Y92 A;  1MNE A;  2GQI A;  1TUG B;  5GAN f;  2CT3 A;  5CQY A;  1ZSZ B;  1QP3 A;  3I56 A;  3G4S T;  1S72 A;  2DTI A;  3A8H B;  3CCM Q;  3S3N A;  4V2S A;  1BKB A;  1UE9 A;  3ASK A;  1M30 A;  3DLL A;  2XDD A;  2X3W D;  2QEX A;  2LQ8 A;  3MJX A;  5IHK A;  2A0F B;  3H41 A;  4M7A C;  4L5G A;  2FG0 A;  2LX7 A;  2BZY A;  3HFO A;  3TQ7 P;  3X25 B;  4M7D E;  1WQ7 A;  4J6Y A;  4FT4 A;  2FPD A;  2LRQ A;  4JJC A;  2DZC A;  3G6E Q;  3L2U A;  2FZK B;  4KGV B;  1ABO A;  2C06 A;  3VUB A;  1UJ0 A;  2EYQ A;  3VS4 A;  3GIB A;  3O8V A;  3SWN A;  3MEV A;  4JPB W;  1YJW A;  2HSE B;  3CCV A;  2H3J A;  1LJO A;  3G4S Q;  3JV3 A;  4OB1 B;  3MO8 A;  1SEM A;  1W2B P;  2OX7 A;  2XDP A;  3L2Q A;  3REA B;  2LMJ A;  1AOJ A;  3PVL A;  5CCA A;  4FW2 A;  2K5F A;  1R77 A;  1TUD A;  2JTF A;  2YUO A;  2DK3 A;  1X6G A;  3A8M B;  3SEM A;  1YHQ A;  1YJ9 A;  2HNI A;  1QKW A;  2KRN A;  1YI2 Q;  2HMA A;  1Q7Y R;  3RER A;  1Z9Z A;  2L3Q A;  2RH2 A;  2KE9 A;  4C92 A;  5J39 A;  5CR2 A;  4M7D A;  4AT1 B;  1U06 A;  3GF5 A;  3EAE A;  2J05 A;  4C92 G;  1M3B A;  3LH0 A;  8AT1 B;  2EYW A;  4M7D F;  5I2S A;  1RUW A;  2MWO A;  4OVA A;  4ZGE B;  3BDU A;  3MCA B;  3QKJ A;  4C8Q F;  4M7D B;  1ZBJ A;  1KQS P;  1M90 U;  1EX4 A;  1PWT A;  3GOX A;  4DBQ A;  1VQ7 A;  5GJW B;  4F16 A;  5D6X A;  1UEC A;  1QCF A;  1ZA1 B;  2DXC A;  2DL5 A;  2DXU A;  2LT4 A;  2RO0 A;  1QLY A;  3M56 A;  1VQ8 A;  1MUZ A;  2DF6 A;  2KRS A;  2EKH A;  1WHG A;  3C0C A;  1KQ1 A;  3CXC A;  5EC7 A;  1NG2 A;  1MGQ A;  1N6A A;  1X6B A;  1IRX A;  2Y4Y A;  3CMA Q;  4MDW A;  2DIQ A;  4J83 A;  3H8Z A;  1GL5 A;  1ARK A;  2C0O A;  5CK9 A;  3EHR A;  2MCN A;  3J81 E;  2FZC B;  2CP5 A;  2LP5 A;  5GMK e;  1GFC A;  1Y96 A;  4QQ6 A;  1H64 1;  2O31 A;  1YWP A;  1I5L A;  2K3X A;  3OB9 A;  3HRS A;  1B7T A;  3HL8 A;  5I22 A;  1PD0 A;  1IGQ A;  3OYM A;  1I0C A;  3OYY A;  4RG8 A;  2V1R A;  4YTL A;  3E9G A;  4RTU A;  3VS5 A;  2Y4X A;  1MMG A;  1K1Z A;  2L8D A;  3GLX A;  5KE3 A;  3L1A A;  3JCM V;  1K8A R;  2K9G A;  3OYJ A;  2PQW A;  1K8A U;  2VB6 A;  3RMQ A;  2I0N A;  2RHX A;  4QT7 A;  5KH6 A;  2FYK A;  2VV5 A;  2AKK A;  1GBQ A;  1VQK T;  1CKA A;  3FB9 A;  4E7H A;  2MI6 A;  4QVZ A;  1TTH B;  3ULR B;  2E1H A;  3CD6 T;  3X24 B;  1AZE A;  2DYI A;  1TOV A;  4RKU E;  3PMT A;  3M57 A;  5GMK l;  1WX6 A;  4C92 D;  1VQ7 T;  2QG9 B;  3JSC A;  1M8V A;  1NM7 A;  4M7D C;  1M1K U;  1X27 A;  1BI0 A;  4DQ2 A;  4N4I A;  2ZPG B;  1I4K 1;  1HK9 A;  2DD5 A;  2J06 A;  1TSF A;  2RQW A;  4J9H A;  3EG2 A;  2NUT B;  2VVK A;  1YI2 A;  4M7A A;  2BIV A;  1QVG A;  5GMK h;  4C5H A;  2JTM A;  4E2F B;  4ORZ A;  4E7K A;  3P8B B;  3PIP A;  4QVD A;  2P0Q A;  1O9S A;  4PJN A;  2X9H A;  1BI2 A;  5CKH A;  1QCO A;  2V8K A;  1M90 C;  1R0C B;  2GF7 A;  2RPN A;  2X4X A;  4PJL A;  1WHJ A;  1J3T A;  3M54 A;  2DJQ A;  2CRE A;  4PJO F;  2A28 A;  1E7O A;  3G71 T;  4M75 C;  4XK8 E;  5LJ3 j;  4WTO B;  3A98 A;  3VV0 A;  4RUG A;  4AFU C;  4PJO A;  4C5G A;  3CCR Q;  1VQM T;  2DD4 A;  3OYL A;  1AT1 B;  5J3B A;  1JBM A;  4F7U F;  1UG1 A;  3QJ6 A;  3CCJ T;  1QMC A;  2ESW A;  2AKL A;  5IN1 A;  2EQI A;  2RD1 A;  4J9I A;  4HVW A;  3CMA T;  1R0B G;  3ZL7 C;  1WJS A;  2JUF A;  1NJI C;  3TU4 K;  2HQX A;  4LXC A;  4X9D A;  3G71 A;  2DRM A;  4N4G A;  3N5B B;  1RAB B;  4A54 A;  2RK1 A;  4ELY C;  3OMG A;  4QKU A;  2DBM A;  2LT1 A;  4BE2 A;  5CQX A;  3MET A;  3EGU A;  3MEU A;  3CCQ Q;  4XU1 A;  4ZN3 A;  4HVV A;  1SPK A;  3DLM A;  7AT1 B;  2L0A A;  2AZV A;  1RAF B;  1RAG B;  1PRL C;  1XQH A;  5I11 A;  1K76 A;  2X4Y A;  4HCC A;  1WDX A;  4A4F A;  1B07 A;  1TWB A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  1YP5 A;  2CSQ A;  1X69 A;  4OMM A;  2PNI A;  2GNC A;  2EBP A;  1GCQ A;  4M4Z A;  2D8H A;  1IO6 A;  2K6D A;  2KR3 A;  4CC4 B;  2KXC A;  2KYB A;  2L2P A;  3H0F A;  4LUE A;  1CKB A;  4RTY A;  1I07 A;  3FJ5 A;  2GGR A;  2CUB A;  2OAW A;  5IXF A;  3QWX X;  2JT4 A;  2KT8 A;  2RN8 A;  4CC7 A;  2D1X A;  1VA7 A;  4KRT A;  1WYX A;  2LJ0 A;  2X3X D;  4OMN A;  1G83 A;  3EG3 A;  3IQL A;  4GBQ A;  1JQQ A;  1B3Q A;  2DRK A;  2DM1 A;  4WCI A;  2K3B A;  4OMQ A;  5ECA A;  2VKN A;  2LJ1 A;  2JS0 A;  1W1F A;  3TVT A;  1YCS B;  2EYZ A;  3VRY A;  2DL8 A;  2FPE A;  2YT6 A;  1MV3 A;  2KNB B;  1AZG B;  1H8K A;  1I1J A;  1NLP C;  1M8M A;  2DMO A;  2J7I A;  1LCK A;  1YWO A;  2HDA A;  1HSQ A;  2JXB A;  1WA7 A;  1OPK A;  1N5Z A;  2K7A A;  2LZ6 B;  1X2K A;  1K9A A;  1K0S A;  4ZNX A;  4Z8A A;  1BB9 A;  1SRL A;  1PKS A;  5L23 A;  1GFD A;  1WXU A;  2A08 A;  1TG0 A;  3EHQ A;  1FMK A;  4D8D A;  1W70 A;  2FPF A;  3CQT A;  1V1C A;  1WXT A;  3REB B;  1OOT A;  3KFV A;  5HCK A;  3UA7 A;  1U3O A;  1GCP A;  1QWF A;  2D0N A;  2RQT A;  2LJ3 A;  2PZ1 A;  1ZUY A;  2O2O A;  1JEG A;  2PTK A;  4HVU A;  2YDL A;  4J9B A;  3I35 A;  2FRY A;  2YUP A;  1UGV A;  1UHC A;  2MOX A;  1X43 A;  2NWM A;  1GRI A;  4Y92 A;  2GQI A;  2F2V A;  2CT3 A;  1JU5 C;  4K11 A;  3VS3 A;  1NYG A;  2ED0 A;  4D8K A;  1ZX6 A;  1S1N A;  2CH4 W;  1UE9 A;  5FWC A;  2HEQ A;  1M30 A;  1K0X A;  2DL3 A;  2HSP A;  2X3W D;  2JMC A;  1FYN A;  4RTX A;  1WXB A;  5IHK A;  3RNJ A;  1GBR A;  3H41 A;  4Z89 A;  2FG0 A;  3H0H A;  2KRM A;  2LX7 A;  2BZY A;  4AFZ C;  2EGA A;  1VYV A;  3GBQ A;  1U5S A;  2FPD A;  2KBT A;  2XMF A;  4JJC A;  3PE0 A;  4J9C A;  3EG0 A;  5IXB A;  1UDL A;  1UTI A;  4F14 A;  1OPL A;  1K4U S;  2EGE A;  4LE9 A;  1ABO A;  1UJ0 A;  2DIL A;  3VS4 A;  2IIM A;  2DE0 X;  4JPB W;  3I5S A;  3VRZ A;  5FWB A;  1KIK A;  2O9V A;  2OI3 A;  2BZX A;  3JV3 A;  4OML A;  1E6G A;  1SEM A;  1VYT A;  3M0R A;  3REA B;  2K79 A;  2LMJ A;  1AOJ A;  2EYY A;  3PVL A;  2K2M A;  2A37 A;  3RBB B;  1TUD A;  2KYM A;  2YUO A;  5FW9 A;  2D8J A;  1X6G A;  1BU1 A;  2ABL A;  3SEM A;  2CUD A;  3M0P A;  2J6K A;  1ZUK A;  2J6O A;  1SSH A;  1QKW A;  1JXO A;  2SEM A;  2KRN A;  4GLM A;  2EW3 A;  1QKX A;  3NPF A;  1Z9Z A;  1OV3 A;  2L3Q A;  4AG2 C;  2KE9 A;  1U06 A;  1PNJ A;  2KT1 A;  2J05 A;  3I9Q A;  1SHG A;  2J6F A;  2G6F X;  1M3B A;  4FSS A;  2EYW A;  2OJ2 A;  3VS6 A;  1RI9 A;  4EIK A;  2RQR A;  3UF4 A;  1RUW A;  2GTJ A;  2KRO A;  5IHN A;  1PRM C;  4J9G A;  2VWF A;  3M0U A;  1ZBJ A;  1X2Q A;  1PWT A;  4HCK A;  4J9D A;  5GJW B;  4F16 A;  1UJY A;  4E6R A;  2CSI A;  1UEC A;  1Z9Q A;  1QCF A;  2ENM A;  4Z88 A;  1T0J A;  2DL5 A;  1KJW A;  1QLY A;  2CDT A;  1MUZ A;  2DF6 A;  2KRS A;  1GCQ C;  3QWY A;  2EKH A;  4RTV A;  2DVJ A;  3C0C A;  2KXD A;  1RLP C;  2O9S A;  2JTE A;  4CC2 A;  5EC7 A;  1NG2 A;  1AD5 A;  2W10 A;  1X6B A;  1CSK A;  4JJD A;  4LN2 A;  4RTZ A;  1SRM A;  2B86 A;  1TUC A;  2EVR A;  1AWO A;  2CT4 A;  4A63 B;  1ARK A;  1GL5 A;  1WI7 A;  5GJV B;  2A36 A;  2C0O A;  2QDL A;  1UFF A;  3TSZ A;  1Y57 A;  2V1Q A;  3EHR A;  2DX1 A;  3EG1 A;  1ZSG A;  2MCN A;  3M0T A;  1AWJ A;  2CH4 A;  2JS2 A;  2LP5 A;  1XOV A;  1GFC A;  2E5K A;  2O31 A;  1YWP A;  1BK2 A;  1KSW A;  1WIE A;  3PVQ A;  4OMP A;  1H3H A;  1AWX A;  5I22 A;  1UHF A;  1NEB A;  1ZLM A;  2GBQ A;  4HXJ A;  4IIO A;  1HJD A;  1YN8 A;  1WFW A;  4AFS C;  4DEY A;  1I0C A;  1ABQ A;  2LQN A;  1UUE A;  3VS0 A;  2V1R A;  1T0H A;  4OMO A;  4RTU A;  3VS5 A;  2SRC A;  1K1Z A;  2BZ8 A;  4LNP A;  1G2B A;  2K9G A;  1AVZ C;  3LH5 A;  4F17 A;  2L3P A;  3VS1 A;  3O5Z A;  2I0N A;  2DA9 A;  2EPD A;  4QT7 A;  2JW4 A;  1AEY A;  2AKK A;  1GBQ A;  1NLO C;  3M0S A;  5IH2 A;  1CKA A;  2RF0 A;  1NEG A;  1YNZ A;  2KEA A;  3TSW A;  3THK A;  3H0I A;  1KFZ A;  2KGT A;  2DNU A;  3I5R A;  3NMZ C;  3ULR B;  2DLP A;  4RTT A;  1AZE A;  2C0I A;  5IHI A;  2MIO A;  2F2X A;  1T3S A;  2JMA A;  3NGP A;  1WX6 A;  1M3C A;  2HCK A;  2HBW A;  2P4R A;  4J9E A;  1NM7 A;  4ESR A;  1E6H A;  3U23 A;  1X27 A;  2DYB A;  1M3A A;  1RLQ C;  2RMO A;  3VS2 A;  2FO0 A;  3SHW A;  2J06 A;  2O88 A;  2RQW A;  4J9H A;  1ZUU A;  3EG2 A;  2C0T A;  2VVK A;  2RQV A;  2RQU A;  3UAT A;  2ROL A;  2LQW A;  4ORZ A;  2JM8 A;  2FRW A;  2LNH B;  3R6N A;  2EYX A;  1JO8 A;  2YUQ A;  2GTO A;  4JZ4 A;  2DBK A;  1A0N B;  2RPN A;  1PHT A;  2DL7 A;  2DL4 A;  1J3T A;  2NUZ A;  2DJQ A;  2CRE A;  2A28 A;  2ROT A;  1E7O A;  2W0Z A;  4RTW A;  3UA6 A;  1SHF A;  3A98 A;  1OEB A;  4RUG A;  4AFU C;  1QWE A;  4AFQ C;  4JJB A;  4JZ3 A;  2YUN A;  4AG1 C;  3M0Q A;  4R0K A;  2AK5 A;  1UG1 A;  1NYF A;  2ESW A;  2AKL A;  2F2W A;  4IIM A;  2EQI A;  1H92 A;  1EFN A;  2AZS A;  4J9I A;  4HVW A;  2EGC A;  1WLP B;  2ED1 A;  1VYU A;  3ZL7 C;  2L3S A;  1M27 C;  4CC3 A;  1MV0 B;  1W6X A;  2RNA A;  2YSQ A;  2DRM A;  2H8H A;  2DBM A;  3VS7 A;  1HD3 A;  2JM9 A;  4DEX A;  4LUD A;  4J9F A;  2FEI A;  1JXM A;  1AWW A;  3EGU A;  1T3L A;  4HVV A;  1SPK A;  1PKT A;  1Y0M A;  4X1V A;  2ECZ A;  2M51 A;  2L0A A;  2AZV A;  2BTT A;  1PRL C;  3NHN A;  1K76 A;  5I11 A;  2M0Y A;  1WDX A;  2LCS A;  1B07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...