2C0LA

Tpr domain of human pex5p in complex with human mscp2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
292
Chain Sequence
HPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/receptor
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 116
structure length 292
sequence length 305
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0lA00
5BW8C 4GA2A 3OXLA 4UQYA 3RKVA 4BT9A 1QQEA 2AVPA 5DIZA 3UPVA 5CCLA 3NF1A 2C2LA 2YQ8A 3RO2A 5DBKA 3TG4A 3CEQA 3VTXA 2IF4A 2YHCA 2VYIA 3MV2B 4U04A 2XPIA 3ZGQA 3BEEA 3LY9A 2C0MA 4WNDA 1Y8MA 3MEKA 4ABNA 3TGOA 2VSYA 4LEUA 2IFUA 3CVNA 4EQFA 3AS5A 3ZPJA 5FTPA 3S7DA 1QZ2A 3MA5A 4HOQA 4I1AA 4I9EA 5FJYA 2R5SA 3SF4A 3SZ7A 2XCBA 5C1DA 2VGXA 5BT1A 5FZQA 4RG6A 1HH8A 3QKYA 3CV0A 4N3CA 5JJ6A 2C0LA 2VGYA 5ARGA 5BNWA 5AYWD 4I2WA 2VGXB 4IN3B 5HQ8A 4U07A 2KCKA 4GYYA 3Q47B 1KT0A 1YA0A 4GZ3A 4H7YA 3VTYA 2FI7A 3CK8A 2JLBA 2VSNA 1KLXA 2Y4UA 4GZ5A 4NQ0A 4Y6WA 2XEVA 3N71A 3ZN3A 3LKUA 1ZBPA 4AM9A 4UI9K 2L6JA 4XIFA 3KS2A 3LPZA 4GCOA 5FZRA 3Q15A 4N3AA 3TG5A 2KCLA 4UQXA 2FEZA 1OUVA 3OXGA 2UWJG 3Q49B 5G04J 5JJTA 1ZU2A 5LCWC 4GZ6A 1IYGA 4WNEA 4KBQA 3O48A 2KCVA 4BTBA 3IEGA 3JYSA 2VQ2A 3WXXA 3QWWA 1WM5A 5D0OD 1XNFA 2QFCA 3RO3A 5LCWJ 5HI7A 3OXFA 4XI0A 4APOA 3S7FA 3ZHEB 3MV3B 4N5CA 5D0QD 4G23A 4GPKA 1WAO1 4A1SA 2E2EA 1P5QA 2FF4A 1ELWA 3CK7A 3UUXA 5KJNA 2HR2A 1HXIA 3URZA 4GA0A 4J8FA 4B94A 4J8EA 4CGVA 3ASFA 1E96B 2J9QA 4KYOB 4UI9J 2XGSA 3U4TA 5KJLA 1NA3A 2PL2A 3CKBA 3CVQA 3LY7A 4AIFA 4F3VA 3PE3A 2LSVA 3RJVA 5ARFA 2FBNA 3CK9A 4HOTA 3FWVA 2PZIA 2NC9A 3CKCA 1W3BA 4G1TA 4GYOA 1KT1A 4I2ZA 4KXKB 3EDTB 4Y6CA 4YVQC 4CDRA 1IHGA 3K9IA 4HOUA 2KATA 4U0SA 4BT8A 3U3WA 1HZ4A 1PC2A 3CVLA 3GW4A 3QDNA 4U0ZA 4WUYA 3QWVA 3Q5MA 2FO7A 4G25A 4G24A 5CHEE 1NA0A 3Q4AB 1NZNA 3PDNA 2HO1A 4I9CA 3ZFWA 4GYWA 2HYZA 5KJKA 4J0UA 1A17A 2I6HA 3HYMB 3LYAA 5A6CA 4JA7A 3CVPA 3LY8A 3GZ2A 2LNIA 2WQHA 4G2VA 3E4BA 4ME2A 4UQZA 4UI9C 5A7DB 4BTAA 5KJMA 2Y4TA 3R9AB 3GZ1A 4WNGA 5G04C 4N3BA 3UQ3A 2PQRA 2V5FA 3ASDA 3FFLA 3FP3A 3GYZA 4H7XA 5FT9A 4HOSA 3KAEA 4N2QA 2DBAA 2ONDA 3PE4A 2LSUA 3MKRA 5M72A 5EKQD 5G05C 4U0UA 3LCAA 4YVOA 4O6FA 2XGMA 4RG9A 4JA9A 4N39A 5CCMA 4HORA 3QWPA 2WPVA 4CGWA 2KC7A 3AS8A 3RIBA 3RU0A 4G26A 5JJ7A 3QOUA 2UY1A 2Q7FA 2BUGA 4AY6A 3AS4A 1B89A 4W9RA 2OOEA 3ESKA 1FCHA 4JHRA 3ASGA 4XI9A 5EX0A 3S7JA 2PQNA 5FZSA 4N2SA 2UY1B 3ULQA 4AY5A 4BWRA 3KD7A 4GCNA 4J8DA 4NRHB 3TAXA 5EX3A 2MHKA 2XGOA 4JL0A 4WNFA 4YNDA 3S7BA 4GA1A 3ZHEA 2XCCA 3ASHA 2P58C 4I17A 2GW1A 1ELRA 1TJCA 5G05J
chains in the Genus database with same CATH superfamily
3RKVA 5DIZA 4F1SA 3EHQA 3DWLG 4U04A 3BEEA 4WNDA 1Y8MA 2WXPA 3TWVA 3UM3A 2J49A 2OEWA 5AQBA 4YDWA 1EPUA 4GTMA 2ZU6B 4DPRA 2HE0A 2J4DA 3CK8A 3N71A 1N0QA 2L6JA 4EZJA 5BUZA 4WWNA 1AWCB 4OAUC 3JCKC 4GTVA 2A5UA 3FUNA 1DCEA 4NACA 1H6KA 3PEVB 5T3RA 4I6JA 3RK6A 4U8HA 2CHWA 2WXJA 2H6FA 1DCQA 4J6IA 4TV3A 4Q96A 3PZ4A 3FY4A 4FHKA 3C72A 1SQMA 2QY7A 4C0EA 3CVLA 4G11A 3C98A 2HO1A 5BXOA 1EF1C 2I6HA 3HYMB 3J5PA 1E8WA 2QZAA 3FP3A 3ZUVB 1TJFA 4B93B 1S64A 3D9KA 3RU0A 2UY1A 2VSOE 5B3SE 3B7TA 1OY3D 3L54A 4BWRA 3AJIA 4BT9A 4UQYA 1BU9A 2ZGGA 3CEQA 2H6IA 3R9MA 3EHNA 3ML8A 1S63A 4RG6A 2C0LA 2VGYA 3L6AA 4RSYA 3LEWA 2IJGX 4A1GA 4E85A 1OCZE 2Y4UA 4NQ0A 2YINA 4U63A 3PZ1A 5AIJA 4MS6A 2VJ8A 5JHAA 3ZYKA 3DSXA 3LJ3A 2VQ2A 2L0TB 3AG2E 4L9PA 2EINE 1L5JA 1OCCE 1BI8B 1N4PA 4L23A 4UWKA 3FTUA 3AG1E 3FWVA 2IO3C 4L2LA 1KPSB 3JQ0A 3D3MA 2WXHA 1TN8A 4WUYA 4FLHA 2FO1E 1QYMA 4GTOA 1TN7A 2CG3A 2NXPA 3D9PA 3QC1A 2PQRA 4OVUA 5B1AE 3PE4A 4L7TA 2H6GA 3LCAA 1RZ4A 1DC2A 3RIBA 5EILA 1HS6A 4CYMD 2UY1B 3KD7A 3HDXA 4NRHB 4CRWA 1OWNA 4AEZC 4DJAA 2P58C 3HXEA 1JWGA 2GGFA 1WDYA 4GA2A 3UPVA 2C2LA 1MZCA 2VYIA 4EECA 1E8ZA 3FH8A 4D10C 5BT1A 4M7CA 3OAWA 3W9FA 4BETA 4B0ZA 2KCKA 3Q47B 1YA0A 3DPDA 3MX3A 3Q15A 3RAUA 2FEZA 3UM2A 2AXZA 3C3OA 3UIOC 4HVBA 3UM1A 2DYRE 2A4ZA 2A5EA 3UI2A 2I1KA 3MV3B 4XX5A 4G23A 1WAO1 4TRQA 3IBEA 4ANUA 2R17C 3UUXA 3G2UA 2PL2A 3PNTB 3PS6A 2X6FA 4KXKB 3TJPA 4DLQA 3E32A 3FTWA 3GW4A 4I9CA 1WY6A 4GYWA 4U95D 5ENPD 4RLYA 1QNFA 3TXMA 1N4QA 5FQ4A 4H7XA 4JEUA 1UOHA 5A23A 5ENOD 2WXLA 1V55E 4LRZA 3CSFA 1UW4B 4PS7A 2WPVA 3AS8A 4J8YA 3CSTA 3Q9UC 3ASNE 1MYOA 3UT4A 2WQ7A 3S7BA 3WG7E 3FEYA 1ELKA 3ASHA 3HG0D 3FUJA 3TG4A 4J7WA 4UWFA 4DX7D 3FH5A 4O1OA 3MEKA 2IO2C 4HS2A 2VSXE 4X8QA 5AYWD 4I2WA 5KNHD 4BX8A 5LX8A 3Q73A 4DX2A 3LKUA 4UI9K 4V3IA 4GCOA 5FZRA 4DLOA 3OTNA 4TXRA 4DRXE 5G04J 1ZU2A 2IQCA 2IOSA 3ZU7B 3D9IA 3APCA 4DI3A 4K03A 2ILRA 3SI5A 5KJLA 1NA3A 3CKBA 4HOTA 5CEAA 1IHGA 3K9IA 3NZSA 3Q9NC 3L22A 4XKCA 3FUFA 5EYPF 4J0UA 1INZA 2F37A 2IOLA 4HRMB 2WXQA 4LNGA 3GZ1A 5G04C 3GYZA 1X5BA 3QWPA 5ANRA 3G2SA 3TWRA 4W9RA 1BLXB 4F1PA 3CIAA 1TNBA 2CG2A 4U7EB 5AENA 5G05J 3D9OA 2V4LA 1QQEA 5CBNA 2LXLA 4AVXA 4U8VD 1OXJA 3CQCB 3T9KA 3LVQE 4HBDA 4I6GA 3DEPA 2XENA 4A3VA 3FTVA 3T8KA 2FI7A 5AAOA 2JLBA 2VSNA 3ULYA 3DSWA 5CMYA 2BTDA 3Q49B 4N5QA 4GZ6A 4Q69A 3PZDA 2ZISA 4EHMA 2J09A 3RRNB 5D0QD 3NAWA 4EBAA 2BKKB 2F0YA 2HR2A 4PS8A 4HB5A 4J8EA 3U4TA 5LFAA 4F3VA 3PE3A 3LJNA 2KBXA 4ILIA 3CKCA 2BKGA 5KWDA 4A63B 2L0IA 3U64A 1HU3A 2F8YA 2WVIA 4U8YD 3E37A 3ZFWA 2V4HC 3FTXA 1X81A 5KJMA 4PDXA 3R9AB 3BU8A 5CBOA 1IKND 3KAEA 2DBAA 4HQDA 5BV0A 1YYHA 3ML9A 4G26A 1TNYA 3UTMA 4HLEA 3Q75A 3QARA 4ANWA 3E34A 3SBTB 1H6OA 5KNGA 2GW1A 2XPYA 3MJWA 2AVPA 2EIME 3UT8A 3SD5A 3ZGQA 2VSYA 1EYHA 3TWWA 4OVVA 5FJYA 2R5SA 3FUIA 4ILHB 3RRMB 3ENEA 4FHJA 3DBSA 1E8XA 2X38A 1KZPA 1FVHA 4N3AA 4DX5D 3SHFA 4KBQA 3ZRHA 3WXXA 1WM5A 4GTSA 1VDYA 3JUEA 3HRAA 5E76A 1N54A 1E8YA 2R05A 2Y1LE 4P29A 3NBNB 3I4RB 4KVOA 3EU9A 3UT7A 5EIBE 3FU3A 4MBGA 4YDOA 3D9MA 5KJKA 4BX9A 3CHQA 3LYAA 3F6QA 4UI9C 5ENNA 4ANXA 2WXIA 3ASDA 3FFLA 4EZLA 3RSEG 3ZEFA 4AV7A 4F7AA 4BERA 4HI9A 3PEUB 3ESKA 4XI9A 2P9UG 3ASGA 3ONKA 2R03A 4GCNA 4A3TA 4AP2A 3JQ1A 2XCCA 4I17A 2OCCE 2WXRA 2XS1A 5HS0A 2XRYA 4APFA 4B8CB 2P9NG 3FU6A 3APDA 3MCXA 2WXNA 2GROB 4I1AA 1O1SA 2VTBB 3C3RA 1K8KG 4EBAG 5BXUA 3TWSA 3B95A 3PUJA 2MOWA 3HXDA 5CRVA 5JJTA 2ZIRA 3FH7A 5G2NA 3IEGA 3QWWA 1HG2A 5HI7A 3ZYLA 5AJLA 2GRLA 4N5CA 1N95A 2MYOA 4B94A 3LDZA 1LF8A 1S0PA 3FTYA 4AIFA 2YNQA 4YDEA 4G1TA 2CHXA 5B1BE 3JUIA 3CHPA 4IULA 2IONA 3AG3E 3KSQA 3FUMA 1BD8A 3GZ2A 3PZ2A 2DIWA 4TUMA 4K5BA 4KT6B 2B0OE 3BUAA 3MKRA 4DK5A 5EKQD 4RG9A 1IQUA 1GW6A 3SFXA 3QOUA 3MYVA 4AJWA 4CEMA 3FUEA 3DSVA 2EQXA 4KMOA 1SA5A 4GMRA 2GRQB 1D8DA 2B6CA 1ELRA 1OWPA 3SY2A 4C0MA 4FP7A 4HOQA 1HH8A 1MQSA 5LP0A 1H2TC 5ARGA 4HORA 3CGHA 4GZ5A 5KJNA 3EIJA 4HXIA 3LS8A 2Y3AA 4C48B 4WNEA 5EDSA 2DCPA 4APOA 3CHMA 3PVLA 4HNAD 3V2OA 1P5QA 2HM8A 1TNOA 4R7LA 1XGWA 1E96B 2J9QA 2WB2A 1H0AA 3O4ZA 3NOGD 2AJAA 4CDRA 4LNBA 1OCRE 2WXMA 3I5PA 5AN8A 2XZTG 3S2AA 4HLLA 3PDNA 4GTRA 1TNUA 3GZSA 3NQPA 2WMOA 3E4BA 4CDNA 4BTAA 4O1PA 2IEJA 2M63A 2I9CA 4DX1A 5FT9A 4GTPA 4HOSA 5M72A 2LSUA 3HXFA 4JW1A 4FJYA 2JEKA 4QFVA 2KC7A 3TL5A 1TEZA 2CHZA 4RQIA 1TN6A 3ULQA 4AY5A 4M3OA 1JCSA 4G8LA 3TAXA 4C9BB 5CECB 4ANVA 4MLPA 1DVPA 1JCQA 3ZIMA 1NP7A 5BPPA 4L2YA 1U3CA 1QZ2A 3ZYMA 2CFUA 3SF4A 3T8MA 1MX4A 4N3CA 3G2WA 4FJZA 2VGXB 5HQ8A 1KT0A 1N4SA 4GZ3A 4AM9A 4BY6A 1OUVA 2UWJG 3SO8A 3JYSA 3PZ3A 2QFCA 3OXFA 3Q7AA 3UIPC 1MX6A 3UM0A 3V2XA 4ACKA 3E30A 2XPZA 3FDHA 5ENSD 3RJVA 5CERB 2DYSE 2PZIA 2NC9A 4A55A 4I2ZA 1OWLA 2OV8A 2J07A 3ABKE 4KZ0A 2YHEA 1HO8A 5G55A 5CHEE 4G25A 2I2OA 5A6CA 2LNIA 2WQHA 2QYJA 3HXBA 1EDUA 5HKPA 1HG5A 2OEVA 5G05C 3T5XA 4EZKA 3ISMC 4CZ2D 2ETCA 2MRIA 5ENQD 5FIOA 3MKQB 3QAQA 3L13A 4JL0A 2J08A 2X6IA 3OXLA 4LUNU 3DPYA 4J8SA 3RO2A 1D8EA 2C0MA 3TWXA 4LEUA 1TR4A 3DRAA 4MKTA 3S7DA 4L1BA 4KZCA 4GMJA 5D2MC 3PH0C 4H7YA 2XEVA 3B13A 4YDYA 3OXGA 3I4GA 3C5RA 2BEDA 1IYGA 4F6RD 3CR3A 3ONLA 2EILE 3BG1B 5FQ7A 4GTTA 3URZA 4GA0A 4J8FA 1BI7B 5FQ6A 1W3BA 4Y6CA 4I6EA 3TXNA 3CHSA 4BT8A 3B7BA 1PC2A 3Q78A 3QWVA 3Q5MA 2I1JA 4PS3A 3DXKG 3CVXA 4ACLA 4ZFHA 1JCRA 4WWPA 2NYJA 1KZOA 3NB2A 3AU5A 2XEHA 2XGMA 4JA9A 1Q2ZA 1O1RA 3I3NA 4MRUA 3EUVA 4HRLA 4AY6A 5EX0A 4TUUA 4WWOA 4GZDA 4JC8A 2XGOA 1Z3XA 3ZHEA 3QNKA 3HVEA 4FLBA 4GU5A 1Z6TA 1HF8A 4XZ4A 3IXEA 1UN8A 2F8XK 3U9WA 4I9EA 2XCBA 5KCMA 3JXIA 5BNWA 3QJZA 1E7VA 3VTYA 3PRZA 5JA4D 1N9AA 4FULA 3W9GA 4UWHA 3UKRG 4FC8A 3L82A 4I1MA 4JB8P 5LCWJ 1UN9A 2GRRB 3LXUX 3MGBA 5AARA 2H6HA 1G3NB 4CGVA 2ETAA 1NFIE 2R2LA 2LAIA 4BESA 4LG6A 3LY7A 4XEIG 2LSVA 1NL4A 4HRNA 1E90A 3L9TA 3CVVA 2LXMA 1OT8A 2KATA 4U0SA 3U3WA 4BFRA 3FUHA 4XE0A 4G24A 1NA0A 3Q4AB 1NI1A 3HIZA 4UQZA 4PUCA 4U96D 3SFZA 2DZOA 3P1UA 3ZNGA 1O5MA 2WXKA 4JZYA 3G2VA 4XKBA 1U2VG 4DUIA 3TWQA 4AXHA 4LCTA 5FZSA 2ZXWE 2OVBA 1K1BA 3VLEA 4JHKA 5EX3A 5H7PA 1MJ0A 4ILGA 3NF1A 5ENTD 3HVEB 5DBKA 2QC9A 4NURA 2XPIA 4ABNA 5FTPA 3MA5A 3DXMG 5C1DA 4OAVB 3NOCD 5FZQA 3DEOA 1ZB1A 1PAQA 4GB9A 4U07A 4GYYA 1FVFA 5EN5D 2ETBA 4ZHBA 3PUKA 3KSLA 3UKUG 4JVSA 3LPZA 4UQXA 5EIDA 5HRYA 1S70B 1AP7A 3Q79A 3IV0A 2VGEA 1H2UA 2GRNB 3ESLA 4UWGA 2E2EA 2FF4A 3CK7A 1ELWA 3G2TA 4KYOB 1N52A 1JWFA 1WG0A 5FINA 1A5EA 3CHRA 4YVQC 4GTQA 1E7UA 2QYUA 2L6BA 2HYZA 3SGHA 4G2VA 2PM7A 1N0RA 4WNGA 4B89A 3HXCA 3DSTA 4N3BA 3PREA 3UQ3A 5CEDB 3HHMA 2V5QC 4LSZE 1PY1A 2P9SG 1TYQG 3ULEG 4CGWA 5LOZA 5JJ7A 2PNNA 4GPMA 1LD8A 4Z68A 3FU0A 2OVFA 4JHRA 2PQNA 5T4YA 3MZLB 3CLJA 4WNFA 3EJNA 3SNXA 4HFGA 1D9SA 2WXFA 3C3QA 3ZXPA 3KEAA 3L16A 2WXOA 2KXPC 2IY0C 4EQFA 3UINC 5JHBA 1QBQA 3QK0A 4JXTA 3CV0A 4CDMA 4EPZA 2EIJE 4K0RA 3D9LA 4KVMA 3TG5A 2JABA 3FEXA 5D0OD 3RO3A 2XEEA 2LAHA 4XI0A 3Q7FA 3S7FA 3VLDA 3D9JA 2IU1A 4JPSA 4WAFA 5CMWA 3SBSA 5J90A 2P2CP 2XGSA 5ENRD 3R7QA 1LTXA 4GMLA 3ZXSA 2P9KG 3ASOE 5AQAA 4HOUA 1Z5SC 4UWLA 2CFZA 4JEHA 2AW6A 1FT1A 4ME2A 1FPPA 1JPLA 4CCAA 2V5FA 5C2YA 5BV1A 3NZUA 1SA4A 3LVRE 3UX4A 4O6FA 5CCMA 1BPOA 3EU5A 1Z3YA 4B8AA 1B89A 2R02A 2RKKA 4N2SA 4E6HA 4IRUA 4URKA 1UJJA 4ATZD 3TWTA 1MHQA 3CQGB 2RFAA 2ZGDA 2KM4A 2AXUA 1YMPA 2L9BA 1V54E 2P9PG 2X6JA 2IFUA 3CVNA 3ZPJA 5AJDA 3SZ7A 2VTBA 3CVWA 2WM9A 3QKYA 5JJ6A 2AXVA 2XQ0A 1IHBA 4IN3B 5E75A 1KLXA 3DSUA 4RVBA 1ZBPA 1DNPA 2NSZA 3IHVA 2KCLA 2XZDG 4BTBA 3P2BA 5KBAA 3ABLE 3RRUA 3KEZA 4K5AB 2BF0X 3X2QE 3D9HA 1SVXA 1HXIA 2LO6A 3VLFA 3ASFA 4DI4A 4BEPA 2EIKE 4UI9J 4UUCA 3PNLB 2LUHA 3CVQA 4CT0A 2FBNA 4GYOA 4ATGA 3EDTB 1Y6IA 4GAAA 4GZCA 1HZ4A 3B7SA 3FUKA 1RW2A 2GRPB 2GRMA 3IHYA 3ZYQA 1UJKA 1HX8A 2X6HA 3LY8A 1N4RA 5AQ9A 2Y69E 4K5CA 2Y4TA 4Q94A 1TNZA 2WXGA 4AOFA 4G8KA 4N2QA 5FWQA 3JXJA 1K1AA 4U0UA 4I1OB 3ABME 4F53A 1SZ9A 3SQVA 3S7JA 3TWUA 1MX2A 3B7RL 3BQOA 4I43A 4YNDA 3D9NA 1N94A 4FADA 3SFYA 3FTZA 2YQ8A 2P9IG 2IF4A 3V30A 3MV2B 3FTSA 3LY9A 3TGOA 3AS5A 4QQIA 2VGXA 4BSZB 3DSSA 2XHEA 4Y6WA 3KS2A 4NIKA 3EHMA 2J8SD 5D66A 2KCVA 3MKQA 5IY5E 2J4BA 4FU3A 5CRUA 5T8IA 1N11A 4GPKA 1K3ZD 3AAAC 4DX6D 4A1SA 3B7UX 2DWZA 2RD0A 2V8SE 2KZTB 5J08A 3APFA 1FT2A 3CVYA 4CT4A 1H19A 3EHRA 5ARFA 2P9LG 4U0ZA 1SZAA 3QDNA 2FO7A 1NZNA 3IKOB 3UXGA 3CVPA 5A7DB 2PM6A 3L08A 1LD7A 2ONDA 1OWMA 2V0PA 3FUDA 4TXQA 1O1TA 4TXPA 3ZW3A 3V79K 3QB2A 3BG0B 2BUGA 2Y0BG 2OOEA 1IXVA 1FCHA 3ZVVA 5JMND 4IYPA 5AQ7A 4J8DA 4HI8A 1SW6A 5BW8C 3J5QB 2X6KA 3AU4A 5CCLA 3VTXA 2YHCA 5FQ8A 2DVWA 1YCSB 3CVUA 4LERA 2AWIA 2XS8A 4FA6A 2DZNA 4PH4B 3ZN3A 4JD2G 4XIFA 2RFMA 3E33A 5LCWC 3FU5A 1OCOE 3O48A 1HFAA 1HE8A 1XNFA 3EIQC 5ITZF 3T5VA 3ZHEB 4BSXA 3L17A 3U66A 4OYSA 1H2VC 3FULA 2KZTA 2E0IA 2FULA 1UG3A 2WMNA 3ZKJA 3CK9A 1KT1A 2X3MA 1U3DA 3CHOA 3R7RA 1IQRA 3V31A 1A17A 4JA7A 1OWOA 4JHJA 1JUQA 2R59A 2XRZA 3AG4E 4YVOA 4N39A 2RG8A 4LNUD 3FHEA 2Q7FA 3AS4A 5EYLA 4O60A 5ANLA 3UMVA 2MHKA 2WQ6A 4GA1A 1H6PA 1TJCA
chains in the Genus database with same CATH topology
3D9OA 3RKVA 4ANVA 2V4LA 1QQEA 4MLPA 1DVPA 5DIZA 4F1SA 3L16A 3ZIMA 1NP7A 2WXOA 5BPPA 4U04A 3BEEA 4WNDA 1Y8MA 2WXPA 4L2YA 4AVXA 4EQFA 5JHBA 1U3CA 3CQCB 1QZ2A 3ZYMA 2CFUA 3QK0A 4JXTA 2J49A 3SF4A 3T8MA 4N3CA 3CV0A 3G2WA 3LVQE 1EPUA 4FJZA 4I6GA 4CDMA 2VGXB 5HQ8A 2ZU6B 4EPZA 4A3VA 4DPRA 1KT0A 4GZ3A 2J4DA 3FTVA 2FI7A 3CK8A 2JLBA 2VSNA 3N71A 3D9LA 4K0RA 4KVMA 4AM9A 5CMYA 2L6JA 4BY6A 2BTDA 3TG5A 3Q49B 1OUVA 4EZJA 2UWJG 5BUZA 4WWNA 4GZ6A 4Q69A 3FEXA 3PZDA 3JYSA 5D0OD 2QFCA 3RO3A 3JCKC 3OXFA 2J09A 2LAHA 4XI0A 3RRNB 3S7FA 3VLDA 2A5UA 3D9JA 5D0QD 2IU1A 4EBAA 3FUNA 4JPSA 4WAFA 4NACA 5CMWA 1H6KA 3PEVB 3SBSA 2HR2A 5T3RA 4ACKA 4PS8A 4I6JA 4J8EA 5J90A 3RK6A 3U4TA 2XGSA 5LFAA 2XPZA 3FDHA 4U8HA 2CHWA 3R7QA 4F3VA 3PE3A 3RJVA 2WXJA 4ILIA 2PZIA 2NC9A 3CKCA 4GMLA 4J6IA 1OWLA 4I2ZA 4Q96A 4TV3A 2OV8A 3FY4A 2J07A 4FHKA 3ZXSA 4HOUA 4KZ0A 1SQMA 2QY7A 2YHEA 2L0IA 3U64A 4C0EA 3CVLA 4G11A 1HU3A 1HO8A 2WVIA 5G55A 5CHEE 4G25A 3C98A 4UWLA 2HO1A 3ZFWA 2CFZA 4JEHA 2I2OA 2AW6A 1EF1C 2I6HA 3FTXA 3HYMB 5A6CA 2LNIA 2WQHA 4ME2A 1E8WA 5KJMA 4PDXA 1JPLA 3R9AB 4CCAA 2V5FA 5C2YA 3FP3A 1EDUA 3KAEA 2DBAA 5BV1A 1HG5A 3NZUA 5G05C 1TJFA 3T5XA 3LVRE 5BV0A 4EZKA 3UX4A 4O6FA 5CCMA 3ML9A 3D9KA 1BPOA 2MRIA 3RU0A 4G26A 2UY1A 2VSOE 4B8AA 1Z3YA 3B7TA 1B89A 4HLEA 4N2SA 4E6HA 4IRUA 4URKA 1UJJA 3L54A 4BWRA 3MKQB 3QARA 3QAQA 1MHQA 3CQGB 4ANWA 3L13A 4JL0A 2J08A 3SBTB 2X6IA 2GW1A 2XPYA 3MJWA 2KM4A 4BT9A 3OXLA 2AXUA 4LUNU 4UQYA 2AVPA 4J8SA 2L9BA 3RO2A 3CEQA 2X6JA 3UT8A 3SD5A 3ZGQA 2C0MA 2VSYA 4LEUA 2IFUA 3CVNA 1EYHA 3ZPJA 5AJDA 3EHNA 4MKTA 4OVVA 3S7DA 3SZ7A 4L1BA 2VTBA 5FJYA 2R5SA 4KZCA 3ML8A 3CVWA 3FUIA 4RG6A 2WM9A 3QKYA 5JJ6A 4ILHB 2AXVA 2C0LA 2VGYA 2XQ0A 3ENEA 3L6AA 4GMJA 3RRMB 4RSYA 4FHJA 3LEWA 3PH0C 4IN3B 3DBSA 2IJGX 5E75A 4A1GA 4H7YA 4E85A 1KLXA 2Y4UA 4NQ0A 1E8XA 2X38A 2YINA 2XEVA 3B13A 4RVBA 4U63A 1ZBPA 1DNPA 2NSZA 5AIJA 4MS6A 2VJ8A 1FVHA 4N3AA 5JHAA 3IHVA 2KCLA 3ZYKA 3OXGA 3I4GA 3SHFA 1IYGA 4KBQA 4BTBA 3P2BA 3LJ3A 3ZRHA 3WXXA 2VQ2A 3RRUA 3KEZA 1WM5A 1VDYA 3CR3A 5E76A 1N54A 3ONLA 1E8YA 2BF0X 3BG1B 2L0TB 5FQ7A 3URZA 1HXIA 4GA0A 4J8FA 4P29A 2LO6A 3VLFA 1L5JA 3ASFA 4DI4A 4UI9J 4L23A 4UWKA 5FQ6A 3I4RB 3PNLB 3CVQA 3FTUA 4CT0A 4KVOA 2FBNA 3FWVA 4GYOA 1W3BA 4L2LA 4ATGA 4Y6CA 3EDTB 1Y6IA 3JQ0A 4GAAA 3UT7A 4GZCA 3D3MA 4I6EA 3CHSA 3TXNA 4BT8A 2WXHA 1HZ4A 3B7SA 1PC2A 3FUKA 4WUYA 4FLHA 3FU3A 3Q5MA 2I1JA 3QWVA 4PS3A 3CVXA 3D9MA 4ACLA 2GRMA 3IHYA 5KJKA 4BX9A 3ZYQA 1UJKA 1HX8A 3CHQA 3LYAA 2X6HA 3LY8A 4UI9C 4WWPA 5ENNA 4ANXA 2CG3A 2NXPA 2Y4TA 4Q94A 2WXGA 3D9PA 3QC1A 4AOFA 2WXIA 2PQRA 3ASDA 3FFLA 4OVUA 4EZLA 4N2QA 5FWQA 3ZEFA 3PE4A 4L7TA 3AU5A 4U0UA 3LCAA 4I1OB 2XGMA 4JA9A 4AV7A 4F53A 4F7AA 3I3NA 4MRUA 3RIBA 3PEUB 1SZ9A 1HS6A 4AY6A 5EX0A 3ESKA 3S7JA 4XI9A 3ASGA 4TUUA 4WWOA 2UY1B 3B7RL 3ONKA 4GZDA 3KD7A 3HDXA 4GCNA 4I43A 4NRHB 4JC8A 4A3TA 4CRWA 2XGOA 4YNDA 3D9NA 4AP2A 1OWNA 1Z3XA 4AEZC 3JQ1A 4DJAA 3ZHEA 2XCCA 2P58C 4I17A 4FADA 1JWGA 3QNKA 2GGFA 2WXRA 3HVEA 4GA2A 3UPVA 4FLBA 4GU5A 2XRYA 3FTZA 1Z6TA 2C2LA 2YQ8A 4APFA 1HF8A 2IF4A 3FU6A 3MCXA 3APDA 4B8CB 2VYIA 2WXNA 3MV2B 4XZ4A 4EECA 3FTSA 1UN8A 1E8ZA 3LY9A 3TGOA 3U9WA 3AS5A 4I9EA 3FH8A 4I1AA 4D10C 2XCBA 2VGXA 5BT1A 5KCMA 5BNWA 3OAWA 2VTBB 4B0ZA 3QJZA 1E7VA 2KCKA 2XHEA 1YA0A 3Q47B 3VTYA 4EBAG 3PRZA 3DPDA 4Y6WA 3KS2A 3MX3A 3Q15A 4FULA 3PUJA 2MOWA 4UWHA 2FEZA 5JJTA 2AXZA 3EHMA 3FH7A 4HVBA 2KCVA 3MKQA 4FC8A 5G2NA 3IEGA 3QWWA 4I1MA 2A4ZA 5LCWJ 1HG2A 5HI7A 3ZYLA 2J4BA 5AJLA 1UN9A 2GRLA 4FU3A 2I1KA 3MV3B 4N5CA 4XX5A 5T8IA 4G23A 3LXUX 4GPKA 1WAO1 4TRQA 4A1SA 3B7UX 3IBEA 4ANUA 2R17C 2RD0A 3UUXA 3MGBA 4B94A 3LDZA 1LF8A 1S0PA 2KZTB 2V8SE 4CGVA 5J08A 3APFA 3G2UA 3FTYA 2LAIA 2PL2A 3LY7A 3CVYA 4CT4A 1H19A 4AIFA 2LSVA 2YNQA 3PNTB 1E90A 3PS6A 5ARFA 2X6FA 4G1TA 4KXKB 2CHXA 3CVVA 3JUIA 2KATA 4U0SA 3CHPA 3TJPA 3U3WA 4BFRA 4IULA 4U0ZA 1SZAA 3FTWA 3FUHA 3GW4A 3QDNA 4XE0A 4DLQA 2FO7A 2IONA 4G24A 1NA0A 3Q4AB 3FUMA 1NZNA 3IKOB 4I9CA 1WY6A 4GYWA 3HIZA 3CVPA 4UQZA 1QNFA 3GZ2A 5A7DB 4PUCA 2PM6A 3TXMA 3L08A 5FQ4A 2DIWA 3SFZA 4H7XA 4JEUA 4KT6B 3P1UA 2ONDA 1OWMA 3MKRA 4DK5A 5A23A 5EKQD 2WXLA 4JZYA 2WXKA 3G2VA 4LRZA 4RG9A 4XKBA 2V0PA 3CSFA 1UW4B 3FUDA 4PS7A 2WPVA 1IQUA 1GW6A 3AS8A 3CSTA 3QOUA 3ZW3A 3QB2A 3BG0B 3MYVA 2BUGA 4AJWA 2OOEA 4AXHA 1FCHA 4LCTA 4CEMA 3FUEA 5FZSA 3UT4A 2EQXA 4KMOA 2OVBA 2WQ7A 3ZVVA 4IYPA 3VLEA 4J8DA 4JHKA 5EX3A 3S7BA 3FEYA 1ELKA 3ASHA 1ELRA 4ILGA 5BW8C 2X6KA 3AU4A 5CCLA 3FUJA 3NF1A 3VTXA 3HVEB 5DBKA 3TG4A 2YHCA 5FQ8A 4NURA 4UWFA 2XPIA 3FH5A 1OWPA 3MEKA 4ABNA 4HS2A 2VSXE 4LERA 3CVUA 4C0MA 2AWIA 4FP7A 5FTPA 3MA5A 4HOQA 4FA6A 5C1DA 5FZQA 1HH8A 1MQSA 5LP0A 1H2TC 5ARGA 4GB9A 1PAQA 4I2WA 5AYWD 4U07A 4BX8A 4GYYA 3CGHA 4HORA 4PH4B 5LX8A 4GZ5A 1FVFA 3ZN3A 5KJNA 3PUKA 3EIJA 3LKUA 4HXIA 4JVSA 4UI9K 4XIFA 3LS8A 3LPZA 4GCOA 4V3IA 5FZRA 3OTNA 4DLOA 2Y3AA 4UQXA 5G04J 1ZU2A 2IQCA 5LCWC 3FU5A 4WNEA 3O48A 5EDSA 2IOSA 1HFAA 1HE8A 2DCPA 3D9IA 1XNFA 3IV0A 3EIQC 3APCA 3CHMA 4APOA 3T5VA 3ZHEB 1H2UA 3ESLA 3PVLA 4UWGA 4DI3A 4K03A 2E2EA 1P5QA 2FF4A 1ELWA 2HM8A 2ILRA 3CK7A 3SI5A 3G2TA 3L17A 4R7LA 4BSXA 1XGWA 3U66A 1E96B 2J9QA 4OYSA 1H2VC 4KYOB 1N52A 3FULA 5KJLA 2WB2A 1NA3A 3CKBA 1H0AA 1JWFA 2KZTA 2E0IA 3O4ZA 2FULA 1UG3A 2WMNA 3CK9A 4HOTA 3CHRA 1KT1A 4A55A 4YVQC 2X3MA 4CDRA 1IHGA 3K9IA 3NZSA 1U3DA 3CHOA 2WXMA 1E7UA 3R7RA 3I5PA 3L22A 4XKCA 1IQRA 3S2AA 3FUFA 3PDNA 2HYZA 4J0UA 1INZA 3NQPA 1A17A 2IOLA 3GZSA 2WMOA 3SGHA 4JA7A 1OWOA 4G2VA 3E4BA 4CDNA 4BTAA 2PM7A 2WXQA 4JHJA 3GZ1A 4WNGA 5G04C 4B89A 2M63A 1JUQA 2R59A 4N3BA 3PREA 3UQ3A 2I9CA 2XRZA 3GYZA 5FT9A 4HOSA 3HHMA 5M72A 2LSUA 4YVOA 4JW1A 1PY1A 4N39A 4FJYA 2RG8A 1X5BA 3QWPA 2JEKA 4QFVA 4CGWA 2KC7A 5LOZA 5JJ7A 3FHEA 5ANRA 2Q7FA 3G2SA 3TL5A 3FU0A 3AS4A 2OVFA 2CHZA 4W9RA 1TEZA 4JHRA 2PQNA 5T4YA 3MZLB 3CIAA 3ULQA 5ANLA 3UMVA 4AY5A 4M3OA 3CLJA 3TAXA 2MHKA 4C9BB 2WQ6A 4WNFA 3EJNA 2CG2A 4GA1A 3SNXA 4HFGA 5AENA 2WXFA 1TJCA 5G05J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW8 C;  4GA2 A;  3OXL A;  4UQY A;  3RKV A;  4BT9 A;  1QQE A;  2AVP A;  5DIZ A;  3UPV A;  5CCL A;  3NF1 A;  2C2L A;  2YQ8 A;  3RO2 A;  5DBK A;  3TG4 A;  3CEQ A;  3VTX A;  2IF4 A;  2YHC A;  2VYI A;  3MV2 B;  4U04 A;  2XPI A;  3ZGQ A;  3BEE A;  3LY9 A;  2C0M A;  4WND A;  1Y8M A;  3MEK A;  4ABN A;  3TGO A;  2VSY A;  4LEU A;  2IFU A;  3CVN A;  4EQF A;  3AS5 A;  3ZPJ A;  5FTP A;  3S7D A;  1QZ2 A;  3MA5 A;  4HOQ A;  4I1A A;  4I9E A;  5FJY A;  2R5S A;  3SF4 A;  3SZ7 A;  2XCB A;  5C1D A;  2VGX A;  5BT1 A;  5FZQ A;  4RG6 A;  1HH8 A;  3QKY A;  3CV0 A;  4N3C A;  5JJ6 A;  2C0L A;  2VGY A;  5ARG A;  5BNW A;  5AYW D;  4I2W A;  2VGX B;  4IN3 B;  5HQ8 A;  4U07 A;  2KCK A;  4GYY A;  3Q47 B;  1KT0 A;  1YA0 A;  4GZ3 A;  4H7Y A;  3VTY A;  2FI7 A;  3CK8 A;  2JLB A;  2VSN A;  1KLX A;  2Y4U A;  4GZ5 A;  4NQ0 A;  4Y6W A;  2XEV A;  3N71 A;  3ZN3 A;  3LKU A;  1ZBP A;  4AM9 A;  4UI9 K;  2L6J A;  4XIF A;  3KS2 A;  3LPZ A;  4GCO A;  5FZR A;  3Q15 A;  4N3A A;  3TG5 A;  2KCL A;  4UQX A;  2FEZ A;  1OUV A;  3OXG A;  2UWJ G;  3Q49 B;  5G04 J;  5JJT A;  1ZU2 A;  5LCW C;  4GZ6 A;  1IYG A;  4WNE A;  4KBQ A;  3O48 A;  2KCV A;  4BTB A;  3IEG A;  3JYS A;  2VQ2 A;  3WXX A;  3QWW A;  1WM5 A;  5D0O D;  1XNF A;  2QFC A;  3RO3 A;  5LCW J;  5HI7 A;  3OXF A;  4XI0 A;  4APO A;  3S7F A;  3ZHE B;  3MV3 B;  4N5C A;  5D0Q D;  4G23 A;  4GPK A;  1WAO 1;  4A1S A;  2E2E A;  1P5Q A;  2FF4 A;  1ELW A;  3CK7 A;  3UUX A;  5KJN A;  2HR2 A;  1HXI A;  3URZ A;  4GA0 A;  4J8F A;  4B94 A;  4J8E A;  4CGV A;  3ASF A;  1E96 B;  2J9Q A;  4KYO B;  4UI9 J;  2XGS A;  3U4T A;  5KJL A;  1NA3 A;  2PL2 A;  3CKB A;  3CVQ A;  3LY7 A;  4AIF A;  4F3V A;  3PE3 A;  2LSV A;  3RJV A;  5ARF A;  2FBN A;  3CK9 A;  4HOT A;  3FWV A;  2PZI A;  2NC9 A;  3CKC A;  1W3B A;  4G1T A;  4GYO A;  1KT1 A;  4I2Z A;  4KXK B;  3EDT B;  4Y6C A;  4YVQ C;  4CDR A;  1IHG A;  3K9I A;  4HOU A;  2KAT A;  4U0S A;  4BT8 A;  3U3W A;  1HZ4 A;  1PC2 A;  3CVL A;  3GW4 A;  3QDN A;  4U0Z A;  4WUY A;  3QWV A;  3Q5M A;  2FO7 A;  4G25 A;  4G24 A;  5CHE E;  1NA0 A;  3Q4A B;  1NZN A;  3PDN A;  2HO1 A;  4I9C A;  3ZFW A;  4GYW A;  2HYZ A;  5KJK A;  4J0U A;  1A17 A;  2I6H A;  3HYM B;  3LYA A;  5A6C A;  4JA7 A;  3CVP A;  3LY8 A;  3GZ2 A;  2LNI A;  2WQH A;  4G2V A;  3E4B A;  4ME2 A;  4UQZ A;  4UI9 C;  5A7D B;  4BTA A;  5KJM A;  2Y4T A;  3R9A B;  3GZ1 A;  4WNG A;  5G04 C;  4N3B A;  3UQ3 A;  2PQR A;  2V5F A;  3ASD A;  3FFL A;  3FP3 A;  3GYZ A;  4H7X A;  5FT9 A;  4HOS A;  3KAE A;  4N2Q A;  2DBA A;  2OND A;  3PE4 A;  2LSU A;  3MKR A;  5M72 A;  5EKQ D;  5G05 C;  4U0U A;  3LCA A;  4YVO A;  4O6F A;  2XGM A;  4RG9 A;  4JA9 A;  4N39 A;  5CCM A;  4HOR A;  3QWP A;  2WPV A;  4CGW A;  2KC7 A;  3AS8 A;  3RIB A;  3RU0 A;  4G26 A;  5JJ7 A;  3QOU A;  2UY1 A;  2Q7F A;  2BUG A;  4AY6 A;  3AS4 A;  1B89 A;  4W9R A;  2OOE A;  3ESK A;  1FCH A;  4JHR A;  3ASG A;  4XI9 A;  5EX0 A;  3S7J A;  2PQN A;  5FZS A;  4N2S A;  2UY1 B;  3ULQ A;  4AY5 A;  4BWR A;  3KD7 A;  4GCN A;  4J8D A;  4NRH B;  3TAX A;  5EX3 A;  2MHK A;  2XGO A;  4JL0 A;  4WNF A;  4YND A;  3S7B A;  4GA1 A;  3ZHE A;  2XCC A;  3ASH A;  2P58 C;  4I17 A;  2GW1 A;  1ELR A;  1TJC A;  5G05 J; 
#chains in the Genus database with same CATH topology
 3RKV A;  5DIZ A;  4F1S A;  3EHQ A;  3DWL G;  4U04 A;  3BEE A;  4WND A;  1Y8M A;  2WXP A;  3TWV A;  3UM3 A;  2J49 A;  2OEW A;  5AQB A;  4YDW A;  1EPU A;  4GTM A;  2ZU6 B;  4DPR A;  2HE0 A;  2J4D A;  3CK8 A;  3N71 A;  1N0Q A;  2L6J A;  4EZJ A;  5BUZ A;  4WWN A;  1AWC B;  4OAU C;  3JCK C;  4GTV A;  2A5U A;  3FUN A;  1DCE A;  4NAC A;  1H6K A;  3PEV B;  5T3R A;  4I6J A;  3RK6 A;  4U8H A;  2CHW A;  2WXJ A;  2H6F A;  1DCQ A;  4J6I A;  4TV3 A;  4Q96 A;  3PZ4 A;  3FY4 A;  4FHK A;  3C72 A;  1SQM A;  2QY7 A;  4C0E A;  3CVL A;  4G11 A;  3C98 A;  2HO1 A;  5BXO A;  1EF1 C;  2I6H A;  3HYM B;  3J5P A;  1E8W A;  2QZA A;  3FP3 A;  3ZUV B;  1TJF A;  4B93 B;  1S64 A;  3D9K A;  3RU0 A;  2UY1 A;  2VSO E;  5B3S E;  3B7T A;  1OY3 D;  3L54 A;  4BWR A;  3AJI A;  4BT9 A;  4UQY A;  1BU9 A;  2ZGG A;  3CEQ A;  2H6I A;  3R9M A;  3EHN A;  3ML8 A;  1S63 A;  4RG6 A;  2C0L A;  2VGY A;  3L6A A;  4RSY A;  3LEW A;  2IJG X;  4A1G A;  4E85 A;  1OCZ E;  2Y4U A;  4NQ0 A;  2YIN A;  4U63 A;  3PZ1 A;  5AIJ A;  4MS6 A;  2VJ8 A;  5JHA A;  3ZYK A;  3DSX A;  3LJ3 A;  2VQ2 A;  2L0T B;  3AG2 E;  4L9P A;  2EIN E;  1L5J A;  1OCC E;  1BI8 B;  1N4P A;  4L23 A;  4UWK A;  3FTU A;  3AG1 E;  3FWV A;  2IO3 C;  4L2L A;  1KPS B;  3JQ0 A;  3D3M A;  2WXH A;  1TN8 A;  4WUY A;  4FLH A;  2FO1 E;  1QYM A;  4GTO A;  1TN7 A;  2CG3 A;  2NXP A;  3D9P A;  3QC1 A;  2PQR A;  4OVU A;  5B1A E;  3PE4 A;  4L7T A;  2H6G A;  3LCA A;  1RZ4 A;  1DC2 A;  3RIB A;  5EIL A;  1HS6 A;  4CYM D;  2UY1 B;  3KD7 A;  3HDX A;  4NRH B;  4CRW A;  1OWN A;  4AEZ C;  4DJA A;  2P58 C;  3HXE A;  1JWG A;  2GGF A;  1WDY A;  4GA2 A;  3UPV A;  2C2L A;  1MZC A;  2VYI A;  4EEC A;  1E8Z A;  3FH8 A;  4D10 C;  5BT1 A;  4M7C A;  3OAW A;  3W9F A;  4BET A;  4B0Z A;  2KCK A;  3Q47 B;  1YA0 A;  3DPD A;  3MX3 A;  3Q15 A;  3RAU A;  2FEZ A;  3UM2 A;  2AXZ A;  3C3O A;  3UIO C;  4HVB A;  3UM1 A;  2DYR E;  2A4Z A;  2A5E A;  3UI2 A;  2I1K A;  3MV3 B;  4XX5 A;  4G23 A;  1WAO 1;  4TRQ A;  3IBE A;  4ANU A;  2R17 C;  3UUX A;  3G2U A;  2PL2 A;  3PNT B;  3PS6 A;  2X6F A;  4KXK B;  3TJP A;  4DLQ A;  3E32 A;  3FTW A;  3GW4 A;  4I9C A;  1WY6 A;  4GYW A;  4U95 D;  5ENP D;  4RLY A;  1QNF A;  3TXM A;  1N4Q A;  5FQ4 A;  4H7X A;  4JEU A;  1UOH A;  5A23 A;  5ENO D;  2WXL A;  1V55 E;  4LRZ A;  3CSF A;  1UW4 B;  4PS7 A;  2WPV A;  3AS8 A;  4J8Y A;  3CST A;  3Q9U C;  3ASN E;  1MYO A;  3UT4 A;  2WQ7 A;  3S7B A;  3WG7 E;  3FEY A;  1ELK A;  3ASH A;  3HG0 D;  3FUJ A;  3TG4 A;  4J7W A;  4UWF A;  4DX7 D;  3FH5 A;  4O1O A;  3MEK A;  2IO2 C;  4HS2 A;  2VSX E;  4X8Q A;  5AYW D;  4I2W A;  5KNH D;  4BX8 A;  5LX8 A;  3Q73 A;  4DX2 A;  3LKU A;  4UI9 K;  4V3I A;  4GCO A;  5FZR A;  4DLO A;  3OTN A;  4TXR A;  4DRX E;  5G04 J;  1ZU2 A;  2IQC A;  2IOS A;  3ZU7 B;  3D9I A;  3APC A;  4DI3 A;  4K03 A;  2ILR A;  3SI5 A;  5KJL A;  1NA3 A;  3CKB A;  4HOT A;  5CEA A;  1IHG A;  3K9I A;  3NZS A;  3Q9N C;  3L22 A;  4XKC A;  3FUF A;  5EYP F;  4J0U A;  1INZ A;  2F37 A;  2IOL A;  4HRM B;  2WXQ A;  4LNG A;  3GZ1 A;  5G04 C;  3GYZ A;  1X5B A;  3QWP A;  5ANR A;  3G2S A;  3TWR A;  4W9R A;  1BLX B;  4F1P A;  3CIA A;  1TNB A;  2CG2 A;  4U7E B;  5AEN A;  5G05 J;  3D9O A;  2V4L A;  1QQE A;  5CBN A;  2LXL A;  4AVX A;  4U8V D;  1OXJ A;  3CQC B;  3T9K A;  3LVQ E;  4HBD A;  4I6G A;  3DEP A;  2XEN A;  4A3V A;  3FTV A;  3T8K A;  2FI7 A;  5AAO A;  2JLB A;  2VSN A;  3ULY A;  3DSW A;  5CMY A;  2BTD A;  3Q49 B;  4N5Q A;  4GZ6 A;  4Q69 A;  3PZD A;  2ZIS A;  4EHM A;  2J09 A;  3RRN B;  5D0Q D;  3NAW A;  4EBA A;  2BKK B;  2F0Y A;  2HR2 A;  4PS8 A;  4HB5 A;  4J8E A;  3U4T A;  5LFA A;  4F3V A;  3PE3 A;  3LJN A;  2KBX A;  4ILI A;  3CKC A;  2BKG A;  5KWD A;  4A63 B;  2L0I A;  3U64 A;  1HU3 A;  2F8Y A;  2WVI A;  4U8Y D;  3E37 A;  3ZFW A;  2V4H C;  3FTX A;  1X81 A;  5KJM A;  4PDX A;  3R9A B;  3BU8 A;  5CBO A;  1IKN D;  3KAE A;  2DBA A;  4HQD A;  5BV0 A;  1YYH A;  3ML9 A;  4G26 A;  1TNY A;  3UTM A;  4HLE A;  3Q75 A;  3QAR A;  4ANW A;  3E34 A;  3SBT B;  1H6O A;  5KNG A;  2GW1 A;  2XPY A;  3MJW A;  2AVP A;  2EIM E;  3UT8 A;  3SD5 A;  3ZGQ A;  2VSY A;  1EYH A;  3TWW A;  4OVV A;  5FJY A;  2R5S A;  3FUI A;  4ILH B;  3RRM B;  3ENE A;  4FHJ A;  3DBS A;  1E8X A;  2X38 A;  1KZP A;  1FVH A;  4N3A A;  4DX5 D;  3SHF A;  4KBQ A;  3ZRH A;  3WXX A;  1WM5 A;  4GTS A;  1VDY A;  3JUE A;  3HRA A;  5E76 A;  1N54 A;  1E8Y A;  2R05 A;  2Y1L E;  4P29 A;  3NBN B;  3I4R B;  4KVO A;  3EU9 A;  3UT7 A;  5EIB E;  3FU3 A;  4MBG A;  4YDO A;  3D9M A;  5KJK A;  4BX9 A;  3CHQ A;  3LYA A;  3F6Q A;  4UI9 C;  5ENN A;  4ANX A;  2WXI A;  3ASD A;  3FFL A;  4EZL A;  3RSE G;  3ZEF A;  4AV7 A;  4F7A A;  4BER A;  4HI9 A;  3PEU B;  3ESK A;  4XI9 A;  2P9U G;  3ASG A;  3ONK A;  2R03 A;  4GCN A;  4A3T A;  4AP2 A;  3JQ1 A;  2XCC A;  4I17 A;  2OCC E;  2WXR A;  2XS1 A;  5HS0 A;  2XRY A;  4APF A;  4B8C B;  2P9N G;  3FU6 A;  3APD A;  3MCX A;  2WXN A;  2GRO B;  4I1A A;  1O1S A;  2VTB B;  3C3R A;  1K8K G;  4EBA G;  5BXU A;  3TWS A;  3B95 A;  3PUJ A;  2MOW A;  3HXD A;  5CRV A;  5JJT A;  2ZIR A;  3FH7 A;  5G2N A;  3IEG A;  3QWW A;  1HG2 A;  5HI7 A;  3ZYL A;  5AJL A;  2GRL A;  4N5C A;  1N95 A;  2MYO A;  4B94 A;  3LDZ A;  1LF8 A;  1S0P A;  3FTY A;  4AIF A;  2YNQ A;  4YDE A;  4G1T A;  2CHX A;  5B1B E;  3JUI A;  3CHP A;  4IUL A;  2ION A;  3AG3 E;  3KSQ A;  3FUM A;  1BD8 A;  3GZ2 A;  3PZ2 A;  2DIW A;  4TUM A;  4K5B A;  4KT6 B;  2B0O E;  3BUA A;  3MKR A;  4DK5 A;  5EKQ D;  4RG9 A;  1IQU A;  1GW6 A;  3SFX A;  3QOU A;  3MYV A;  4AJW A;  4CEM A;  3FUE A;  3DSV A;  2EQX A;  4KMO A;  1SA5 A;  4GMR A;  2GRQ B;  1D8D A;  2B6C A;  1ELR A;  1OWP A;  3SY2 A;  4C0M A;  4FP7 A;  4HOQ A;  1HH8 A;  1MQS A;  5LP0 A;  1H2T C;  5ARG A;  4HOR A;  3CGH A;  4GZ5 A;  5KJN A;  3EIJ A;  4HXI A;  3LS8 A;  2Y3A A;  4C48 B;  4WNE A;  5EDS A;  2DCP A;  4APO A;  3CHM A;  3PVL A;  4HNA D;  3V2O A;  1P5Q A;  2HM8 A;  1TNO A;  4R7L A;  1XGW A;  1E96 B;  2J9Q A;  2WB2 A;  1H0A A;  3O4Z A;  3NOG D;  2AJA A;  4CDR A;  4LNB A;  1OCR E;  2WXM A;  3I5P A;  5AN8 A;  2XZT G;  3S2A A;  4HLL A;  3PDN A;  4GTR A;  1TNU A;  3GZS A;  3NQP A;  2WMO A;  3E4B A;  4CDN A;  4BTA A;  4O1P A;  2IEJ A;  2M63 A;  2I9C A;  4DX1 A;  5FT9 A;  4GTP A;  4HOS A;  5M72 A;  2LSU A;  3HXF A;  4JW1 A;  4FJY A;  2JEK A;  4QFV A;  2KC7 A;  3TL5 A;  1TEZ A;  2CHZ A;  4RQI A;  1TN6 A;  3ULQ A;  4AY5 A;  4M3O A;  1JCS A;  4G8L A;  3TAX A;  4C9B B;  5CEC B;  4ANV A;  4MLP A;  1DVP A;  1JCQ A;  3ZIM A;  1NP7 A;  5BPP A;  4L2Y A;  1U3C A;  1QZ2 A;  3ZYM A;  2CFU A;  3SF4 A;  3T8M A;  1MX4 A;  4N3C A;  3G2W A;  4FJZ A;  2VGX B;  5HQ8 A;  1KT0 A;  1N4S A;  4GZ3 A;  4AM9 A;  4BY6 A;  1OUV A;  2UWJ G;  3SO8 A;  3JYS A;  3PZ3 A;  2QFC A;  3OXF A;  3Q7A A;  3UIP C;  1MX6 A;  3UM0 A;  3V2X A;  4ACK A;  3E30 A;  2XPZ A;  3FDH A;  5ENS D;  3RJV A;  5CER B;  2DYS E;  2PZI A;  2NC9 A;  4A55 A;  4I2Z A;  1OWL A;  2OV8 A;  2J07 A;  3ABK E;  4KZ0 A;  2YHE A;  1HO8 A;  5G55 A;  5CHE E;  4G25 A;  2I2O A;  5A6C A;  2LNI A;  2WQH A;  2QYJ A;  3HXB A;  1EDU A;  5HKP A;  1HG5 A;  2OEV A;  5G05 C;  3T5X A;  4EZK A;  3ISM C;  4CZ2 D;  2ETC A;  2MRI A;  5ENQ D;  5FIO A;  3MKQ B;  3QAQ A;  3L13 A;  4JL0 A;  2J08 A;  2X6I A;  3OXL A;  4LUN U;  3DPY A;  4J8S A;  3RO2 A;  1D8E A;  2C0M A;  3TWX A;  4LEU A;  1TR4 A;  3DRA A;  4MKT A;  3S7D A;  4L1B A;  4KZC A;  4GMJ A;  5D2M C;  3PH0 C;  4H7Y A;  2XEV A;  3B13 A;  4YDY A;  3OXG A;  3I4G A;  3C5R A;  2BED A;  1IYG A;  4F6R D;  3CR3 A;  3ONL A;  2EIL E;  3BG1 B;  5FQ7 A;  4GTT A;  3URZ A;  4GA0 A;  4J8F A;  1BI7 B;  5FQ6 A;  1W3B A;  4Y6C A;  4I6E A;  3TXN A;  3CHS A;  4BT8 A;  3B7B A;  1PC2 A;  3Q78 A;  3QWV A;  3Q5M A;  2I1J A;  4PS3 A;  3DXK G;  3CVX A;  4ACL A;  4ZFH A;  1JCR A;  4WWP A;  2NYJ A;  1KZO A;  3NB2 A;  3AU5 A;  2XEH A;  2XGM A;  4JA9 A;  1Q2Z A;  1O1R A;  3I3N A;  4MRU A;  3EUV A;  4HRL A;  4AY6 A;  5EX0 A;  4TUU A;  4WWO A;  4GZD A;  4JC8 A;  2XGO A;  1Z3X A;  3ZHE A;  3QNK A;  3HVE A;  4FLB A;  4GU5 A;  1Z6T A;  1HF8 A;  4XZ4 A;  3IXE A;  1UN8 A;  2F8X K;  3U9W A;  4I9E A;  2XCB A;  5KCM A;  3JXI A;  5BNW A;  3QJZ A;  1E7V A;  3VTY A;  3PRZ A;  5JA4 D;  1N9A A;  4FUL A;  3W9G A;  4UWH A;  3UKR G;  4FC8 A;  3L82 A;  4I1M A;  4JB8 P;  5LCW J;  1UN9 A;  2GRR B;  3LXU X;  3MGB A;  5AAR A;  2H6H A;  1G3N B;  4CGV A;  2ETA A;  1NFI E;  2R2L A;  2LAI A;  4BES A;  4LG6 A;  3LY7 A;  4XEI G;  2LSV A;  1NL4 A;  4HRN A;  1E90 A;  3L9T A;  3CVV A;  2LXM A;  1OT8 A;  2KAT A;  4U0S A;  3U3W A;  4BFR A;  3FUH A;  4XE0 A;  4G24 A;  1NA0 A;  3Q4A B;  1NI1 A;  3HIZ A;  4UQZ A;  4PUC A;  4U96 D;  3SFZ A;  2DZO A;  3P1U A;  3ZNG A;  1O5M A;  2WXK A;  4JZY A;  3G2V A;  4XKB A;  1U2V G;  4DUI A;  3TWQ A;  4AXH A;  4LCT A;  5FZS A;  2ZXW E;  2OVB A;  1K1B A;  3VLE A;  4JHK A;  5EX3 A;  5H7P A;  1MJ0 A;  4ILG A;  3NF1 A;  5ENT D;  3HVE B;  5DBK A;  2QC9 A;  4NUR A;  2XPI A;  4ABN A;  5FTP A;  3MA5 A;  3DXM G;  5C1D A;  4OAV B;  3NOC D;  5FZQ A;  3DEO A;  1ZB1 A;  1PAQ A;  4GB9 A;  4U07 A;  4GYY A;  1FVF A;  5EN5 D;  2ETB A;  4ZHB A;  3PUK A;  3KSL A;  3UKU G;  4JVS A;  3LPZ A;  4UQX A;  5EID A;  5HRY A;  1S70 B;  1AP7 A;  3Q79 A;  3IV0 A;  2VGE A;  1H2U A;  2GRN B;  3ESL A;  4UWG A;  2E2E A;  2FF4 A;  3CK7 A;  1ELW A;  3G2T A;  4KYO B;  1N52 A;  1JWF A;  1WG0 A;  5FIN A;  1A5E A;  3CHR A;  4YVQ C;  4GTQ A;  1E7U A;  2QYU A;  2L6B A;  2HYZ A;  3SGH A;  4G2V A;  2PM7 A;  1N0R A;  4WNG A;  4B89 A;  3HXC A;  3DST A;  4N3B A;  3PRE A;  3UQ3 A;  5CED B;  3HHM A;  2V5Q C;  4LSZ E;  1PY1 A;  2P9S G;  1TYQ G;  3ULE G;  4CGW A;  5LOZ A;  5JJ7 A;  2PNN A;  4GPM A;  1LD8 A;  4Z68 A;  3FU0 A;  2OVF A;  4JHR A;  2PQN A;  5T4Y A;  3MZL B;  3CLJ A;  4WNF A;  3EJN A;  3SNX A;  4HFG A;  1D9S A;  2WXF A;  3C3Q A;  3ZXP A;  3KEA A;  3L16 A;  2WXO A;  2KXP C;  2IY0 C;  4EQF A;  3UIN C;  5JHB A;  1QBQ A;  3QK0 A;  4JXT A;  3CV0 A;  4CDM A;  4EPZ A;  2EIJ E;  4K0R A;  3D9L A;  4KVM A;  3TG5 A;  2JAB A;  3FEX A;  5D0O D;  3RO3 A;  2XEE A;  2LAH A;  4XI0 A;  3Q7F A;  3S7F A;  3VLD A;  3D9J A;  2IU1 A;  4JPS A;  4WAF A;  5CMW A;  3SBS A;  5J90 A;  2P2C P;  2XGS A;  5ENR D;  3R7Q A;  1LTX A;  4GML A;  3ZXS A;  2P9K G;  3ASO E;  5AQA A;  4HOU A;  1Z5S C;  4UWL A;  2CFZ A;  4JEH A;  2AW6 A;  1FT1 A;  4ME2 A;  1FPP A;  1JPL A;  4CCA A;  2V5F A;  5C2Y A;  5BV1 A;  3NZU A;  1SA4 A;  3LVR E;  3UX4 A;  4O6F A;  5CCM A;  1BPO A;  3EU5 A;  1Z3Y A;  4B8A A;  1B89 A;  2R02 A;  2RKK A;  4N2S A;  4E6H A;  4IRU A;  4URK A;  1UJJ A;  4ATZ D;  3TWT A;  1MHQ A;  3CQG B;  2RFA A;  2ZGD A;  2KM4 A;  2AXU A;  1YMP A;  2L9B A;  1V54 E;  2P9P G;  2X6J A;  2IFU A;  3CVN A;  3ZPJ A;  5AJD A;  3SZ7 A;  2VTB A;  3CVW A;  2WM9 A;  3QKY A;  5JJ6 A;  2AXV A;  2XQ0 A;  1IHB A;  4IN3 B;  5E75 A;  1KLX A;  3DSU A;  4RVB A;  1ZBP A;  1DNP A;  2NSZ A;  3IHV A;  2KCL A;  2XZD G;  4BTB A;  3P2B A;  5KBA A;  3ABL E;  3RRU A;  3KEZ A;  4K5A B;  2BF0 X;  3X2Q E;  3D9H A;  1SVX A;  1HXI A;  2LO6 A;  3VLF A;  3ASF A;  4DI4 A;  4BEP A;  2EIK E;  4UI9 J;  4UUC A;  3PNL B;  2LUH A;  3CVQ A;  4CT0 A;  2FBN A;  4GYO A;  4ATG A;  3EDT B;  1Y6I A;  4GAA A;  4GZC A;  1HZ4 A;  3B7S A;  3FUK A;  1RW2 A;  2GRP B;  2GRM A;  3IHY A;  3ZYQ A;  1UJK A;  1HX8 A;  2X6H A;  3LY8 A;  1N4R A;  5AQ9 A;  2Y69 E;  4K5C A;  2Y4T A;  4Q94 A;  1TNZ A;  2WXG A;  4AOF A;  4G8K A;  4N2Q A;  5FWQ A;  3JXJ A;  1K1A A;  4U0U A;  4I1O B;  3ABM E;  4F53 A;  1SZ9 A;  3SQV A;  3S7J A;  3TWU A;  1MX2 A;  3B7R L;  3BQO A;  4I43 A;  4YND A;  3D9N A;  1N94 A;  4FAD A;  3SFY A;  3FTZ A;  2YQ8 A;  2P9I G;  2IF4 A;  3V30 A;  3MV2 B;  3FTS A;  3LY9 A;  3TGO A;  3AS5 A;  4QQI A;  2VGX A;  4BSZ B;  3DSS A;  2XHE A;  4Y6W A;  3KS2 A;  4NIK A;  3EHM A;  2J8S D;  5D66 A;  2KCV A;  3MKQ A;  5IY5 E;  2J4B A;  4FU3 A;  5CRU A;  5T8I A;  1N11 A;  4GPK A;  1K3Z D;  3AAA C;  4DX6 D;  4A1S A;  3B7U X;  2DWZ A;  2RD0 A;  2V8S E;  2KZT B;  5J08 A;  3APF A;  1FT2 A;  3CVY A;  4CT4 A;  1H19 A;  3EHR A;  5ARF A;  2P9L G;  4U0Z A;  1SZA A;  3QDN A;  2FO7 A;  1NZN A;  3IKO B;  3UXG A;  3CVP A;  5A7D B;  2PM6 A;  3L08 A;  1LD7 A;  2OND A;  1OWM A;  2V0P A;  3FUD A;  4TXQ A;  1O1T A;  4TXP A;  3ZW3 A;  3V79 K;  3QB2 A;  3BG0 B;  2BUG A;  2Y0B G;  2OOE A;  1IXV A;  1FCH A;  3ZVV A;  5JMN D;  4IYP A;  5AQ7 A;  4J8D A;  4HI8 A;  1SW6 A;  5BW8 C;  3J5Q B;  2X6K A;  3AU4 A;  5CCL A;  3VTX A;  2YHC A;  5FQ8 A;  2DVW A;  1YCS B;  3CVU A;  4LER A;  2AWI A;  2XS8 A;  4FA6 A;  2DZN A;  4PH4 B;  3ZN3 A;  4JD2 G;  4XIF A;  2RFM A;  3E33 A;  5LCW C;  3FU5 A;  1OCO E;  3O48 A;  1HFA A;  1HE8 A;  1XNF A;  3EIQ C;  5ITZ F;  3T5V A;  3ZHE B;  4BSX A;  3L17 A;  3U66 A;  4OYS A;  1H2V C;  3FUL A;  2KZT A;  2E0I A;  2FUL A;  1UG3 A;  2WMN A;  3ZKJ A;  3CK9 A;  1KT1 A;  2X3M A;  1U3D A;  3CHO A;  3R7R A;  1IQR A;  3V31 A;  1A17 A;  4JA7 A;  1OWO A;  4JHJ A;  1JUQ A;  2R59 A;  2XRZ A;  3AG4 E;  4YVO A;  4N39 A;  2RG8 A;  4LNU D;  3FHE A;  2Q7F A;  3AS4 A;  5EYL A;  4O60 A;  5ANL A;  3UMV A;  2MHK A;  2WQ6 A;  4GA1 A;  1H6P A;  1TJC A; 
#chains in the Genus database with same CATH homology
 3D9O A;  3RKV A;  4ANV A;  2V4L A;  1QQE A;  4MLP A;  1DVP A;  5DIZ A;  4F1S A;  3L16 A;  3ZIM A;  1NP7 A;  2WXO A;  5BPP A;  4U04 A;  3BEE A;  4WND A;  1Y8M A;  2WXP A;  4L2Y A;  4AVX A;  4EQF A;  5JHB A;  1U3C A;  3CQC B;  1QZ2 A;  3ZYM A;  2CFU A;  3QK0 A;  4JXT A;  2J49 A;  3SF4 A;  3T8M A;  4N3C A;  3CV0 A;  3G2W A;  3LVQ E;  1EPU A;  4FJZ A;  4I6G A;  4CDM A;  2VGX B;  5HQ8 A;  2ZU6 B;  4EPZ A;  4A3V A;  4DPR A;  1KT0 A;  4GZ3 A;  2J4D A;  3FTV A;  2FI7 A;  3CK8 A;  2JLB A;  2VSN A;  3N71 A;  3D9L A;  4K0R A;  4KVM A;  4AM9 A;  5CMY A;  2L6J A;  4BY6 A;  2BTD A;  3TG5 A;  3Q49 B;  1OUV A;  4EZJ A;  2UWJ G;  5BUZ A;  4WWN A;  4GZ6 A;  4Q69 A;  3FEX A;  3PZD A;  3JYS A;  5D0O D;  2QFC A;  3RO3 A;  3JCK C;  3OXF A;  2J09 A;  2LAH A;  4XI0 A;  3RRN B;  3S7F A;  3VLD A;  2A5U A;  3D9J A;  5D0Q D;  2IU1 A;  4EBA A;  3FUN A;  4JPS A;  4WAF A;  4NAC A;  5CMW A;  1H6K A;  3PEV B;  3SBS A;  2HR2 A;  5T3R A;  4ACK A;  4PS8 A;  4I6J A;  4J8E A;  5J90 A;  3RK6 A;  3U4T A;  2XGS A;  5LFA A;  2XPZ A;  3FDH A;  4U8H A;  2CHW A;  3R7Q A;  4F3V A;  3PE3 A;  3RJV A;  2WXJ A;  4ILI A;  2PZI A;  2NC9 A;  3CKC A;  4GML A;  4J6I A;  1OWL A;  4I2Z A;  4Q96 A;  4TV3 A;  2OV8 A;  3FY4 A;  2J07 A;  4FHK A;  3ZXS A;  4HOU A;  4KZ0 A;  1SQM A;  2QY7 A;  2YHE A;  2L0I A;  3U64 A;  4C0E A;  3CVL A;  4G11 A;  1HU3 A;  1HO8 A;  2WVI A;  5G55 A;  5CHE E;  4G25 A;  3C98 A;  4UWL A;  2HO1 A;  3ZFW A;  2CFZ A;  4JEH A;  2I2O A;  2AW6 A;  1EF1 C;  2I6H A;  3FTX A;  3HYM B;  5A6C A;  2LNI A;  2WQH A;  4ME2 A;  1E8W A;  5KJM A;  4PDX A;  1JPL A;  3R9A B;  4CCA A;  2V5F A;  5C2Y A;  3FP3 A;  1EDU A;  3KAE A;  2DBA A;  5BV1 A;  1HG5 A;  3NZU A;  5G05 C;  1TJF A;  3T5X A;  3LVR E;  5BV0 A;  4EZK A;  3UX4 A;  4O6F A;  5CCM A;  3ML9 A;  3D9K A;  1BPO A;  2MRI A;  3RU0 A;  4G26 A;  2UY1 A;  2VSO E;  4B8A A;  1Z3Y A;  3B7T A;  1B89 A;  4HLE A;  4N2S A;  4E6H A;  4IRU A;  4URK A;  1UJJ A;  3L54 A;  4BWR A;  3MKQ B;  3QAR A;  3QAQ A;  1MHQ A;  3CQG B;  4ANW A;  3L13 A;  4JL0 A;  2J08 A;  3SBT B;  2X6I A;  2GW1 A;  2XPY A;  3MJW A;  2KM4 A;  4BT9 A;  3OXL A;  2AXU A;  4LUN U;  4UQY A;  2AVP A;  4J8S A;  2L9B A;  3RO2 A;  3CEQ A;  2X6J A;  3UT8 A;  3SD5 A;  3ZGQ A;  2C0M A;  2VSY A;  4LEU A;  2IFU A;  3CVN A;  1EYH A;  3ZPJ A;  5AJD A;  3EHN A;  4MKT A;  4OVV A;  3S7D A;  3SZ7 A;  4L1B A;  2VTB A;  5FJY A;  2R5S A;  4KZC A;  3ML8 A;  3CVW A;  3FUI A;  4RG6 A;  2WM9 A;  3QKY A;  5JJ6 A;  4ILH B;  2AXV A;  2C0L A;  2VGY A;  2XQ0 A;  3ENE A;  3L6A A;  4GMJ A;  3RRM B;  4RSY A;  4FHJ A;  3LEW A;  3PH0 C;  4IN3 B;  3DBS A;  2IJG X;  5E75 A;  4A1G A;  4H7Y A;  4E85 A;  1KLX A;  2Y4U A;  4NQ0 A;  1E8X A;  2X38 A;  2YIN A;  2XEV A;  3B13 A;  4RVB A;  4U63 A;  1ZBP A;  1DNP A;  2NSZ A;  5AIJ A;  4MS6 A;  2VJ8 A;  1FVH A;  4N3A A;  5JHA A;  3IHV A;  2KCL A;  3ZYK A;  3OXG A;  3I4G A;  3SHF A;  1IYG A;  4KBQ A;  4BTB A;  3P2B A;  3LJ3 A;  3ZRH A;  3WXX A;  2VQ2 A;  3RRU A;  3KEZ A;  1WM5 A;  1VDY A;  3CR3 A;  5E76 A;  1N54 A;  3ONL A;  1E8Y A;  2BF0 X;  3BG1 B;  2L0T B;  5FQ7 A;  3URZ A;  1HXI A;  4GA0 A;  4J8F A;  4P29 A;  2LO6 A;  3VLF A;  1L5J A;  3ASF A;  4DI4 A;  4UI9 J;  4L23 A;  4UWK A;  5FQ6 A;  3I4R B;  3PNL B;  3CVQ A;  3FTU A;  4CT0 A;  4KVO A;  2FBN A;  3FWV A;  4GYO A;  1W3B A;  4L2L A;  4ATG A;  4Y6C A;  3EDT B;  1Y6I A;  3JQ0 A;  4GAA A;  3UT7 A;  4GZC A;  3D3M A;  4I6E A;  3CHS A;  3TXN A;  4BT8 A;  2WXH A;  1HZ4 A;  3B7S A;  1PC2 A;  3FUK A;  4WUY A;  4FLH A;  3FU3 A;  3Q5M A;  2I1J A;  3QWV A;  4PS3 A;  3CVX A;  3D9M A;  4ACL A;  2GRM A;  3IHY A;  5KJK A;  4BX9 A;  3ZYQ A;  1UJK A;  1HX8 A;  3CHQ A;  3LYA A;  2X6H A;  3LY8 A;  4UI9 C;  4WWP A;  5ENN A;  4ANX A;  2CG3 A;  2NXP A;  2Y4T A;  4Q94 A;  2WXG A;  3D9P A;  3QC1 A;  4AOF A;  2WXI A;  2PQR A;  3ASD A;  3FFL A;  4OVU A;  4EZL A;  4N2Q A;  5FWQ A;  3ZEF A;  3PE4 A;  4L7T A;  3AU5 A;  4U0U A;  3LCA A;  4I1O B;  2XGM A;  4JA9 A;  4AV7 A;  4F53 A;  4F7A A;  3I3N A;  4MRU A;  3RIB A;  3PEU B;  1SZ9 A;  1HS6 A;  4AY6 A;  5EX0 A;  3ESK A;  3S7J A;  4XI9 A;  3ASG A;  4TUU A;  4WWO A;  2UY1 B;  3B7R L;  3ONK A;  4GZD A;  3KD7 A;  3HDX A;  4GCN A;  4I43 A;  4NRH B;  4JC8 A;  4A3T A;  4CRW A;  2XGO A;  4YND A;  3D9N A;  4AP2 A;  1OWN A;  1Z3X A;  4AEZ C;  3JQ1 A;  4DJA A;  3ZHE A;  2XCC A;  2P58 C;  4I17 A;  4FAD A;  1JWG A;  3QNK A;  2GGF A;  2WXR A;  3HVE A;  4GA2 A;  3UPV A;  4FLB A;  4GU5 A;  2XRY A;  3FTZ A;  1Z6T A;  2C2L A;  2YQ8 A;  4APF A;  1HF8 A;  2IF4 A;  3FU6 A;  3MCX A;  3APD A;  4B8C B;  2VYI A;  2WXN A;  3MV2 B;  4XZ4 A;  4EEC A;  3FTS A;  1UN8 A;  1E8Z A;  3LY9 A;  3TGO A;  3U9W A;  3AS5 A;  4I9E A;  3FH8 A;  4I1A A;  4D10 C;  2XCB A;  2VGX A;  5BT1 A;  5KCM A;  5BNW A;  3OAW A;  2VTB B;  4B0Z A;  3QJZ A;  1E7V A;  2KCK A;  2XHE A;  1YA0 A;  3Q47 B;  3VTY A;  4EBA G;  3PRZ A;  3DPD A;  4Y6W A;  3KS2 A;  3MX3 A;  3Q15 A;  4FUL A;  3PUJ A;  2MOW A;  4UWH A;  2FEZ A;  5JJT A;  2AXZ A;  3EHM A;  3FH7 A;  4HVB A;  2KCV A;  3MKQ A;  4FC8 A;  5G2N A;  3IEG A;  3QWW A;  4I1M A;  2A4Z A;  5LCW J;  1HG2 A;  5HI7 A;  3ZYL A;  2J4B A;  5AJL A;  1UN9 A;  2GRL A;  4FU3 A;  2I1K A;  3MV3 B;  4N5C A;  4XX5 A;  5T8I A;  4G23 A;  3LXU X;  4GPK A;  1WAO 1;  4TRQ A;  4A1S A;  3B7U X;  3IBE A;  4ANU A;  2R17 C;  2RD0 A;  3UUX A;  3MGB A;  4B94 A;  3LDZ A;  1LF8 A;  1S0P A;  2KZT B;  2V8S E;  4CGV A;  5J08 A;  3APF A;  3G2U A;  3FTY A;  2LAI A;  2PL2 A;  3LY7 A;  3CVY A;  4CT4 A;  1H19 A;  4AIF A;  2LSV A;  2YNQ A;  3PNT B;  1E90 A;  3PS6 A;  5ARF A;  2X6F A;  4G1T A;  4KXK B;  2CHX A;  3CVV A;  3JUI A;  2KAT A;  4U0S A;  3CHP A;  3TJP A;  3U3W A;  4BFR A;  4IUL A;  4U0Z A;  1SZA A;  3FTW A;  3FUH A;  3GW4 A;  3QDN A;  4XE0 A;  4DLQ A;  2FO7 A;  2ION A;  4G24 A;  1NA0 A;  3Q4A B;  3FUM A;  1NZN A;  3IKO B;  4I9C A;  1WY6 A;  4GYW A;  3HIZ A;  3CVP A;  4UQZ A;  1QNF A;  3GZ2 A;  5A7D B;  4PUC A;  2PM6 A;  3TXM A;  3L08 A;  5FQ4 A;  2DIW A;  3SFZ A;  4H7X A;  4JEU A;  4KT6 B;  3P1U A;  2OND A;  1OWM A;  3MKR A;  4DK5 A;  5A23 A;  5EKQ D;  2WXL A;  4JZY A;  2WXK A;  3G2V A;  4LRZ A;  4RG9 A;  4XKB A;  2V0P A;  3CSF A;  1UW4 B;  3FUD A;  4PS7 A;  2WPV A;  1IQU A;  1GW6 A;  3AS8 A;  3CST A;  3QOU A;  3ZW3 A;  3QB2 A;  3BG0 B;  3MYV A;  2BUG A;  4AJW A;  2OOE A;  4AXH A;  1FCH A;  4LCT A;  4CEM A;  3FUE A;  5FZS A;  3UT4 A;  2EQX A;  4KMO A;  2OVB A;  2WQ7 A;  3ZVV A;  4IYP A;  3VLE A;  4J8D A;  4JHK A;  5EX3 A;  3S7B A;  3FEY A;  1ELK A;  3ASH A;  1ELR A;  4ILG A;  5BW8 C;  2X6K A;  3AU4 A;  5CCL A;  3FUJ A;  3NF1 A;  3VTX A;  3HVE B;  5DBK A;  3TG4 A;  2YHC A;  5FQ8 A;  4NUR A;  4UWF A;  2XPI A;  3FH5 A;  1OWP A;  3MEK A;  4ABN A;  4HS2 A;  2VSX E;  4LER A;  3CVU A;  4C0M A;  2AWI A;  4FP7 A;  5FTP A;  3MA5 A;  4HOQ A;  4FA6 A;  5C1D A;  5FZQ A;  1HH8 A;  1MQS A;  5LP0 A;  1H2T C;  5ARG A;  4GB9 A;  1PAQ A;  4I2W A;  5AYW D;  4U07 A;  4BX8 A;  4GYY A;  3CGH A;  4HOR A;  4PH4 B;  5LX8 A;  4GZ5 A;  1FVF A;  3ZN3 A;  5KJN A;  3PUK A;  3EIJ A;  3LKU A;  4HXI A;  4JVS A;  4UI9 K;  4XIF A;  3LS8 A;  3LPZ A;  4GCO A;  4V3I A;  5FZR A;  3OTN A;  4DLO A;  2Y3A A;  4UQX A;  5G04 J;  1ZU2 A;  2IQC A;  5LCW C;  3FU5 A;  4WNE A;  3O48 A;  5EDS A;  2IOS A;  1HFA A;  1HE8 A;  2DCP A;  3D9I A;  1XNF A;  3IV0 A;  3EIQ C;  3APC A;  3CHM A;  4APO A;  3T5V A;  3ZHE B;  1H2U A;  3ESL A;  3PVL A;  4UWG A;  4DI3 A;  4K03 A;  2E2E A;  1P5Q A;  2FF4 A;  1ELW A;  2HM8 A;  2ILR A;  3CK7 A;  3SI5 A;  3G2T A;  3L17 A;  4R7L A;  4BSX A;  1XGW A;  3U66 A;  1E96 B;  2J9Q A;  4OYS A;  1H2V C;  4KYO B;  1N52 A;  3FUL A;  5KJL A;  2WB2 A;  1NA3 A;  3CKB A;  1H0A A;  1JWF A;  2KZT A;  2E0I A;  3O4Z A;  2FUL A;  1UG3 A;  2WMN A;  3CK9 A;  4HOT A;  3CHR A;  1KT1 A;  4A55 A;  4YVQ C;  2X3M A;  4CDR A;  1IHG A;  3K9I A;  3NZS A;  1U3D A;  3CHO A;  2WXM A;  1E7U A;  3R7R A;  3I5P A;  3L22 A;  4XKC A;  1IQR A;  3S2A A;  3FUF A;  3PDN A;  2HYZ A;  4J0U A;  1INZ A;  3NQP A;  1A17 A;  2IOL A;  3GZS A;  2WMO A;  3SGH A;  4JA7 A;  1OWO A;  4G2V A;  3E4B A;  4CDN A;  4BTA A;  2PM7 A;  2WXQ A;  4JHJ A;  3GZ1 A;  4WNG A;  5G04 C;  4B89 A;  2M63 A;  1JUQ A;  2R59 A;  4N3B A;  3PRE A;  3UQ3 A;  2I9C A;  2XRZ A;  3GYZ A;  5FT9 A;  4HOS A;  3HHM A;  5M72 A;  2LSU A;  4YVO A;  4JW1 A;  1PY1 A;  4N39 A;  4FJY A;  2RG8 A;  1X5B A;  3QWP A;  2JEK A;  4QFV A;  4CGW A;  2KC7 A;  5LOZ A;  5JJ7 A;  3FHE A;  5ANR A;  2Q7F A;  3G2S A;  3TL5 A;  3FU0 A;  3AS4 A;  2OVF A;  2CHZ A;  4W9R A;  1TEZ A;  4JHR A;  2PQN A;  5T4Y A;  3MZL B;  3CIA A;  3ULQ A;  5ANL A;  3UMV A;  4AY5 A;  4M3O A;  3CLJ A;  3TAX A;  2MHK A;  4C9B B;  2WQ6 A;  4WNF A;  3EJN A;  2CG2 A;  4GA1 A;  3SNX A;  4HFG A;  5AEN A;  2WXF A;  1TJC A;  5G05 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...