2C0LA

Tpr domain of human pex5p in complex with human mscp2
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
305
structure length
292
Chain Sequence
HPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/receptor
total genus 116
structure length 292
sequence length 305
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0lA00
3SF4A 4CGWA 5KJLA 5KJKA 4N2QA 3QWWA 2VYIA 1FCHA 4HOUA 3TG4A 4JHRA 3ASDA 3LY8A 2QFCA 4XIFA 5DIZA 2VSNA 2VSYA 4G26A 4YVQC 4WNDA 1ZU2A 3MV2B 4GA0A 3CVLA 4U0ZA 4I9EA 3ZFWA 5CCLA 2FBNA 4U0UA 2XGMA 5BW8C 4UI9K 3QWPA 5G05C 4A1SA 3OXLA 5FZQA 4AY5A 2DBAA 3KS2A 4U0SA 3UQ3A 3CEQA 4ABNA 5D0OD 4B94A 4I17A 3R9AB 2R5SA 2NC9A 4APOA 2E2EA 4G2VA 3QWVA 4JA7A 5G05J 3ZGQA 4I2ZA 4N5CA 1ZBPA 4J8FA 2XEVA 4N3BA 4GYYA 2Y4TA 1KT0A 1P5QA 2C2LA 5BT1A 4HOSA 2OOEA 5HI7A 4GYWA 3MEKA 4XI9A 4AY6A 4RG6A 2PZIA 3CVPA 2BUGA 3EDTB 3WXXA 4BTBA 5EX0A 4GCNA 5EX3A 1KLXA 2VGYA 3ASFA 5KJNA 4JL0A 5FZSA 4BT9A 4U07A 4HOTA 5FT9A 2XCCA 3RO2A 4LEUA 5BNWA 2Q7FA 2PQNA 3IEGA 2PL2A 2J9QA 4CGVA 5LCWC 4G25A 3S7JA 4BWRA 3CV0A 4YVOA 3U3WA 3MKRA 5M72A 2Y4UA 4J8EA 1WAO1 3O48A 3RJVA 4BT8A 3ASHA 2FF4A 2KATA 3ZHEB 2XGSA 5FJYA 3QOUA 5AYWD 1HH8A 3ESKA 1A17A 4G23A 4W9RA 3BEEA 2C0MA 3FFLA 1YA0A 2WPVA 1NA3A 3PDNA 2XGOA 5ARFA 3Q15A 5LCWJ 2KC7A 4U04A 3ZN3A 3CKCA 3KD7A 2LNIA 2PQRA 3CK8A 2FI7A 2UY1A 3FWVA 3QKYA 5DBKA 5A7DB 3CVNA 4AIFA 4GCOA 5JJTA 3S7BA 4G1TA 2YQ8A 3TAXA 1QZ2A 5JJ6A 3RU0A 1NZNA 5EKQD 4Y6CA 4GA1A 2AVPA 1HXIA 3FP3A 2ONDA 1PC2A 4CDRA 2I6HA 3NF1A 4HOQA 3Q49B 3GZ2A 3E4BA 4J8DA 5FTPA 3PE4A 2KCKA 3OXFA 1WM5A 2VGXA 3K9IA 4YNDA 4F3VA 4N39A 3MV3B 4KXKB 3LPZA 3KAEA 3RO3A 3Q4AB 4NQ0A 3ASGA 3ULQA 4G24A 5G04C 3SZ7A 3LKUA 1NA0A 4H7XA 1KT1A 4GYOA 3URZA 4I1AA 4BTAA 4UQYA 1W3BA 3RKVA 4AM9A 4JA9A 2FO7A 4I9CA 4UI9J 4IN3B 4I2WA 3PE3A 1IYGA 2LSUA 3LY7A 2IFUA 5G04J 4WUYA 3UUXA 3JYSA 5CCMA 3U4TA 1HZ4A 2HR2A 4N3CA 5C1DA 3LYAA 3CK9A 1ELWA 4XI0A 5CHEE 3GZ1A 2LSVA 2FEZA 4WNEA 2VGXB 2JLBA 5D0QD 3VTYA 2UWJG 2HYZA 2WQHA 2L6JA 4RG9A 4H7YA 4WNGA 3HYMB 4ME2A 4Y6WA 4WNFA 3CVQA 4UQZA 2XCBA 3AS4A 4N2SA 2XPIA 3RIBA 4GPKA 2VQ2A 4O6FA 5FZRA 4KYOB 2IF4A 2KCVA 3AS8A 3MA5A 4GZ3A 2V5FA 3LY9A 4GZ5A 1ELRA 1E96B 3TG5A 5HQ8A 3ZHEA 5A6CA 5KJMA 4UI9C 4HORA 2HO1A 1QQEA 5JJ7A 4EQFA 4N3AA 4KBQA 1TJCA 2YHCA 3S7DA 3CKBA 2GW1A 3Q47B 3AS5A 4GA2A 3OXGA 4J0UA 1B89A 3ZPJA 4GZ6A 2P58C 5ARGA 2C0LA 3Q5MA 3CK7A 3S7FA 1OUVA 2UY1B 2MHKA 4NRHB 1IHGA 1XNFA 3N71A 3VTXA 3TGOA 1Y8MA 2KCLA 3GW4A 3QDNA 4UQXA 3UPVA 3GYZA 3LCAA
chains in the Genus database with same CATH superfamily
2WXJA 4L7TA 2L0IA 3SFZA 3QARA 4PS7A 5H7PA 4N2QA 3QWWA 3OTNA 2VYIA 3SGHA 1TNYA 2QFCA 1PY1A 3V2XA 3JUIA 2BKGA 4O1PA 4DX2A 3ZFWA 5FQ7A 2FBNA 2ETBA 5EYPF 4ILHB 4C0MA 4ZHBA 2VSXE 1TNUA 3Q7AA 4A55A 2DBAA 3KS2A 4U0SA 3ML9A 4PH4B 5T8IA 3ML8A 3CSTA 4EZKA 4WWNA 5T4YA 4B94A 1MZCA 2WM9A 3PVLA 4XEIG 4FU3A 5BPPA 4HQDA 2GGFA 4APOA 3J5QB 2Y69E 1JUQA 4J6IA 1YYHA 3TWRA 3ISMC 2H6FA 3ZGQA 2RKKA 2WXHA 4I2ZA 3QB2A 4IRUA 3PZ4A 2LAIA 1N9AA 2XEVA 4N3BA 4J8YA 1N4SA 1MX6A 4HOSA 4F53A 3UINC 3MEKA 2HM8A 3FEXA 2Y1LE 2KBXA 2YHEA 2BUGA 3MCXA 3NB2A 2XPZA 2ETCA 3V79K 2R05A 1NFIE 2AXVA 3C5RA 5EX0A 5D2MC 3DSUA 3HXDA 4GCNA 4GMLA 2VSOE 5KJNA 4DX6D 4JL0A 3BU8A 3T9KA 1FVFA 1V55E 3PRZA 3RRNB 3PUKA 3QNKA 3DRAA 1K1BA 3ABKE 3FUHA 2WQ7A 1H0AA 2E0IA 4ILIA 1IQUA 1QYMA 4MLPA 2PQNA 3EIJA 5CRVA 4CT4A 4UWFA 2WB2A 3Q73A 4YVOA 2VJ8A 1H2VC 3RJVA 4K0RA 2WXOA 3FU6A 3L16A 4B8AA 5AYWD 4I43A 1HH8A 3ESKA 4FULA 4G23A 4W9RA 1TYQG 3FFLA 1YA0A 3ZRHA 3NBNB 3PDNA 3Q79A 2RD0A 3KD7A 3GZSA 4DJAA 3PEVB 5DBKA 3ZW3A 3W9GA 3FTUA 3LDZA 4AIFA 4I6EA 5JJTA 3JXIA 4HNAD 2VTBB 5JJ6A 4I1OB 3B13A 4QFVA 4HB5A 4GA1A 2AVPA 1NP7A 1HXIA 3FTVA 2ONDA 3G2VA 5JHBA 2DWZA 3G2SA 3CHQA 5EIBE 4DX1A 3I3NA 2KZTA 3Q75A 4HI9A 4LRZA 2GRMA 3LXUX 4EHMA 1WM5A 3FDHA 5CEDB 4YNDA 4N39A 1OXJA 3RO3A 5EYLA 3ULQA 3DEOA 4G24A 3SZ7A 3SNXA 4H7XA 5FQ8A 1OT8A 5J08A 4JA9A 4KZCA 3RSEG 4EBAA 1U3DA 3TXMA 4I2WA 5CBOA 3LY7A 1OCRE 1HG2A 1U2VG 1N94A 5G04J 4NACA 2X6IA 4YDWA 1Z3YA 3ZKJA 3AJIA 5ENSD 3LS8A 1E90A 3C72A 3ZYMA 3JQ1A 5C1DA 5CEAA 2KM4A 3UT8A 4XE0A 2YINA 2I2OA 2WXFA 3DXMG 3RRUA 4XI0A 4JXTA 3DSWA 4JPSA 3GZ1A 3UMVA 2FEZA 1FVHA 4WNEA 1SW6A 1IQRA 4L2LA 4DK5A 5HKPA 2L9BA 2EIME 5D0QD 3VTYA 2HYZA 4KVMA 3HVEA 2WQHA 1YCSB 3HYMB 4ME2A 4WNFA 1A5EA 2CG2A 3DEPA 3FUDA 3SHFA 3BG0B 3MJWA 2CFZA 4BSZB 2WVIA 3AS4A 2ZU6B 4N2SA 2XPIA 3RIBA 4GPKA 5FZRA 4TXQA 4KT6B 2WXPA 3DBSA 4GZ3A 4ANXA 4GZ5A 1E7UA 2WXRA 4LCTA 2P9UG 3LVRE 3UT7A 1DCQA 3ZHEA 5KJMA 4UI9C 4HORA 4F1PA 2HO1A 2P2CP 4GU5A 3TWWA 4KBQA 4O1OA 4GMRA 4TUMA 4MRUA 3TXNA 1HU3A 1D8DA 5BUZA 4GZ6A 2C0LA 4WWPA 3CSFA 3TWQA 3SFYA 4EPZA 1H2TC 4GTQA 3APCA 1XNFA 2V0PA 2NYJA 1OY3D 4F6RD 3UIPC 3LCAA 3TWUA 2R02A 4YDOA 4J8SA 4FP7A 4TXRA 4FA6A 4CGWA 3EIQC 5KJLA 1FCHA 3TG4A 4JHRA 3CHOA 1BU9A 3C3OA 4V3IA 3DSXA 2WMNA 4DUIA 4IULA 4XIFA 5IY5E 5DIZA 2R2LA 2VSNA 1HO8A 4G26A 5AAOA 4WNDA 1ZU2A 3CVLA 5CCLA 1TJFA 5BW8C 1G3NB 3NOGD 4A1SA 4A63B 2I1KA 2WXIA 3HG0D 3JUEA 3WG7E 3UIOC 4TV3A 4ABNA 5CMWA 1Z6TA 1EF1C 3L6AA 2CG3A 3R9AB 4AXHA 2R5SA 1KPSB 3SO8A 2IQCA 3SI5A 3Q78A 2WXQA 5ENNA 3AU5A 5G05J 1MHQA 1MX2A 4N5CA 1TN6A 1TNBA 4LUNU 4TXPA 3F6QA 4LNUD 1KT0A 4HRLA 5CMYA 4P29A 2C2LA 2PM7A 4ATGA 4XI9A 3V31A 5LFAA 4RG6A 2L0TB 2F8XK 1OWNA 4RQIA 2AJAA 2QC9A 4Q69A 2DVWA 3VLEA 3HVEB 5CBNA 2VGYA 3VLDA 4L9PA 5FZSA 4K03A 1TNOA 4URKA 4BT9A 4U07A 4HOTA 3FEYA 5LX8A 3APDA 3E33A 4N5QA 3SY2A 3PNLB 1EYHA 4BX8A 2XS1A 4A3VA 1HG5A 1U3CA 3FTYA 5E76A 3BUAA 2Q7FA 4RVBA 3UKUG 3T5VA 2J9QA 5AARA 4I1MA 3JCKC 2R59A 2FO1E 2QY7A 2RG8A 4U7EB 3EHQA 2ZXWE 1IXVA 2V5QC 3C3QA 5M72A 4ATZD 3KEZA 4XKBA 4K5BA 3ZHEB 4HVBA 5FJYA 1N11A 3QOUA 3TL5A 1AP7A 3CVXA 4X8QA 1O5MA 1UOHA 2XGOA 5ARFA 3NZSA 4F1SA 4U04A 3ZN3A 3EJNA 4JEHA 3AG3E 4EZLA 1SA5A 2LNIA 2PQRA 3ABLE 4ILGA 2P9KG 3CVNA 4CDMA 3D9NA 5BV0A 5CECB 3S7BA 4E6HA 3TAXA 1HS6A 1NZNA 2HE0A 4Y6CA 3L82A 3NQPA 3EU9A 1Q2ZA 2I6HA 5ANRA 3ULYA 4FHKA 3NF1A 5ENTD 5AENA 2DZNA 1NL4A 3ABME 2QYUA 4J8DA 5AJLA 4YDYA 3MV3B 3LPZA 3B7RL 3IHYA 3O4ZA 4UWLA 4O60A 3ZU7B 4LNBA 5G04C 2H6IA 3IKOB 3LKUA 1DNPA 3ZXSA 3B7SA 4BTAA 1W3BA 3E34A 2GRLA 1MX4A 4G11A 4I9CA 3PE3A 1OCCE 1IYGA 1H19A 4FC8A 4ANVA 2IFUA 2GRRB 1LD7A 3E30A 4YDEA 1N0QA 4OVVA 3UUXA 3JYSA 3L54A 2MRIA 4U95D 2EQXA 4N3CA 4UWKA 4HBDA 2OCCE 2I1JA 4CEMA 5AN8A 5ENOD 4DI3A 1X81A 3CK9A 4K5CA 3L22A 2GRQB 4Q94A 4GTVA 5ITZF 4AJWA 4AVXA 3B7TA 4U63A 2JLBA 3V2OA 2OEWA 3HHMA 4HS2A 4RG9A 4H7YA 1NI1A 4LG6A 1L5JA 3FTSA 4UQZA 2P9LG 3FUEA 3PUJA 2DIWA 3CHMA 1E8WA 4O6FA 3D9IA 2IO2C 3ZEFA 3OAWA 1SA4A 4GZCA 2BEDA 1S70B 3D9MA 5LP0A 1S64A 3AU4A 4PS3A 5HQ8A 4BFRA 1IHBA 1JCRA 5A6CA 4OVUA 4NURA 3R9MA 4BETA 3UM2A 4N3AA 1TJCA 3S7DA 1QBQA 3CKBA 4ZFHA 2IJGX 5E75A 2EIJE 2GW1A 1SVXA 3DSTA 1Z3XA 3ZPJA 4ACKA 4TRQA 1TEZA 5EILA 5ARGA 3T5XA 5C2YA 3U66A 1BPOA 3AG4E 2ZGGA 2MHKA 5HS0A 2YNQA 3TJPA 3CVWA 5AQ7A 4MBGA 5ENRD 1DC2A 2KCLA 3GW4A 4GZDA 5FWQA 3GYZA 3FU0A 1WDYA 3DWLG 4GTSA 1OWMA 3SF4A 3DSVA 2OVBA 5KJKA 5EIDA 2GROB 3ASDA 1HF8A 3EHMA 5AQAA 1O1TA 3RRMB 3U9WA 1JWFA 4GA0A 4U0ZA 4CYMD 4JC8A 4NIKA 3QWPA 5G05C 5FZQA 1ZB1A 3E32A 5KWDA 2EILE 4OAVB 3HIZA 2XZTG 3ASOE 4Q96A 3FU3A 1Z5SC 2J08A 4LNGA 2NC9A 4WAFA 2XPYA 3IHVA 3NOCD 2M63A 2F8YA 1HE8A 4I6GA 3HDXA 5EN5D 2H6GA 2E2EA 3AG1E 3DPYA 3QWVA 2X6JA 3IXEA 4ANUA 4DLOA 3CVVA 3DSSA 3FTWA 4GTPA 3C98A 4JW1A 1DCEA 1K8KG 2EINE 2V8SE 4GYYA 2J09A 3Q9UC 3Q9NC 3DPDA 4GTOA 5G2NA 2MOWA 2CFUA 2WXMA 5FQ4A 2PZIA 3LEWA 2P9PG 5BXUA 3EDTB 3D9LA 4BTBA 3FULA 3CQCB 4Z68A 3I4GA 3S2AA 1RW2A 1KLXA 3ASFA 1OCZE 3B7BA 3PH0C 3QJZA 3P1UA 1TNZA 2DYSE 1FT1A 1JPLA 5FT9A 2P9SG 4DPRA 5D66A 3RO2A 4BSXA 2L6BA 1BLXB 3UI2A 2Y3AA 1WG0A 2BTDA 3FUKA 2F0YA 2PL2A 4BESA 4PUCA 4CGVA 1OCOE 4G25A 4C48B 4JVSA 2AWIA 2X3MA 3FTXA 4KZ0A 3X2QE 4BWRA 4CZ2D 3CV0A 1HX8A 2Y4UA 4J8EA 4FJZA 3O48A 4B89A 4HLEA 5KBAA 4GPMA 2J4BA 3ASNE 1A17A 3BEEA 2C0MA 1O1RA 2WPVA 4HI8A 1NA3A 3LJ3A 5LCWJ 4AP2A 3CKCA 3MKQA 2GRPB 2FI7A 3FWVA 1LF8A 3QKYA 5JMND 4B93B 3FUMA 3CVUA 1UN9A 5A7DB 1N95A 5J90A 2YQ8A 4CCAA 1QZ2A 3CGHA 3L17A 4U8HA 3RU0A 3R7QA 4JEUA 3FP3A 2IONA 1PC2A 5T3RA 4HOQA 1MJ0A 3HXFA 4L23A 2X6HA 4PDXA 2LUHA 3HXBA 4BEPA 1H6PA 4UWHA 3PE4A 3G2TA 3K9IA 4F3VA 3JXJA 4KXKB 3KAEA 4E85A 3Q4AB 2OVFA 3RAUA 3ZYQA 4MS6A 1NA0A 4F7AA 4RSYA 1KT1A 2QYJA 4MKTA 4I1AA 4UUCA 1BI7B 4BY6A 1KZPA 3KEAA 4A3TA 3ZVVA 4UI9J 1E8XA 5FQ6A 4IN3B 2LSUA 2V4HC 3FU5A 5ENPD 2DCPA 2WXLA 1JCSA 2Y0BG 2OEVA 3APFA 4WUYA 4JHKA 1HZ4A 2HR2A 3CVYA 2RFAA 4FADA 3FUIA 3SD5A 1S0PA 3I4RB 3LYAA 2QZAA 4B8CB 4DRXE 5AQBA 2ZGDA 5CRUA 4WWOA 3PZDA 1E8ZA 3QAQA 1Y6IA 3TWXA 3P2BA 4EZJA 3EUVA 5BV1A 3KSQA 1TN7A 2VGXB 2UWJG 5AJDA 2L6JA 1YMPA 4GTMA 2B0OE 4WNGA 5JHAA 4D10C 3MX3A 2OV8A 2J4DA 2X38A 3D9HA 3SFXA 2XCBA 2FULA 3ENEA 1WY6A 1OWPA 4EBAG 4JHJA 4KYOB 2IF4A 1HFAA 2KCVA 1N52A 3ZIMA 1JWGA 1ELRA 2IOSA 3ZYKA 2DZOA 3TG5A 1N0RA 4DX5D 3DXKG 1LTXA 4DX7D 4HRMB 3D9JA 3FY4A 3SQVA 4A1GA 5KNGA 4EQFA 4FJYA 3UM1A 5B1AE 3UKRG 4G8LA 2XENA 2R03A 2JABA 3Q47B 3AS5A 4GA2A 3FHEA 3J5PA 1AWCB 3EHNA 1B89A 4JD2G 2P9IG 3VLFA 3TWTA 2V4LA 5AIJA 3S7FA 3MKQB 3NZUA 3T8KA 2ILRA 2CHZA 4NRHB 4U8YD 3FUNA 3ONLA 1IHGA 5KNHD 3QDNA 4UQXA 1OWLA 3PZ1A 3UPVA 5A23A 3CLJA 5EDSA 2XQ0A 4L2YA 5B1BE 1H6KA 3PREA 4UWGA 4HOUA 4LSZE 1UN8A 3LY8A 1X5BA 2AXZA 1FT2A 2VSYA 4YVQC 2IOLA 2J49A 3MV2B 1FPPA 4I9EA 1N54A 4U0UA 2XGMA 2R17C 1PAQA 4UI9K 3W9FA 1MYOA 1EPUA 2A5UA 3OXLA 4AY5A 3UQ3A 2EIKE 3CEQA 3LVQE 3MZLB 3PEUB 2J8SD 2BF0X 1UG3A 5D0OD 1KZOA 2RFMA 4I17A 2NSZA 3FH8A 3NAWA 2AXUA 3MYVA 4G2VA 2I9CA 4JA7A 1EDUA 3V30A 2LO6A 2XRYA 4B0ZA 3L9TA 3AAAC 1ZBPA 2XEEA 4J8FA 2Y4TA 2IEJA 2XS8A 1P5QA 2F37A 1K1AA 4M7CA 5BT1A 3D9KA 2KXPC 2OOEA 5HI7A 5G55A 4GYWA 4ANWA 4AY6A 5KCMA 3CVPA 3FUJA 3PNTB 1UW4B 3C3RA 3WXXA 5JA4D 2A4ZA 4FLHA 5EX3A 2H6HA 3FUFA 2XEHA 3B7UX 5BXOA 2XCCA 1OWOA 4LEUA 5BNWA 3G2UA 4IYPA 1QNFA 3IEGA 3I5PA 3CR3A 3EU5A 3AG2E 5LCWC 5B3SE 3S7JA 4PS8A 3ZNGA 1O1SA 4AEZC 2BKKB 3U3WA 3MKRA 1E8YA 4C0EA 1IKND 4M3OA 1WAO1 1VDYA 3ASHA 3Q7FA 4BT8A 2FF4A 2KATA 2XGSA 1D9SA 4QQIA 3ZUVB 2VGEA 4EECA 2JEKA 4DI4A 1ELKA 1DVPA 4LERA 3CHPA 3Q15A 4AOFA 2KC7A 2PNNA 3HRAA 4HLLA 4JZYA 3CHSA 3FH7A 2IU1A 4GTTA 3CK8A 3L08A 2UY1A 4DLQA 2LAHA 2CHWA 4CDNA 4GCOA 3UT4A 3B95A 4G1TA 4KMOA 2J07A 1K3ZD 1N4RA 5FINA 3E37A 1SQMA 3IV0A 1RZ4A 5EKQD 4FLBA 2NXPA 3FTZA 4CT0A 3ZXPA 4CDRA 2WXKA 1TR4A 2ETAA 3ONKA 3L13A 3Q49B 4XKCA 4OYSA 1E7VA 3GZ2A 3E4BA 5FTPA 1V54E 2KCKA 3OXFA 2VGXA 2LXMA 3EHRA 4AV7A 4GAAA 3R7RA 2IO3C 2XRZA 4NQ0A 3T8MA 3ASGA 3CHRA 3PZ3A 3CIAA 4CRWA 4GYOA 3URZA 4UQYA 4I6JA 3UX4A 3QK0A 4AM9A 3RKVA 2X6FA 2FO7A 4G8KA 3HXEA 2B6CA 2ZISA 4BERA 1UJJA 2WXNA 3D9PA 3BG1B 2DYRE 5CCMA 3U4TA 3PZ2A 4GMJA 1INZA 1H6OA 1BI8B 2AW6A 1TN8A 4HRNA 3BQOA 3FH5A 1SZAA 1ELWA 1UJKA 5CHEE 4J7WA 1LD8A 2ZIRA 4GTRA 3D3MA 2LSVA 2CHXA 3U64A 2KZTB 1JCQA 1GW6A 3QC1A 2WXGA 2GRNB 2P9NG 3ZYLA 4Y6WA 3CVQA 4HFGA 4BX9A 2IY0C 5ENQD 3JQ0A 4JB8P 3ESLA 1BD8A 4K5AB 5CERB 2VQ2A 4RLYA 3KSLA 1S63A 2WMOA 2A5EA 3AS8A 4XZ4A 3UM0A 3MA5A 4KVOA 4FHJA 4TUUA 5LOZA 1H2UA 1N4PA 4GB9A 4ACLA 3SBSA 2V5FA 3LY9A 5ANLA 4R7LA 1E96B 4APFA 3RK6A 3G2WA 4HXIA 4XX5A 3ULEG 1QQEA 5JJ7A 3UTMA 4U8VD 3MGBA 2WQ6A 2LXLA 4U96D 3UM3A 3SBTB 2YHCA 3LJNA 5HRYA 3PS6A 5AQ9A 3IBEA 2PM6A 3UXGA 3OXGA 4J0UA 4OAUC 3HXCA 3D9OA 1XGWA 3CQGB 2P58C 2XHEA 3Q5MA 3CK7A 1D8EA 2X6KA 3TWVA 4C9BB 1N4QA 1OUVA 2UY1B 2XZDG 5FIOA 1SZ9A 3TWSA 4L1BA 3N71A 3VTXA 3TGOA 1Y8MA 2MYOA 2VTBA 1MQSA
chains in the Genus database with same CATH topology
3CLJA 5EDSA 2WXJA 1OWMA 4J8SA 4L7TA 4FP7A 3SF4A 2OVBA 2L0IA 2XQ0A 3SFZA 3EIQC 3QARA 4FA6A 4CGWA 5KJLA 4PS7A 4L2YA 1H6KA 3PREA 5KJKA 4N2QA 3QWWA 4UWGA 3OTNA 2VYIA 1FCHA 4HOUA 3SGHA 3TG4A 4JHRA 3ASDA 1UN8A 3LY8A 1HF8A 2QFCA 3CHOA 1PY1A 4V3IA 3EHMA 2WMNA 4IULA 4XIFA 1X5BA 3JUIA 2AXZA 5DIZA 3RRMB 2VSNA 2VSYA 1HO8A 3U9WA 4G26A 4YVQC 1JWFA 2IOLA 2J49A 4WNDA 1ZU2A 3MV2B 4GA0A 3CVLA 4U0ZA 4I9EA 3ZFWA 1N54A 2FBNA 5FQ7A 5CCLA 4U0UA 4JC8A 2XGMA 2R17C 1TJFA 4ILHB 5BW8C 4C0MA 1PAQA 4UI9K 2VSXE 3QWPA 1EPUA 2A5UA 5G05C 4A1SA 3OXLA 5FZQA 4A55A 4AY5A 2DBAA 2I1KA 3KS2A 4U0SA 3UQ3A 2WXIA 3CEQA 3ML9A 4PH4B 3LVQE 3MZLB 5T8IA 3ML8A 3PEUB 4TV3A 3CSTA 4ABNA 4EZKA 5CMWA 2BF0X 1UG3A 3HIZA 1Z6TA 5D0OD 4WWNA 1EF1C 5T4YA 4B94A 4I17A 3L6AA 2CG3A 2NSZA 4Q96A 3R9AB 2WM9A 4AXHA 2R5SA 3PVLA 3FH8A 3FU3A 4FU3A 5BPPA 2J08A 2NC9A 2GGFA 4WAFA 2XPYA 3IHVA 4APOA 2AXUA 3MYVA 1JUQA 2M63A 2IQCA 1HE8A 4I6GA 3HDXA 3SI5A 4J6IA 2E2EA 4G2VA 3QWVA 2I9CA 4JA7A 1EDUA 2WXQA 5ENNA 2X6JA 3AU5A 5G05J 1MHQA 4DLOA 4ANUA 3CVVA 3ZGQA 2WXHA 4I2ZA 2LO6A 2XRYA 3FTWA 3QB2A 4B0ZA 4N5CA 4IRUA 2LAIA 3C98A 4LUNU 4JW1A 1ZBPA 4J8FA 2XEVA 4N3BA 2V8SE 4GYYA 2Y4TA 1KT0A 2J09A 5CMYA 4P29A 1P5QA 2C2LA 5BT1A 4HOSA 3D9KA 3DPDA 2OOEA 2PM7A 5HI7A 5G55A 5G2NA 4F53A 4GYWA 4ATGA 2MOWA 3MEKA 2HM8A 4ANWA 4XI9A 3FEXA 4AY6A 2CFUA 2WXMA 5LFAA 2YHEA 5KCMA 4RG6A 5FQ4A 2L0TB 2PZIA 3CVPA 3FUJA 1OWNA 2BUGA 3LEWA 3MCXA 2XPZA 3PNTB 1UW4B 3EDTB 3D9LA 3WXXA 4BTBA 3FULA 2AXVA 3CQCB 4Q69A 5EX0A 3VLEA 3I4GA 3S2AA 2A4ZA 4FLHA 3HVEB 4GCNA 4GMLA 5EX3A 1KLXA 3FUFA 2VSOE 2VGYA 3ASFA 5KJNA 3VLDA 3PH0C 4JL0A 5FZSA 4K03A 3QJZA 3P1UA 4URKA 4BT9A 4U07A 1FVFA 3PRZA 1JPLA 3RRNB 4HOTA 3B7UX 3FEYA 5LX8A 3APDA 5FT9A 3PUKA 4DPRA 3QNKA 2XCCA 3RO2A 3PNLB 1EYHA 4BX8A 3FUHA 4BSXA 4A3VA 2WQ7A 1HG5A 1H0AA 1OWOA 4LEUA 2E0IA 2Y3AA 1U3CA 3FTYA 4ILIA 1IQUA 5BNWA 2BTDA 3G2UA 4IYPA 1QNFA 3FUKA 5E76A 4MLPA 2Q7FA 2PQNA 3CR3A 3I5PA 3IEGA 3EIJA 2PL2A 4RVBA 3T5VA 4PUCA 4CT4A 2J9QA 4CGVA 5LCWC 4UWFA 2WB2A 4G25A 3S7JA 4I1MA 4JVSA 3JCKC 2R59A 2AWIA 2X3MA 2QY7A 3FTXA 4KZ0A 2RG8A 4PS8A 4BWRA 3CV0A 4YVOA 4AEZC 3U3WA 1HX8A 1E8YA 3MKRA 5M72A 2Y4UA 4J8EA 4C0EA 2VJ8A 4FJZA 3KEZA 4M3OA 1WAO1 4XKBA 1H2VC 3O48A 1VDYA 3ASHA 3RJVA 4B89A 4BT8A 4HLEA 2FF4A 2KATA 4K0RA 3ZHEB 4HVBA 2XGSA 2WXOA 3FU6A 5FJYA 3QOUA 2J4BA 3L16A 4B8AA 5AYWD 3TL5A 4I43A 1HH8A 4EECA 3ESKA 3CVXA 4FULA 1A17A 4G23A 4W9RA 3BEEA 2C0MA 2JEKA 4DI4A 1ELKA 3FFLA 1YA0A 2WPVA 1DVPA 1NA3A 4LERA 3ZRHA 3LJ3A 3CHPA 3PDNA 2XGOA 5ARFA 3Q15A 3NZSA 4AOFA 4F1SA 2KC7A 5LCWJ 4U04A 3ZN3A 3EJNA 4JEHA 2RD0A 3CKCA 4AP2A 4EZLA 3KD7A 3GZSA 4DJAA 4JZYA 3CHSA 3FH7A 2LNIA 3MKQA 2IU1A 2PQRA 3CK8A 2FI7A 2UY1A 3L08A 5A23A 3FWVA 1LF8A 3QKYA 3PEVB 4DLQA 5DBKA 3ZW3A 3FUMA 2LAHA 2CHWA 4ILGA 3CVUA 3FTUA 1UN9A 3LDZA 5A7DB 3CVNA 4AIFA 4CDMA 4CDNA 3D9NA 4GCOA 4I6EA 3UT4A 5JJTA 5BV0A 3S7BA 4G1TA 4KMOA 4E6HA 2J07A 5J90A 2YQ8A 3TAXA 4CCAA 2VTBB 1QZ2A 3CGHA 5JJ6A 1SQMA 3L17A 4U8HA 3IV0A 4I1OB 3B13A 1HS6A 1NZNA 4QFVA 5EKQD 3R7QA 3RU0A 4FLBA 4Y6CA 4GA1A 4JEUA 2NXPA 3FTZA 3NQPA 2AVPA 1NP7A 4CT0A 1HXIA 3FTVA 3FP3A 2IONA 2ONDA 1PC2A 4CDRA 2I6HA 2WXKA 5ANRA 3ONKA 5T3RA 3G2VA 4FHKA 5JHBA 3NF1A 3L13A 4HOQA 4L23A 2X6HA 3Q49B 5AENA 4XKCA 4PDXA 4OYSA 1E7VA 3GZ2A 3G2SA 3CHQA 3E4BA 4J8DA 5FTPA 3I3NA 2KZTA 4LRZA 2GRMA 4UWHA 3PE4A 5AJLA 2KCKA 3LXUX 3OXFA 3G2TA 1WM5A 3FDHA 2VGXA 3K9IA 4YNDA 4F3VA 4N39A 3MV3B 4KXKB 3LPZA 4AV7A 3B7RL 3IHYA 3KAEA 4E85A 3RO3A 4GAAA 3R7RA 3Q4AB 2XRZA 2OVFA 4NQ0A 3T8MA 3O4ZA 3ASGA 4UWLA 3ULQA 3ZYQA 4MS6A 3CHRA 4G24A 5G04C 3SZ7A 3LKUA 3CIAA 3IKOB 3SNXA 1NA0A 1DNPA 3ZXSA 4H7XA 4F7AA 4RSYA 4CRWA 1KT1A 3B7SA 4MKTA 5FQ8A 4GYOA 3URZA 4I1AA 4BTAA 4UQYA 4I6JA 3UX4A 3QK0A 4BY6A 1W3BA 3RKVA 4AM9A 4A3TA 5J08A 2GRLA 2X6FA 4JA9A 2FO7A 4G11A 4I9CA 4KZCA 3ZVVA 4UI9J 1E8XA 5FQ6A 4EBAA 1U3DA 3TXMA 4IN3B 4I2WA 3PE3A 1IYGA 1H19A 2LSUA 4FC8A 4ANVA 3FU5A 3LY7A 2IFUA 1HG2A 1UJJA 2WXNA 2DCPA 2WXLA 3D9PA 3BG1B 3APFA 5G04J 4NACA 2X6IA 4OVVA 4WUYA 1Z3YA 3UUXA 3JYSA 3L54A 5CCMA 4JHKA 2MRIA 1HZ4A 3U4TA 2EQXA 2HR2A 4N3CA 4GMJA 4UWKA 3CVYA 3LS8A 1INZA 2I1JA 1E90A 4FADA 3FUIA 3SD5A 3ZYMA 3JQ1A 4CEMA 1S0PA 5C1DA 2KM4A 3UT8A 4XE0A 2YINA 2AW6A 3I4RB 2I2OA 3LYAA 2WXFA 1SZAA 3FH5A 4B8CB 3CK9A 4DI3A 1ELWA 3RRUA 1UJKA 4XI0A 4WWOA 3L22A 4JXTA 3PZDA 5CHEE 1E8ZA 3QAQA 4JPSA 4Q94A 1Y6IA 3GZ1A 3UMVA 3D3MA 2LSVA 2CHXA 2FEZA 1FVHA 3P2BA 4WNEA 3U64A 1IQRA 4EZJA 4L2LA 5BV1A 4AJWA 2KZTB 4AVXA 1GW6A 4DK5A 3B7TA 4U63A 3QC1A 2VGXB 2JLBA 2L9BA 3HHMA 2WXGA 5D0QD 4HS2A 3VTYA 2UWJG 2HYZA 4KVMA 3HVEA 2WQHA 2L6JA 5AJDA 3ZYLA 4RG9A 4H7YA 4WNGA 1L5JA 5JHAA 3HYMB 4ME2A 4Y6WA 4WNFA 4D10C 2CG2A 3FUDA 3MX3A 2OV8A 3SHFA 2J4DA 2X38A 3CVQA 4HFGA 3BG0B 3FTSA 2CFZA 3MJWA 2WVIA 4BX9A 4UQZA 2XCBA 3AS4A 2ZU6B 2FULA 3FUEA 3ENEA 1WY6A 4N2SA 3JQ0A 1OWPA 2DIWA 3CHMA 1E8WA 3PUJA 2XPIA 3ESLA 3RIBA 4GPKA 2VQ2A 4O6FA 5FZRA 4KT6B 2WXPA 3D9IA 4EBAG 2WMOA 4JHJA 3ZEFA 3DBSA 4KYOB 2IF4A 1HFAA 2KCVA 3AS8A 3OAWA 4XZ4A 3MA5A 4GZ3A 4KVOA 4FHJA 4TUUA 5LOZA 4GZCA 1H2UA 1N52A 4GB9A 4ACLA 3SBSA 3ZIMA 2V5FA 1JWGA 3LY9A 4GZ5A 5ANLA 4ANXA 1ELRA 2IOSA 4R7LA 1E7UA 2WXRA 4LCTA 1E96B 3ZYKA 3D9MA 4APFA 3AU4A 5LP0A 3LVRE 3UT7A 3RK6A 3TG5A 4PS3A 5HQ8A 3G2WA 4BFRA 3ZHEA 4HXIA 5A6CA 5KJMA 4XX5A 3D9JA 4OVUA 4NURA 4UI9C 4HORA 3FY4A 2HO1A 4A1GA 1QQEA 5JJ7A 4EQFA 4FJYA 4GU5A 3MGBA 2WQ6A 4N3AA 4KBQA 1TJCA 3SBTB 2YHCA 3S7DA 3CKBA 2IJGX 5E75A 4MRUA 2GW1A 3Q47B 3AS5A 3FHEA 3PS6A 3IBEA 4GA2A 2PM6A 3EHNA 3GYZA 3OXGA 4J0UA 1B89A 3TXNA 1HU3A 1Z3XA 5BUZA 3ZPJA 4ACKA 3D9OA 4TRQA 4GZ6A 1XGWA 3CQGB 3VLFA 2V4LA 1TEZA 2P58C 2XHEA 5ARGA 2C0LA 3Q5MA 4WWPA 3CSFA 3CK7A 3T5XA 5AIJA 2X6KA 3S7FA 5C2YA 3MKQB 3NZUA 3U66A 4C9BB 4EPZA 2ILRA 2CHZA 1BPOA 1H2TC 1OUVA 2UY1B 2MHKA 2YNQA 4NRHB 3FUNA 1SZ9A 3ONLA 1IHGA 3APCA 3TJPA 1XNFA 2V0PA 3CVWA 4L1BA 3N71A 3VTXA 3TGOA 1Y8MA 2KCLA 3GW4A 3QDNA 4UQXA 1OWLA 4GZDA 5FWQA 2VTBA 3UPVA 1MQSA 3LCAA 3FU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SF4 A;  4CGW A;  5KJL A;  5KJK A;  4N2Q A;  3QWW A;  2VYI A;  1FCH A;  4HOU A;  3TG4 A;  4JHR A;  3ASD A;  3LY8 A;  2QFC A;  4XIF A;  5DIZ A;  2VSN A;  2VSY A;  4G26 A;  4YVQ C;  4WND A;  1ZU2 A;  3MV2 B;  4GA0 A;  3CVL A;  4U0Z A;  4I9E A;  3ZFW A;  5CCL A;  2FBN A;  4U0U A;  2XGM A;  5BW8 C;  4UI9 K;  3QWP A;  5G05 C;  4A1S A;  3OXL A;  5FZQ A;  4AY5 A;  2DBA A;  3KS2 A;  4U0S A;  3UQ3 A;  3CEQ A;  4ABN A;  5D0O D;  4B94 A;  4I17 A;  3R9A B;  2R5S A;  2NC9 A;  4APO A;  2E2E A;  4G2V A;  3QWV A;  4JA7 A;  5G05 J;  3ZGQ A;  4I2Z A;  4N5C A;  1ZBP A;  4J8F A;  2XEV A;  4N3B A;  4GYY A;  2Y4T A;  1KT0 A;  1P5Q A;  2C2L A;  5BT1 A;  4HOS A;  2OOE A;  5HI7 A;  4GYW A;  3MEK A;  4XI9 A;  4AY6 A;  4RG6 A;  2PZI A;  3CVP A;  2BUG A;  3EDT B;  3WXX A;  4BTB A;  5EX0 A;  4GCN A;  5EX3 A;  1KLX A;  2VGY A;  3ASF A;  5KJN A;  4JL0 A;  5FZS A;  4BT9 A;  4U07 A;  4HOT A;  5FT9 A;  2XCC A;  3RO2 A;  4LEU A;  5BNW A;  2Q7F A;  2PQN A;  3IEG A;  2PL2 A;  2J9Q A;  4CGV A;  5LCW C;  4G25 A;  3S7J A;  4BWR A;  3CV0 A;  4YVO A;  3U3W A;  3MKR A;  5M72 A;  2Y4U A;  4J8E A;  1WAO 1;  3O48 A;  3RJV A;  4BT8 A;  3ASH A;  2FF4 A;  2KAT A;  3ZHE B;  2XGS A;  5FJY A;  3QOU A;  5AYW D;  1HH8 A;  3ESK A;  1A17 A;  4G23 A;  4W9R A;  3BEE A;  2C0M A;  3FFL A;  1YA0 A;  2WPV A;  1NA3 A;  3PDN A;  2XGO A;  5ARF A;  3Q15 A;  5LCW J;  2KC7 A;  4U04 A;  3ZN3 A;  3CKC A;  3KD7 A;  2LNI A;  2PQR A;  3CK8 A;  2FI7 A;  2UY1 A;  3FWV A;  3QKY A;  5DBK A;  5A7D B;  3CVN A;  4AIF A;  4GCO A;  5JJT A;  3S7B A;  4G1T A;  2YQ8 A;  3TAX A;  1QZ2 A;  5JJ6 A;  3RU0 A;  1NZN A;  5EKQ D;  4Y6C A;  4GA1 A;  2AVP A;  1HXI A;  3FP3 A;  2OND A;  1PC2 A;  4CDR A;  2I6H A;  3NF1 A;  4HOQ A;  3Q49 B;  3GZ2 A;  3E4B A;  4J8D A;  5FTP A;  3PE4 A;  2KCK A;  3OXF A;  1WM5 A;  2VGX A;  3K9I A;  4YND A;  4F3V A;  4N39 A;  3MV3 B;  4KXK B;  3LPZ A;  3KAE A;  3RO3 A;  3Q4A B;  4NQ0 A;  3ASG A;  3ULQ A;  4G24 A;  5G04 C;  3SZ7 A;  3LKU A;  1NA0 A;  4H7X A;  1KT1 A;  4GYO A;  3URZ A;  4I1A A;  4BTA A;  4UQY A;  1W3B A;  3RKV A;  4AM9 A;  4JA9 A;  2FO7 A;  4I9C A;  4UI9 J;  4IN3 B;  4I2W A;  3PE3 A;  1IYG A;  2LSU A;  3LY7 A;  2IFU A;  5G04 J;  4WUY A;  3UUX A;  3JYS A;  5CCM A;  3U4T A;  1HZ4 A;  2HR2 A;  4N3C A;  5C1D A;  3LYA A;  3CK9 A;  1ELW A;  4XI0 A;  5CHE E;  3GZ1 A;  2LSV A;  2FEZ A;  4WNE A;  2VGX B;  2JLB A;  5D0Q D;  3VTY A;  2UWJ G;  2HYZ A;  2WQH A;  2L6J A;  4RG9 A;  4H7Y A;  4WNG A;  3HYM B;  4ME2 A;  4Y6W A;  4WNF A;  3CVQ A;  4UQZ A;  2XCB A;  3AS4 A;  4N2S A;  2XPI A;  3RIB A;  4GPK A;  2VQ2 A;  4O6F A;  5FZR A;  4KYO B;  2IF4 A;  2KCV A;  3AS8 A;  3MA5 A;  4GZ3 A;  2V5F A;  3LY9 A;  4GZ5 A;  1ELR A;  1E96 B;  3TG5 A;  5HQ8 A;  3ZHE A;  5A6C A;  5KJM A;  4UI9 C;  4HOR A;  2HO1 A;  1QQE A;  5JJ7 A;  4EQF A;  4N3A A;  4KBQ A;  1TJC A;  2YHC A;  3S7D A;  3CKB A;  2GW1 A;  3Q47 B;  3AS5 A;  4GA2 A;  3OXG A;  4J0U A;  1B89 A;  3ZPJ A;  4GZ6 A;  2P58 C;  5ARG A;  2C0L A;  3Q5M A;  3CK7 A;  3S7F A;  1OUV A;  2UY1 B;  2MHK A;  4NRH B;  1IHG A;  1XNF A;  3N71 A;  3VTX A;  3TGO A;  1Y8M A;  2KCL A;  3GW4 A;  3QDN A;  4UQX A;  3UPV A;  3GYZ A;  3LCA A; 
#chains in the Genus database with same CATH topology
 2WXJ A;  4L7T A;  2L0I A;  3SFZ A;  3QAR A;  4PS7 A;  5H7P A;  4N2Q A;  3QWW A;  3OTN A;  2VYI A;  3SGH A;  1TNY A;  2QFC A;  1PY1 A;  3V2X A;  3JUI A;  2BKG A;  4O1P A;  4DX2 A;  3ZFW A;  5FQ7 A;  2FBN A;  2ETB A;  5EYP F;  4ILH B;  4C0M A;  4ZHB A;  2VSX E;  1TNU A;  3Q7A A;  4A55 A;  2DBA A;  3KS2 A;  4U0S A;  3ML9 A;  4PH4 B;  5T8I A;  3ML8 A;  3CST A;  4EZK A;  4WWN A;  5T4Y A;  4B94 A;  1MZC A;  2WM9 A;  3PVL A;  4XEI G;  4FU3 A;  5BPP A;  4HQD A;  2GGF A;  4APO A;  3J5Q B;  2Y69 E;  1JUQ A;  4J6I A;  1YYH A;  3TWR A;  3ISM C;  2H6F A;  3ZGQ A;  2RKK A;  2WXH A;  4I2Z A;  3QB2 A;  4IRU A;  3PZ4 A;  2LAI A;  1N9A A;  2XEV A;  4N3B A;  4J8Y A;  1N4S A;  1MX6 A;  4HOS A;  4F53 A;  3UIN C;  3MEK A;  2HM8 A;  3FEX A;  2Y1L E;  2KBX A;  2YHE A;  2BUG A;  3MCX A;  3NB2 A;  2XPZ A;  2ETC A;  3V79 K;  2R05 A;  1NFI E;  2AXV A;  3C5R A;  5EX0 A;  5D2M C;  3DSU A;  3HXD A;  4GCN A;  4GML A;  2VSO E;  5KJN A;  4DX6 D;  4JL0 A;  3BU8 A;  3T9K A;  1FVF A;  1V55 E;  3PRZ A;  3RRN B;  3PUK A;  3QNK A;  3DRA A;  1K1B A;  3ABK E;  3FUH A;  2WQ7 A;  1H0A A;  2E0I A;  4ILI A;  1IQU A;  1QYM A;  4MLP A;  2PQN A;  3EIJ A;  5CRV A;  4CT4 A;  4UWF A;  2WB2 A;  3Q73 A;  4YVO A;  2VJ8 A;  1H2V C;  3RJV A;  4K0R A;  2WXO A;  3FU6 A;  3L16 A;  4B8A A;  5AYW D;  4I43 A;  1HH8 A;  3ESK A;  4FUL A;  4G23 A;  4W9R A;  1TYQ G;  3FFL A;  1YA0 A;  3ZRH A;  3NBN B;  3PDN A;  3Q79 A;  2RD0 A;  3KD7 A;  3GZS A;  4DJA A;  3PEV B;  5DBK A;  3ZW3 A;  3W9G A;  3FTU A;  3LDZ A;  4AIF A;  4I6E A;  5JJT A;  3JXI A;  4HNA D;  2VTB B;  5JJ6 A;  4I1O B;  3B13 A;  4QFV A;  4HB5 A;  4GA1 A;  2AVP A;  1NP7 A;  1HXI A;  3FTV A;  2OND A;  3G2V A;  5JHB A;  2DWZ A;  3G2S A;  3CHQ A;  5EIB E;  4DX1 A;  3I3N A;  2KZT A;  3Q75 A;  4HI9 A;  4LRZ A;  2GRM A;  3LXU X;  4EHM A;  1WM5 A;  3FDH A;  5CED B;  4YND A;  4N39 A;  1OXJ A;  3RO3 A;  5EYL A;  3ULQ A;  3DEO A;  4G24 A;  3SZ7 A;  3SNX A;  4H7X A;  5FQ8 A;  1OT8 A;  5J08 A;  4JA9 A;  4KZC A;  3RSE G;  4EBA A;  1U3D A;  3TXM A;  4I2W A;  5CBO A;  3LY7 A;  1OCR E;  1HG2 A;  1U2V G;  1N94 A;  5G04 J;  4NAC A;  2X6I A;  4YDW A;  1Z3Y A;  3ZKJ A;  3AJI A;  5ENS D;  3LS8 A;  1E90 A;  3C72 A;  3ZYM A;  3JQ1 A;  5C1D A;  5CEA A;  2KM4 A;  3UT8 A;  4XE0 A;  2YIN A;  2I2O A;  2WXF A;  3DXM G;  3RRU A;  4XI0 A;  4JXT A;  3DSW A;  4JPS A;  3GZ1 A;  3UMV A;  2FEZ A;  1FVH A;  4WNE A;  1SW6 A;  1IQR A;  4L2L A;  4DK5 A;  5HKP A;  2L9B A;  2EIM E;  5D0Q D;  3VTY A;  2HYZ A;  4KVM A;  3HVE A;  2WQH A;  1YCS B;  3HYM B;  4ME2 A;  4WNF A;  1A5E A;  2CG2 A;  3DEP A;  3FUD A;  3SHF A;  3BG0 B;  3MJW A;  2CFZ A;  4BSZ B;  2WVI A;  3AS4 A;  2ZU6 B;  4N2S A;  2XPI A;  3RIB A;  4GPK A;  5FZR A;  4TXQ A;  4KT6 B;  2WXP A;  3DBS A;  4GZ3 A;  4ANX A;  4GZ5 A;  1E7U A;  2WXR A;  4LCT A;  2P9U G;  3LVR E;  3UT7 A;  1DCQ A;  3ZHE A;  5KJM A;  4UI9 C;  4HOR A;  4F1P A;  2HO1 A;  2P2C P;  4GU5 A;  3TWW A;  4KBQ A;  4O1O A;  4GMR A;  4TUM A;  4MRU A;  3TXN A;  1HU3 A;  1D8D A;  5BUZ A;  4GZ6 A;  2C0L A;  4WWP A;  3CSF A;  3TWQ A;  3SFY A;  4EPZ A;  1H2T C;  4GTQ A;  3APC A;  1XNF A;  2V0P A;  2NYJ A;  1OY3 D;  4F6R D;  3UIP C;  3LCA A;  3TWU A;  2R02 A;  4YDO A;  4J8S A;  4FP7 A;  4TXR A;  4FA6 A;  4CGW A;  3EIQ C;  5KJL A;  1FCH A;  3TG4 A;  4JHR A;  3CHO A;  1BU9 A;  3C3O A;  4V3I A;  3DSX A;  2WMN A;  4DUI A;  4IUL A;  4XIF A;  5IY5 E;  5DIZ A;  2R2L A;  2VSN A;  1HO8 A;  4G26 A;  5AAO A;  4WND A;  1ZU2 A;  3CVL A;  5CCL A;  1TJF A;  5BW8 C;  1G3N B;  3NOG D;  4A1S A;  4A63 B;  2I1K A;  2WXI A;  3HG0 D;  3JUE A;  3WG7 E;  3UIO C;  4TV3 A;  4ABN A;  5CMW A;  1Z6T A;  1EF1 C;  3L6A A;  2CG3 A;  3R9A B;  4AXH A;  2R5S A;  1KPS B;  3SO8 A;  2IQC A;  3SI5 A;  3Q78 A;  2WXQ A;  5ENN A;  3AU5 A;  5G05 J;  1MHQ A;  1MX2 A;  4N5C A;  1TN6 A;  1TNB A;  4LUN U;  4TXP A;  3F6Q A;  4LNU D;  1KT0 A;  4HRL A;  5CMY A;  4P29 A;  2C2L A;  2PM7 A;  4ATG A;  4XI9 A;  3V31 A;  5LFA A;  4RG6 A;  2L0T B;  2F8X K;  1OWN A;  4RQI A;  2AJA A;  2QC9 A;  4Q69 A;  2DVW A;  3VLE A;  3HVE B;  5CBN A;  2VGY A;  3VLD A;  4L9P A;  5FZS A;  4K03 A;  1TNO A;  4URK A;  4BT9 A;  4U07 A;  4HOT A;  3FEY A;  5LX8 A;  3APD A;  3E33 A;  4N5Q A;  3SY2 A;  3PNL B;  1EYH A;  4BX8 A;  2XS1 A;  4A3V A;  1HG5 A;  1U3C A;  3FTY A;  5E76 A;  3BUA A;  2Q7F A;  4RVB A;  3UKU G;  3T5V A;  2J9Q A;  5AAR A;  4I1M A;  3JCK C;  2R59 A;  2FO1 E;  2QY7 A;  2RG8 A;  4U7E B;  3EHQ A;  2ZXW E;  1IXV A;  2V5Q C;  3C3Q A;  5M72 A;  4ATZ D;  3KEZ A;  4XKB A;  4K5B A;  3ZHE B;  4HVB A;  5FJY A;  1N11 A;  3QOU A;  3TL5 A;  1AP7 A;  3CVX A;  4X8Q A;  1O5M A;  1UOH A;  2XGO A;  5ARF A;  3NZS A;  4F1S A;  4U04 A;  3ZN3 A;  3EJN A;  4JEH A;  3AG3 E;  4EZL A;  1SA5 A;  2LNI A;  2PQR A;  3ABL E;  4ILG A;  2P9K G;  3CVN A;  4CDM A;  3D9N A;  5BV0 A;  5CEC B;  3S7B A;  4E6H A;  3TAX A;  1HS6 A;  1NZN A;  2HE0 A;  4Y6C A;  3L82 A;  3NQP A;  3EU9 A;  1Q2Z A;  2I6H A;  5ANR A;  3ULY A;  4FHK A;  3NF1 A;  5ENT D;  5AEN A;  2DZN A;  1NL4 A;  3ABM E;  2QYU A;  4J8D A;  5AJL A;  4YDY A;  3MV3 B;  3LPZ A;  3B7R L;  3IHY A;  3O4Z A;  4UWL A;  4O60 A;  3ZU7 B;  4LNB A;  5G04 C;  2H6I A;  3IKO B;  3LKU A;  1DNP A;  3ZXS A;  3B7S A;  4BTA A;  1W3B A;  3E34 A;  2GRL A;  1MX4 A;  4G11 A;  4I9C A;  3PE3 A;  1OCC E;  1IYG A;  1H19 A;  4FC8 A;  4ANV A;  2IFU A;  2GRR B;  1LD7 A;  3E30 A;  4YDE A;  1N0Q A;  4OVV A;  3UUX A;  3JYS A;  3L54 A;  2MRI A;  4U95 D;  2EQX A;  4N3C A;  4UWK A;  4HBD A;  2OCC E;  2I1J A;  4CEM A;  5AN8 A;  5ENO D;  4DI3 A;  1X81 A;  3CK9 A;  4K5C A;  3L22 A;  2GRQ B;  4Q94 A;  4GTV A;  5ITZ F;  4AJW A;  4AVX A;  3B7T A;  4U63 A;  2JLB A;  3V2O A;  2OEW A;  3HHM A;  4HS2 A;  4RG9 A;  4H7Y A;  1NI1 A;  4LG6 A;  1L5J A;  3FTS A;  4UQZ A;  2P9L G;  3FUE A;  3PUJ A;  2DIW A;  3CHM A;  1E8W A;  4O6F A;  3D9I A;  2IO2 C;  3ZEF A;  3OAW A;  1SA4 A;  4GZC A;  2BED A;  1S70 B;  3D9M A;  5LP0 A;  1S64 A;  3AU4 A;  4PS3 A;  5HQ8 A;  4BFR A;  1IHB A;  1JCR A;  5A6C A;  4OVU A;  4NUR A;  3R9M A;  4BET A;  3UM2 A;  4N3A A;  1TJC A;  3S7D A;  1QBQ A;  3CKB A;  4ZFH A;  2IJG X;  5E75 A;  2EIJ E;  2GW1 A;  1SVX A;  3DST A;  1Z3X A;  3ZPJ A;  4ACK A;  4TRQ A;  1TEZ A;  5EIL A;  5ARG A;  3T5X A;  5C2Y A;  3U66 A;  1BPO A;  3AG4 E;  2ZGG A;  2MHK A;  5HS0 A;  2YNQ A;  3TJP A;  3CVW A;  5AQ7 A;  4MBG A;  5ENR D;  1DC2 A;  2KCL A;  3GW4 A;  4GZD A;  5FWQ A;  3GYZ A;  3FU0 A;  1WDY A;  3DWL G;  4GTS A;  1OWM A;  3SF4 A;  3DSV A;  2OVB A;  5KJK A;  5EID A;  2GRO B;  3ASD A;  1HF8 A;  3EHM A;  5AQA A;  1O1T A;  3RRM B;  3U9W A;  1JWF A;  4GA0 A;  4U0Z A;  4CYM D;  4JC8 A;  4NIK A;  3QWP A;  5G05 C;  5FZQ A;  1ZB1 A;  3E32 A;  5KWD A;  2EIL E;  4OAV B;  3HIZ A;  2XZT G;  3ASO E;  4Q96 A;  3FU3 A;  1Z5S C;  2J08 A;  4LNG A;  2NC9 A;  4WAF A;  2XPY A;  3IHV A;  3NOC D;  2M63 A;  2F8Y A;  1HE8 A;  4I6G A;  3HDX A;  5EN5 D;  2H6G A;  2E2E A;  3AG1 E;  3DPY A;  3QWV A;  2X6J A;  3IXE A;  4ANU A;  4DLO A;  3CVV A;  3DSS A;  3FTW A;  4GTP A;  3C98 A;  4JW1 A;  1DCE A;  1K8K G;  2EIN E;  2V8S E;  4GYY A;  2J09 A;  3Q9U C;  3Q9N C;  3DPD A;  4GTO A;  5G2N A;  2MOW A;  2CFU A;  2WXM A;  5FQ4 A;  2PZI A;  3LEW A;  2P9P G;  5BXU A;  3EDT B;  3D9L A;  4BTB A;  3FUL A;  3CQC B;  4Z68 A;  3I4G A;  3S2A A;  1RW2 A;  1KLX A;  3ASF A;  1OCZ E;  3B7B A;  3PH0 C;  3QJZ A;  3P1U A;  1TNZ A;  2DYS E;  1FT1 A;  1JPL A;  5FT9 A;  2P9S G;  4DPR A;  5D66 A;  3RO2 A;  4BSX A;  2L6B A;  1BLX B;  3UI2 A;  2Y3A A;  1WG0 A;  2BTD A;  3FUK A;  2F0Y A;  2PL2 A;  4BES A;  4PUC A;  4CGV A;  1OCO E;  4G25 A;  4C48 B;  4JVS A;  2AWI A;  2X3M A;  3FTX A;  4KZ0 A;  3X2Q E;  4BWR A;  4CZ2 D;  3CV0 A;  1HX8 A;  2Y4U A;  4J8E A;  4FJZ A;  3O48 A;  4B89 A;  4HLE A;  5KBA A;  4GPM A;  2J4B A;  3ASN E;  1A17 A;  3BEE A;  2C0M A;  1O1R A;  2WPV A;  4HI8 A;  1NA3 A;  3LJ3 A;  5LCW J;  4AP2 A;  3CKC A;  3MKQ A;  2GRP B;  2FI7 A;  3FWV A;  1LF8 A;  3QKY A;  5JMN D;  4B93 B;  3FUM A;  3CVU A;  1UN9 A;  5A7D B;  1N95 A;  5J90 A;  2YQ8 A;  4CCA A;  1QZ2 A;  3CGH A;  3L17 A;  4U8H A;  3RU0 A;  3R7Q A;  4JEU A;  3FP3 A;  2ION A;  1PC2 A;  5T3R A;  4HOQ A;  1MJ0 A;  3HXF A;  4L23 A;  2X6H A;  4PDX A;  2LUH A;  3HXB A;  4BEP A;  1H6P A;  4UWH A;  3PE4 A;  3G2T A;  3K9I A;  4F3V A;  3JXJ A;  4KXK B;  3KAE A;  4E85 A;  3Q4A B;  2OVF A;  3RAU A;  3ZYQ A;  4MS6 A;  1NA0 A;  4F7A A;  4RSY A;  1KT1 A;  2QYJ A;  4MKT A;  4I1A A;  4UUC A;  1BI7 B;  4BY6 A;  1KZP A;  3KEA A;  4A3T A;  3ZVV A;  4UI9 J;  1E8X A;  5FQ6 A;  4IN3 B;  2LSU A;  2V4H C;  3FU5 A;  5ENP D;  2DCP A;  2WXL A;  1JCS A;  2Y0B G;  2OEV A;  3APF A;  4WUY A;  4JHK A;  1HZ4 A;  2HR2 A;  3CVY A;  2RFA A;  4FAD A;  3FUI A;  3SD5 A;  1S0P A;  3I4R B;  3LYA A;  2QZA A;  4B8C B;  4DRX E;  5AQB A;  2ZGD A;  5CRU A;  4WWO A;  3PZD A;  1E8Z A;  3QAQ A;  1Y6I A;  3TWX A;  3P2B A;  4EZJ A;  3EUV A;  5BV1 A;  3KSQ A;  1TN7 A;  2VGX B;  2UWJ G;  5AJD A;  2L6J A;  1YMP A;  4GTM A;  2B0O E;  4WNG A;  5JHA A;  4D10 C;  3MX3 A;  2OV8 A;  2J4D A;  2X38 A;  3D9H A;  3SFX A;  2XCB A;  2FUL A;  3ENE A;  1WY6 A;  1OWP A;  4EBA G;  4JHJ A;  4KYO B;  2IF4 A;  1HFA A;  2KCV A;  1N52 A;  3ZIM A;  1JWG A;  1ELR A;  2IOS A;  3ZYK A;  2DZO A;  3TG5 A;  1N0R A;  4DX5 D;  3DXK G;  1LTX A;  4DX7 D;  4HRM B;  3D9J A;  3FY4 A;  3SQV A;  4A1G A;  5KNG A;  4EQF A;  4FJY A;  3UM1 A;  5B1A E;  3UKR G;  4G8L A;  2XEN A;  2R03 A;  2JAB A;  3Q47 B;  3AS5 A;  4GA2 A;  3FHE A;  3J5P A;  1AWC B;  3EHN A;  1B89 A;  4JD2 G;  2P9I G;  3VLF A;  3TWT A;  2V4L A;  5AIJ A;  3S7F A;  3MKQ B;  3NZU A;  3T8K A;  2ILR A;  2CHZ A;  4NRH B;  4U8Y D;  3FUN A;  3ONL A;  1IHG A;  5KNH D;  3QDN A;  4UQX A;  1OWL A;  3PZ1 A;  3UPV A;  5A23 A;  3CLJ A;  5EDS A;  2XQ0 A;  4L2Y A;  5B1B E;  1H6K A;  3PRE A;  4UWG A;  4HOU A;  4LSZ E;  1UN8 A;  3LY8 A;  1X5B A;  2AXZ A;  1FT2 A;  2VSY A;  4YVQ C;  2IOL A;  2J49 A;  3MV2 B;  1FPP A;  4I9E A;  1N54 A;  4U0U A;  2XGM A;  2R17 C;  1PAQ A;  4UI9 K;  3W9F A;  1MYO A;  1EPU A;  2A5U A;  3OXL A;  4AY5 A;  3UQ3 A;  2EIK E;  3CEQ A;  3LVQ E;  3MZL B;  3PEU B;  2J8S D;  2BF0 X;  1UG3 A;  5D0O D;  1KZO A;  2RFM A;  4I17 A;  2NSZ A;  3FH8 A;  3NAW A;  2AXU A;  3MYV A;  4G2V A;  2I9C A;  4JA7 A;  1EDU A;  3V30 A;  2LO6 A;  2XRY A;  4B0Z A;  3L9T A;  3AAA C;  1ZBP A;  2XEE A;  4J8F A;  2Y4T A;  2IEJ A;  2XS8 A;  1P5Q A;  2F37 A;  1K1A A;  4M7C A;  5BT1 A;  3D9K A;  2KXP C;  2OOE A;  5HI7 A;  5G55 A;  4GYW A;  4ANW A;  4AY6 A;  5KCM A;  3CVP A;  3FUJ A;  3PNT B;  1UW4 B;  3C3R A;  3WXX A;  5JA4 D;  2A4Z A;  4FLH A;  5EX3 A;  2H6H A;  3FUF A;  2XEH A;  3B7U X;  5BXO A;  2XCC A;  1OWO A;  4LEU A;  5BNW A;  3G2U A;  4IYP A;  1QNF A;  3IEG A;  3I5P A;  3CR3 A;  3EU5 A;  3AG2 E;  5LCW C;  5B3S E;  3S7J A;  4PS8 A;  3ZNG A;  1O1S A;  4AEZ C;  2BKK B;  3U3W A;  3MKR A;  1E8Y A;  4C0E A;  1IKN D;  4M3O A;  1WAO 1;  1VDY A;  3ASH A;  3Q7F A;  4BT8 A;  2FF4 A;  2KAT A;  2XGS A;  1D9S A;  4QQI A;  3ZUV B;  2VGE A;  4EEC A;  2JEK A;  4DI4 A;  1ELK A;  1DVP A;  4LER A;  3CHP A;  3Q15 A;  4AOF A;  2KC7 A;  2PNN A;  3HRA A;  4HLL A;  4JZY A;  3CHS A;  3FH7 A;  2IU1 A;  4GTT A;  3CK8 A;  3L08 A;  2UY1 A;  4DLQ A;  2LAH A;  2CHW A;  4CDN A;  4GCO A;  3UT4 A;  3B95 A;  4G1T A;  4KMO A;  2J07 A;  1K3Z D;  1N4R A;  5FIN A;  3E37 A;  1SQM A;  3IV0 A;  1RZ4 A;  5EKQ D;  4FLB A;  2NXP A;  3FTZ A;  4CT0 A;  3ZXP A;  4CDR A;  2WXK A;  1TR4 A;  2ETA A;  3ONK A;  3L13 A;  3Q49 B;  4XKC A;  4OYS A;  1E7V A;  3GZ2 A;  3E4B A;  5FTP A;  1V54 E;  2KCK A;  3OXF A;  2VGX A;  2LXM A;  3EHR A;  4AV7 A;  4GAA A;  3R7R A;  2IO3 C;  2XRZ A;  4NQ0 A;  3T8M A;  3ASG A;  3CHR A;  3PZ3 A;  3CIA A;  4CRW A;  4GYO A;  3URZ A;  4UQY A;  4I6J A;  3UX4 A;  3QK0 A;  4AM9 A;  3RKV A;  2X6F A;  2FO7 A;  4G8K A;  3HXE A;  2B6C A;  2ZIS A;  4BER A;  1UJJ A;  2WXN A;  3D9P A;  3BG1 B;  2DYR E;  5CCM A;  3U4T A;  3PZ2 A;  4GMJ A;  1INZ A;  1H6O A;  1BI8 B;  2AW6 A;  1TN8 A;  4HRN A;  3BQO A;  3FH5 A;  1SZA A;  1ELW A;  1UJK A;  5CHE E;  4J7W A;  1LD8 A;  2ZIR A;  4GTR A;  3D3M A;  2LSV A;  2CHX A;  3U64 A;  2KZT B;  1JCQ A;  1GW6 A;  3QC1 A;  2WXG A;  2GRN B;  2P9N G;  3ZYL A;  4Y6W A;  3CVQ A;  4HFG A;  4BX9 A;  2IY0 C;  5ENQ D;  3JQ0 A;  4JB8 P;  3ESL A;  1BD8 A;  4K5A B;  5CER B;  2VQ2 A;  4RLY A;  3KSL A;  1S63 A;  2WMO A;  2A5E A;  3AS8 A;  4XZ4 A;  3UM0 A;  3MA5 A;  4KVO A;  4FHJ A;  4TUU A;  5LOZ A;  1H2U A;  1N4P A;  4GB9 A;  4ACL A;  3SBS A;  2V5F A;  3LY9 A;  5ANL A;  4R7L A;  1E96 B;  4APF A;  3RK6 A;  3G2W A;  4HXI A;  4XX5 A;  3ULE G;  1QQE A;  5JJ7 A;  3UTM A;  4U8V D;  3MGB A;  2WQ6 A;  2LXL A;  4U96 D;  3UM3 A;  3SBT B;  2YHC A;  3LJN A;  5HRY A;  3PS6 A;  5AQ9 A;  3IBE A;  2PM6 A;  3UXG A;  3OXG A;  4J0U A;  4OAU C;  3HXC A;  3D9O A;  1XGW A;  3CQG B;  2P58 C;  2XHE A;  3Q5M A;  3CK7 A;  1D8E A;  2X6K A;  3TWV A;  4C9B B;  1N4Q A;  1OUV A;  2UY1 B;  2XZD G;  5FIO A;  1SZ9 A;  3TWS A;  4L1B A;  3N71 A;  3VTX A;  3TGO A;  1Y8M A;  2MYO A;  2VTB A;  1MQS A; 
#chains in the Genus database with same CATH homology
 3CLJ A;  5EDS A;  2WXJ A;  1OWM A;  4J8S A;  4L7T A;  4FP7 A;  3SF4 A;  2OVB A;  2L0I A;  2XQ0 A;  3SFZ A;  3EIQ C;  3QAR A;  4FA6 A;  4CGW A;  5KJL A;  4PS7 A;  4L2Y A;  1H6K A;  3PRE A;  5KJK A;  4N2Q A;  3QWW A;  4UWG A;  3OTN A;  2VYI A;  1FCH A;  4HOU A;  3SGH A;  3TG4 A;  4JHR A;  3ASD A;  1UN8 A;  3LY8 A;  1HF8 A;  2QFC A;  3CHO A;  1PY1 A;  4V3I A;  3EHM A;  2WMN A;  4IUL A;  4XIF A;  1X5B A;  3JUI A;  2AXZ A;  5DIZ A;  3RRM B;  2VSN A;  2VSY A;  1HO8 A;  3U9W A;  4G26 A;  4YVQ C;  1JWF A;  2IOL A;  2J49 A;  4WND A;  1ZU2 A;  3MV2 B;  4GA0 A;  3CVL A;  4U0Z A;  4I9E A;  3ZFW A;  1N54 A;  2FBN A;  5FQ7 A;  5CCL A;  4U0U A;  4JC8 A;  2XGM A;  2R17 C;  1TJF A;  4ILH B;  5BW8 C;  4C0M A;  1PAQ A;  4UI9 K;  2VSX E;  3QWP A;  1EPU A;  2A5U A;  5G05 C;  4A1S A;  3OXL A;  5FZQ A;  4A55 A;  4AY5 A;  2DBA A;  2I1K A;  3KS2 A;  4U0S A;  3UQ3 A;  2WXI A;  3CEQ A;  3ML9 A;  4PH4 B;  3LVQ E;  3MZL B;  5T8I A;  3ML8 A;  3PEU B;  4TV3 A;  3CST A;  4ABN A;  4EZK A;  5CMW A;  2BF0 X;  1UG3 A;  3HIZ A;  1Z6T A;  5D0O D;  4WWN A;  1EF1 C;  5T4Y A;  4B94 A;  4I17 A;  3L6A A;  2CG3 A;  2NSZ A;  4Q96 A;  3R9A B;  2WM9 A;  4AXH A;  2R5S A;  3PVL A;  3FH8 A;  3FU3 A;  4FU3 A;  5BPP A;  2J08 A;  2NC9 A;  2GGF A;  4WAF A;  2XPY A;  3IHV A;  4APO A;  2AXU A;  3MYV A;  1JUQ A;  2M63 A;  2IQC A;  1HE8 A;  4I6G A;  3HDX A;  3SI5 A;  4J6I A;  2E2E A;  4G2V A;  3QWV A;  2I9C A;  4JA7 A;  1EDU A;  2WXQ A;  5ENN A;  2X6J A;  3AU5 A;  5G05 J;  1MHQ A;  4DLO A;  4ANU A;  3CVV A;  3ZGQ A;  2WXH A;  4I2Z A;  2LO6 A;  2XRY A;  3FTW A;  3QB2 A;  4B0Z A;  4N5C A;  4IRU A;  2LAI A;  3C98 A;  4LUN U;  4JW1 A;  1ZBP A;  4J8F A;  2XEV A;  4N3B A;  2V8S E;  4GYY A;  2Y4T A;  1KT0 A;  2J09 A;  5CMY A;  4P29 A;  1P5Q A;  2C2L A;  5BT1 A;  4HOS A;  3D9K A;  3DPD A;  2OOE A;  2PM7 A;  5HI7 A;  5G55 A;  5G2N A;  4F53 A;  4GYW A;  4ATG A;  2MOW A;  3MEK A;  2HM8 A;  4ANW A;  4XI9 A;  3FEX A;  4AY6 A;  2CFU A;  2WXM A;  5LFA A;  2YHE A;  5KCM A;  4RG6 A;  5FQ4 A;  2L0T B;  2PZI A;  3CVP A;  3FUJ A;  1OWN A;  2BUG A;  3LEW A;  3MCX A;  2XPZ A;  3PNT B;  1UW4 B;  3EDT B;  3D9L A;  3WXX A;  4BTB A;  3FUL A;  2AXV A;  3CQC B;  4Q69 A;  5EX0 A;  3VLE A;  3I4G A;  3S2A A;  2A4Z A;  4FLH A;  3HVE B;  4GCN A;  4GML A;  5EX3 A;  1KLX A;  3FUF A;  2VSO E;  2VGY A;  3ASF A;  5KJN A;  3VLD A;  3PH0 C;  4JL0 A;  5FZS A;  4K03 A;  3QJZ A;  3P1U A;  4URK A;  4BT9 A;  4U07 A;  1FVF A;  3PRZ A;  1JPL A;  3RRN B;  4HOT A;  3B7U X;  3FEY A;  5LX8 A;  3APD A;  5FT9 A;  3PUK A;  4DPR A;  3QNK A;  2XCC A;  3RO2 A;  3PNL B;  1EYH A;  4BX8 A;  3FUH A;  4BSX A;  4A3V A;  2WQ7 A;  1HG5 A;  1H0A A;  1OWO A;  4LEU A;  2E0I A;  2Y3A A;  1U3C A;  3FTY A;  4ILI A;  1IQU A;  5BNW A;  2BTD A;  3G2U A;  4IYP A;  1QNF A;  3FUK A;  5E76 A;  4MLP A;  2Q7F A;  2PQN A;  3CR3 A;  3I5P A;  3IEG A;  3EIJ A;  2PL2 A;  4RVB A;  3T5V A;  4PUC A;  4CT4 A;  2J9Q A;  4CGV A;  5LCW C;  4UWF A;  2WB2 A;  4G25 A;  3S7J A;  4I1M A;  4JVS A;  3JCK C;  2R59 A;  2AWI A;  2X3M A;  2QY7 A;  3FTX A;  4KZ0 A;  2RG8 A;  4PS8 A;  4BWR A;  3CV0 A;  4YVO A;  4AEZ C;  3U3W A;  1HX8 A;  1E8Y A;  3MKR A;  5M72 A;  2Y4U A;  4J8E A;  4C0E A;  2VJ8 A;  4FJZ A;  3KEZ A;  4M3O A;  1WAO 1;  4XKB A;  1H2V C;  3O48 A;  1VDY A;  3ASH A;  3RJV A;  4B89 A;  4BT8 A;  4HLE A;  2FF4 A;  2KAT A;  4K0R A;  3ZHE B;  4HVB A;  2XGS A;  2WXO A;  3FU6 A;  5FJY A;  3QOU A;  2J4B A;  3L16 A;  4B8A A;  5AYW D;  3TL5 A;  4I43 A;  1HH8 A;  4EEC A;  3ESK A;  3CVX A;  4FUL A;  1A17 A;  4G23 A;  4W9R A;  3BEE A;  2C0M A;  2JEK A;  4DI4 A;  1ELK A;  3FFL A;  1YA0 A;  2WPV A;  1DVP A;  1NA3 A;  4LER A;  3ZRH A;  3LJ3 A;  3CHP A;  3PDN A;  2XGO A;  5ARF A;  3Q15 A;  3NZS A;  4AOF A;  4F1S A;  2KC7 A;  5LCW J;  4U04 A;  3ZN3 A;  3EJN A;  4JEH A;  2RD0 A;  3CKC A;  4AP2 A;  4EZL A;  3KD7 A;  3GZS A;  4DJA A;  4JZY A;  3CHS A;  3FH7 A;  2LNI A;  3MKQ A;  2IU1 A;  2PQR A;  3CK8 A;  2FI7 A;  2UY1 A;  3L08 A;  5A23 A;  3FWV A;  1LF8 A;  3QKY A;  3PEV B;  4DLQ A;  5DBK A;  3ZW3 A;  3FUM A;  2LAH A;  2CHW A;  4ILG A;  3CVU A;  3FTU A;  1UN9 A;  3LDZ A;  5A7D B;  3CVN A;  4AIF A;  4CDM A;  4CDN A;  3D9N A;  4GCO A;  4I6E A;  3UT4 A;  5JJT A;  5BV0 A;  3S7B A;  4G1T A;  4KMO A;  4E6H A;  2J07 A;  5J90 A;  2YQ8 A;  3TAX A;  4CCA A;  2VTB B;  1QZ2 A;  3CGH A;  5JJ6 A;  1SQM A;  3L17 A;  4U8H A;  3IV0 A;  4I1O B;  3B13 A;  1HS6 A;  1NZN A;  4QFV A;  5EKQ D;  3R7Q A;  3RU0 A;  4FLB A;  4Y6C A;  4GA1 A;  4JEU A;  2NXP A;  3FTZ A;  3NQP A;  2AVP A;  1NP7 A;  4CT0 A;  1HXI A;  3FTV A;  3FP3 A;  2ION A;  2OND A;  1PC2 A;  4CDR A;  2I6H A;  2WXK A;  5ANR A;  3ONK A;  5T3R A;  3G2V A;  4FHK A;  5JHB A;  3NF1 A;  3L13 A;  4HOQ A;  4L23 A;  2X6H A;  3Q49 B;  5AEN A;  4XKC A;  4PDX A;  4OYS A;  1E7V A;  3GZ2 A;  3G2S A;  3CHQ A;  3E4B A;  4J8D A;  5FTP A;  3I3N A;  2KZT A;  4LRZ A;  2GRM A;  4UWH A;  3PE4 A;  5AJL A;  2KCK A;  3LXU X;  3OXF A;  3G2T A;  1WM5 A;  3FDH A;  2VGX A;  3K9I A;  4YND A;  4F3V A;  4N39 A;  3MV3 B;  4KXK B;  3LPZ A;  4AV7 A;  3B7R L;  3IHY A;  3KAE A;  4E85 A;  3RO3 A;  4GAA A;  3R7R A;  3Q4A B;  2XRZ A;  2OVF A;  4NQ0 A;  3T8M A;  3O4Z A;  3ASG A;  4UWL A;  3ULQ A;  3ZYQ A;  4MS6 A;  3CHR A;  4G24 A;  5G04 C;  3SZ7 A;  3LKU A;  3CIA A;  3IKO B;  3SNX A;  1NA0 A;  1DNP A;  3ZXS A;  4H7X A;  4F7A A;  4RSY A;  4CRW A;  1KT1 A;  3B7S A;  4MKT A;  5FQ8 A;  4GYO A;  3URZ A;  4I1A A;  4BTA A;  4UQY A;  4I6J A;  3UX4 A;  3QK0 A;  4BY6 A;  1W3B A;  3RKV A;  4AM9 A;  4A3T A;  5J08 A;  2GRL A;  2X6F A;  4JA9 A;  2FO7 A;  4G11 A;  4I9C A;  4KZC A;  3ZVV A;  4UI9 J;  1E8X A;  5FQ6 A;  4EBA A;  1U3D A;  3TXM A;  4IN3 B;  4I2W A;  3PE3 A;  1IYG A;  1H19 A;  2LSU A;  4FC8 A;  4ANV A;  3FU5 A;  3LY7 A;  2IFU A;  1HG2 A;  1UJJ A;  2WXN A;  2DCP A;  2WXL A;  3D9P A;  3BG1 B;  3APF A;  5G04 J;  4NAC A;  2X6I A;  4OVV A;  4WUY A;  1Z3Y A;  3UUX A;  3JYS A;  3L54 A;  5CCM A;  4JHK A;  2MRI A;  1HZ4 A;  3U4T A;  2EQX A;  2HR2 A;  4N3C A;  4GMJ A;  4UWK A;  3CVY A;  3LS8 A;  1INZ A;  2I1J A;  1E90 A;  4FAD A;  3FUI A;  3SD5 A;  3ZYM A;  3JQ1 A;  4CEM A;  1S0P A;  5C1D A;  2KM4 A;  3UT8 A;  4XE0 A;  2YIN A;  2AW6 A;  3I4R B;  2I2O A;  3LYA A;  2WXF A;  1SZA A;  3FH5 A;  4B8C B;  3CK9 A;  4DI3 A;  1ELW A;  3RRU A;  1UJK A;  4XI0 A;  4WWO A;  3L22 A;  4JXT A;  3PZD A;  5CHE E;  1E8Z A;  3QAQ A;  4JPS A;  4Q94 A;  1Y6I A;  3GZ1 A;  3UMV A;  3D3M A;  2LSV A;  2CHX A;  2FEZ A;  1FVH A;  3P2B A;  4WNE A;  3U64 A;  1IQR A;  4EZJ A;  4L2L A;  5BV1 A;  4AJW A;  2KZT B;  4AVX A;  1GW6 A;  4DK5 A;  3B7T A;  4U63 A;  3QC1 A;  2VGX B;  2JLB A;  2L9B A;  3HHM A;  2WXG A;  5D0Q D;  4HS2 A;  3VTY A;  2UWJ G;  2HYZ A;  4KVM A;  3HVE A;  2WQH A;  2L6J A;  5AJD A;  3ZYL A;  4RG9 A;  4H7Y A;  4WNG A;  1L5J A;  5JHA A;  3HYM B;  4ME2 A;  4Y6W A;  4WNF A;  4D10 C;  2CG2 A;  3FUD A;  3MX3 A;  2OV8 A;  3SHF A;  2J4D A;  2X38 A;  3CVQ A;  4HFG A;  3BG0 B;  3FTS A;  2CFZ A;  3MJW A;  2WVI A;  4BX9 A;  4UQZ A;  2XCB A;  3AS4 A;  2ZU6 B;  2FUL A;  3FUE A;  3ENE A;  1WY6 A;  4N2S A;  3JQ0 A;  1OWP A;  2DIW A;  3CHM A;  1E8W A;  3PUJ A;  2XPI A;  3ESL A;  3RIB A;  4GPK A;  2VQ2 A;  4O6F A;  5FZR A;  4KT6 B;  2WXP A;  3D9I A;  4EBA G;  2WMO A;  4JHJ A;  3ZEF A;  3DBS A;  4KYO B;  2IF4 A;  1HFA A;  2KCV A;  3AS8 A;  3OAW A;  4XZ4 A;  3MA5 A;  4GZ3 A;  4KVO A;  4FHJ A;  4TUU A;  5LOZ A;  4GZC A;  1H2U A;  1N52 A;  4GB9 A;  4ACL A;  3SBS A;  3ZIM A;  2V5F A;  1JWG A;  3LY9 A;  4GZ5 A;  5ANL A;  4ANX A;  1ELR A;  2IOS A;  4R7L A;  1E7U A;  2WXR A;  4LCT A;  1E96 B;  3ZYK A;  3D9M A;  4APF A;  3AU4 A;  5LP0 A;  3LVR E;  3UT7 A;  3RK6 A;  3TG5 A;  4PS3 A;  5HQ8 A;  3G2W A;  4BFR A;  3ZHE A;  4HXI A;  5A6C A;  5KJM A;  4XX5 A;  3D9J A;  4OVU A;  4NUR A;  4UI9 C;  4HOR A;  3FY4 A;  2HO1 A;  4A1G A;  1QQE A;  5JJ7 A;  4EQF A;  4FJY A;  4GU5 A;  3MGB A;  2WQ6 A;  4N3A A;  4KBQ A;  1TJC A;  3SBT B;  2YHC A;  3S7D A;  3CKB A;  2IJG X;  5E75 A;  4MRU A;  2GW1 A;  3Q47 B;  3AS5 A;  3FHE A;  3PS6 A;  3IBE A;  4GA2 A;  2PM6 A;  3EHN A;  3GYZ A;  3OXG A;  4J0U A;  1B89 A;  3TXN A;  1HU3 A;  1Z3X A;  5BUZ A;  3ZPJ A;  4ACK A;  3D9O A;  4TRQ A;  4GZ6 A;  1XGW A;  3CQG B;  3VLF A;  2V4L A;  1TEZ A;  2P58 C;  2XHE A;  5ARG A;  2C0L A;  3Q5M A;  4WWP A;  3CSF A;  3CK7 A;  3T5X A;  5AIJ A;  2X6K A;  3S7F A;  5C2Y A;  3MKQ B;  3NZU A;  3U66 A;  4C9B B;  4EPZ A;  2ILR A;  2CHZ A;  1BPO A;  1H2T C;  1OUV A;  2UY1 B;  2MHK A;  2YNQ A;  4NRH B;  3FUN A;  1SZ9 A;  3ONL A;  1IHG A;  3APC A;  3TJP A;  1XNF A;  2V0P A;  3CVW A;  4L1B A;  3N71 A;  3VTX A;  3TGO A;  1Y8M A;  2KCL A;  3GW4 A;  3QDN A;  4UQX A;  1OWL A;  4GZD A;  5FWQ A;  2VTB A;  3UPV A;  1MQS A;  3LCA A;  3FU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...