2C0MA

Apo form of the tpr domain of the pex5p receptor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
297
Chain Sequence
DKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 120
structure length 297
sequence length 319
chains with identical sequence B, C, F
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0mA00
2J9QA 3ASDA 4XI0A 2FF4A 3CKBA 3E4BA 2UY1B 3CVLA 3CVNA 3LKUA 3ZFWA 4GPKA 3LY8A 4BTBA 5C1DA 3K9IA 4NQ0A 4EQFA 5KJNA 4HOTA 2HR2A 2KC7A 2VGXB 1KT0A 3FWVA 4HOUA 4U0SA 4UQXA 5FTPA 4GYYA 2XCBA 5JJ6A 4RG9A 4N2QA 2OOEA 2XPIA 3IEGA 2KCKA 3Q49B 4H7YA 4G26A 3GYZA 4NRHB 3NF1A 4Y6CA 4A1SA 5HQ8A 4HORA 4G23A 3MV3B 2JLBA 5AYWD 5EX3A 2GW1A 3CKCA 3AS5A 1IHGA 2I6HA 4UI9C 1NA0A 4YNDA 5CHEE 4I9CA 5HI7A 3TGOA 3TG5A 3PE4A 2VSNA 3MV2B 4RG6A 3GW4A 5LCWC 1KT1A 1P5QA 2E2EA 3CK7A 4WNEA 4ABNA 1PC2A 2C2LA 3KAEA 3Q15A 1HZ4A 2R5SA 3LCAA 3QWWA 4J8EA 4XI9A 3S7FA 3VTYA 3WXXA 3RU0A 4IN3B 4UQYA 3RJVA 3UPVA 2YHCA 3URZA 3TAXA 2HYZA 4O6FA 4GZ6A 3RO2A 3ZHEA 1ELRA 4HOQA 3LY7A 2LSVA 1HH8A 4N2SA 1A17A 1YA0A 2DBAA 4I2WA 2L6JA 4GZ3A 4U07A 2XCCA 3FP3A 4Y6WA 4I2ZA 4N3AA 1WM5A 2NC9A 4JHRA 1QQEA 3CVQA 4WUYA 1OUVA 2VSYA 2P58C 3MKRA 1NA3A 5G05C 4B94A 5FZQA 2ONDA 3RIBA 4BT9A 3RKVA 3QWPA 5A7DB 4AY5A 2XGMA 4WNGA 3U4TA 2VGYA 4BT8A 4BTAA 4G25A 2WQHA 3ASFA 3ASGA 3CV0A 3LPZA 2BUGA 3GZ1A 3S7BA 4AIFA 4GYWA 4G1TA 5G05J 5KJKA 3JYSA 4J8DA 3LYAA 2Q7FA 4J0UA 3CEQA 3QOUA 2VGXA 5EKQD 2FO7A 5DBKA 5FZRA 3ESKA 4UQZA 5BW8C 2VYIA 4N3CA 5A6CA 2MHKA 3ASHA 4W9RA 5EX0A 3CK8A 4BWRA 3EDTB 4XIFA 3Q5MA 2VQ2A 3PE3A 5FT9A 4F3VA 1Y8MA 2UY1A 5D0QD 2XGSA 3QDNA 4GCNA 1HXIA 1ELWA 2LNIA 3KD7A 4JA9A 2UWJG 3R9AB 4CGVA 3S7JA 1QZ2A 1ZU2A 3UUXA 4H7XA 3UQ3A 4KXKB 4N3BA 1KLXA 5D0OD 3OXGA 4ME2A 3ULQA 5LCWJ 2QFCA 4N5CA 4WNDA 2PQNA 1IYGA 4JL0A 2LSUA 4I1AA 5ARFA 1TJCA 2Y4TA 3ZGQA 3OXLA 2AVPA 4AM9A 4UI9K 2HO1A 2KATA 3Q47B 4UI9J 3ZPJA 5KJMA 5G04C 4GA0A 1WAO1 3GZ2A 4KYOB 3VTXA 3HYMB 3SZ7A 2C0MA 3Q4AB 4G24A 4J8FA 5G04J 2C0LA 1W3BA 2V5FA 3BEEA 3CK9A 5BT1A 5DIZA 5ARGA 2XEVA 4I17A 4LEUA 5KJLA 3FFLA 3AS8A 4G2VA 4GYOA 2PL2A 2WPVA 5FJYA 5JJ7A 4YVQC 2XGOA 1B89A 3RO3A 3PDNA 2KCVA 4YVOA 1ZBPA 3QWVA 3ZN3A 5JJTA 2FI7A 4GZ5A 3SF4A 5CCMA 4I9EA 4WNFA 4GA1A 4AY6A 2FEZA 4APOA 3MA5A 2IF4A 3O48A 4JA7A 1E96B 3MEKA 3OXFA 4CDRA 5CCLA 2FBNA 4GA2A 2PQRA 5FZSA 1NZNA 1XNFA 3N71A 3S7DA 2IFUA 3KS2A 4U0UA 4U0ZA 2KCLA 2PZIA 3LY9A 1FCHA 3QKYA 3AS4A 4KBQA 4N39A 5BNWA 4CGWA 4GCOA 2Y4UA 3ZHEB 2YQ8A 3TG4A 5M72A 3U3WA 4U04A 4HOSA 3CVPA
chains in the Genus database with same CATH superfamily
2ETCA 3FUIA 2IU1A 3CHQA 2X3MA 4JEHA 5EN5D 2P9IG 3AG3E 4UUCA 1N4RA 3LS8A 3FTUA 3KAEA 1L5JA 4KVMA 1DC2A 4GB9A 4GZ6A 5FINA 4CRWA 2OVFA 2H6GA 3HIZA 4N3AA 2XS8A 3TWRA 2KZTA 3E30A 3NAWA 4B94A 1H0AA 4C0EA 4BT8A 2XZTG 4GYWA 4ANWA 3F6QA 4LUNU 2F37A 2YNQA 1XGWA 4XIFA 3E37A 1E7UA 5D0QD 5LP0A 3PUKA 1LTXA 4CGVA 4E85A 3S7JA 3UQ3A 3PZDA 5D0OD 3PEVB 1FT2A 4ZHBA 3L17A 5KJMA 3JXJA 4RSYA 3SFXA 2QC9A 5KNHD 4GMLA 3SQVA 3D9KA 2OVBA 1WG0A 3FUHA 5CBNA 4HI8A 4I9EA 1OXJA 2FEZA 3QB2A 1HG5A 4ILIA 2IFUA 4HLEA 1IKND 1PAQA 4UWKA 4GCOA 1SVXA 3UKRG 2UY1B 2VGXB 1D8EA 4EPZA 4MRUA 3I4GA 4NURA 1IHGA 4UWGA 3ONLA 3W9FA 4FLBA 3UIOC 4WNEA 2C2LA 3HVEB 4LNGA 2ZISA 3HXCA 4HOQA 5ENSD 3SNXA 4GZ3A 4EZJA 4JHRA 5C2YA 3LXUX 3ZEFA 4EECA 2FULA 3ESLA 4I1MA 4EHMA 3CSFA 4AJWA 4MBGA 3LPZA 2IY0C 4HXIA 1BD8A 2B0OE 4APFA 1U3DA 3I4RB 3Q5MA 4Q96A 4FHKA 2H6HA 3ABME 2MOWA 2R03A 5J08A 3FU6A 2WMOA 2V5FA 2LXMA 2XQ0A 5FJYA 3C3OA 3PDNA 4FLHA 3AAAC 2AJAA 3LJNA 5ANLA 4A55A 1E96B 4FADA 4CDRA 3N71A 5BNWA 2GRQB 4U8HA 1KPSB 3Q79A 4OVUA 3ASDA 4J8YA 4NACA 1Y6IA 3CQGB 1GW6A 1G3NB 1TN6A 4DLOA 2X6HA 4HOTA 2HR2A 4O1PA 5LFAA 3AS5A 1TN8A 3TWUA 4YDOA 4ILHB 5LCWC 3FUDA 3MJWA 3PUJA 4JHJA 3TG5A 2JABA 1N4QA 3WXXA 1INZA 4AV7A 4DRXE 4CZ2D 4TXRA 2QYUA 3FUEA 2DBAA 4RLYA 3FP3A 2EINE 2L9BA 1TNYA 3UM1A 4ANXA 2ZGGA 2WXJA 3QWPA 2WVIA 4HRLA 2A5UA 2X38A 3IHVA 3JYSA 2Q7FA 3J5QB 5DBKA 4UQZA 4N3CA 4F7AA 4FULA 4ACLA 2VQ2A 2R05A 4FC8A 4XEIG 1ELWA 3MKQB 3R9AB 2MRIA 4P29A 3ULQA 3B7TA 3U9WA 3OXGA 4XE0A 2LSUA 1IQUA 4UI9J 4UI9K 3APFA 3AJIA 5EYPF 1RW2A 4WAFA 3APCA 4J8FA 3CK9A 3FTXA 3D9OA 2IOSA 3QK0A 1E8WA 4PS8A 1O5MA 1IXVA 1OWLA 2PQRA 2WXRA 4AP2A 3NOCD 3C3RA 1H6PA 1FCHA 4N39A 4CGWA 1SA5A 2OCCE 3NZUA 3Q9UC 5ITZF 2V8SE 1QYMA 4JB8P 4XKBA 5JA4D 4ANVA 4K0RA 1YYHA 3NBNB 2GRNB 3UI2A 2GW1A 2J4BA 5ENPD 2CHZA 4XI9A 4PDXA 2GRMA 1SZAA 2P9KG 3SHFA 1YA0A 2X6KA 3UM0A 2Y3AA 4I6GA 4BTAA 1D8DA 1S70B 5A6CA 4EBAG 2MHKA 4HFGA 4W9RA 5EX0A 3EHNA 2CFZA 3CSTA 1V54E 3EIJA 5D2MC 2WB2A 1KLXA 1AWCB 2VSXE 3MZLB 3IV0A 5G2NA 4A63B 1TNUA 3FFLA 4D10C 1S0PA 5JJ7A 2XGOA 3DSUA 4CYMD 2HE0A 4APOA 3DEOA 2P9PG 3TWSA 2DVWA 2BEDA 4HOSA 1LD8A 5KBAA 1O1SA 4J6IA 3EU5A 3G2SA 3BQOA 2WXGA 3V79K 3IEGA 3FEYA 2GROB 1K1BA 2JLBA 5EX3A 3UXGA 4UI9C 3DSVA 4Q94A 4L2YA 2F0YA 1HG2A 2L0TB 4LRZA 4MS6A 2XEHA 1QNFA 4ILGA 3LY7A 1OWPA 4Y6WA 4I2ZA 2OEVA 2RFMA 3D9HA 3CVQA 5ENTD 3MKRA 3J5PA 3U64A 3ASFA 2CG2A 3ASGA 3CVXA 1N95A 3JXIA 2IQCA 3CVYA 2VYIA 2PM6A 3HVEA 4BFRA 4GCNA 4JA9A 3QNKA 5LCWJ 3HG0D 1KZPA 4OYSA 4WNDA 5BPPA 1BLXB 2Y4TA 3DSWA 3C5RA 5G04J 3PZ1A 4F1PA 2WXHA 3PZ4A 2P2CP 4XKCA 4UWFA 1Z5SC 5JJTA 4B89A 1N54A 3DPYA 4KBQA 3U3WA 2X6IA 4ATGA 4N2QA 4F1SA 2XHEA 2J9QA 2FF4A 5B3SE 4B93B 4EQFA 5CBOA 5AARA 1ELKA 1LD7A 3G2TA 2P9UG 4NRHB 3FTSA 3CHPA 4FJZA 4I9CA 3GW4A 4KVOA 3HHMA 1PC2A 2ZXWE 3RU0A 3UPVA 5AJDA 2X6FA 1A17A 3UX4A 2QZAA 3Q78A 3D3MA 2KZTB 5KWDA 4G11A 3KSQA 3U4TA 3EHMA 5HS0A 3FTVA 3U66A 1SA4A 2WXKA 3FEXA 2MYOA 3ZVVA 4TRQA 4EZKA 1X5BA 3UMVA 3AG2E 1ZU2A 3HXEA 2XRZA 4ACKA 3LDZA 2QFCA 1PY1A 2PQNA 3FU3A 3OXLA 5CERB 4BX8A 3ZXPA 2NSZA 3TWTA 2R2LA 1Z3XA 3E33A 2BKKB 4BSZB 3V30A 4U8VD 2DYSE 1N94A 4BX9A 3V31A 4FA6A 4GYYA 3NQPA 4JPSA 2KCKA 4G26A 4GAAA 4Y6CA 1S64A 1K3ZD 1NA0A 4I6JA 2VSNA 1H2UA 4GZDA 1KT1A 3CK7A 3LCAA 3CHSA 4J8EA 2KXPC 2OV8A 3FULA 2B6CA 4I2WA 1N0QA 3PNTB 3UTMA 3ZYKA 1EF1C 4C48B 5FIOA 3EUVA 2A4ZA 3QC1A 1N52A 3TWXA 3CV0A 4G1TA 3LYAA 3SO8A 3CEQA 3CVVA 2XPZA 5CEAA 4XX5A 3DBSA 3Q9NC 3DSXA 4HI9A 5FT9A 1FVFA 4AVXA 4NIKA 4PUCA 1HU3A 4DX1A 1FVHA 1ZB1A 4I1AA 2WXLA 3TXMA 5CEDB 2E0IA 3SFYA 2KATA 5G04C 3SZ7A 3PZ2A 3OTNA 4QQIA 5ARGA 2WMNA 1Z3YA 2CG3A 2WPVA 3L16A 3X2QE 1JCRA 4WWNA 4GZ5A 2I2OA 4JVSA 2V0PA 5CMYA 2H6IA 5CRUA 2IF4A 4JA7A 4L2LA 2LUHA 3ZRHA 5FZSA 4OAUC 4JC8A 5LX8A 3SY2A 1H6KA 3CVLA 5JJ6A 4L9PA 3JUEA 2KM4A 4L7TA 5BV1A 4GTRA 5AYWD 2P9SG 2CFUA 2XENA 1P5QA 1H19A 3Q15A 4DPRA 1X81A 5BXOA 2ZIRA 3RO2A 1ELRA 4BETA 3HRAA 4G8LA 3JCKC 1N11A 2H6FA 3GZSA 2WXPA 4J7WA 2VSYA 2P58C 1NA3A 4HBDA 3MKQA 1JCSA 2EILE 4FU3A 2BF0X 1OWOA 2FO7A 3ESKA 3SI5A 3CK8A 1OT8A 1H2VC 2I9CA 3B7UX 3S2AA 2DIWA 3UUXA 4KXKB 3ZUVB 1UJJA 4N5CA 1JWGA 3D9JA 2HO1A 3ZW3A 3GZ2A 3EJNA 1W3BA 3AS8A 5AQAA 2PL2A 4GTOA 1OCOE 3FUMA 5AIJA 1S63A 4U7EB 3FTWA 1BI8B 2V4LA 3MEKA 5BXUA 3S7DA 3JUIA 4GA2A 4JHKA 4KZ0A 1UOHA 1NFIE 4GPKA 2WM9A 3UKUG 3QARA 1A5EA 4NQ0A 3RRMB 5ENQD 5ANRA 2Y69E 3C98A 2LXLA 1UG3A 2XCBA 3L9TA 4H7YA 3GYZA 5HQ8A 4HORA 5AQBA 3IKOB 4PH4B 2DCPA 3E32A 2R17C 4GTMA 2IEJA 3OAWA 3TAXA 3T9KA 3ZHEA 2R59A 4AXHA 3FTZA 2LSVA 3B7BA 1NI1A 2VSOE 4GTQA 2NC9A 4BY6A 3RRUA 1OUVA 4KMOA 3C3QA 4KT6B 5KNGA 4O1OA 4GTSA 3JQ0A 5KJKA 5FZRA 4BEPA 3DXMG 4EZLA 4I6EA 4HRNA 3ASHA 4XZ4A 1DNPA 3MGBA 4DUIA 5G55A 2ZU6B 2I1KA 1WDYA 3ZPJA 3AG1E 1WAO1 4F6RD 4E6HA 3ZYQA 4URKA 3SGHA 1UN8A 3QWVA 2FI7A 4K03A 4HQDA 2GRPB 3RRNB 4DX5D 1SW6A 2YQ8A 1N9AA 3CVPA 3SFZA 3CKBA 3ML9A 3L22A 3SD5A 5C1DA 1YMPA 4L23A 3K9IA 1HO8A 2KC7A 3Q49B 1O1RA 3FY4A 3LVQE 4KZCA 4HB5A 3UM3A 2HM8A 1Q2ZA 4GMRA 4RG6A 3UM2A 2E2EA 2WQ7A 5T8IA 3AG4E 3HDXA 5CMWA 2R5SA 4UQYA 5E75A 3URZA 5BUZA 4GZCA 2HYZA 2ETBA 3Q7AA 3L13A 1SZ9A 3KEAA 3DSTA 1QQEA 3Q75A 4WWOA 2XPYA 5FZQA 3FDHA 2AXZA 3ZNGA 3CQCB 4CT0A 4AIFA 2V5QC 3KEZA 1LF8A 2QY7A 2X6JA 4Q69A 5B1BE 3L08A 1TR4A 3Q73A 2F8YA 2WXNA 1Y8MA 1U2VG 3W9GA 2OEWA 1JCQA 5EILA 4H7XA 4N3BA 4FJYA 1TJCA 3R9MA 3L6AA 4M3OA 3IBEA 2GGFA 3UT8A 3BEEA 4DX2A 3ZYLA 3JQ1A 4G2VA 3MX3A 4CEMA 3V2XA 4BSXA 1KZOA 5CRVA 4UWLA 4M7CA 1E8YA 3PS6A 4BERA 5B1AE 3QKYA 1EPUA 5LOZA 3I3NA 3DXKG 4UQXA 1UW4B 2DYRE 3TXNA 2XZDG 1HS6A 3MV3B 3CKCA 3HXBA 1N4SA 3BG0B 5EYLA 2EIME 1SQMA 1MQSA 3TJPA 4HRMB 2KBXA 4YDWA 4OVVA 3EIQC 4N2SA 2AXUA 2WXQA 3B7RL 4B8CB 2IONA 2J08A 4G25A 3I5PA 2ILRA 4F53A 1H6OA 4TXPA 4CDNA 3P2BA 5IY5E 5J90A 4N5QA 3ML8A 4DLQA 3KD7A 3D9MA 2UWJG 4A3VA 3CVUA 3ZGQA 3D9PA 3CLJA 4GA0A 3FU5A 4HVBA 3CHRA 4I1OB 2C0LA 2NXPA 3ZIMA 3ASNE 5ENOD 3SF4A 4DX6D 3FUFA 4ANUA 4U0ZA 4LERA 2KCLA 3LY9A 1RZ4A 2F8XK 4I43A 4XI0A 4IULA 3CVNA 4R7LA 1OCZE 2WXOA 2CHXA 5FQ8A 2OOEA 2VTBA 4K5AB 3BUAA 4GTPA 3BG1B 2FO1E 3V2OA 1H2TC 4JW1A 5CHEE 2YHEA 4QFVA 4GU5A 4GMJA 4J8SA 2RG8A 1HE8A 1YCSB 4IN3B 2XCCA 1HFAA 4TV3A 3MCXA 2RKKA 2EIKE 3VLFA 5HKPA 3FUKA 5CECB 2XGMA 2VGYA 4YDEA 3RSEG 4K5CA 5EKQD 2A5EA 4TXQA 3T5XA 3WG7E 3L82A 3FHEA 2YINA 3AU5A 2VJ8A 4LG6A 1E7VA 4YDYA 3PNLB 2WXFA 1BU9A 2IO3C 3FH7A 4DI3A 1EDUA 5H7PA 4DK5A 3RAUA 3NZSA 2RD0A 3SBTB 3B13A 2GRRB 3TWVA 1HF8A 1K1AA 2WXIA 1BPOA 1QBQA 3G2UA 2C0MA 3PZ3A 1JWFA 5KJLA 3G2WA 2WQ6A 1B89A 4YVOA 2KCVA 3KSLA 3D9LA 4U96D 4WNFA 2Y0BG 3ZU7B 3ENEA 2FBNA 1NZNA 1XNFA 3KS2A 3TG4A 1NL4A 3E4BA 4FHJA 3DRAA 5KJNA 3CVWA 3IHYA 5JHBA 3FTYA 3LVRE 3L54A 5FQ4A 4UWHA 2ZGDA 4L1BA 1FPPA 4YNDA 3EHRA 3PE4A 4GTTA 3QWWA 4IRUA 5EIDA 4AEZC 1OCRE 4TUMA 2GRLA 4PS7A 1E8ZA 2L6JA 1TNBA 4V3IA 4BT9A 2I1JA 3CR3A 1U3CA 4WNGA 4U95D 5AJLA 1DCEA 2BUGA 3GZ1A 3SBSA 4J8DA 3HXFA 3MYVA 2VGEA 1O1TA 3P1UA 3CHOA 1EYHA 4RQIA 3Q7FA 3PREA 2XGSA 3QAQA 1DVPA 5A23A 1JPLA 4EBAA 3EHQA 3ZXSA 5T3RA 3B7SA 2QYJA 1IYGA 5ARFA 4U8YD 3B95A 3Q47B 1DCQA 3DSSA 2V4HC 3VTXA 3HYMB 1TNZA 3LJ3A 3ULYA 1TNOA 2J09A 3IXEA 4GYOA 2CHWA 3PH0C 4B0ZA 3DEPA 3PRZA 4LNUD 4ATZD 3T5VA 3UINC 2LO6A 1MX2A 4DI4A 1K8KG 4LNBA 3AS4A 3PVLA 5M72A 1TJFA 4U04A 3CIAA 3D9IA 2P9NG 2BKGA 4MKTA 5JMND 4U0SA 2R02A 2XPIA 4JD2G 4G23A 2VTBB 2DZOA 4A3TA 2LAHA 3MV2B 2IO2C 3ABLE 2Y1LE 4ABNA 1TEZA 3S7FA 4JZYA 3VTYA 2J49A 2YHCA 3RK6A 4O6FA 4LSZE 1IHBA 4U07A 4IYPA 4GPMA 3R7QA 1WM5A 4C0MA 5G05C 3RKVA 5A7DB 2EIJE 1MJ0A 4HS2A 4DJAA 4G8KA 1IQRA 1MYOA 1N0RA 3QOUA 5BW8C 1E8XA 3ULEG 2UY1A 3QDNA 1HXIA 5HRYA 1QZ2A 2IJGX 4CT4A 4PS3A 4AM9A 2AVPA 3FH8A 5E76A 3APDA 4JEUA 3ASOE 3FU0A 4G24A 5FQ6A 4I17A 3NB2A 3CHMA 4YVQC 4ZFHA 3RO3A 3E34A 3TL5A 5AAOA 1E90A 1OCCE 1AP7A 3NOGD 3UIPC 1TYQG 1OY3D 3UT4A 1UN9A 2IOLA 4A1GA 1OWMA 1VDYA 3ZFWA 3LY8A 4BTBA 2J8SD 2JEKA 4HLLA 1N4PA 4RG9A 2WXMA 1MX6A 5BV0A 2L6BA 4A1SA 2DWZA 4GTVA 2I6HA 5HI7A 2DZNA 4C9BB 4DX7D 2LAIA 2M63A 4O60A 1HZ4A 4B8AA 3ABKE 3EU9A 3FUNA 3HXDA 4Z68A 5T4YA 1D9SA 4AOFA 4WUYA 2PM7A 2XRYA 1HX8A 3RIBA 2ONDA 4K5BA 4FP7A 3ZYMA 3S7BA 5AN8A 1MHQA 3G2VA 2RFAA 2L0IA 4BWRA 4MLPA 3BU8A 2LNIA 2J07A 5KCMA 3FH5A 1V55E 3DWLG 5BT1A 4LEUA 1MX4A 2XS1A 4OAVB 3TWQA 3T8MA 1BI7B 1TN7A 4AY6A 3QJZA 4TUUA 4BESA 3OXFA 1FT1A 4U0UA 3ZHEB 4CDMA 3TWWA 2BTDA 1UJKA 1NP7A 3LKUA 3ZKJA 4HOUA 3FWVA 1KT0A 5FTPA 3NF1A 3T8KA 4X8QA 5AQ7A 4WWPA 5EIBE 5ENNA 3TGOA 1JUQA 3RJVA 4CCAA 2XEEA 3C72A 3FUJA 5EDSA 1HH8A 3O4ZA 5CCMA 3ISMC 5D66A 3AU4A 2AWIA 3DPDA 4U63A 2EQXA 4AY5A 2WQHA 5G05J 4J0UA 2VGXA 1OWNA 5AQ9A 3R7RA 2ETAA 4RVBA 3EDTB 3PE3A 4F3VA 1Z6TA 5FQ7A 2J4DA 4JXTA 5FWQA 4ME2A 4JL0A 2NYJA 1MZCA 4KYOB 3Q4AB 3LEWA 5DIZA 2XEVA 3VLEA 3ONKA 4HNAD 4LCTA 2AW6A 1WY6A 1ZBPA 3ZN3A 2P9LG 4GA1A 3MA5A 5ENRD 3O48A 5JHAA 5CCLA 2AXVA 3PEUB 3UT7A 3VLDA 2PZIA 3CGHA 2PNNA 2Y4UA 3D9NA 5AENA
chains in the Genus database with same CATH topology
3FUIA 3E4BA 4FHJA 3QARA 4J6IA 3G2SA 4NQ0A 5KJNA 2IU1A 3CHQA 3RRMB 5ANRA 2X3MA 3C98A 3CVWA 4JEHA 2XCBA 1UG3A 2WXGA 3IHYA 3IEGA 4H7YA 5JHBA 3GYZA 3FTYA 3LVRE 3L54A 5FQ4A 5HQ8A 4UWHA 4HORA 3IKOB 4PH4B 3FEYA 4L1BA 2DCPA 2JLBA 5EX3A 4UI9C 4YNDA 2R17C 3PE4A 3LS8A 4Q94A 3FTUA 4L2YA 3OAWA 3KAEA 1L5JA 4KVMA 3QWWA 1HG2A 2L0TB 4LRZA 4IRUA 4MS6A 4AEZC 4GB9A 1QNFA 3TAXA 4GZ6A 4ILGA 3ZHEA 2R59A 4CRWA 3LY7A 4AXHA 2OVFA 3FTZA 2LSVA 2GRLA 4PS7A 1OWPA 1E8ZA 2L6JA 4Y6WA 3HIZA 2VSOE 4I2ZA 4N3AA 2NC9A 4BY6A 2KZTA 3CVQA 3RRUA 1OUVA 3MKRA 4B94A 4V3IA 4BT9A 2I1JA 3CR3A 1H0AA 3U64A 1U3CA 4WNGA 4C0EA 5AJLA 4KMOA 4BT8A 4KT6B 3ASFA 2CG2A 3ASGA 3CVXA 2BUGA 3GZ1A 3JQ0A 3SBSA 4GYWA 5KJKA 4ANWA 4J8DA 5FZRA 4LUNU 4EZLA 2IQCA 3MYVA 3CVYA 4I6EA 2VYIA 2PM6A 3ASHA 4XZ4A 2YNQA 3P1UA 3CHOA 1XGWA 1EYHA 3PREA 1DNPA 3HVEA 4XIFA 4BFRA 1E7UA 3MGBA 5D0QD 2XGSA 3QAQA 1DVPA 4GCNA 5G55A 5LP0A 3PUKA 5A23A 1JPLA 2ZU6B 4JA9A 4EBAA 4CGVA 4E85A 3QNKA 3S7JA 3UQ3A 3PZDA 5D0OD 2I1KA 3PEVB 3ZXSA 5LCWJ 5T3RA 4OYSA 3B7SA 1IYGA 4WNDA 5BPPA 5ARFA 2Y4TA 3L17A 3ZPJA 3Q47B 5KJMA 4RSYA 1WAO1 3VTXA 4E6HA 3HYMB 5G04J 3LJ3A 2WXHA 4GMLA 2J09A 3ZYQA 4GYOA 3D9KA 4URKA 2CHWA 3PH0C 2OVBA 1UN8A 4XKCA 3SGHA 4B0ZA 3PRZA 3QWVA 4UWFA 3FUHA 5JJTA 2FI7A 3T5VA 4I9EA 4K03A 2FEZA 3QB2A 4B89A 2LO6A 3RRNB 1HG5A 1N54A 4ILIA 4DI4A 2IFUA 4HLEA 4KBQA 3AS4A 3PVLA 1PAQA 4UWKA 4GCOA 1TJFA 5M72A 2X6IA 2YQ8A 3U3WA 4U04A 4ATGA 3CIAA 3D9IA 4N2QA 4F1SA 3CVPA 2XHEA 3SFZA 2J9QA 2FF4A 3CKBA 3ML9A 2UY1B 3L22A 3SD5A 4MKTA 5C1DA 4L23A 3K9IA 4EQFA 1HO8A 2KC7A 2VGXB 4U0SA 1ELKA 4EPZA 3G2TA 2XPIA 3Q49B 3FY4A 4NRHB 4MRUA 4G23A 3I4GA 3FTSA 3CHPA 3LVQE 4KZCA 4NURA 1IHGA 4UWGA 2VTBB 3ONLA 4FJZA 4I9CA 4A3TA 2HM8A 2LAHA 4FLBA 3MV2B 4RG6A 3GW4A 4KVOA 2E2EA 2WQ7A 5T8IA 4WNEA 3HDXA 1PC2A 2C2LA 3HVEB 3HHMA 4ABNA 2R5SA 3S7FA 4JZYA 3VTYA 5CMWA 1TEZA 3RU0A 4UQYA 3UPVA 2J49A 2YHCA 5AJDA 5E75A 3URZA 4GZCA 3RK6A 5BUZA 2HYZA 4O6FA 4HOQA 2X6FA 3L13A 1A17A 3SNXA 4U07A 3UX4A 4GZ3A 4IYPA 1SZ9A 3R7QA 1WM5A 4EZJA 4JHRA 1QQEA 4C0MA 4WWOA 5C2YA 3LXUX 3ZEFA 3D3MA 4EECA 2FULA 2KZTB 3ESLA 4G11A 2XPYA 5FZQA 5G05C 3FDHA 2AXZA 3RKVA 5A7DB 4I1MA 3U4TA 3CQCB 3CSFA 3EHMA 4AJWA 3FTVA 3LPZA 4CT0A 3U66A 4AIFA 4HS2A 3KEZA 1LF8A 2QY7A 4DJAA 2X6JA 2WXKA 4HXIA 1IQRA 3QOUA 3FEXA 4Q69A 5BW8C 3ZVVA 3L08A 1E8XA 4TRQA 4APFA 2WXNA 1U3DA 3I4RB 3Q5MA 4EZKA 4Q96A 1Y8MA 1X5BA 2UY1A 4FHKA 3QDNA 3UMVA 1HXIA 2MOWA 1QZ2A 1ZU2A 2XRZA 4H7XA 4N3BA 4ACKA 2IJGX 3LDZA 2QFCA 1PY1A 2PQNA 3FU3A 1TJCA 4FJYA 4PS3A 4CT4A 3OXLA 2AVPA 3FH8A 5E76A 4AM9A 5J08A 3FU6A 3APDA 3L6AA 2WMOA 4JEUA 4M3OA 3IBEA 3FU0A 4BX8A 2GGFA 4G24A 3UT8A 2V5FA 3BEEA 3ZYLA 2NSZA 5FQ6A 3JQ1A 4I17A 2XQ0A 4G2VA 5FJYA 3CHMA 4YVQC 3RO3A 3PDNA 4FLHA 3MX3A 3TL5A 4CEMA 1E90A 4BSXA 5ANLA 4A55A 1E96B 4FADA 4UWLA 1Z3XA 4CDRA 1E8YA 3PS6A 3N71A 3QKYA 5BNWA 4U8HA 3UT4A 1UN9A 1EPUA 4OVUA 2IOLA 1OWMA 3ASDA 5LOZA 3I3NA 4NACA 4A1GA 1VDYA 1Y6IA 3CQGB 3ZFWA 4BX9A 1GW6A 3LY8A 4BTBA 4DLOA 2JEKA 2X6HA 4HOTA 2HR2A 4UQXA 1UW4B 4FA6A 4GYYA 4RG9A 2WXMA 3NQPA 5LCWC 4JPSA 5BV0A 2KCKA 4G26A 3TXNA 1HS6A 4GAAA 4Y6CA 4A1SA 5LFAA 3MV3B 3CKCA 3AS5A 2I6HA 1NA0A 3BG0B 5HI7A 4I6JA 2VSNA 1H2UA 1SQMA 4ILHB 4C9BB 1MQSA 1KT1A 2LAIA 3FUDA 3MJWA 2M63A 3CK7A 3PUJA 4GZDA 4JHJA 3TG5A 3TJPA 1HZ4A 3LCAA 3CHSA 4B8AA 4J8EA 3WXXA 1INZA 4AV7A 2OV8A 4OVVA 3FUNA 3EIQC 3FULA 3FUEA 4N2SA 2DBAA 4I2WA 3FP3A 3PNTB 5T4YA 2AXUA 2L9BA 4AOFA 4WUYA 2WXQA 4ANXA 2PM7A 2XRYA 3ZYKA 1EF1C 1HX8A 3RIBA 2ONDA 3B7RL 2WXJA 3QWPA 4B8CB 2WVIA 2A4ZA 2IONA 2J08A 4FP7A 2A5UA 3QC1A 1N52A 4G25A 3ZYMA 2X38A 3CV0A 3S7BA 3I5PA 3IHVA 4G1TA 2ILRA 1MHQA 3G2VA 3JYSA 3LYAA 2Q7FA 4F53A 3CEQA 3CVVA 5DBKA 2XPZA 4XX5A 4UQZA 3DBSA 4CDNA 3P2BA 4N3CA 4F7AA 4FULA 2L0IA 4BWRA 4MLPA 5J90A 4ACLA 5FT9A 1FVFA 2VQ2A 3ML8A 4FC8A 4DLQA 4AVXA 4PUCA 1ELWA 2LNIA 1HU3A 3KD7A 2J07A 3D9MA 2UWJG 3MKQB 3R9AB 4A3VA 2MRIA 4P29A 3ULQA 3B7TA 3U9WA 3OXGA 4XE0A 1FVHA 3CVUA 2LSUA 4I1AA 1IQUA 5KCMA 3ZGQA 2WXLA 3TXMA 3D9PA 2E0IA 2KATA 3APFA 3CLJA 3FH5A 4UI9K 4UI9J 5G04C 4GA0A 3FU5A 4HVBA 3CHRA 3SZ7A 4WAFA 4I1OB 3APCA 4J8FA 2C0LA 3CK9A 2NXPA 3OTNA 5BT1A 3FTXA 3D9OA 5ARGA 2WMNA 3ZIMA 1Z3YA 2IOSA 4LEUA 2CG3A 2WPVA 3L16A 3QK0A 3T8MA 1E8WA 4WWNA 4GZ5A 3SF4A 2I2OA 4JVSA 2V0PA 4PS8A 5CMYA 4AY6A 3QJZA 2IF4A 4JA7A 4L2LA 4TUUA 3OXFA 3ZRHA 1OWLA 2PQRA 3FUFA 5FZSA 2WXRA 4JC8A 4AP2A 4ANUA 4U0UA 4U0ZA 4LERA 2KCLA 3LY9A 5LX8A 1FCHA 4N39A 4CGWA 3ZHEB 4CDMA 3NZUA 2BTDA 4I43A 1UJKA 4XI0A 1H6KA 2V8SE 1NP7A 4IULA 3CVLA 3CVNA 3LKUA 4R7LA 4XKBA 4HOUA 2WXOA 1KT0A 2CHXA 3FWVA 5FTPA 5JJ6A 4ANVA 4K0RA 5FQ8A 2OOEA 2VTBA 2KM4A 3NF1A 4L7TA 5BV1A 4WWPA 5AYWD 2GW1A 3BG1B 2CFUA 2J4BA 1H2TC 4JW1A 5CHEE 5ENNA 1JUQA 3TGOA 2YHEA 4QFVA 4GU5A 1P5QA 4GMJA 1H19A 4J8SA 2RG8A 2CHZA 3Q15A 4XI9A 4DPRA 1HE8A 4PDXA 4IN3B 3RJVA 4CCAA 2GRMA 1SZAA 3SHFA 3RO2A 1ELRA 3FUJA 5EDSA 1HH8A 3O4ZA 1YA0A 5CCMA 2XCCA 1HFAA 3JCKC 3AU4A 2AWIA 3DPDA 4TV3A 4U63A 3GZSA 2X6KA 2WXPA 3MCXA 2VSYA 2P58C 3VLFA 1NA3A 2EQXA 3FUKA 4AY5A 2XGMA 2Y3AA 2VGYA 4I6GA 4BTAA 3MKQA 2WQHA 5G05J 4FU3A 4J0UA 2BF0X 5EKQD 1OWOA 2VGXA 2FO7A 3ESKA 3T5XA 1OWNA 5A6CA 4EBAG 2MHKA 3FHEA 4HFGA 2YINA 3AU5A 2VJ8A 4W9RA 1E7VA 5EX0A 3CK8A 3R7RA 3SI5A 3PNLB 4RVBA 3EDTB 3EHNA 2WXFA 3PE3A 4F3VA 1Z6TA 5FQ7A 2CFZA 2J4DA 4JXTA 3CSTA 1H2VC 5FWQA 3FH7A 2I9CA 3B7UX 3EIJA 3S2AA 4DI3A 2DIWA 1EDUA 3UUXA 2WB2A 4KXKB 1KLXA 1UJJA 4ME2A 4N5CA 4DK5A 4JL0A 3NZSA 2VSXE 2RD0A 3SBTB 1JWGA 3D9JA 3MZLB 2HO1A 3B13A 3ZW3A 1HF8A 2WXIA 3GZ2A 3EJNA 1BPOA 3IV0A 4KYOB 3G2UA 2C0MA 3Q4AB 3LEWA 5G2NA 1W3BA 5DIZA 1JWFA 2XEVA 5KJLA 3VLEA 3FFLA 3AS8A 1S0PA 3G2WA 3ONKA 2PL2A 4D10C 5JJ7A 2WQ6A 2XGOA 1B89A 4LCTA 2AW6A 1WY6A 2KCVA 3FUMA 4YVOA 3D9LA 5AIJA 1ZBPA 3ZN3A 4WNFA 4GA1A 3FTWA 3MA5A 4APOA 3O48A 2V4LA 3ENEA 3MEKA 5JHAA 5CCLA 2FBNA 3JUIA 2AXVA 4GA2A 4JHKA 1NZNA 1XNFA 4KZ0A 3S7DA 3PEUB 3KS2A 3UT7A 3VLDA 2PZIA 3CGHA 4GPKA 2Y4UA 3D9NA 3TG4A 4HOSA 5AENA 2WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9Q A;  3ASD A;  4XI0 A;  2FF4 A;  3CKB A;  3E4B A;  2UY1 B;  3CVL A;  3CVN A;  3LKU A;  3ZFW A;  4GPK A;  3LY8 A;  4BTB A;  5C1D A;  3K9I A;  4NQ0 A;  4EQF A;  5KJN A;  4HOT A;  2HR2 A;  2KC7 A;  2VGX B;  1KT0 A;  3FWV A;  4HOU A;  4U0S A;  4UQX A;  5FTP A;  4GYY A;  2XCB A;  5JJ6 A;  4RG9 A;  4N2Q A;  2OOE A;  2XPI A;  3IEG A;  2KCK A;  3Q49 B;  4H7Y A;  4G26 A;  3GYZ A;  4NRH B;  3NF1 A;  4Y6C A;  4A1S A;  5HQ8 A;  4HOR A;  4G23 A;  3MV3 B;  2JLB A;  5AYW D;  5EX3 A;  2GW1 A;  3CKC A;  3AS5 A;  1IHG A;  2I6H A;  4UI9 C;  1NA0 A;  4YND A;  5CHE E;  4I9C A;  5HI7 A;  3TGO A;  3TG5 A;  3PE4 A;  2VSN A;  3MV2 B;  4RG6 A;  3GW4 A;  5LCW C;  1KT1 A;  1P5Q A;  2E2E A;  3CK7 A;  4WNE A;  4ABN A;  1PC2 A;  2C2L A;  3KAE A;  3Q15 A;  1HZ4 A;  2R5S A;  3LCA A;  3QWW A;  4J8E A;  4XI9 A;  3S7F A;  3VTY A;  3WXX A;  3RU0 A;  4IN3 B;  4UQY A;  3RJV A;  3UPV A;  2YHC A;  3URZ A;  3TAX A;  2HYZ A;  4O6F A;  4GZ6 A;  3RO2 A;  3ZHE A;  1ELR A;  4HOQ A;  3LY7 A;  2LSV A;  1HH8 A;  4N2S A;  1A17 A;  1YA0 A;  2DBA A;  4I2W A;  2L6J A;  4GZ3 A;  4U07 A;  2XCC A;  3FP3 A;  4Y6W A;  4I2Z A;  4N3A A;  1WM5 A;  2NC9 A;  4JHR A;  1QQE A;  3CVQ A;  4WUY A;  1OUV A;  2VSY A;  2P58 C;  3MKR A;  1NA3 A;  5G05 C;  4B94 A;  5FZQ A;  2OND A;  3RIB A;  4BT9 A;  3RKV A;  3QWP A;  5A7D B;  4AY5 A;  2XGM A;  4WNG A;  3U4T A;  2VGY A;  4BT8 A;  4BTA A;  4G25 A;  2WQH A;  3ASF A;  3ASG A;  3CV0 A;  3LPZ A;  2BUG A;  3GZ1 A;  3S7B A;  4AIF A;  4GYW A;  4G1T A;  5G05 J;  5KJK A;  3JYS A;  4J8D A;  3LYA A;  2Q7F A;  4J0U A;  3CEQ A;  3QOU A;  2VGX A;  5EKQ D;  2FO7 A;  5DBK A;  5FZR A;  3ESK A;  4UQZ A;  5BW8 C;  2VYI A;  4N3C A;  5A6C A;  2MHK A;  3ASH A;  4W9R A;  5EX0 A;  3CK8 A;  4BWR A;  3EDT B;  4XIF A;  3Q5M A;  2VQ2 A;  3PE3 A;  5FT9 A;  4F3V A;  1Y8M A;  2UY1 A;  5D0Q D;  2XGS A;  3QDN A;  4GCN A;  1HXI A;  1ELW A;  2LNI A;  3KD7 A;  4JA9 A;  2UWJ G;  3R9A B;  4CGV A;  3S7J A;  1QZ2 A;  1ZU2 A;  3UUX A;  4H7X A;  3UQ3 A;  4KXK B;  4N3B A;  1KLX A;  5D0O D;  3OXG A;  4ME2 A;  3ULQ A;  5LCW J;  2QFC A;  4N5C A;  4WND A;  2PQN A;  1IYG A;  4JL0 A;  2LSU A;  4I1A A;  5ARF A;  1TJC A;  2Y4T A;  3ZGQ A;  3OXL A;  2AVP A;  4AM9 A;  4UI9 K;  2HO1 A;  2KAT A;  3Q47 B;  4UI9 J;  3ZPJ A;  5KJM A;  5G04 C;  4GA0 A;  1WAO 1;  3GZ2 A;  4KYO B;  3VTX A;  3HYM B;  3SZ7 A;  2C0M A;  3Q4A B;  4G24 A;  4J8F A;  5G04 J;  2C0L A;  1W3B A;  2V5F A;  3BEE A;  3CK9 A;  5BT1 A;  5DIZ A;  5ARG A;  2XEV A;  4I17 A;  4LEU A;  5KJL A;  3FFL A;  3AS8 A;  4G2V A;  4GYO A;  2PL2 A;  2WPV A;  5FJY A;  5JJ7 A;  4YVQ C;  2XGO A;  1B89 A;  3RO3 A;  3PDN A;  2KCV A;  4YVO A;  1ZBP A;  3QWV A;  3ZN3 A;  5JJT A;  2FI7 A;  4GZ5 A;  3SF4 A;  5CCM A;  4I9E A;  4WNF A;  4GA1 A;  4AY6 A;  2FEZ A;  4APO A;  3MA5 A;  2IF4 A;  3O48 A;  4JA7 A;  1E96 B;  3MEK A;  3OXF A;  4CDR A;  5CCL A;  2FBN A;  4GA2 A;  2PQR A;  5FZS A;  1NZN A;  1XNF A;  3N71 A;  3S7D A;  2IFU A;  3KS2 A;  4U0U A;  4U0Z A;  2KCL A;  2PZI A;  3LY9 A;  1FCH A;  3QKY A;  3AS4 A;  4KBQ A;  4N39 A;  5BNW A;  4CGW A;  4GCO A;  2Y4U A;  3ZHE B;  2YQ8 A;  3TG4 A;  5M72 A;  3U3W A;  4U04 A;  4HOS A;  3CVP A; 
#chains in the Genus database with same CATH topology
 2ETC A;  3FUI A;  2IU1 A;  3CHQ A;  2X3M A;  4JEH A;  5EN5 D;  2P9I G;  3AG3 E;  4UUC A;  1N4R A;  3LS8 A;  3FTU A;  3KAE A;  1L5J A;  4KVM A;  1DC2 A;  4GB9 A;  4GZ6 A;  5FIN A;  4CRW A;  2OVF A;  2H6G A;  3HIZ A;  4N3A A;  2XS8 A;  3TWR A;  2KZT A;  3E30 A;  3NAW A;  4B94 A;  1H0A A;  4C0E A;  4BT8 A;  2XZT G;  4GYW A;  4ANW A;  3F6Q A;  4LUN U;  2F37 A;  2YNQ A;  1XGW A;  4XIF A;  3E37 A;  1E7U A;  5D0Q D;  5LP0 A;  3PUK A;  1LTX A;  4CGV A;  4E85 A;  3S7J A;  3UQ3 A;  3PZD A;  5D0O D;  3PEV B;  1FT2 A;  4ZHB A;  3L17 A;  5KJM A;  3JXJ A;  4RSY A;  3SFX A;  2QC9 A;  5KNH D;  4GML A;  3SQV A;  3D9K A;  2OVB A;  1WG0 A;  3FUH A;  5CBN A;  4HI8 A;  4I9E A;  1OXJ A;  2FEZ A;  3QB2 A;  1HG5 A;  4ILI A;  2IFU A;  4HLE A;  1IKN D;  1PAQ A;  4UWK A;  4GCO A;  1SVX A;  3UKR G;  2UY1 B;  2VGX B;  1D8E A;  4EPZ A;  4MRU A;  3I4G A;  4NUR A;  1IHG A;  4UWG A;  3ONL A;  3W9F A;  4FLB A;  3UIO C;  4WNE A;  2C2L A;  3HVE B;  4LNG A;  2ZIS A;  3HXC A;  4HOQ A;  5ENS D;  3SNX A;  4GZ3 A;  4EZJ A;  4JHR A;  5C2Y A;  3LXU X;  3ZEF A;  4EEC A;  2FUL A;  3ESL A;  4I1M A;  4EHM A;  3CSF A;  4AJW A;  4MBG A;  3LPZ A;  2IY0 C;  4HXI A;  1BD8 A;  2B0O E;  4APF A;  1U3D A;  3I4R B;  3Q5M A;  4Q96 A;  4FHK A;  2H6H A;  3ABM E;  2MOW A;  2R03 A;  5J08 A;  3FU6 A;  2WMO A;  2V5F A;  2LXM A;  2XQ0 A;  5FJY A;  3C3O A;  3PDN A;  4FLH A;  3AAA C;  2AJA A;  3LJN A;  5ANL A;  4A55 A;  1E96 B;  4FAD A;  4CDR A;  3N71 A;  5BNW A;  2GRQ B;  4U8H A;  1KPS B;  3Q79 A;  4OVU A;  3ASD A;  4J8Y A;  4NAC A;  1Y6I A;  3CQG B;  1GW6 A;  1G3N B;  1TN6 A;  4DLO A;  2X6H A;  4HOT A;  2HR2 A;  4O1P A;  5LFA A;  3AS5 A;  1TN8 A;  3TWU A;  4YDO A;  4ILH B;  5LCW C;  3FUD A;  3MJW A;  3PUJ A;  4JHJ A;  3TG5 A;  2JAB A;  1N4Q A;  3WXX A;  1INZ A;  4AV7 A;  4DRX E;  4CZ2 D;  4TXR A;  2QYU A;  3FUE A;  2DBA A;  4RLY A;  3FP3 A;  2EIN E;  2L9B A;  1TNY A;  3UM1 A;  4ANX A;  2ZGG A;  2WXJ A;  3QWP A;  2WVI A;  4HRL A;  2A5U A;  2X38 A;  3IHV A;  3JYS A;  2Q7F A;  3J5Q B;  5DBK A;  4UQZ A;  4N3C A;  4F7A A;  4FUL A;  4ACL A;  2VQ2 A;  2R05 A;  4FC8 A;  4XEI G;  1ELW A;  3MKQ B;  3R9A B;  2MRI A;  4P29 A;  3ULQ A;  3B7T A;  3U9W A;  3OXG A;  4XE0 A;  2LSU A;  1IQU A;  4UI9 J;  4UI9 K;  3APF A;  3AJI A;  5EYP F;  1RW2 A;  4WAF A;  3APC A;  4J8F A;  3CK9 A;  3FTX A;  3D9O A;  2IOS A;  3QK0 A;  1E8W A;  4PS8 A;  1O5M A;  1IXV A;  1OWL A;  2PQR A;  2WXR A;  4AP2 A;  3NOC D;  3C3R A;  1H6P A;  1FCH A;  4N39 A;  4CGW A;  1SA5 A;  2OCC E;  3NZU A;  3Q9U C;  5ITZ F;  2V8S E;  1QYM A;  4JB8 P;  4XKB A;  5JA4 D;  4ANV A;  4K0R A;  1YYH A;  3NBN B;  2GRN B;  3UI2 A;  2GW1 A;  2J4B A;  5ENP D;  2CHZ A;  4XI9 A;  4PDX A;  2GRM A;  1SZA A;  2P9K G;  3SHF A;  1YA0 A;  2X6K A;  3UM0 A;  2Y3A A;  4I6G A;  4BTA A;  1D8D A;  1S70 B;  5A6C A;  4EBA G;  2MHK A;  4HFG A;  4W9R A;  5EX0 A;  3EHN A;  2CFZ A;  3CST A;  1V54 E;  3EIJ A;  5D2M C;  2WB2 A;  1KLX A;  1AWC B;  2VSX E;  3MZL B;  3IV0 A;  5G2N A;  4A63 B;  1TNU A;  3FFL A;  4D10 C;  1S0P A;  5JJ7 A;  2XGO A;  3DSU A;  4CYM D;  2HE0 A;  4APO A;  3DEO A;  2P9P G;  3TWS A;  2DVW A;  2BED A;  4HOS A;  1LD8 A;  5KBA A;  1O1S A;  4J6I A;  3EU5 A;  3G2S A;  3BQO A;  2WXG A;  3V79 K;  3IEG A;  3FEY A;  2GRO B;  1K1B A;  2JLB A;  5EX3 A;  3UXG A;  4UI9 C;  3DSV A;  4Q94 A;  4L2Y A;  2F0Y A;  1HG2 A;  2L0T B;  4LRZ A;  4MS6 A;  2XEH A;  1QNF A;  4ILG A;  3LY7 A;  1OWP A;  4Y6W A;  4I2Z A;  2OEV A;  2RFM A;  3D9H A;  3CVQ A;  5ENT D;  3MKR A;  3J5P A;  3U64 A;  3ASF A;  2CG2 A;  3ASG A;  3CVX A;  1N95 A;  3JXI A;  2IQC A;  3CVY A;  2VYI A;  2PM6 A;  3HVE A;  4BFR A;  4GCN A;  4JA9 A;  3QNK A;  5LCW J;  3HG0 D;  1KZP A;  4OYS A;  4WND A;  5BPP A;  1BLX B;  2Y4T A;  3DSW A;  3C5R A;  5G04 J;  3PZ1 A;  4F1P A;  2WXH A;  3PZ4 A;  2P2C P;  4XKC A;  4UWF A;  1Z5S C;  5JJT A;  4B89 A;  1N54 A;  3DPY A;  4KBQ A;  3U3W A;  2X6I A;  4ATG A;  4N2Q A;  4F1S A;  2XHE A;  2J9Q A;  2FF4 A;  5B3S E;  4B93 B;  4EQF A;  5CBO A;  5AAR A;  1ELK A;  1LD7 A;  3G2T A;  2P9U G;  4NRH B;  3FTS A;  3CHP A;  4FJZ A;  4I9C A;  3GW4 A;  4KVO A;  3HHM A;  1PC2 A;  2ZXW E;  3RU0 A;  3UPV A;  5AJD A;  2X6F A;  1A17 A;  3UX4 A;  2QZA A;  3Q78 A;  3D3M A;  2KZT B;  5KWD A;  4G11 A;  3KSQ A;  3U4T A;  3EHM A;  5HS0 A;  3FTV A;  3U66 A;  1SA4 A;  2WXK A;  3FEX A;  2MYO A;  3ZVV A;  4TRQ A;  4EZK A;  1X5B A;  3UMV A;  3AG2 E;  1ZU2 A;  3HXE A;  2XRZ A;  4ACK A;  3LDZ A;  2QFC A;  1PY1 A;  2PQN A;  3FU3 A;  3OXL A;  5CER B;  4BX8 A;  3ZXP A;  2NSZ A;  3TWT A;  2R2L A;  1Z3X A;  3E33 A;  2BKK B;  4BSZ B;  3V30 A;  4U8V D;  2DYS E;  1N94 A;  4BX9 A;  3V31 A;  4FA6 A;  4GYY A;  3NQP A;  4JPS A;  2KCK A;  4G26 A;  4GAA A;  4Y6C A;  1S64 A;  1K3Z D;  1NA0 A;  4I6J A;  2VSN A;  1H2U A;  4GZD A;  1KT1 A;  3CK7 A;  3LCA A;  3CHS A;  4J8E A;  2KXP C;  2OV8 A;  3FUL A;  2B6C A;  4I2W A;  1N0Q A;  3PNT B;  3UTM A;  3ZYK A;  1EF1 C;  4C48 B;  5FIO A;  3EUV A;  2A4Z A;  3QC1 A;  1N52 A;  3TWX A;  3CV0 A;  4G1T A;  3LYA A;  3SO8 A;  3CEQ A;  3CVV A;  2XPZ A;  5CEA A;  4XX5 A;  3DBS A;  3Q9N C;  3DSX A;  4HI9 A;  5FT9 A;  1FVF A;  4AVX A;  4NIK A;  4PUC A;  1HU3 A;  4DX1 A;  1FVH A;  1ZB1 A;  4I1A A;  2WXL A;  3TXM A;  5CED B;  2E0I A;  3SFY A;  2KAT A;  5G04 C;  3SZ7 A;  3PZ2 A;  3OTN A;  4QQI A;  5ARG A;  2WMN A;  1Z3Y A;  2CG3 A;  2WPV A;  3L16 A;  3X2Q E;  1JCR A;  4WWN A;  4GZ5 A;  2I2O A;  4JVS A;  2V0P A;  5CMY A;  2H6I A;  5CRU A;  2IF4 A;  4JA7 A;  4L2L A;  2LUH A;  3ZRH A;  5FZS A;  4OAU C;  4JC8 A;  5LX8 A;  3SY2 A;  1H6K A;  3CVL A;  5JJ6 A;  4L9P A;  3JUE A;  2KM4 A;  4L7T A;  5BV1 A;  4GTR A;  5AYW D;  2P9S G;  2CFU A;  2XEN A;  1P5Q A;  1H19 A;  3Q15 A;  4DPR A;  1X81 A;  5BXO A;  2ZIR A;  3RO2 A;  1ELR A;  4BET A;  3HRA A;  4G8L A;  3JCK C;  1N11 A;  2H6F A;  3GZS A;  2WXP A;  4J7W A;  2VSY A;  2P58 C;  1NA3 A;  4HBD A;  3MKQ A;  1JCS A;  2EIL E;  4FU3 A;  2BF0 X;  1OWO A;  2FO7 A;  3ESK A;  3SI5 A;  3CK8 A;  1OT8 A;  1H2V C;  2I9C A;  3B7U X;  3S2A A;  2DIW A;  3UUX A;  4KXK B;  3ZUV B;  1UJJ A;  4N5C A;  1JWG A;  3D9J A;  2HO1 A;  3ZW3 A;  3GZ2 A;  3EJN A;  1W3B A;  3AS8 A;  5AQA A;  2PL2 A;  4GTO A;  1OCO E;  3FUM A;  5AIJ A;  1S63 A;  4U7E B;  3FTW A;  1BI8 B;  2V4L A;  3MEK A;  5BXU A;  3S7D A;  3JUI A;  4GA2 A;  4JHK A;  4KZ0 A;  1UOH A;  1NFI E;  4GPK A;  2WM9 A;  3UKU G;  3QAR A;  1A5E A;  4NQ0 A;  3RRM B;  5ENQ D;  5ANR A;  2Y69 E;  3C98 A;  2LXL A;  1UG3 A;  2XCB A;  3L9T A;  4H7Y A;  3GYZ A;  5HQ8 A;  4HOR A;  5AQB A;  3IKO B;  4PH4 B;  2DCP A;  3E32 A;  2R17 C;  4GTM A;  2IEJ A;  3OAW A;  3TAX A;  3T9K A;  3ZHE A;  2R59 A;  4AXH A;  3FTZ A;  2LSV A;  3B7B A;  1NI1 A;  2VSO E;  4GTQ A;  2NC9 A;  4BY6 A;  3RRU A;  1OUV A;  4KMO A;  3C3Q A;  4KT6 B;  5KNG A;  4O1O A;  4GTS A;  3JQ0 A;  5KJK A;  5FZR A;  4BEP A;  3DXM G;  4EZL A;  4I6E A;  4HRN A;  3ASH A;  4XZ4 A;  1DNP A;  3MGB A;  4DUI A;  5G55 A;  2ZU6 B;  2I1K A;  1WDY A;  3ZPJ A;  3AG1 E;  1WAO 1;  4F6R D;  4E6H A;  3ZYQ A;  4URK A;  3SGH A;  1UN8 A;  3QWV A;  2FI7 A;  4K03 A;  4HQD A;  2GRP B;  3RRN B;  4DX5 D;  1SW6 A;  2YQ8 A;  1N9A A;  3CVP A;  3SFZ A;  3CKB A;  3ML9 A;  3L22 A;  3SD5 A;  5C1D A;  1YMP A;  4L23 A;  3K9I A;  1HO8 A;  2KC7 A;  3Q49 B;  1O1R A;  3FY4 A;  3LVQ E;  4KZC A;  4HB5 A;  3UM3 A;  2HM8 A;  1Q2Z A;  4GMR A;  4RG6 A;  3UM2 A;  2E2E A;  2WQ7 A;  5T8I A;  3AG4 E;  3HDX A;  5CMW A;  2R5S A;  4UQY A;  5E75 A;  3URZ A;  5BUZ A;  4GZC A;  2HYZ A;  2ETB A;  3Q7A A;  3L13 A;  1SZ9 A;  3KEA A;  3DST A;  1QQE A;  3Q75 A;  4WWO A;  2XPY A;  5FZQ A;  3FDH A;  2AXZ A;  3ZNG A;  3CQC B;  4CT0 A;  4AIF A;  2V5Q C;  3KEZ A;  1LF8 A;  2QY7 A;  2X6J A;  4Q69 A;  5B1B E;  3L08 A;  1TR4 A;  3Q73 A;  2F8Y A;  2WXN A;  1Y8M A;  1U2V G;  3W9G A;  2OEW A;  1JCQ A;  5EIL A;  4H7X A;  4N3B A;  4FJY A;  1TJC A;  3R9M A;  3L6A A;  4M3O A;  3IBE A;  2GGF A;  3UT8 A;  3BEE A;  4DX2 A;  3ZYL A;  3JQ1 A;  4G2V A;  3MX3 A;  4CEM A;  3V2X A;  4BSX A;  1KZO A;  5CRV A;  4UWL A;  4M7C A;  1E8Y A;  3PS6 A;  4BER A;  5B1A E;  3QKY A;  1EPU A;  5LOZ A;  3I3N A;  3DXK G;  4UQX A;  1UW4 B;  2DYR E;  3TXN A;  2XZD G;  1HS6 A;  3MV3 B;  3CKC A;  3HXB A;  1N4S A;  3BG0 B;  5EYL A;  2EIM E;  1SQM A;  1MQS A;  3TJP A;  4HRM B;  2KBX A;  4YDW A;  4OVV A;  3EIQ C;  4N2S A;  2AXU A;  2WXQ A;  3B7R L;  4B8C B;  2ION A;  2J08 A;  4G25 A;  3I5P A;  2ILR A;  4F53 A;  1H6O A;  4TXP A;  4CDN A;  3P2B A;  5IY5 E;  5J90 A;  4N5Q A;  3ML8 A;  4DLQ A;  3KD7 A;  3D9M A;  2UWJ G;  4A3V A;  3CVU A;  3ZGQ A;  3D9P A;  3CLJ A;  4GA0 A;  3FU5 A;  4HVB A;  3CHR A;  4I1O B;  2C0L A;  2NXP A;  3ZIM A;  3ASN E;  5ENO D;  3SF4 A;  4DX6 D;  3FUF A;  4ANU A;  4U0Z A;  4LER A;  2KCL A;  3LY9 A;  1RZ4 A;  2F8X K;  4I43 A;  4XI0 A;  4IUL A;  3CVN A;  4R7L A;  1OCZ E;  2WXO A;  2CHX A;  5FQ8 A;  2OOE A;  2VTB A;  4K5A B;  3BUA A;  4GTP A;  3BG1 B;  2FO1 E;  3V2O A;  1H2T C;  4JW1 A;  5CHE E;  2YHE A;  4QFV A;  4GU5 A;  4GMJ A;  4J8S A;  2RG8 A;  1HE8 A;  1YCS B;  4IN3 B;  2XCC A;  1HFA A;  4TV3 A;  3MCX A;  2RKK A;  2EIK E;  3VLF A;  5HKP A;  3FUK A;  5CEC B;  2XGM A;  2VGY A;  4YDE A;  3RSE G;  4K5C A;  5EKQ D;  2A5E A;  4TXQ A;  3T5X A;  3WG7 E;  3L82 A;  3FHE A;  2YIN A;  3AU5 A;  2VJ8 A;  4LG6 A;  1E7V A;  4YDY A;  3PNL B;  2WXF A;  1BU9 A;  2IO3 C;  3FH7 A;  4DI3 A;  1EDU A;  5H7P A;  4DK5 A;  3RAU A;  3NZS A;  2RD0 A;  3SBT B;  3B13 A;  2GRR B;  3TWV A;  1HF8 A;  1K1A A;  2WXI A;  1BPO A;  1QBQ A;  3G2U A;  2C0M A;  3PZ3 A;  1JWF A;  5KJL A;  3G2W A;  2WQ6 A;  1B89 A;  4YVO A;  2KCV A;  3KSL A;  3D9L A;  4U96 D;  4WNF A;  2Y0B G;  3ZU7 B;  3ENE A;  2FBN A;  1NZN A;  1XNF A;  3KS2 A;  3TG4 A;  1NL4 A;  3E4B A;  4FHJ A;  3DRA A;  5KJN A;  3CVW A;  3IHY A;  5JHB A;  3FTY A;  3LVR E;  3L54 A;  5FQ4 A;  4UWH A;  2ZGD A;  4L1B A;  1FPP A;  4YND A;  3EHR A;  3PE4 A;  4GTT A;  3QWW A;  4IRU A;  5EID A;  4AEZ C;  1OCR E;  4TUM A;  2GRL A;  4PS7 A;  1E8Z A;  2L6J A;  1TNB A;  4V3I A;  4BT9 A;  2I1J A;  3CR3 A;  1U3C A;  4WNG A;  4U95 D;  5AJL A;  1DCE A;  2BUG A;  3GZ1 A;  3SBS A;  4J8D A;  3HXF A;  3MYV A;  2VGE A;  1O1T A;  3P1U A;  3CHO A;  1EYH A;  4RQI A;  3Q7F A;  3PRE A;  2XGS A;  3QAQ A;  1DVP A;  5A23 A;  1JPL A;  4EBA A;  3EHQ A;  3ZXS A;  5T3R A;  3B7S A;  2QYJ A;  1IYG A;  5ARF A;  4U8Y D;  3B95 A;  3Q47 B;  1DCQ A;  3DSS A;  2V4H C;  3VTX A;  3HYM B;  1TNZ A;  3LJ3 A;  3ULY A;  1TNO A;  2J09 A;  3IXE A;  4GYO A;  2CHW A;  3PH0 C;  4B0Z A;  3DEP A;  3PRZ A;  4LNU D;  4ATZ D;  3T5V A;  3UIN C;  2LO6 A;  1MX2 A;  4DI4 A;  1K8K G;  4LNB A;  3AS4 A;  3PVL A;  5M72 A;  1TJF A;  4U04 A;  3CIA A;  3D9I A;  2P9N G;  2BKG A;  4MKT A;  5JMN D;  4U0S A;  2R02 A;  2XPI A;  4JD2 G;  4G23 A;  2VTB B;  2DZO A;  4A3T A;  2LAH A;  3MV2 B;  2IO2 C;  3ABL E;  2Y1L E;  4ABN A;  1TEZ A;  3S7F A;  4JZY A;  3VTY A;  2J49 A;  2YHC A;  3RK6 A;  4O6F A;  4LSZ E;  1IHB A;  4U07 A;  4IYP A;  4GPM A;  3R7Q A;  1WM5 A;  4C0M A;  5G05 C;  3RKV A;  5A7D B;  2EIJ E;  1MJ0 A;  4HS2 A;  4DJA A;  4G8K A;  1IQR A;  1MYO A;  1N0R A;  3QOU A;  5BW8 C;  1E8X A;  3ULE G;  2UY1 A;  3QDN A;  1HXI A;  5HRY A;  1QZ2 A;  2IJG X;  4CT4 A;  4PS3 A;  4AM9 A;  2AVP A;  3FH8 A;  5E76 A;  3APD A;  4JEU A;  3ASO E;  3FU0 A;  4G24 A;  5FQ6 A;  4I17 A;  3NB2 A;  3CHM A;  4YVQ C;  4ZFH A;  3RO3 A;  3E34 A;  3TL5 A;  5AAO A;  1E90 A;  1OCC E;  1AP7 A;  3NOG D;  3UIP C;  1TYQ G;  1OY3 D;  3UT4 A;  1UN9 A;  2IOL A;  4A1G A;  1OWM A;  1VDY A;  3ZFW A;  3LY8 A;  4BTB A;  2J8S D;  2JEK A;  4HLL A;  1N4P A;  4RG9 A;  2WXM A;  1MX6 A;  5BV0 A;  2L6B A;  4A1S A;  2DWZ A;  4GTV A;  2I6H A;  5HI7 A;  2DZN A;  4C9B B;  4DX7 D;  2LAI A;  2M63 A;  4O60 A;  1HZ4 A;  4B8A A;  3ABK E;  3EU9 A;  3FUN A;  3HXD A;  4Z68 A;  5T4Y A;  1D9S A;  4AOF A;  4WUY A;  2PM7 A;  2XRY A;  1HX8 A;  3RIB A;  2OND A;  4K5B A;  4FP7 A;  3ZYM A;  3S7B A;  5AN8 A;  1MHQ A;  3G2V A;  2RFA A;  2L0I A;  4BWR A;  4MLP A;  3BU8 A;  2LNI A;  2J07 A;  5KCM A;  3FH5 A;  1V55 E;  3DWL G;  5BT1 A;  4LEU A;  1MX4 A;  2XS1 A;  4OAV B;  3TWQ A;  3T8M A;  1BI7 B;  1TN7 A;  4AY6 A;  3QJZ A;  4TUU A;  4BES A;  3OXF A;  1FT1 A;  4U0U A;  3ZHE B;  4CDM A;  3TWW A;  2BTD A;  1UJK A;  1NP7 A;  3LKU A;  3ZKJ A;  4HOU A;  3FWV A;  1KT0 A;  5FTP A;  3NF1 A;  3T8K A;  4X8Q A;  5AQ7 A;  4WWP A;  5EIB E;  5ENN A;  3TGO A;  1JUQ A;  3RJV A;  4CCA A;  2XEE A;  3C72 A;  3FUJ A;  5EDS A;  1HH8 A;  3O4Z A;  5CCM A;  3ISM C;  5D66 A;  3AU4 A;  2AWI A;  3DPD A;  4U63 A;  2EQX A;  4AY5 A;  2WQH A;  5G05 J;  4J0U A;  2VGX A;  1OWN A;  5AQ9 A;  3R7R A;  2ETA A;  4RVB A;  3EDT B;  3PE3 A;  4F3V A;  1Z6T A;  5FQ7 A;  2J4D A;  4JXT A;  5FWQ A;  4ME2 A;  4JL0 A;  2NYJ A;  1MZC A;  4KYO B;  3Q4A B;  3LEW A;  5DIZ A;  2XEV A;  3VLE A;  3ONK A;  4HNA D;  4LCT A;  2AW6 A;  1WY6 A;  1ZBP A;  3ZN3 A;  2P9L G;  4GA1 A;  3MA5 A;  5ENR D;  3O48 A;  5JHA A;  5CCL A;  2AXV A;  3PEU B;  3UT7 A;  3VLD A;  2PZI A;  3CGH A;  2PNN A;  2Y4U A;  3D9N A;  5AEN A; 
#chains in the Genus database with same CATH homology
 3FUI A;  3E4B A;  4FHJ A;  3QAR A;  4J6I A;  3G2S A;  4NQ0 A;  5KJN A;  2IU1 A;  3CHQ A;  3RRM B;  5ANR A;  2X3M A;  3C98 A;  3CVW A;  4JEH A;  2XCB A;  1UG3 A;  2WXG A;  3IHY A;  3IEG A;  4H7Y A;  5JHB A;  3GYZ A;  3FTY A;  3LVR E;  3L54 A;  5FQ4 A;  5HQ8 A;  4UWH A;  4HOR A;  3IKO B;  4PH4 B;  3FEY A;  4L1B A;  2DCP A;  2JLB A;  5EX3 A;  4UI9 C;  4YND A;  2R17 C;  3PE4 A;  3LS8 A;  4Q94 A;  3FTU A;  4L2Y A;  3OAW A;  3KAE A;  1L5J A;  4KVM A;  3QWW A;  1HG2 A;  2L0T B;  4LRZ A;  4IRU A;  4MS6 A;  4AEZ C;  4GB9 A;  1QNF A;  3TAX A;  4GZ6 A;  4ILG A;  3ZHE A;  2R59 A;  4CRW A;  3LY7 A;  4AXH A;  2OVF A;  3FTZ A;  2LSV A;  2GRL A;  4PS7 A;  1OWP A;  1E8Z A;  2L6J A;  4Y6W A;  3HIZ A;  2VSO E;  4I2Z A;  4N3A A;  2NC9 A;  4BY6 A;  2KZT A;  3CVQ A;  3RRU A;  1OUV A;  3MKR A;  4B94 A;  4V3I A;  4BT9 A;  2I1J A;  3CR3 A;  1H0A A;  3U64 A;  1U3C A;  4WNG A;  4C0E A;  5AJL A;  4KMO A;  4BT8 A;  4KT6 B;  3ASF A;  2CG2 A;  3ASG A;  3CVX A;  2BUG A;  3GZ1 A;  3JQ0 A;  3SBS A;  4GYW A;  5KJK A;  4ANW A;  4J8D A;  5FZR A;  4LUN U;  4EZL A;  2IQC A;  3MYV A;  3CVY A;  4I6E A;  2VYI A;  2PM6 A;  3ASH A;  4XZ4 A;  2YNQ A;  3P1U A;  3CHO A;  1XGW A;  1EYH A;  3PRE A;  1DNP A;  3HVE A;  4XIF A;  4BFR A;  1E7U A;  3MGB A;  5D0Q D;  2XGS A;  3QAQ A;  1DVP A;  4GCN A;  5G55 A;  5LP0 A;  3PUK A;  5A23 A;  1JPL A;  2ZU6 B;  4JA9 A;  4EBA A;  4CGV A;  4E85 A;  3QNK A;  3S7J A;  3UQ3 A;  3PZD A;  5D0O D;  2I1K A;  3PEV B;  3ZXS A;  5LCW J;  5T3R A;  4OYS A;  3B7S A;  1IYG A;  4WND A;  5BPP A;  5ARF A;  2Y4T A;  3L17 A;  3ZPJ A;  3Q47 B;  5KJM A;  4RSY A;  1WAO 1;  3VTX A;  4E6H A;  3HYM B;  5G04 J;  3LJ3 A;  2WXH A;  4GML A;  2J09 A;  3ZYQ A;  4GYO A;  3D9K A;  4URK A;  2CHW A;  3PH0 C;  2OVB A;  1UN8 A;  4XKC A;  3SGH A;  4B0Z A;  3PRZ A;  3QWV A;  4UWF A;  3FUH A;  5JJT A;  2FI7 A;  3T5V A;  4I9E A;  4K03 A;  2FEZ A;  3QB2 A;  4B89 A;  2LO6 A;  3RRN B;  1HG5 A;  1N54 A;  4ILI A;  4DI4 A;  2IFU A;  4HLE A;  4KBQ A;  3AS4 A;  3PVL A;  1PAQ A;  4UWK A;  4GCO A;  1TJF A;  5M72 A;  2X6I A;  2YQ8 A;  3U3W A;  4U04 A;  4ATG A;  3CIA A;  3D9I A;  4N2Q A;  4F1S A;  3CVP A;  2XHE A;  3SFZ A;  2J9Q A;  2FF4 A;  3CKB A;  3ML9 A;  2UY1 B;  3L22 A;  3SD5 A;  4MKT A;  5C1D A;  4L23 A;  3K9I A;  4EQF A;  1HO8 A;  2KC7 A;  2VGX B;  4U0S A;  1ELK A;  4EPZ A;  3G2T A;  2XPI A;  3Q49 B;  3FY4 A;  4NRH B;  4MRU A;  4G23 A;  3I4G A;  3FTS A;  3CHP A;  3LVQ E;  4KZC A;  4NUR A;  1IHG A;  4UWG A;  2VTB B;  3ONL A;  4FJZ A;  4I9C A;  4A3T A;  2HM8 A;  2LAH A;  4FLB A;  3MV2 B;  4RG6 A;  3GW4 A;  4KVO A;  2E2E A;  2WQ7 A;  5T8I A;  4WNE A;  3HDX A;  1PC2 A;  2C2L A;  3HVE B;  3HHM A;  4ABN A;  2R5S A;  3S7F A;  4JZY A;  3VTY A;  5CMW A;  1TEZ A;  3RU0 A;  4UQY A;  3UPV A;  2J49 A;  2YHC A;  5AJD A;  5E75 A;  3URZ A;  4GZC A;  3RK6 A;  5BUZ A;  2HYZ A;  4O6F A;  4HOQ A;  2X6F A;  3L13 A;  1A17 A;  3SNX A;  4U07 A;  3UX4 A;  4GZ3 A;  4IYP A;  1SZ9 A;  3R7Q A;  1WM5 A;  4EZJ A;  4JHR A;  1QQE A;  4C0M A;  4WWO A;  5C2Y A;  3LXU X;  3ZEF A;  3D3M A;  4EEC A;  2FUL A;  2KZT B;  3ESL A;  4G11 A;  2XPY A;  5FZQ A;  5G05 C;  3FDH A;  2AXZ A;  3RKV A;  5A7D B;  4I1M A;  3U4T A;  3CQC B;  3CSF A;  3EHM A;  4AJW A;  3FTV A;  3LPZ A;  4CT0 A;  3U66 A;  4AIF A;  4HS2 A;  3KEZ A;  1LF8 A;  2QY7 A;  4DJA A;  2X6J A;  2WXK A;  4HXI A;  1IQR A;  3QOU A;  3FEX A;  4Q69 A;  5BW8 C;  3ZVV A;  3L08 A;  1E8X A;  4TRQ A;  4APF A;  2WXN A;  1U3D A;  3I4R B;  3Q5M A;  4EZK A;  4Q96 A;  1Y8M A;  1X5B A;  2UY1 A;  4FHK A;  3QDN A;  3UMV A;  1HXI A;  2MOW A;  1QZ2 A;  1ZU2 A;  2XRZ A;  4H7X A;  4N3B A;  4ACK A;  2IJG X;  3LDZ A;  2QFC A;  1PY1 A;  2PQN A;  3FU3 A;  1TJC A;  4FJY A;  4PS3 A;  4CT4 A;  3OXL A;  2AVP A;  3FH8 A;  5E76 A;  4AM9 A;  5J08 A;  3FU6 A;  3APD A;  3L6A A;  2WMO A;  4JEU A;  4M3O A;  3IBE A;  3FU0 A;  4BX8 A;  2GGF A;  4G24 A;  3UT8 A;  2V5F A;  3BEE A;  3ZYL A;  2NSZ A;  5FQ6 A;  3JQ1 A;  4I17 A;  2XQ0 A;  4G2V A;  5FJY A;  3CHM A;  4YVQ C;  3RO3 A;  3PDN A;  4FLH A;  3MX3 A;  3TL5 A;  4CEM A;  1E90 A;  4BSX A;  5ANL A;  4A55 A;  1E96 B;  4FAD A;  4UWL A;  1Z3X A;  4CDR A;  1E8Y A;  3PS6 A;  3N71 A;  3QKY A;  5BNW A;  4U8H A;  3UT4 A;  1UN9 A;  1EPU A;  4OVU A;  2IOL A;  1OWM A;  3ASD A;  5LOZ A;  3I3N A;  4NAC A;  4A1G A;  1VDY A;  1Y6I A;  3CQG B;  3ZFW A;  4BX9 A;  1GW6 A;  3LY8 A;  4BTB A;  4DLO A;  2JEK A;  2X6H A;  4HOT A;  2HR2 A;  4UQX A;  1UW4 B;  4FA6 A;  4GYY A;  4RG9 A;  2WXM A;  3NQP A;  5LCW C;  4JPS A;  5BV0 A;  2KCK A;  4G26 A;  3TXN A;  1HS6 A;  4GAA A;  4Y6C A;  4A1S A;  5LFA A;  3MV3 B;  3CKC A;  3AS5 A;  2I6H A;  1NA0 A;  3BG0 B;  5HI7 A;  4I6J A;  2VSN A;  1H2U A;  1SQM A;  4ILH B;  4C9B B;  1MQS A;  1KT1 A;  2LAI A;  3FUD A;  3MJW A;  2M63 A;  3CK7 A;  3PUJ A;  4GZD A;  4JHJ A;  3TG5 A;  3TJP A;  1HZ4 A;  3LCA A;  3CHS A;  4B8A A;  4J8E A;  3WXX A;  1INZ A;  4AV7 A;  2OV8 A;  4OVV A;  3FUN A;  3EIQ C;  3FUL A;  3FUE A;  4N2S A;  2DBA A;  4I2W A;  3FP3 A;  3PNT B;  5T4Y A;  2AXU A;  2L9B A;  4AOF A;  4WUY A;  2WXQ A;  4ANX A;  2PM7 A;  2XRY A;  3ZYK A;  1EF1 C;  1HX8 A;  3RIB A;  2OND A;  3B7R L;  2WXJ A;  3QWP A;  4B8C B;  2WVI A;  2A4Z A;  2ION A;  2J08 A;  4FP7 A;  2A5U A;  3QC1 A;  1N52 A;  4G25 A;  3ZYM A;  2X38 A;  3CV0 A;  3S7B A;  3I5P A;  3IHV A;  4G1T A;  2ILR A;  1MHQ A;  3G2V A;  3JYS A;  3LYA A;  2Q7F A;  4F53 A;  3CEQ A;  3CVV A;  5DBK A;  2XPZ A;  4XX5 A;  4UQZ A;  3DBS A;  4CDN A;  3P2B A;  4N3C A;  4F7A A;  4FUL A;  2L0I A;  4BWR A;  4MLP A;  5J90 A;  4ACL A;  5FT9 A;  1FVF A;  2VQ2 A;  3ML8 A;  4FC8 A;  4DLQ A;  4AVX A;  4PUC A;  1ELW A;  2LNI A;  1HU3 A;  3KD7 A;  2J07 A;  3D9M A;  2UWJ G;  3MKQ B;  3R9A B;  4A3V A;  2MRI A;  4P29 A;  3ULQ A;  3B7T A;  3U9W A;  3OXG A;  4XE0 A;  1FVH A;  3CVU A;  2LSU A;  4I1A A;  1IQU A;  5KCM A;  3ZGQ A;  2WXL A;  3TXM A;  3D9P A;  2E0I A;  2KAT A;  3APF A;  3CLJ A;  3FH5 A;  4UI9 K;  4UI9 J;  5G04 C;  4GA0 A;  3FU5 A;  4HVB A;  3CHR A;  3SZ7 A;  4WAF A;  4I1O B;  3APC A;  4J8F A;  2C0L A;  3CK9 A;  2NXP A;  3OTN A;  5BT1 A;  3FTX A;  3D9O A;  5ARG A;  2WMN A;  3ZIM A;  1Z3Y A;  2IOS A;  4LEU A;  2CG3 A;  2WPV A;  3L16 A;  3QK0 A;  3T8M A;  1E8W A;  4WWN A;  4GZ5 A;  3SF4 A;  2I2O A;  4JVS A;  2V0P A;  4PS8 A;  5CMY A;  4AY6 A;  3QJZ A;  2IF4 A;  4JA7 A;  4L2L A;  4TUU A;  3OXF A;  3ZRH A;  1OWL A;  2PQR A;  3FUF A;  5FZS A;  2WXR A;  4JC8 A;  4AP2 A;  4ANU A;  4U0U A;  4U0Z A;  4LER A;  2KCL A;  3LY9 A;  5LX8 A;  1FCH A;  4N39 A;  4CGW A;  3ZHE B;  4CDM A;  3NZU A;  2BTD A;  4I43 A;  1UJK A;  4XI0 A;  1H6K A;  2V8S E;  1NP7 A;  4IUL A;  3CVL A;  3CVN A;  3LKU A;  4R7L A;  4XKB A;  4HOU A;  2WXO A;  1KT0 A;  2CHX A;  3FWV A;  5FTP A;  5JJ6 A;  4ANV A;  4K0R A;  5FQ8 A;  2OOE A;  2VTB A;  2KM4 A;  3NF1 A;  4L7T A;  5BV1 A;  4WWP A;  5AYW D;  2GW1 A;  3BG1 B;  2CFU A;  2J4B A;  1H2T C;  4JW1 A;  5CHE E;  5ENN A;  1JUQ A;  3TGO A;  2YHE A;  4QFV A;  4GU5 A;  1P5Q A;  4GMJ A;  1H19 A;  4J8S A;  2RG8 A;  2CHZ A;  3Q15 A;  4XI9 A;  4DPR A;  1HE8 A;  4PDX A;  4IN3 B;  3RJV A;  4CCA A;  2GRM A;  1SZA A;  3SHF A;  3RO2 A;  1ELR A;  3FUJ A;  5EDS A;  1HH8 A;  3O4Z A;  1YA0 A;  5CCM A;  2XCC A;  1HFA A;  3JCK C;  3AU4 A;  2AWI A;  3DPD A;  4TV3 A;  4U63 A;  3GZS A;  2X6K A;  2WXP A;  3MCX A;  2VSY A;  2P58 C;  3VLF A;  1NA3 A;  2EQX A;  3FUK A;  4AY5 A;  2XGM A;  2Y3A A;  2VGY A;  4I6G A;  4BTA A;  3MKQ A;  2WQH A;  5G05 J;  4FU3 A;  4J0U A;  2BF0 X;  5EKQ D;  1OWO A;  2VGX A;  2FO7 A;  3ESK A;  3T5X A;  1OWN A;  5A6C A;  4EBA G;  2MHK A;  3FHE A;  4HFG A;  2YIN A;  3AU5 A;  2VJ8 A;  4W9R A;  1E7V A;  5EX0 A;  3CK8 A;  3R7R A;  3SI5 A;  3PNL B;  4RVB A;  3EDT B;  3EHN A;  2WXF A;  3PE3 A;  4F3V A;  1Z6T A;  5FQ7 A;  2CFZ A;  2J4D A;  4JXT A;  3CST A;  1H2V C;  5FWQ A;  3FH7 A;  2I9C A;  3B7U X;  3EIJ A;  3S2A A;  4DI3 A;  2DIW A;  1EDU A;  3UUX A;  2WB2 A;  4KXK B;  1KLX A;  1UJJ A;  4ME2 A;  4N5C A;  4DK5 A;  4JL0 A;  3NZS A;  2VSX E;  2RD0 A;  3SBT B;  1JWG A;  3D9J A;  3MZL B;  2HO1 A;  3B13 A;  3ZW3 A;  1HF8 A;  2WXI A;  3GZ2 A;  3EJN A;  1BPO A;  3IV0 A;  4KYO B;  3G2U A;  2C0M A;  3Q4A B;  3LEW A;  5G2N A;  1W3B A;  5DIZ A;  1JWF A;  2XEV A;  5KJL A;  3VLE A;  3FFL A;  3AS8 A;  1S0P A;  3G2W A;  3ONK A;  2PL2 A;  4D10 C;  5JJ7 A;  2WQ6 A;  2XGO A;  1B89 A;  4LCT A;  2AW6 A;  1WY6 A;  2KCV A;  3FUM A;  4YVO A;  3D9L A;  5AIJ A;  1ZBP A;  3ZN3 A;  4WNF A;  4GA1 A;  3FTW A;  3MA5 A;  4APO A;  3O48 A;  2V4L A;  3ENE A;  3MEK A;  5JHA A;  5CCL A;  2FBN A;  3JUI A;  2AXV A;  4GA2 A;  4JHK A;  1NZN A;  1XNF A;  4KZ0 A;  3S7D A;  3PEU B;  3KS2 A;  3UT7 A;  3VLD A;  2PZI A;  3CGH A;  4GPK A;  2Y4U A;  3D9N A;  3TG4 A;  4HOS A;  5AEN A;  2WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...