2C0MA

Apo form of the tpr domain of the pex5p receptor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
297
Chain Sequence
DKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 120
structure length 297
sequence length 319
chains with identical sequence B, C, F
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0mA00
4I2WA 4WNFA 3CK7A 3QDNA 4HOTA 3ZHEB 1KT0A 2KCVA 4AY5A 4GPKA 4UQYA 3CKBA 3S7JA 1W3BA 4UQXA 1HXIA 2MHKA 1B89A 2FI7A 4J8DA 3MEKA 4WNGA 5CHEE 2Q7FA 5DIZA 2PQNA 3SF4A 3N71A 1Y8MA 2E2EA 5BT1A 2Y4TA 3QWWA 5FT9A 2I6HA 2VSYA 3Q47B 2YQ8A 3GYZA 4JA9A 4U0ZA 3SZ7A 2DBAA 4J8FA 3ZN3A 1IYGA 4BTAA 2OOEA 2WQHA 4GCOA 4WUYA 1HZ4A 2XEVA 1NA0A 4BT9A 5D0QD 2R5SA 4GYWA 2QFCA 4ME2A 3Q15A 4GA0A 4CDRA 3PE3A 5FZQA 4J8EA 5G04J 5BW8C 2IF4A 2NC9A 1TJCA 4HOUA 2KC7A 3ASHA 3EDTB 3LY8A 3QWVA 3E4BA 4KBQA 5KJNA 4NQ0A 2ONDA 1PC2A 3RJVA 3TGOA 2KATA 1ELRA 3CVQA 4AY6A 2YHCA 1ELWA 4F3VA 3ULQA 5A7DB 3U3WA 3VTXA 3Q4AB 1FCHA 3ASFA 5EKQD 1KT1A 3S7BA 4UQZA 3S7FA 5FJYA 2HR2A 1NA3A 2UY1A 3Q5MA 2V5FA 3CVPA 4Y6WA 3ZFWA 1KLXA 4EQFA 4CGWA 3RU0A 4N3AA 4B94A 3LKUA 3TAXA 3K9IA 4GZ6A 1P5QA 3CVNA 3MV3B 5AYWD 5CCMA 4AIFA 5HQ8A 4G1TA 3ESKA 4GA2A 5M72A 3O48A 2Y4UA 3RKVA 3GZ1A 3CK9A 2FEZA 3AS4A 4N3BA 4XIFA 3U4TA 5KJLA 4GYOA 3MKRA 5DBKA 1A17A 2VGYA 2VYIA 4KXKB 4WNEA 5ARGA 5HI7A 3RO2A 4Y6CA 4U0SA 3TG4A 3MV2B 4U0UA 2XCBA 3OXLA 3QWPA 4GCNA 4H7YA 4N5CA 3RIBA 2FO7A 1E96B 3LYAA 3PE4A 5FTPA 3CKCA 3LCAA 1IHGA 5JJ6A 4JA7A 3GW4A 1NZNA 4J0UA 3CK8A 4G23A 3VTYA 4G26A 4YNDA 3OXGA 5EX3A 3LY7A 3RO3A 3AS8A 3ZGQA 2PL2A 4A1SA 3KD7A 4ABNA 2AVPA 2HYZA 3CEQA 3LY9A 4WNDA 3QOUA 2XGSA 4BWRA 2LSUA 1XNFA 4UI9J 1WAO1 1OUVA 3ZPJA 3ZHEA 4U04A 1HH8A 2LSVA 3ASGA 1YA0A 3KS2A 2BUGA 1WM5A 2VQ2A 4YVQC 4XI9A 2VGXA 4GZ3A 5LCWJ 3AS5A 3BEEA 2P58C 2FF4A 3UPVA 4HORA 5A6CA 4U07A 4LEUA 4XI0A 5G04C 1ZBPA 2C2LA 2VGXB 4G25A 4GYYA 2WPVA 4I2ZA 3WXXA 4N2SA 2J9QA 2XGOA 3UQ3A 2L6JA 4IN3B 2C0MA 4RG6A 1QQEA 3FFLA 4G24A 4H7XA 4O6FA 5LCWC 3FP3A 5C1DA 4BT8A 4I9EA 3CV0A 2C0LA 2IFUA 5BNWA 4I9CA 4AM9A 2VSNA 1QZ2A 3QKYA 4HOQA 3OXFA 3R9AB 2JLBA 4KYOB 1ZU2A 4GA1A 3JYSA 4NRHB 4I1AA 4N39A 2XCCA 4GZ5A 4UI9K 2FBNA 5FZSA 4CGVA 3NF1A 3LPZA 3HYMB 3UUXA 5CCLA 2PZIA 4G2VA 3S7DA 4W9RA 4N3CA 4N2QA 5KJMA 2KCKA 3GZ2A 3TG5A 2GW1A 5EX0A 2PQRA 2KCLA 5ARFA 4JL0A 4RG9A 3MA5A 2HO1A 3FWVA 2UWJG 3ASDA 3KAEA 2UY1B 3Q49B 2XGMA 4I17A 5G05J 3IEGA 5KJKA 4JHRA 5FZRA 3CVLA 5JJTA 2LNIA 4YVOA 3URZA 5JJ7A 4UI9C 3PDNA 4APOA 2XPIA 4BTBA 5D0OD 4HOSA 5G05C
chains in the Genus database with same CATH superfamily
3UM3A 4UWKA 1N11A 3D9OA 3L13A 3SNXA 1MQSA 4NACA 2DZNA 4PS8A 4U0ZA 4BTAA 1N4QA 4WUYA 4BT9A 1NA0A 1OWLA 3PRZA 1TJCA 3NAWA 4ZHBA 4GU5A 2KATA 1SQMA 4B8CB 5BPPA 5CRVA 3ML8A 1FVFA 4FJYA 2X6KA 2Y1LE 4I6GA 3D3MA 3QJZA 1EYHA 2VGYA 4MKTA 3SY2A 4ANUA 2LXLA 3ZXPA 3CIAA 2FO7A 4YDYA 1Z6TA 3TL5A 4KZCA 4G26A 3UT8A 3APCA 3QOUA 2IO2C 1YA0A 1IQUA 2IO3C 2L0IA 4BETA 2IU1A 1E7UA 1YCSB 4HVBA 3PZDA 3FFLA 4O6FA 5LCWC 3MZLB 3B7RL 3NF1A 3HYMB 2PZIA 2H6GA 4FC8A 3C3RA 1SZAA 1TNUA 5B1BE 2DZOA 4R7LA 5EDSA 3U66A 4KT6B 1Q2ZA 4I6JA 2XQ0A 1JWGA 1KT0A 2DWZA 3L82A 4GPKA 2X6JA 5BUZA 3FTYA 2MHKA 1B89A 3D9MA 4BERA 3AJIA 1U2VG 2I6HA 1OWNA 4G8LA 1QYMA 5AJLA 2B0OE 1BI8B 3Q15A 2I1KA 5CBOA 5BXUA 2KC7A 3AG2E 4F6RD 5KJNA 4J8YA 3JXIA 2XEEA 3SHFA 3ZFWA 3CVPA 3ENEA 3RU0A 2GRNB 3MV3B 3SFXA 2J49A 3LXUX 3T8MA 3WG7E 3BG1B 3CHPA 2IOSA 1OWOA 5FTPA 3FHEA 5JJ6A 3CK8A 1DCQA 2J09A 2WM9A 2WXPA 2CG2A 3Q7FA 4I43A 2KZTB 4XI9A 3FUNA 4I2ZA 2X6HA 3RK6A 4H7XA 4C48B 4L1BA 4O60A 1ZU2A 3JYSA 3VLDA 3G2WA 5CEDB 5ITZF 1U3DA 3UIPC 4HRMB 3DBSA 3ASDA 4HBDA 3CVLA 2LNIA 1WG0A 4TRQA 5EILA 2VSXE 4RSYA 4HNAD 4GTQA 4P29A 3CSFA 3ZYQA 4AP2A 1X81A 3Q79A 3PZ1A 3HVEB 2VSYA 2YQ8A 4FHKA 2DBAA 4L2YA 2V0PA 2JABA 2OCCE 3ABME 3DSSA 5BW8C 3D9IA 1ELWA 3ULQA 5ENTD 5ENRD 2MRIA 2R02A 3TXNA 2HR2A 1NA3A 2UY1A 3PZ3A 1SVXA 5CEAA 3K9IA 5CCMA 4N2QA 1N94A 3GZ1A 4XE0A 2XRYA 2OV8A 3CGHA 4GCNA 3ASOE 3EHNA 4LERA 1IHGA 2ETCA 3RO3A 4ABNA 5A23A 4BWRA 3KS2A 1OCRE 2FF4A 4BY6A 1SZ9A 5HKPA 5T3RA 2QC9A 3FH7A 2ILRA 3DXMG 3HIZA 3DPYA 3QKYA 3ABKE 3UM0A 1KZPA 1H6PA 2QZAA 5KJMA 3T8KA 3TG5A 2IOLA 4GPMA 2H6FA 2OVFA 1E90A 3IEGA 5CBNA 3OTNA 4EECA 5JJ7A 4GTVA 1INZA 3NQPA 2R03A 4HOTA 3AG3E 3Q9UC 2X3MA 1JCQA 3CHRA 3ZN3A 3ZU7B 4DX1A 1ELKA 3D9LA 2OVBA 3TWTA 1UJJA 2R5SA 5AN8A 4ILHB 4K03A 4ILGA 1NI1A 1TJFA 3BQOA 3EHMA 3KEZA 3ASHA 4DLQA 1JUQA 1PC2A 2WXFA 1HFAA 3BU8A 4FJZA 3U3WA 3VTXA 4I6EA 1PY1A 3CQCB 3RRUA 4G1TA 3ESKA 1V55E 2VJ8A 2P9KG 4WNEA 2XZDG 3HXFA 4CDMA 1E96B 3LYAA 5KNGA 3CHMA 3DEPA 1NZNA 3JQ1A 4A1SA 2LSUA 2MOWA 5LOZA 2P9LG 2VGXA 5CMYA 4GTPA 4QFVA 1ZBPA 2E0IA 4UUCA 2J9QA 2ZISA 4GMLA 2WVIA 4IN3B 4L9PA 3ESLA 3FUMA 3CV0A 4BX9A 1E8ZA 2VSNA 1QZ2A 4HOQA 3OXFA 4G2VA 3UKRG 4W9RA 3P1UA 3C98A 5EYLA 1MX4A 5JHAA 4EBAG 3V2XA 3NOGD 2FULA 1KZOA 4JHRA 3Q73A 1JCRA 5AJDA 4JEHA 4UI9C 5BV1A 4APOA 1E8WA 1HE8A 1N54A 2XEHA 4TUUA 3ZYKA 3ZIMA 4GCOA 2XEVA 2CHXA 2ZGDA 1NP7A 5EN5D 4KBQA 1SA5A 1D8DA 3T5XA 4MS6A 3FUFA 4JW1A 4OAUC 1RZ4A 3FTXA 3PZ4A 3RSEG 3Q5MA 4FULA 4EQFA 4N3AA 3O48A 4WWNA 4N3BA 3J5PA 4AEZC 5DBKA 4Y6CA 5HRYA 3MV2B 4B0ZA 3FULA 2WXGA 5FINA 3PE4A 4Q96A 3L08A 3HXBA 3QNKA 4CT0A 2QY7A 2I2OA 4MRUA 3CEQA 3EJNA 4A63B 4K5BA 3IHVA 2V4HC 4U04A 3TWXA 5LCWJ 3AS5A 2VGXB 2WPVA 3UM1A 2XGOA 1IHBA 3JCKC 4RG6A 2C0MA 2WXKA 2IFUA 2DCPA 5ENQD 4LUNU 2J8SD 3PS6A 3S2AA 2KCKA 3V79K 2KCLA 1MZCA 4HFGA 4PS7A 3UT4A 3E30A 3SGHA 4CYMD 2GRPB 4G11A 4BX8A 1FT1A 4U96D 5D0OD 3AU4A 3FH5A 4KVMA 2XPZA 3DEOA 2KCVA 1A5EA 1JWFA 3RRMB 1Y8MA 4ILIA 5AQ9A 2WXMA 1N4RA 2EIKE 2WQHA 2XENA 4DRXE 2P9SG 2DYRE 3SO8A 1DC2A 3Q4AB 4GZCA 3UMVA 3DSXA 3FUDA 4O1OA 4ATGA 4CGWA 4U8HA 2RG8A 4D10C 2BKGA 1SA4A 4U0UA 4ATZD 4N5CA 3CKCA 4EZLA 3VTYA 2AXZA 4DI4A 1NFIE 2AVPA 4DX2A 3I4GA 1HH8A 2IY0C 4HI8A 3SFYA 2L6JA 1UG3A 4IYPA 1UJKA 5BNWA 3D9NA 2JLBA 4NRHB 2ZU6B 4GZ5A 3LPZA 3MA5A 1V54E 3FUEA 3PEVB 1N52A 3RAUA 3CVVA 4UWGA 3C5RA 4LRZA 4TXQA 4G8KA 4FADA 1W3BA 2A5UA 3HVEA 3CVWA 2CHWA 3B7TA 5ENPD 5E76A 4GA0A 3HHMA 3PE3A 4J8EA 2ZIRA 2NC9A 3FUIA 3EDTB 2DYSE 2X38A 2YHCA 2NXPA 3PVLA 5EKQD 1KT1A 1OWMA 5E75A 2YINA 3IBEA 4GA2A 4Q94A 2Y4UA 3RKVA 3DSTA 3B95A 4GYOA 3X2QE 3D9KA 2LUHA 4H7YA 4J6IA 3L16A 4DJAA 3PUJA 1BPOA 1UN9A 2PL2A 3KD7A 3UTMA 3LY9A 3FUJA 1H0AA 1WAO1 4MBGA 1WM5A 4K5AB 1VDYA 4JZYA 4G25A 2AWIA 5FQ8A 3L22A 3PZ2A 1DNPA 3E33A 2WQ6A 3FP3A 4BT8A 4F1PA 3AU5A 4NIKA 2GRLA 4I1MA 4CGVA 2DVWA 3FUKA 4FLBA 3S7DA 5IY5E 2EILE 4ACKA 3ZNGA 4K0RA 3NOCD 1QBQA 2WXRA 2X6IA 4HLLA 5ANLA 5J90A 3CKBA 3EU5A 5D66A 1Z3XA 3EHRA 3VLEA 3QWWA 2A4ZA 3PREA 2XS1A 5D0QD 4U8VD 4HOUA 4JVSA 4O1PA 1JPLA 1E8YA 3L9TA 3CSTA 2AXVA 2P9PG 5KNHD 1HO8A 4Q69A 5AENA 3MKRA 4B8AA 5AIJA 4JHJA 2XCBA 3CLJA 4EHMA 3AG1E 3OAWA 5EYPF 2WXJA 3AAAC 5EX3A 3B7SA 3CHOA 5FQ7A 2P9NG 1OUVA 3CVYA 2L9BA 3APDA 1TR4A 1HU3A 3QAQA 3TWRA 1HF8A 4IULA 1TNBA 2CG3A 3E32A 5G55A 4F1SA 4N39A 1PAQA 2F0YA 5JMND 4RG9A 2XGMA 3QB2A 2IONA 1N0QA 1TNOA 4BTBA 4DI3A 5LX8A 4I2WA 4FU3A 3PEUB 2R17C 4UQXA 3TWUA 5CHEE 1LF8A 4HRNA 2Y4TA 3FU6A 2VTBA 2V5QC 1HZ4A 3UI2A 2F37A 1OY3D 3IKOB 2L6BA 1BLXB 4U95D 3KSQA 3E37A 2LO6A 2P9UG 2WXOA 3PNTB 4CT4A 5M72A 2B6CA 2IQCA 2HM8A 4RQIA 4ACLA 4JC8A 3MKQB 4DPRA 3LCAA 3SI5A 3LY7A 4GTSA 1AWCB 2FO1E 4A55A 3ZPJA 4GMJA 4UWLA 3ZHEA 4GZ3A 3ML9A 4UWFA 1BI7B 3V2OA 5B3SE 4GAAA 3WXXA 2WQ7A 4LNGA 3APFA 3UQ3A 4FLHA 2F8YA 1WDYA 1N4PA 4U63A 4DX6D 3SFZA 5BXOA 1D8EA 1S70B 2BTDA 4KYOB 5FQ6A 2PNNA 3R7RA 2I9CA 3IXEA 2VSOE 2HO1A 2UY1B 1N0RA 1HX8A 5KJKA 2Y0BG 3ULYA 3HXEA 1JCSA 3PDNA 4HQDA 1H2VC 5G05C 5KBAA 4B89A 4TXPA 1HXIA 4DX5D 4WNGA 2PQNA 1FPPA 4ANWA 1AP7A 2EIJE 2P9IG 2VTBB 3C3QA 3ONLA 5FZQA 4TV3A 4EBAA 2HE0A 2ONDA 3RJVA 3CVQA 2QYJA 3NB2A 1OWPA 1UW4B 3NZSA 4Y6WA 1Z3YA 3Q75A 4A1GA 3O4ZA 4AIFA 4CRWA 3DSUA 3BG0B 4XIFA 1N95A 3ZYMA 1TN7A 5D2MC 4GMRA 3TG4A 3FH8A 4B93B 1K8KG 2VGEA 3G2TA 4EPZA 4JA7A 3UXGA 3LVRE 2XS8A 1BU9A 4GTOA 3TAXA 2BUGA 1MX2A 3E34A 3FDHA 4GYYA 3CVUA 2ETBA 3RRNB 1GW6A 2J08A 4HXIA 2GRRB 3DRAA 2I1JA 5AARA 4I9EA 2C0LA 2YNQA 4I9CA 3D9JA 2XCCA 1OCCE 5CCLA 4V3IA 4CDNA 2LXMA 3J5QB 3FWVA 3P2BA 3EU9A 2GRMA 3MCXA 3TJPA 2V8SE 3D9PA 3CVXA 4LG6A 3S7JA 1Y6IA 4J8DA 5DIZA 1E7VA 4J7WA 4RVBA 4FHJA 1MX6A 1S0PA 2XHEA 1IYGA 5EIDA 1LTXA 1UOHA 4E6HA 2QFCA 5G04J 3W9GA 3E4BA 1OCZE 1LD8A 3U64A 2RD0A 3Q9NC 5LFAA 5AQ7A 3LKUA 3NBNB 4FP7A 3AS4A 5JA4D 3U4TA 3C72A 2VYIA 4PDXA 4A3TA 1LD7A 2EQXA 2YHEA 2J4DA 2WXIA 3FU5A 2X6FA 2XGSA 1XNFA 2OEVA 4UI9J 2LSVA 4JB8P 4YVQC 3GZSA 4HORA 5G04C 4N2SA 4LCTA 3TXMA 5CECB 1Z5SC 4EZJA 1WY6A 4EZKA 5ENSD 4KVOA 3FUHA 5FZSA 3TWQA 2EINE 1O1SA 4K5CA 4NURA 4BFRA 2PM7A 4I17A 4AVXA 5JJTA 2AXUA 3URZA 5BV0A 3ISMC 4WNFA 3CK7A 3QDNA 4QQIA 4AY5A 4GB9A 3JQ0A 2BF0X 3SF4A 2Q7FA 3DPDA 5EIBE 3GYZA 1OXJA 4L2LA 1IXVA 5H7PA 1IQRA 1NL4A 4ANXA 3TWVA 5C2YA 3ASFA 4HLEA 4DLOA 2V5FA 4B94A 1O1TA 1P5QA 3CVNA 3ZKJA 4DX7D 3Q7AA 3EIQC 5FIOA 2AJAA 5LP0A 3OXLA 4HB5A 3PUKA 4AV7A 5KWDA 4J0UA 3MJWA 1S64A 3OXGA 3LJNA 4XZ4A 1TN6A 1IKND 3ASGA 3UKUG 3CQGB 2P58C 3AG4E 1H6OA 3QK0A 2ETAA 3SD5A 3C3OA 3L6AA 4BSZB 3ZYLA 4GA1A 3DXKG 3TGOA 5AAOA 3T5VA 3R9MA 3UUXA 1H2TC 4N3CA 3LVQE 5CMWA 3B7BA 5ENOD 1OCOE 1E8XA 4U8YD 4M3OA 3Q49B 3IV0A 2XRZA 3MYVA 2ZGGA 2WMNA 1OT8A 4OAVB 1HS6A 4AOFA 4GTTA 3ZXSA 2L0TB 4JXTA 4WWOA 4F53A 3MEKA 3ZEFA 4JD2G 4LSZE 4YDOA 3SZ7A 4JA9A 4HRLA 3LDZA 2OOEA 2WB2A 4GZDA 2BEDA 4GYWA 3HRAA 2KXPC 4E85A 4C0MA 3QWVA 3HDXA 2GRQB 4AY6A 3JUIA 3FTVA 3DSVA 3I5PA 1FCHA 3S7FA 4UQZA 1HG5A 3DSWA 3UT7A 3G2SA 4JPSA 2KM4A 4HS2A 4U0SA 1UN8A 1ZB1A 4X8QA 4HI9A 4PH4B 2CFZA 4N5QA 5ENNA 3MKQA 2HYZA 4WNDA 4TUMA 2KBXA 3UINC 4XEIG 2V4LA 4WWPA 2BKKB 2WXNA 2Y69E 4RLYA 4XI0A 4U7EB 2C2LA 2WMOA 4APFA 2WXHA 4YDWA 3EIJA 3QARA 3L17A 1FT2A 2LAIA 4JEUA 4LNUD 3F6QA 4WAFA 2JEKA 2EIME 1BD8A 2GW1A 4PUCA 1TYQG 3TWSA 3KAEA 1XGWA 2WXLA 3QC1A 5G05J 2NSZA 1TNYA 4YVOA 3FEXA 1HG2A 2PM6A 3G2UA 3R7QA 3ZHEB 4UQYA 2FI7A 1MJ0A 3W9FA 3V31A 3MX3A 3Q47B 4J8FA 4OVVA 3I3NA 4ME2A 3IHYA 3LS8A 4KMOA 3V30A 4AJWA 4A3VA 3ULEG 1QNFA 3NZUA 3UX4A 2WXQA 5FJYA 3JUEA 4CZ2D 1TN8A 5J08A 4KZ0A 3FEYA 5HQ8A 4DK5A 5AYWD 3PNLB 4BESA 3CK9A 4L23A 3FTWA 1YYHA 1O1RA 1A17A 5HI7A 5FQ4A 4DUIA 3QWPA 5FWQA 2P2CP 2ZXWE 3RIBA 3CHSA 4CCAA 3ZGQA 2GGFA 2KZTA 3LEWA 3SBSA 3ZUVB 1K1AA 3ZW3A 4L7TA 1H6KA 3CHQA 4AM9A 3Q78A 4UI9K 1S63A 2J4BA 1MYOA 4I1OB 5EX0A 2PQRA 4JHKA 2H6IA 1YMPA 2R2LA 2XZTG 1U3CA 2R59A 3HXDA 3FY4A 4GTMA 2E2EA 5BT1A 3BUAA 4ANVA 4F7AA 3FTZA 2RFAA 4BEPA 3SQVA 2J07A 1SW6A 1H2UA 2IF4A 1K1BA 3LY8A 1X5BA 3FU0A 5JHBA 3LJ3A 3JXJA 1ELRA 3FU3A 4IRUA 2CFUA 3PH0C 4F3VA 3G2VA 5A7DB 3MGBA 1K3ZD 4URKA 2XPYA 4GZ6A 3ZVVA 4XKCA 4J8SA 2FEZA 3ASNE 5KJLA 3KEAA 4KXKB 5ARGA 3RO2A 2DIWA 4XKBA 2A5EA 4GTRA 4G23A 2IJGX 3DWLG 3HG0D 4C9BB 3SBTB 2VQ2A 4LEUA 1MHQA 1EDUA 3I4RB 3EHQA 3ABLE 4LNBA 5KCMA 5C1DA 3ONKA 3TWWA 2AW6A 2FBNA 4OYSA 3EUVA 3HXCA 2RKKA 4JL0A 2MYOA 3T9KA 5T4YA 4MLPA 5AQAA 5FZRA 4TXRA 2M63A 1N9AA 2OEWA 5HS0A 4M7CA 1DVPA 1D9SA 4UWHA 1G3NB 4ZFHA 5CERB 3N71A 1H19A 5FT9A 3VLFA 1FVHA 3B7UX 1KPSB 2RFMA 4CDRA 1TNZA 1N4SA 4NQ0A 2NYJA 3ZRHA 1RW2A 3L54A 5B1AE 2Y3AA 1EF1C 3S7BA 2GROB 1KLXA 2CHZA 2IEJA 3UM2A 5ANRA 5CRUA 3GW4A 3B13A 1EPUA 4YNDA 3AS8A 5AQBA 2H6HA 5T8IA 3UPVA 3BEEA 5A6CA 4U07A 4XX5A 3U9WA 4BSXA 4AXHA 2QYUA 2R05A 3KSLA 1QQEA 4G24A 4CEMA 1TEZA 5G2NA 4Z68A 4FA6A 3FTSA 2LAHA 3D9HA 3R9AB 4I1AA 1DCEA 4OVUA 3UIOC 1O5MA 3GZ2A 5ARFA 2UWJG 3CR3A 3FTUA 2F8XK 4C0EA 2XPIA 1L5JA 4HOSA 4YDEA 4PS3A
chains in the Genus database with same CATH topology
4I2WA 1E8WA 3ZXSA 1HE8A 4UWKA 3D9OA 1N54A 3L13A 2L0TB 3PEUB 2R17C 4FU3A 4JXTA 4UQXA 4WWOA 5CHEE 3SNXA 4F53A 3MEKA 1LF8A 3ZEFA 4TUUA 1MQSA 2Y4TA 4NACA 3FU6A 2VTBA 3SZ7A 4PS8A 4JA9A 4U0ZA 3ZYKA 3LDZA 3ZIMA 4BTAA 2OOEA 4GCOA 4WUYA 4BT9A 1HZ4A 2XEVA 1NA0A 4GZDA 2WB2A 1OWLA 4GYWA 2CHXA 4E85A 1NP7A 4C0MA 3PRZA 1TJCA 4KBQA 3QWVA 3IKOB 3HDXA 3T5XA 4MS6A 4GU5A 2KATA 3FUFA 4JW1A 4AY6A 1SQMA 4B8CB 3JUIA 3FTVA 3I5PA 5BPPA 1FCHA 3FTXA 3ML8A 3S7FA 1FVFA 1HG5A 4FJYA 4UQZA 3Q5MA 2LO6A 2X6KA 3UT7A 3G2SA 4FULA 4EQFA 4N3AA 2WXOA 4I6GA 3PNTB 4CT4A 5M72A 4JPSA 2KM4A 3O48A 4HS2A 2IQCA 4WWNA 3D3MA 4N3BA 2HM8A 3QJZA 1EYHA 4AEZC 5DBKA 2VGYA 4MKTA 4Y6CA 4U0SA 4ACLA 1UN8A 3MV2B 4B0ZA 4ANUA 4JC8A 3FULA 2WXGA 3CIAA 2FO7A 3PE4A 4PH4B 3MKQB 4DPRA 2CFZA 3LCAA 3L08A 4Q96A 3SI5A 3QNKA 4CT0A 5ENNA 1Z6TA 3TL5A 4KZCA 3MKQA 4G26A 3UT8A 2QY7A 3LY7A 2I2OA 4MRUA 3APCA 2HYZA 4WNDA 3CEQA 3EJNA 3QOUA 4A55A 3ZPJA 4GMJA 3IHVA 4UWLA 2V4LA 4U04A 4WWPA 3ZHEA 1YA0A 1IQUA 5LCWJ 2WXNA 4GZ3A 3ML9A 3AS5A 4UWFA 2L0IA 4XI0A 2VGXB 2C2LA 2IU1A 1E7UA 2WMOA 2WPVA 2WXHA 4GAAA 3WXXA 4APFA 2WQ7A 2XGOA 3APFA 3JCKC 4RG6A 3UQ3A 2C0MA 4HVBA 3PZDA 3FFLA 4O6FA 4FLHA 5LCWC 3MZLB 2WXKA 2IFUA 3EIJA 3QARA 2DCPA 4U63A 4LUNU 3SFZA 3L17A 2LAIA 4JEUA 2BTDA 3PS6A 4KYOB 3B7RL 5FQ6A 3S2AA 3R7RA 3NF1A 2I9CA 3HYMB 2PZIA 2VSOE 4WAFA 4FC8A 2JEKA 2KCKA 2GW1A 4PUCA 2KCLA 4HFGA 1SZAA 2HO1A 4PS7A 3KAEA 1XGWA 2UY1B 2WXLA 3UT4A 3QC1A 3SGHA 5G05J 2NSZA 1HX8A 4R7LA 5KJKA 5EDSA 3U66A 4G11A 4KT6B 4BX8A 4YVOA 3PDNA 3FEXA 1HG2A 5D0OD 3AU4A 3FH5A 4KVMA 1H2VC 2XPZA 2PM6A 3G2UA 2XQ0A 4I6JA 1JWGA 5G05C 3R7QA 1KT0A 3ZHEB 2KCVA 4GPKA 4UQYA 4B89A 2X6JA 5BUZA 3FTYA 1HXIA 1JWFA 2MHKA 1B89A 2FI7A 4WNGA 2PQNA 3D9MA 3RRMB 1Y8MA 4ILIA 3MX3A 4ANWA 2I6HA 3Q47B 2WXMA 1OWNA 4J8FA 2VTBB 2WQHA 5AJLA 4OVVA 3I3NA 3ONLA 4ME2A 3Q15A 3IHYA 5FZQA 4TV3A 4EBAA 2I1KA 3LS8A 2KC7A 4KMOA 5KJNA 4AJWA 2ONDA 3RJVA 3CVQA 4A3VA 1OWPA 1UW4B 1QNFA 3Q4AB 3SHFA 4GZCA 3NZUA 3UMVA 3UX4A 2WXQA 3NZSA 5FJYA 3ZFWA 3FUDA 4Y6WA 1Z3YA 3CVPA 4ATGA 5J08A 3ENEA 4CGWA 3RU0A 4KZ0A 3FEYA 5HQ8A 3MV3B 4A1GA 4DK5A 5AYWD 3O4ZA 4AIFA 3PNLB 4CRWA 3CK9A 4U8HA 3BG0B 4XIFA 4L23A 3ZYMA 2RG8A 2J49A 3LXUX 3FTWA 4D10C 3T8MA 1A17A 5HI7A 3TG4A 5FQ4A 3FH8A 3BG1B 4U0UA 3CHPA 3QWPA 2IOSA 5FWQA 4N5CA 3RIBA 1OWOA 3CHSA 3G2TA 5FTPA 3CKCA 4EPZA 4CCAA 3FHEA 4JA7A 5JJ6A 4EZLA 3CK8A 3VTYA 2J09A 2AXZA 3ZGQA 2WM9A 2WXPA 4DI4A 2AVPA 3LVRE 2GGFA 2CG2A 3I4GA 2KZTA 1HH8A 3TAXA 4I43A 2BUGA 2KZTB 3LEWA 4XI9A 3SBSA 3FDHA 4GYYA 3FUNA 4I2ZA 3CVUA 3RRNB 1GW6A 2J08A 2L6JA 4HXIA 1UG3A 2X6HA 3RK6A 4H7XA 2I1JA 4IYPA 3ZW3A 4L7TA 1H6KA 4I9EA 1UJKA 2C0LA 2YNQA 3CHQA 4I9CA 4L1BA 5BNWA 4AM9A 3D9NA 2JLBA 3D9JA 4NRHB 1ZU2A 4UI9K 3JYSA 3VLDA 2XCCA 2ZU6B 4GZ5A 3G2WA 3LPZA 5CCLA 1U3DA 4V3IA 2J4BA 4I1OB 4CDNA 5EX0A 2PQRA 4JHKA 3MA5A 3FWVA 3DBSA 3ASDA 3FUEA 3PEVB 1N52A 3P2BA 3CVLA 3CVVA 2LNIA 1U3CA 2R59A 4UWGA 2GRMA 4TRQA 2VSXE 4RSYA 3FY4A 3MCXA 4LRZA 3TJPA 2V8SE 3D9PA 3CVXA 4P29A 3CSFA 3S7JA 4FADA 1W3BA 3ZYQA 2A5UA 1Y6IA 4J8DA 4AP2A 5DIZA 3HVEA 1E7VA 4RVBA 4FHJA 2E2EA 5BT1A 4ANVA 3HVEB 1S0PA 4F7AA 3CVWA 3FTZA 2VSYA 2XHEA 2YQ8A 4FHKA 1IYGA 2DBAA 2CHWA 4L2YA 2V0PA 3B7TA 4E6HA 2J07A 5E76A 2QFCA 4GA0A 3HHMA 3PE3A 4J8EA 5G04J 1H2UA 5BW8C 2IF4A 2NC9A 3FUIA 3EDTB 3LY8A 3E4BA 1X5BA 3FU0A 5JHBA 3LJ3A 1ELRA 3FU3A 4IRUA 3D9IA 2X38A 2CFUA 2YHCA 3PH0C 1ELWA 4F3VA 3G2VA 3ULQA 5A7DB 2NXPA 2MRIA 3MGBA 3PVLA 5EKQD 1KT1A 1OWMA 3TXNA 3U64A 2RD0A 2HR2A 1NA3A 2UY1A 2YINA 5E75A 4URKA 5LFAA 2XPYA 3IBEA 3LKUA 3K9IA 4GZ6A 5CCMA 4N2QA 3ZVVA 4GA2A 4XKCA 4Q94A 2Y4UA 3RKVA 3GZ1A 4XE0A 4J8SA 2FEZA 4FP7A 3AS4A 2XRYA 3U4TA 5KJLA 4GYOA 2VYIA 3D9KA 4KXKB 5ARGA 4PDXA 3RO2A 4A3TA 2OV8A 2EQXA 2DIWA 3CGHA 4GCNA 4H7YA 4J6IA 4XKBA 2YHEA 3EHNA 4LERA 1IHGA 3L16A 2J4DA 2WXIA 4DJAA 4G23A 3FU5A 3PUJA 1BPOA 3RO3A 2X6FA 4ABNA 1UN9A 2PL2A 3KD7A 3LY9A 3FUJA 5A23A 2XGSA 2IJGX 1H0AA 4BWRA 1XNFA 4UI9J 1WAO1 4C9BB 2LSVA 3KS2A 3SBTB 2VQ2A 1WM5A 4YVQC 3GZSA 1VDYA 2FF4A 4BY6A 4HORA 1SZ9A 4LEUA 4JZYA 5G04C 1MHQA 4G25A 4N2SA 4LCTA 1EDUA 2AWIA 3I4RB 3TXMA 5KCMA 5FQ8A 5T3RA 3L22A 4EZJA 1DNPA 3FH7A 2WQ6A 2ILRA 3FP3A 3HIZA 3ONKA 4BT8A 5C1DA 1WY6A 2AW6A 4EZKA 3QKYA 3AU5A 2GRLA 4I1MA 4KVOA 3FUHA 5FZSA 2FBNA 4OYSA 4CGVA 4FLBA 3FUKA 3S7DA 5KJMA 3TG5A 4ACKA 4JL0A 4K0RA 4NURA 2IOLA 4BFRA 5T4YA 2PM7A 2OVFA 1E90A 4I17A 2WXRA 4AVXA 3IEGA 4MLPA 2X6IA 5FZRA 3OTNA 2M63A 4EECA 5JJTA 2AXUA 3URZA 5JJ7A 5ANLA 1INZA 5BV0A 3NQPA 4WNFA 3CK7A 3QDNA 5J90A 4HOTA 1DVPA 4AY5A 2X3MA 3CKBA 4GB9A 3JQ0A 4UWHA 2BF0X 1Z3XA 3SF4A 2Q7FA 3DPDA 3N71A 3VLEA 3CHRA 3QWWA 1H19A 5FT9A 3VLFA 3ZN3A 2A4ZA 3GYZA 1FVHA 3B7UX 1ELKA 3PREA 3D9LA 2OVBA 4L2LA 5D0QD 1UJJA 2R5SA 4CDRA 4ILHB 4K03A 4ILGA 1TJFA 3EHMA 3KEZA 4HOUA 3ASHA 4DLQA 1IQRA 1JUQA 4NQ0A 1PC2A 4JVSA 2WXFA 1HFAA 3ZRHA 4FJZA 3L54A 4ANXA 3U3WA 3VTXA 1JPLA 5C2YA 2Y3AA 3ASFA 1EF1C 4I6EA 1E8YA 3S7BA 4DLOA 4HLEA 3CSTA 2V5FA 2AXVA 1KLXA 1PY1A 1HO8A 2CHZA 4B94A 3CQCB 3RRUA 1P5QA 3CVNA 4G1TA 3ESKA 2VJ8A 4Q69A 5AENA 3EIQC 3MKRA 5LP0A 4WNEA 4B8AA 5AIJA 4JHJA 5ANRA 2XCBA 3OXLA 3CLJA 3OAWA 4CDMA 1E96B 3LYAA 3PUKA 2WXJA 4AV7A 3CHMA 3GW4A 1NZNA 3B13A 3JQ1A 4J0UA 3MJWA 1EPUA 4YNDA 5EX3A 3OXGA 3B7SA 4XZ4A 3AS8A 3CHOA 4A1SA 5FQ7A 2LSUA 1OUVA 3CVYA 2MOWA 3APDA 2L9BA 3ASGA 5LOZA 5T8IA 2VGXA 3CQGB 5CMYA 3UPVA 3BEEA 2P58C 5A6CA 4U07A 4XX5A 3U9WA 1HU3A 3QAQA 4QFVA 1ZBPA 4AXHA 3QK0A 4BSXA 2E0IA 2J9QA 3SD5A 4GMLA 2WVIA 4IN3B 1QQEA 3ESLA 4G24A 4CEMA 1HF8A 1TEZA 5G2NA 3FUMA 3CV0A 4FA6A 4BX9A 3L6AA 1E8ZA 3FTSA 2LAHA 2VSNA 1QZ2A 4HOQA 2CG3A 3OXFA 4IULA 5G55A 3R9AB 3ZYLA 4F1SA 4GA1A 4N39A 3TGOA 4I1AA 1PAQA 3T5VA 3UUXA 4G2VA 4OVUA 1H2TC 4W9RA 4N3CA 3LVQE 5CMWA 3P1UA 3C98A 3GZ2A 5ARFA 1E8XA 5JHAA 4RG9A 4M3OA 4EBAG 2UWJG 3Q49B 3IV0A 3CR3A 2XRZA 2XGMA 3QB2A 2FULA 4JHRA 3MYVA 2WMNA 2IONA 5AJDA 4JEHA 3FTUA 4UI9C 5BV1A 4APOA 2XPIA 1L5JA 1HS6A 4BTBA 4C0EA 4DI3A 5LX8A 4HOSA 4AOFA 4PS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2W A;  4WNF A;  3CK7 A;  3QDN A;  4HOT A;  3ZHE B;  1KT0 A;  2KCV A;  4AY5 A;  4GPK A;  4UQY A;  3CKB A;  3S7J A;  1W3B A;  4UQX A;  1HXI A;  2MHK A;  1B89 A;  2FI7 A;  4J8D A;  3MEK A;  4WNG A;  5CHE E;  2Q7F A;  5DIZ A;  2PQN A;  3SF4 A;  3N71 A;  1Y8M A;  2E2E A;  5BT1 A;  2Y4T A;  3QWW A;  5FT9 A;  2I6H A;  2VSY A;  3Q47 B;  2YQ8 A;  3GYZ A;  4JA9 A;  4U0Z A;  3SZ7 A;  2DBA A;  4J8F A;  3ZN3 A;  1IYG A;  4BTA A;  2OOE A;  2WQH A;  4GCO A;  4WUY A;  1HZ4 A;  2XEV A;  1NA0 A;  4BT9 A;  5D0Q D;  2R5S A;  4GYW A;  2QFC A;  4ME2 A;  3Q15 A;  4GA0 A;  4CDR A;  3PE3 A;  5FZQ A;  4J8E A;  5G04 J;  5BW8 C;  2IF4 A;  2NC9 A;  1TJC A;  4HOU A;  2KC7 A;  3ASH A;  3EDT B;  3LY8 A;  3QWV A;  3E4B A;  4KBQ A;  5KJN A;  4NQ0 A;  2OND A;  1PC2 A;  3RJV A;  3TGO A;  2KAT A;  1ELR A;  3CVQ A;  4AY6 A;  2YHC A;  1ELW A;  4F3V A;  3ULQ A;  5A7D B;  3U3W A;  3VTX A;  3Q4A B;  1FCH A;  3ASF A;  5EKQ D;  1KT1 A;  3S7B A;  4UQZ A;  3S7F A;  5FJY A;  2HR2 A;  1NA3 A;  2UY1 A;  3Q5M A;  2V5F A;  3CVP A;  4Y6W A;  3ZFW A;  1KLX A;  4EQF A;  4CGW A;  3RU0 A;  4N3A A;  4B94 A;  3LKU A;  3TAX A;  3K9I A;  4GZ6 A;  1P5Q A;  3CVN A;  3MV3 B;  5AYW D;  5CCM A;  4AIF A;  5HQ8 A;  4G1T A;  3ESK A;  4GA2 A;  5M72 A;  3O48 A;  2Y4U A;  3RKV A;  3GZ1 A;  3CK9 A;  2FEZ A;  3AS4 A;  4N3B A;  4XIF A;  3U4T A;  5KJL A;  4GYO A;  3MKR A;  5DBK A;  1A17 A;  2VGY A;  2VYI A;  4KXK B;  4WNE A;  5ARG A;  5HI7 A;  3RO2 A;  4Y6C A;  4U0S A;  3TG4 A;  3MV2 B;  4U0U A;  2XCB A;  3OXL A;  3QWP A;  4GCN A;  4H7Y A;  4N5C A;  3RIB A;  2FO7 A;  1E96 B;  3LYA A;  3PE4 A;  5FTP A;  3CKC A;  3LCA A;  1IHG A;  5JJ6 A;  4JA7 A;  3GW4 A;  1NZN A;  4J0U A;  3CK8 A;  4G23 A;  3VTY A;  4G26 A;  4YND A;  3OXG A;  5EX3 A;  3LY7 A;  3RO3 A;  3AS8 A;  3ZGQ A;  2PL2 A;  4A1S A;  3KD7 A;  4ABN A;  2AVP A;  2HYZ A;  3CEQ A;  3LY9 A;  4WND A;  3QOU A;  2XGS A;  4BWR A;  2LSU A;  1XNF A;  4UI9 J;  1WAO 1;  1OUV A;  3ZPJ A;  3ZHE A;  4U04 A;  1HH8 A;  2LSV A;  3ASG A;  1YA0 A;  3KS2 A;  2BUG A;  1WM5 A;  2VQ2 A;  4YVQ C;  4XI9 A;  2VGX A;  4GZ3 A;  5LCW J;  3AS5 A;  3BEE A;  2P58 C;  2FF4 A;  3UPV A;  4HOR A;  5A6C A;  4U07 A;  4LEU A;  4XI0 A;  5G04 C;  1ZBP A;  2C2L A;  2VGX B;  4G25 A;  4GYY A;  2WPV A;  4I2Z A;  3WXX A;  4N2S A;  2J9Q A;  2XGO A;  3UQ3 A;  2L6J A;  4IN3 B;  2C0M A;  4RG6 A;  1QQE A;  3FFL A;  4G24 A;  4H7X A;  4O6F A;  5LCW C;  3FP3 A;  5C1D A;  4BT8 A;  4I9E A;  3CV0 A;  2C0L A;  2IFU A;  5BNW A;  4I9C A;  4AM9 A;  2VSN A;  1QZ2 A;  3QKY A;  4HOQ A;  3OXF A;  3R9A B;  2JLB A;  4KYO B;  1ZU2 A;  4GA1 A;  3JYS A;  4NRH B;  4I1A A;  4N39 A;  2XCC A;  4GZ5 A;  4UI9 K;  2FBN A;  5FZS A;  4CGV A;  3NF1 A;  3LPZ A;  3HYM B;  3UUX A;  5CCL A;  2PZI A;  4G2V A;  3S7D A;  4W9R A;  4N3C A;  4N2Q A;  5KJM A;  2KCK A;  3GZ2 A;  3TG5 A;  2GW1 A;  5EX0 A;  2PQR A;  2KCL A;  5ARF A;  4JL0 A;  4RG9 A;  3MA5 A;  2HO1 A;  3FWV A;  2UWJ G;  3ASD A;  3KAE A;  2UY1 B;  3Q49 B;  2XGM A;  4I17 A;  5G05 J;  3IEG A;  5KJK A;  4JHR A;  5FZR A;  3CVL A;  5JJT A;  2LNI A;  4YVO A;  3URZ A;  5JJ7 A;  4UI9 C;  3PDN A;  4APO A;  2XPI A;  4BTB A;  5D0O D;  4HOS A;  5G05 C; 
#chains in the Genus database with same CATH topology
 3UM3 A;  4UWK A;  1N11 A;  3D9O A;  3L13 A;  3SNX A;  1MQS A;  4NAC A;  2DZN A;  4PS8 A;  4U0Z A;  4BTA A;  1N4Q A;  4WUY A;  4BT9 A;  1NA0 A;  1OWL A;  3PRZ A;  1TJC A;  3NAW A;  4ZHB A;  4GU5 A;  2KAT A;  1SQM A;  4B8C B;  5BPP A;  5CRV A;  3ML8 A;  1FVF A;  4FJY A;  2X6K A;  2Y1L E;  4I6G A;  3D3M A;  3QJZ A;  1EYH A;  2VGY A;  4MKT A;  3SY2 A;  4ANU A;  2LXL A;  3ZXP A;  3CIA A;  2FO7 A;  4YDY A;  1Z6T A;  3TL5 A;  4KZC A;  4G26 A;  3UT8 A;  3APC A;  3QOU A;  2IO2 C;  1YA0 A;  1IQU A;  2IO3 C;  2L0I A;  4BET A;  2IU1 A;  1E7U A;  1YCS B;  4HVB A;  3PZD A;  3FFL A;  4O6F A;  5LCW C;  3MZL B;  3B7R L;  3NF1 A;  3HYM B;  2PZI A;  2H6G A;  4FC8 A;  3C3R A;  1SZA A;  1TNU A;  5B1B E;  2DZO A;  4R7L A;  5EDS A;  3U66 A;  4KT6 B;  1Q2Z A;  4I6J A;  2XQ0 A;  1JWG A;  1KT0 A;  2DWZ A;  3L82 A;  4GPK A;  2X6J A;  5BUZ A;  3FTY A;  2MHK A;  1B89 A;  3D9M A;  4BER A;  3AJI A;  1U2V G;  2I6H A;  1OWN A;  4G8L A;  1QYM A;  5AJL A;  2B0O E;  1BI8 B;  3Q15 A;  2I1K A;  5CBO A;  5BXU A;  2KC7 A;  3AG2 E;  4F6R D;  5KJN A;  4J8Y A;  3JXI A;  2XEE A;  3SHF A;  3ZFW A;  3CVP A;  3ENE A;  3RU0 A;  2GRN B;  3MV3 B;  3SFX A;  2J49 A;  3LXU X;  3T8M A;  3WG7 E;  3BG1 B;  3CHP A;  2IOS A;  1OWO A;  5FTP A;  3FHE A;  5JJ6 A;  3CK8 A;  1DCQ A;  2J09 A;  2WM9 A;  2WXP A;  2CG2 A;  3Q7F A;  4I43 A;  2KZT B;  4XI9 A;  3FUN A;  4I2Z A;  2X6H A;  3RK6 A;  4H7X A;  4C48 B;  4L1B A;  4O60 A;  1ZU2 A;  3JYS A;  3VLD A;  3G2W A;  5CED B;  5ITZ F;  1U3D A;  3UIP C;  4HRM B;  3DBS A;  3ASD A;  4HBD A;  3CVL A;  2LNI A;  1WG0 A;  4TRQ A;  5EIL A;  2VSX E;  4RSY A;  4HNA D;  4GTQ A;  4P29 A;  3CSF A;  3ZYQ A;  4AP2 A;  1X81 A;  3Q79 A;  3PZ1 A;  3HVE B;  2VSY A;  2YQ8 A;  4FHK A;  2DBA A;  4L2Y A;  2V0P A;  2JAB A;  2OCC E;  3ABM E;  3DSS A;  5BW8 C;  3D9I A;  1ELW A;  3ULQ A;  5ENT D;  5ENR D;  2MRI A;  2R02 A;  3TXN A;  2HR2 A;  1NA3 A;  2UY1 A;  3PZ3 A;  1SVX A;  5CEA A;  3K9I A;  5CCM A;  4N2Q A;  1N94 A;  3GZ1 A;  4XE0 A;  2XRY A;  2OV8 A;  3CGH A;  4GCN A;  3ASO E;  3EHN A;  4LER A;  1IHG A;  2ETC A;  3RO3 A;  4ABN A;  5A23 A;  4BWR A;  3KS2 A;  1OCR E;  2FF4 A;  4BY6 A;  1SZ9 A;  5HKP A;  5T3R A;  2QC9 A;  3FH7 A;  2ILR A;  3DXM G;  3HIZ A;  3DPY A;  3QKY A;  3ABK E;  3UM0 A;  1KZP A;  1H6P A;  2QZA A;  5KJM A;  3T8K A;  3TG5 A;  2IOL A;  4GPM A;  2H6F A;  2OVF A;  1E90 A;  3IEG A;  5CBN A;  3OTN A;  4EEC A;  5JJ7 A;  4GTV A;  1INZ A;  3NQP A;  2R03 A;  4HOT A;  3AG3 E;  3Q9U C;  2X3M A;  1JCQ A;  3CHR A;  3ZN3 A;  3ZU7 B;  4DX1 A;  1ELK A;  3D9L A;  2OVB A;  3TWT A;  1UJJ A;  2R5S A;  5AN8 A;  4ILH B;  4K03 A;  4ILG A;  1NI1 A;  1TJF A;  3BQO A;  3EHM A;  3KEZ A;  3ASH A;  4DLQ A;  1JUQ A;  1PC2 A;  2WXF A;  1HFA A;  3BU8 A;  4FJZ A;  3U3W A;  3VTX A;  4I6E A;  1PY1 A;  3CQC B;  3RRU A;  4G1T A;  3ESK A;  1V55 E;  2VJ8 A;  2P9K G;  4WNE A;  2XZD G;  3HXF A;  4CDM A;  1E96 B;  3LYA A;  5KNG A;  3CHM A;  3DEP A;  1NZN A;  3JQ1 A;  4A1S A;  2LSU A;  2MOW A;  5LOZ A;  2P9L G;  2VGX A;  5CMY A;  4GTP A;  4QFV A;  1ZBP A;  2E0I A;  4UUC A;  2J9Q A;  2ZIS A;  4GML A;  2WVI A;  4IN3 B;  4L9P A;  3ESL A;  3FUM A;  3CV0 A;  4BX9 A;  1E8Z A;  2VSN A;  1QZ2 A;  4HOQ A;  3OXF A;  4G2V A;  3UKR G;  4W9R A;  3P1U A;  3C98 A;  5EYL A;  1MX4 A;  5JHA A;  4EBA G;  3V2X A;  3NOG D;  2FUL A;  1KZO A;  4JHR A;  3Q73 A;  1JCR A;  5AJD A;  4JEH A;  4UI9 C;  5BV1 A;  4APO A;  1E8W A;  1HE8 A;  1N54 A;  2XEH A;  4TUU A;  3ZYK A;  3ZIM A;  4GCO A;  2XEV A;  2CHX A;  2ZGD A;  1NP7 A;  5EN5 D;  4KBQ A;  1SA5 A;  1D8D A;  3T5X A;  4MS6 A;  3FUF A;  4JW1 A;  4OAU C;  1RZ4 A;  3FTX A;  3PZ4 A;  3RSE G;  3Q5M A;  4FUL A;  4EQF A;  4N3A A;  3O48 A;  4WWN A;  4N3B A;  3J5P A;  4AEZ C;  5DBK A;  4Y6C A;  5HRY A;  3MV2 B;  4B0Z A;  3FUL A;  2WXG A;  5FIN A;  3PE4 A;  4Q96 A;  3L08 A;  3HXB A;  3QNK A;  4CT0 A;  2QY7 A;  2I2O A;  4MRU A;  3CEQ A;  3EJN A;  4A63 B;  4K5B A;  3IHV A;  2V4H C;  4U04 A;  3TWX A;  5LCW J;  3AS5 A;  2VGX B;  2WPV A;  3UM1 A;  2XGO A;  1IHB A;  3JCK C;  4RG6 A;  2C0M A;  2WXK A;  2IFU A;  2DCP A;  5ENQ D;  4LUN U;  2J8S D;  3PS6 A;  3S2A A;  2KCK A;  3V79 K;  2KCL A;  1MZC A;  4HFG A;  4PS7 A;  3UT4 A;  3E30 A;  3SGH A;  4CYM D;  2GRP B;  4G11 A;  4BX8 A;  1FT1 A;  4U96 D;  5D0O D;  3AU4 A;  3FH5 A;  4KVM A;  2XPZ A;  3DEO A;  2KCV A;  1A5E A;  1JWF A;  3RRM B;  1Y8M A;  4ILI A;  5AQ9 A;  2WXM A;  1N4R A;  2EIK E;  2WQH A;  2XEN A;  4DRX E;  2P9S G;  2DYR E;  3SO8 A;  1DC2 A;  3Q4A B;  4GZC A;  3UMV A;  3DSX A;  3FUD A;  4O1O A;  4ATG A;  4CGW A;  4U8H A;  2RG8 A;  4D10 C;  2BKG A;  1SA4 A;  4U0U A;  4ATZ D;  4N5C A;  3CKC A;  4EZL A;  3VTY A;  2AXZ A;  4DI4 A;  1NFI E;  2AVP A;  4DX2 A;  3I4G A;  1HH8 A;  2IY0 C;  4HI8 A;  3SFY A;  2L6J A;  1UG3 A;  4IYP A;  1UJK A;  5BNW A;  3D9N A;  2JLB A;  4NRH B;  2ZU6 B;  4GZ5 A;  3LPZ A;  3MA5 A;  1V54 E;  3FUE A;  3PEV B;  1N52 A;  3RAU A;  3CVV A;  4UWG A;  3C5R A;  4LRZ A;  4TXQ A;  4G8K A;  4FAD A;  1W3B A;  2A5U A;  3HVE A;  3CVW A;  2CHW A;  3B7T A;  5ENP D;  5E76 A;  4GA0 A;  3HHM A;  3PE3 A;  4J8E A;  2ZIR A;  2NC9 A;  3FUI A;  3EDT B;  2DYS E;  2X38 A;  2YHC A;  2NXP A;  3PVL A;  5EKQ D;  1KT1 A;  1OWM A;  5E75 A;  2YIN A;  3IBE A;  4GA2 A;  4Q94 A;  2Y4U A;  3RKV A;  3DST A;  3B95 A;  4GYO A;  3X2Q E;  3D9K A;  2LUH A;  4H7Y A;  4J6I A;  3L16 A;  4DJA A;  3PUJ A;  1BPO A;  1UN9 A;  2PL2 A;  3KD7 A;  3UTM A;  3LY9 A;  3FUJ A;  1H0A A;  1WAO 1;  4MBG A;  1WM5 A;  4K5A B;  1VDY A;  4JZY A;  4G25 A;  2AWI A;  5FQ8 A;  3L22 A;  3PZ2 A;  1DNP A;  3E33 A;  2WQ6 A;  3FP3 A;  4BT8 A;  4F1P A;  3AU5 A;  4NIK A;  2GRL A;  4I1M A;  4CGV A;  2DVW A;  3FUK A;  4FLB A;  3S7D A;  5IY5 E;  2EIL E;  4ACK A;  3ZNG A;  4K0R A;  3NOC D;  1QBQ A;  2WXR A;  2X6I A;  4HLL A;  5ANL A;  5J90 A;  3CKB A;  3EU5 A;  5D66 A;  1Z3X A;  3EHR A;  3VLE A;  3QWW A;  2A4Z A;  3PRE A;  2XS1 A;  5D0Q D;  4U8V D;  4HOU A;  4JVS A;  4O1P A;  1JPL A;  1E8Y A;  3L9T A;  3CST A;  2AXV A;  2P9P G;  5KNH D;  1HO8 A;  4Q69 A;  5AEN A;  3MKR A;  4B8A A;  5AIJ A;  4JHJ A;  2XCB A;  3CLJ A;  4EHM A;  3AG1 E;  3OAW A;  5EYP F;  2WXJ A;  3AAA C;  5EX3 A;  3B7S A;  3CHO A;  5FQ7 A;  2P9N G;  1OUV A;  3CVY A;  2L9B A;  3APD A;  1TR4 A;  1HU3 A;  3QAQ A;  3TWR A;  1HF8 A;  4IUL A;  1TNB A;  2CG3 A;  3E32 A;  5G55 A;  4F1S A;  4N39 A;  1PAQ A;  2F0Y A;  5JMN D;  4RG9 A;  2XGM A;  3QB2 A;  2ION A;  1N0Q A;  1TNO A;  4BTB A;  4DI3 A;  5LX8 A;  4I2W A;  4FU3 A;  3PEU B;  2R17 C;  4UQX A;  3TWU A;  5CHE E;  1LF8 A;  4HRN A;  2Y4T A;  3FU6 A;  2VTB A;  2V5Q C;  1HZ4 A;  3UI2 A;  2F37 A;  1OY3 D;  3IKO B;  2L6B A;  1BLX B;  4U95 D;  3KSQ A;  3E37 A;  2LO6 A;  2P9U G;  2WXO A;  3PNT B;  4CT4 A;  5M72 A;  2B6C A;  2IQC A;  2HM8 A;  4RQI A;  4ACL A;  4JC8 A;  3MKQ B;  4DPR A;  3LCA A;  3SI5 A;  3LY7 A;  4GTS A;  1AWC B;  2FO1 E;  4A55 A;  3ZPJ A;  4GMJ A;  4UWL A;  3ZHE A;  4GZ3 A;  3ML9 A;  4UWF A;  1BI7 B;  3V2O A;  5B3S E;  4GAA A;  3WXX A;  2WQ7 A;  4LNG A;  3APF A;  3UQ3 A;  4FLH A;  2F8Y A;  1WDY A;  1N4P A;  4U63 A;  4DX6 D;  3SFZ A;  5BXO A;  1D8E A;  1S70 B;  2BTD A;  4KYO B;  5FQ6 A;  2PNN A;  3R7R A;  2I9C A;  3IXE A;  2VSO E;  2HO1 A;  2UY1 B;  1N0R A;  1HX8 A;  5KJK A;  2Y0B G;  3ULY A;  3HXE A;  1JCS A;  3PDN A;  4HQD A;  1H2V C;  5G05 C;  5KBA A;  4B89 A;  4TXP A;  1HXI A;  4DX5 D;  4WNG A;  2PQN A;  1FPP A;  4ANW A;  1AP7 A;  2EIJ E;  2P9I G;  2VTB B;  3C3Q A;  3ONL A;  5FZQ A;  4TV3 A;  4EBA A;  2HE0 A;  2OND A;  3RJV A;  3CVQ A;  2QYJ A;  3NB2 A;  1OWP A;  1UW4 B;  3NZS A;  4Y6W A;  1Z3Y A;  3Q75 A;  4A1G A;  3O4Z A;  4AIF A;  4CRW A;  3DSU A;  3BG0 B;  4XIF A;  1N95 A;  3ZYM A;  1TN7 A;  5D2M C;  4GMR A;  3TG4 A;  3FH8 A;  4B93 B;  1K8K G;  2VGE A;  3G2T A;  4EPZ A;  4JA7 A;  3UXG A;  3LVR E;  2XS8 A;  1BU9 A;  4GTO A;  3TAX A;  2BUG A;  1MX2 A;  3E34 A;  3FDH A;  4GYY A;  3CVU A;  2ETB A;  3RRN B;  1GW6 A;  2J08 A;  4HXI A;  2GRR B;  3DRA A;  2I1J A;  5AAR A;  4I9E A;  2C0L A;  2YNQ A;  4I9C A;  3D9J A;  2XCC A;  1OCC E;  5CCL A;  4V3I A;  4CDN A;  2LXM A;  3J5Q B;  3FWV A;  3P2B A;  3EU9 A;  2GRM A;  3MCX A;  3TJP A;  2V8S E;  3D9P A;  3CVX A;  4LG6 A;  3S7J A;  1Y6I A;  4J8D A;  5DIZ A;  1E7V A;  4J7W A;  4RVB A;  4FHJ A;  1MX6 A;  1S0P A;  2XHE A;  1IYG A;  5EID A;  1LTX A;  1UOH A;  4E6H A;  2QFC A;  5G04 J;  3W9G A;  3E4B A;  1OCZ E;  1LD8 A;  3U64 A;  2RD0 A;  3Q9N C;  5LFA A;  5AQ7 A;  3LKU A;  3NBN B;  4FP7 A;  3AS4 A;  5JA4 D;  3U4T A;  3C72 A;  2VYI A;  4PDX A;  4A3T A;  1LD7 A;  2EQX A;  2YHE A;  2J4D A;  2WXI A;  3FU5 A;  2X6F A;  2XGS A;  1XNF A;  2OEV A;  4UI9 J;  2LSV A;  4JB8 P;  4YVQ C;  3GZS A;  4HOR A;  5G04 C;  4N2S A;  4LCT A;  3TXM A;  5CEC B;  1Z5S C;  4EZJ A;  1WY6 A;  4EZK A;  5ENS D;  4KVO A;  3FUH A;  5FZS A;  3TWQ A;  2EIN E;  1O1S A;  4K5C A;  4NUR A;  4BFR A;  2PM7 A;  4I17 A;  4AVX A;  5JJT A;  2AXU A;  3URZ A;  5BV0 A;  3ISM C;  4WNF A;  3CK7 A;  3QDN A;  4QQI A;  4AY5 A;  4GB9 A;  3JQ0 A;  2BF0 X;  3SF4 A;  2Q7F A;  3DPD A;  5EIB E;  3GYZ A;  1OXJ A;  4L2L A;  1IXV A;  5H7P A;  1IQR A;  1NL4 A;  4ANX A;  3TWV A;  5C2Y A;  3ASF A;  4HLE A;  4DLO A;  2V5F A;  4B94 A;  1O1T A;  1P5Q A;  3CVN A;  3ZKJ A;  4DX7 D;  3Q7A A;  3EIQ C;  5FIO A;  2AJA A;  5LP0 A;  3OXL A;  4HB5 A;  3PUK A;  4AV7 A;  5KWD A;  4J0U A;  3MJW A;  1S64 A;  3OXG A;  3LJN A;  4XZ4 A;  1TN6 A;  1IKN D;  3ASG A;  3UKU G;  3CQG B;  2P58 C;  3AG4 E;  1H6O A;  3QK0 A;  2ETA A;  3SD5 A;  3C3O A;  3L6A A;  4BSZ B;  3ZYL A;  4GA1 A;  3DXK G;  3TGO A;  5AAO A;  3T5V A;  3R9M A;  3UUX A;  1H2T C;  4N3C A;  3LVQ E;  5CMW A;  3B7B A;  5ENO D;  1OCO E;  1E8X A;  4U8Y D;  4M3O A;  3Q49 B;  3IV0 A;  2XRZ A;  3MYV A;  2ZGG A;  2WMN A;  1OT8 A;  4OAV B;  1HS6 A;  4AOF A;  4GTT A;  3ZXS A;  2L0T B;  4JXT A;  4WWO A;  4F53 A;  3MEK A;  3ZEF A;  4JD2 G;  4LSZ E;  4YDO A;  3SZ7 A;  4JA9 A;  4HRL A;  3LDZ A;  2OOE A;  2WB2 A;  4GZD A;  2BED A;  4GYW A;  3HRA A;  2KXP C;  4E85 A;  4C0M A;  3QWV A;  3HDX A;  2GRQ B;  4AY6 A;  3JUI A;  3FTV A;  3DSV A;  3I5P A;  1FCH A;  3S7F A;  4UQZ A;  1HG5 A;  3DSW A;  3UT7 A;  3G2S A;  4JPS A;  2KM4 A;  4HS2 A;  4U0S A;  1UN8 A;  1ZB1 A;  4X8Q A;  4HI9 A;  4PH4 B;  2CFZ A;  4N5Q A;  5ENN A;  3MKQ A;  2HYZ A;  4WND A;  4TUM A;  2KBX A;  3UIN C;  4XEI G;  2V4L A;  4WWP A;  2BKK B;  2WXN A;  2Y69 E;  4RLY A;  4XI0 A;  4U7E B;  2C2L A;  2WMO A;  4APF A;  2WXH A;  4YDW A;  3EIJ A;  3QAR A;  3L17 A;  1FT2 A;  2LAI A;  4JEU A;  4LNU D;  3F6Q A;  4WAF A;  2JEK A;  2EIM E;  1BD8 A;  2GW1 A;  4PUC A;  1TYQ G;  3TWS A;  3KAE A;  1XGW A;  2WXL A;  3QC1 A;  5G05 J;  2NSZ A;  1TNY A;  4YVO A;  3FEX A;  1HG2 A;  2PM6 A;  3G2U A;  3R7Q A;  3ZHE B;  4UQY A;  2FI7 A;  1MJ0 A;  3W9F A;  3V31 A;  3MX3 A;  3Q47 B;  4J8F A;  4OVV A;  3I3N A;  4ME2 A;  3IHY A;  3LS8 A;  4KMO A;  3V30 A;  4AJW A;  4A3V A;  3ULE G;  1QNF A;  3NZU A;  3UX4 A;  2WXQ A;  5FJY A;  3JUE A;  4CZ2 D;  1TN8 A;  5J08 A;  4KZ0 A;  3FEY A;  5HQ8 A;  4DK5 A;  5AYW D;  3PNL B;  4BES A;  3CK9 A;  4L23 A;  3FTW A;  1YYH A;  1O1R A;  1A17 A;  5HI7 A;  5FQ4 A;  4DUI A;  3QWP A;  5FWQ A;  2P2C P;  2ZXW E;  3RIB A;  3CHS A;  4CCA A;  3ZGQ A;  2GGF A;  2KZT A;  3LEW A;  3SBS A;  3ZUV B;  1K1A A;  3ZW3 A;  4L7T A;  1H6K A;  3CHQ A;  4AM9 A;  3Q78 A;  4UI9 K;  1S63 A;  2J4B A;  1MYO A;  4I1O B;  5EX0 A;  2PQR A;  4JHK A;  2H6I A;  1YMP A;  2R2L A;  2XZT G;  1U3C A;  2R59 A;  3HXD A;  3FY4 A;  4GTM A;  2E2E A;  5BT1 A;  3BUA A;  4ANV A;  4F7A A;  3FTZ A;  2RFA A;  4BEP A;  3SQV A;  2J07 A;  1SW6 A;  1H2U A;  2IF4 A;  1K1B A;  3LY8 A;  1X5B A;  3FU0 A;  5JHB A;  3LJ3 A;  3JXJ A;  1ELR A;  3FU3 A;  4IRU A;  2CFU A;  3PH0 C;  4F3V A;  3G2V A;  5A7D B;  3MGB A;  1K3Z D;  4URK A;  2XPY A;  4GZ6 A;  3ZVV A;  4XKC A;  4J8S A;  2FEZ A;  3ASN E;  5KJL A;  3KEA A;  4KXK B;  5ARG A;  3RO2 A;  2DIW A;  4XKB A;  2A5E A;  4GTR A;  4G23 A;  2IJG X;  3DWL G;  3HG0 D;  4C9B B;  3SBT B;  2VQ2 A;  4LEU A;  1MHQ A;  1EDU A;  3I4R B;  3EHQ A;  3ABL E;  4LNB A;  5KCM A;  5C1D A;  3ONK A;  3TWW A;  2AW6 A;  2FBN A;  4OYS A;  3EUV A;  3HXC A;  2RKK A;  4JL0 A;  2MYO A;  3T9K A;  5T4Y A;  4MLP A;  5AQA A;  5FZR A;  4TXR A;  2M63 A;  1N9A A;  2OEW A;  5HS0 A;  4M7C A;  1DVP A;  1D9S A;  4UWH A;  1G3N B;  4ZFH A;  5CER B;  3N71 A;  1H19 A;  5FT9 A;  3VLF A;  1FVH A;  3B7U X;  1KPS B;  2RFM A;  4CDR A;  1TNZ A;  1N4S A;  4NQ0 A;  2NYJ A;  3ZRH A;  1RW2 A;  3L54 A;  5B1A E;  2Y3A A;  1EF1 C;  3S7B A;  2GRO B;  1KLX A;  2CHZ A;  2IEJ A;  3UM2 A;  5ANR A;  5CRU A;  3GW4 A;  3B13 A;  1EPU A;  4YND A;  3AS8 A;  5AQB A;  2H6H A;  5T8I A;  3UPV A;  3BEE A;  5A6C A;  4U07 A;  4XX5 A;  3U9W A;  4BSX A;  4AXH A;  2QYU A;  2R05 A;  3KSL A;  1QQE A;  4G24 A;  4CEM A;  1TEZ A;  5G2N A;  4Z68 A;  4FA6 A;  3FTS A;  2LAH A;  3D9H A;  3R9A B;  4I1A A;  1DCE A;  4OVU A;  3UIO C;  1O5M A;  3GZ2 A;  5ARF A;  2UWJ G;  3CR3 A;  3FTU A;  2F8X K;  4C0E A;  2XPI A;  1L5J A;  4HOS A;  4YDE A;  4PS3 A; 
#chains in the Genus database with same CATH homology
 4I2W A;  1E8W A;  3ZXS A;  1HE8 A;  4UWK A;  3D9O A;  1N54 A;  3L13 A;  2L0T B;  3PEU B;  2R17 C;  4FU3 A;  4JXT A;  4UQX A;  4WWO A;  5CHE E;  3SNX A;  4F53 A;  3MEK A;  1LF8 A;  3ZEF A;  4TUU A;  1MQS A;  2Y4T A;  4NAC A;  3FU6 A;  2VTB A;  3SZ7 A;  4PS8 A;  4JA9 A;  4U0Z A;  3ZYK A;  3LDZ A;  3ZIM A;  4BTA A;  2OOE A;  4GCO A;  4WUY A;  4BT9 A;  1HZ4 A;  2XEV A;  1NA0 A;  4GZD A;  2WB2 A;  1OWL A;  4GYW A;  2CHX A;  4E85 A;  1NP7 A;  4C0M A;  3PRZ A;  1TJC A;  4KBQ A;  3QWV A;  3IKO B;  3HDX A;  3T5X A;  4MS6 A;  4GU5 A;  2KAT A;  3FUF A;  4JW1 A;  4AY6 A;  1SQM A;  4B8C B;  3JUI A;  3FTV A;  3I5P A;  5BPP A;  1FCH A;  3FTX A;  3ML8 A;  3S7F A;  1FVF A;  1HG5 A;  4FJY A;  4UQZ A;  3Q5M A;  2LO6 A;  2X6K A;  3UT7 A;  3G2S A;  4FUL A;  4EQF A;  4N3A A;  2WXO A;  4I6G A;  3PNT B;  4CT4 A;  5M72 A;  4JPS A;  2KM4 A;  3O48 A;  4HS2 A;  2IQC A;  4WWN A;  3D3M A;  4N3B A;  2HM8 A;  3QJZ A;  1EYH A;  4AEZ C;  5DBK A;  2VGY A;  4MKT A;  4Y6C A;  4U0S A;  4ACL A;  1UN8 A;  3MV2 B;  4B0Z A;  4ANU A;  4JC8 A;  3FUL A;  2WXG A;  3CIA A;  2FO7 A;  3PE4 A;  4PH4 B;  3MKQ B;  4DPR A;  2CFZ A;  3LCA A;  3L08 A;  4Q96 A;  3SI5 A;  3QNK A;  4CT0 A;  5ENN A;  1Z6T A;  3TL5 A;  4KZC A;  3MKQ A;  4G26 A;  3UT8 A;  2QY7 A;  3LY7 A;  2I2O A;  4MRU A;  3APC A;  2HYZ A;  4WND A;  3CEQ A;  3EJN A;  3QOU A;  4A55 A;  3ZPJ A;  4GMJ A;  3IHV A;  4UWL A;  2V4L A;  4U04 A;  4WWP A;  3ZHE A;  1YA0 A;  1IQU A;  5LCW J;  2WXN A;  4GZ3 A;  3ML9 A;  3AS5 A;  4UWF A;  2L0I A;  4XI0 A;  2VGX B;  2C2L A;  2IU1 A;  1E7U A;  2WMO A;  2WPV A;  2WXH A;  4GAA A;  3WXX A;  4APF A;  2WQ7 A;  2XGO A;  3APF A;  3JCK C;  4RG6 A;  3UQ3 A;  2C0M A;  4HVB A;  3PZD A;  3FFL A;  4O6F A;  4FLH A;  5LCW C;  3MZL B;  2WXK A;  2IFU A;  3EIJ A;  3QAR A;  2DCP A;  4U63 A;  4LUN U;  3SFZ A;  3L17 A;  2LAI A;  4JEU A;  2BTD A;  3PS6 A;  4KYO B;  3B7R L;  5FQ6 A;  3S2A A;  3R7R A;  3NF1 A;  2I9C A;  3HYM B;  2PZI A;  2VSO E;  4WAF A;  4FC8 A;  2JEK A;  2KCK A;  2GW1 A;  4PUC A;  2KCL A;  4HFG A;  1SZA A;  2HO1 A;  4PS7 A;  3KAE A;  1XGW A;  2UY1 B;  2WXL A;  3UT4 A;  3QC1 A;  3SGH A;  5G05 J;  2NSZ A;  1HX8 A;  4R7L A;  5KJK A;  5EDS A;  3U66 A;  4G11 A;  4KT6 B;  4BX8 A;  4YVO A;  3PDN A;  3FEX A;  1HG2 A;  5D0O D;  3AU4 A;  3FH5 A;  4KVM A;  1H2V C;  2XPZ A;  2PM6 A;  3G2U A;  2XQ0 A;  4I6J A;  1JWG A;  5G05 C;  3R7Q A;  1KT0 A;  3ZHE B;  2KCV A;  4GPK A;  4UQY A;  4B89 A;  2X6J A;  5BUZ A;  3FTY A;  1HXI A;  1JWF A;  2MHK A;  1B89 A;  2FI7 A;  4WNG A;  2PQN A;  3D9M A;  3RRM B;  1Y8M A;  4ILI A;  3MX3 A;  4ANW A;  2I6H A;  3Q47 B;  2WXM A;  1OWN A;  4J8F A;  2VTB B;  2WQH A;  5AJL A;  4OVV A;  3I3N A;  3ONL A;  4ME2 A;  3Q15 A;  3IHY A;  5FZQ A;  4TV3 A;  4EBA A;  2I1K A;  3LS8 A;  2KC7 A;  4KMO A;  5KJN A;  4AJW A;  2OND A;  3RJV A;  3CVQ A;  4A3V A;  1OWP A;  1UW4 B;  1QNF A;  3Q4A B;  3SHF A;  4GZC A;  3NZU A;  3UMV A;  3UX4 A;  2WXQ A;  3NZS A;  5FJY A;  3ZFW A;  3FUD A;  4Y6W A;  1Z3Y A;  3CVP A;  4ATG A;  5J08 A;  3ENE A;  4CGW A;  3RU0 A;  4KZ0 A;  3FEY A;  5HQ8 A;  3MV3 B;  4A1G A;  4DK5 A;  5AYW D;  3O4Z A;  4AIF A;  3PNL B;  4CRW A;  3CK9 A;  4U8H A;  3BG0 B;  4XIF A;  4L23 A;  3ZYM A;  2RG8 A;  2J49 A;  3LXU X;  3FTW A;  4D10 C;  3T8M A;  1A17 A;  5HI7 A;  3TG4 A;  5FQ4 A;  3FH8 A;  3BG1 B;  4U0U A;  3CHP A;  3QWP A;  2IOS A;  5FWQ A;  4N5C A;  3RIB A;  1OWO A;  3CHS A;  3G2T A;  5FTP A;  3CKC A;  4EPZ A;  4CCA A;  3FHE A;  4JA7 A;  5JJ6 A;  4EZL A;  3CK8 A;  3VTY A;  2J09 A;  2AXZ A;  3ZGQ A;  2WM9 A;  2WXP A;  4DI4 A;  2AVP A;  3LVR E;  2GGF A;  2CG2 A;  3I4G A;  2KZT A;  1HH8 A;  3TAX A;  4I43 A;  2BUG A;  2KZT B;  3LEW A;  4XI9 A;  3SBS A;  3FDH A;  4GYY A;  3FUN A;  4I2Z A;  3CVU A;  3RRN B;  1GW6 A;  2J08 A;  2L6J A;  4HXI A;  1UG3 A;  2X6H A;  3RK6 A;  4H7X A;  2I1J A;  4IYP A;  3ZW3 A;  4L7T A;  1H6K A;  4I9E A;  1UJK A;  2C0L A;  2YNQ A;  3CHQ A;  4I9C A;  4L1B A;  5BNW A;  4AM9 A;  3D9N A;  2JLB A;  3D9J A;  4NRH B;  1ZU2 A;  4UI9 K;  3JYS A;  3VLD A;  2XCC A;  2ZU6 B;  4GZ5 A;  3G2W A;  3LPZ A;  5CCL A;  1U3D A;  4V3I A;  2J4B A;  4I1O B;  4CDN A;  5EX0 A;  2PQR A;  4JHK A;  3MA5 A;  3FWV A;  3DBS A;  3ASD A;  3FUE A;  3PEV B;  1N52 A;  3P2B A;  3CVL A;  3CVV A;  2LNI A;  1U3C A;  2R59 A;  4UWG A;  2GRM A;  4TRQ A;  2VSX E;  4RSY A;  3FY4 A;  3MCX A;  4LRZ A;  3TJP A;  2V8S E;  3D9P A;  3CVX A;  4P29 A;  3CSF A;  3S7J A;  4FAD A;  1W3B A;  3ZYQ A;  2A5U A;  1Y6I A;  4J8D A;  4AP2 A;  5DIZ A;  3HVE A;  1E7V A;  4RVB A;  4FHJ A;  2E2E A;  5BT1 A;  4ANV A;  3HVE B;  1S0P A;  4F7A A;  3CVW A;  3FTZ A;  2VSY A;  2XHE A;  2YQ8 A;  4FHK A;  1IYG A;  2DBA A;  2CHW A;  4L2Y A;  2V0P A;  3B7T A;  4E6H A;  2J07 A;  5E76 A;  2QFC A;  4GA0 A;  3HHM A;  3PE3 A;  4J8E A;  5G04 J;  1H2U A;  5BW8 C;  2IF4 A;  2NC9 A;  3FUI A;  3EDT B;  3LY8 A;  3E4B A;  1X5B A;  3FU0 A;  5JHB A;  3LJ3 A;  1ELR A;  3FU3 A;  4IRU A;  3D9I A;  2X38 A;  2CFU A;  2YHC A;  3PH0 C;  1ELW A;  4F3V A;  3G2V A;  3ULQ A;  5A7D B;  2NXP A;  2MRI A;  3MGB A;  3PVL A;  5EKQ D;  1KT1 A;  1OWM A;  3TXN A;  3U64 A;  2RD0 A;  2HR2 A;  1NA3 A;  2UY1 A;  2YIN A;  5E75 A;  4URK A;  5LFA A;  2XPY A;  3IBE A;  3LKU A;  3K9I A;  4GZ6 A;  5CCM A;  4N2Q A;  3ZVV A;  4GA2 A;  4XKC A;  4Q94 A;  2Y4U A;  3RKV A;  3GZ1 A;  4XE0 A;  4J8S A;  2FEZ A;  4FP7 A;  3AS4 A;  2XRY A;  3U4T A;  5KJL A;  4GYO A;  2VYI A;  3D9K A;  4KXK B;  5ARG A;  4PDX A;  3RO2 A;  4A3T A;  2OV8 A;  2EQX A;  2DIW A;  3CGH A;  4GCN A;  4H7Y A;  4J6I A;  4XKB A;  2YHE A;  3EHN A;  4LER A;  1IHG A;  3L16 A;  2J4D A;  2WXI A;  4DJA A;  4G23 A;  3FU5 A;  3PUJ A;  1BPO A;  3RO3 A;  2X6F A;  4ABN A;  1UN9 A;  2PL2 A;  3KD7 A;  3LY9 A;  3FUJ A;  5A23 A;  2XGS A;  2IJG X;  1H0A A;  4BWR A;  1XNF A;  4UI9 J;  1WAO 1;  4C9B B;  2LSV A;  3KS2 A;  3SBT B;  2VQ2 A;  1WM5 A;  4YVQ C;  3GZS A;  1VDY A;  2FF4 A;  4BY6 A;  4HOR A;  1SZ9 A;  4LEU A;  4JZY A;  5G04 C;  1MHQ A;  4G25 A;  4N2S A;  4LCT A;  1EDU A;  2AWI A;  3I4R B;  3TXM A;  5KCM A;  5FQ8 A;  5T3R A;  3L22 A;  4EZJ A;  1DNP A;  3FH7 A;  2WQ6 A;  2ILR A;  3FP3 A;  3HIZ A;  3ONK A;  4BT8 A;  5C1D A;  1WY6 A;  2AW6 A;  4EZK A;  3QKY A;  3AU5 A;  2GRL A;  4I1M A;  4KVO A;  3FUH A;  5FZS A;  2FBN A;  4OYS A;  4CGV A;  4FLB A;  3FUK A;  3S7D A;  5KJM A;  3TG5 A;  4ACK A;  4JL0 A;  4K0R A;  4NUR A;  2IOL A;  4BFR A;  5T4Y A;  2PM7 A;  2OVF A;  1E90 A;  4I17 A;  2WXR A;  4AVX A;  3IEG A;  4MLP A;  2X6I A;  5FZR A;  3OTN A;  2M63 A;  4EEC A;  5JJT A;  2AXU A;  3URZ A;  5JJ7 A;  5ANL A;  1INZ A;  5BV0 A;  3NQP A;  4WNF A;  3CK7 A;  3QDN A;  5J90 A;  4HOT A;  1DVP A;  4AY5 A;  2X3M A;  3CKB A;  4GB9 A;  3JQ0 A;  4UWH A;  2BF0 X;  1Z3X A;  3SF4 A;  2Q7F A;  3DPD A;  3N71 A;  3VLE A;  3CHR A;  3QWW A;  1H19 A;  5FT9 A;  3VLF A;  3ZN3 A;  2A4Z A;  3GYZ A;  1FVH A;  3B7U X;  1ELK A;  3PRE A;  3D9L A;  2OVB A;  4L2L A;  5D0Q D;  1UJJ A;  2R5S A;  4CDR A;  4ILH B;  4K03 A;  4ILG A;  1TJF A;  3EHM A;  3KEZ A;  4HOU A;  3ASH A;  4DLQ A;  1IQR A;  1JUQ A;  4NQ0 A;  1PC2 A;  4JVS A;  2WXF A;  1HFA A;  3ZRH A;  4FJZ A;  3L54 A;  4ANX A;  3U3W A;  3VTX A;  1JPL A;  5C2Y A;  2Y3A A;  3ASF A;  1EF1 C;  4I6E A;  1E8Y A;  3S7B A;  4DLO A;  4HLE A;  3CST A;  2V5F A;  2AXV A;  1KLX A;  1PY1 A;  1HO8 A;  2CHZ A;  4B94 A;  3CQC B;  3RRU A;  1P5Q A;  3CVN A;  4G1T A;  3ESK A;  2VJ8 A;  4Q69 A;  5AEN A;  3EIQ C;  3MKR A;  5LP0 A;  4WNE A;  4B8A A;  5AIJ A;  4JHJ A;  5ANR A;  2XCB A;  3OXL A;  3CLJ A;  3OAW A;  4CDM A;  1E96 B;  3LYA A;  3PUK A;  2WXJ A;  4AV7 A;  3CHM A;  3GW4 A;  1NZN A;  3B13 A;  3JQ1 A;  4J0U A;  3MJW A;  1EPU A;  4YND A;  5EX3 A;  3OXG A;  3B7S A;  4XZ4 A;  3AS8 A;  3CHO A;  4A1S A;  5FQ7 A;  2LSU A;  1OUV A;  3CVY A;  2MOW A;  3APD A;  2L9B A;  3ASG A;  5LOZ A;  5T8I A;  2VGX A;  3CQG B;  5CMY A;  3UPV A;  3BEE A;  2P58 C;  5A6C A;  4U07 A;  4XX5 A;  3U9W A;  1HU3 A;  3QAQ A;  4QFV A;  1ZBP A;  4AXH A;  3QK0 A;  4BSX A;  2E0I A;  2J9Q A;  3SD5 A;  4GML A;  2WVI A;  4IN3 B;  1QQE A;  3ESL A;  4G24 A;  4CEM A;  1HF8 A;  1TEZ A;  5G2N A;  3FUM A;  3CV0 A;  4FA6 A;  4BX9 A;  3L6A A;  1E8Z A;  3FTS A;  2LAH A;  2VSN A;  1QZ2 A;  4HOQ A;  2CG3 A;  3OXF A;  4IUL A;  5G55 A;  3R9A B;  3ZYL A;  4F1S A;  4GA1 A;  4N39 A;  3TGO A;  4I1A A;  1PAQ A;  3T5V A;  3UUX A;  4G2V A;  4OVU A;  1H2T C;  4W9R A;  4N3C A;  3LVQ E;  5CMW A;  3P1U A;  3C98 A;  3GZ2 A;  5ARF A;  1E8X A;  5JHA A;  4RG9 A;  4M3O A;  4EBA G;  2UWJ G;  3Q49 B;  3IV0 A;  3CR3 A;  2XRZ A;  2XGM A;  3QB2 A;  2FUL A;  4JHR A;  3MYV A;  2WMN A;  2ION A;  5AJD A;  4JEH A;  3FTU A;  4UI9 C;  5BV1 A;  4APO A;  2XPI A;  1L5J A;  1HS6 A;  4BTB A;  4C0E A;  4DI3 A;  5LX8 A;  4HOS A;  4AOF A;  4PS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...