2C0MA

Apo form of the tpr domain of the pex5p receptor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
297
Chain Sequence
DKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 120
structure length 297
sequence length 319
chains with identical sequence B, C, F
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0mA00
4GZ5A 3LY7A 2VGXB 4U0SA 3NF1A 5ARGA 4YVOA 5AYWD 2VGXA 3BEEA 3MEKA 4G25A 5EX3A 1QQEA 5FJYA 3MV3B 3RKVA 4XI9A 5BT1A 2FI7A 3LPZA 2KCVA 2FBNA 4G1TA 4GYYA 4UI9K 5JJTA 4N3AA 4HOTA 3ASDA 2IFUA 3RO3A 1FCHA 4HORA 4H7YA 2VSNA 4G26A 2R5SA 5JJ7A 4JA9A 3S7BA 3S7JA 1HH8A 2LSUA 3QWWA 5FZRA 3KD7A 4U07A 4O6FA 5KJKA 2VQ2A 3ZGQA 4N2SA 5D0OD 3LYAA 5HI7A 4H7XA 4W9RA 3SZ7A 2WPVA 1KLXA 3ASFA 4WNDA 4A1SA 4F3VA 5KJNA 4BWRA 3FFLA 5BNWA 3GW4A 2JLBA 3CVPA 3CVNA 1P5QA 2UY1A 4WNGA 3RIBA 1B89A 4GA2A 4KXKB 4CGVA 4J8EA 2L6JA 5DBKA 2Y4UA 4BT9A 3MV2B 1ELWA 2J9QA 2KATA 3AS5A 4N3BA 4WUYA 3JYSA 4RG9A 2UY1B 5LCWC 5EKQD 5G04J 4CGWA 3ZHEB 3CEQA 5A6CA 3EDTB 4GA0A 3TG5A 2KCLA 4KYOB 2DBAA 2C0MA 3RJVA 3AS4A 4UI9J 1OUVA 1ELRA 2UWJG 4GYWA 4RG6A 1TJCA 3CK9A 3QWVA 4N39A 3S7FA 5KJMA 3IEGA 1IHGA 5CCLA 4ME2A 3Q47B 2LNIA 4NRHB 4EQFA 2YHCA 3TAXA 3LKUA 1WM5A 4N3CA 2BUGA 1NA3A 4GCOA 4J8DA 4I9EA 4HOSA 3Q5MA 3ZFWA 1E96B 3PE4A 5A7DB 4BTBA 3CVQA 1ZU2A 3GYZA 2VYIA 3N71A 3OXGA 4U0ZA 5LCWJ 1A17A 2VSYA 2Q7FA 2ONDA 2IF4A 1NA0A 4HOUA 4IN3B 1Y8MA 4NQ0A 3CKBA 4HOQA 3URZA 4BT8A 4I17A 2MHKA 5BW8C 3ESKA 3CK7A 3FP3A 3LY9A 3QKYA 2PQNA 4AIFA 5M72A 1ZBPA 3TGOA 4G24A 4UQYA 3U3WA 2C0LA 4GYOA 3RU0A 3LCAA 3PE3A 4I2WA 1XNFA 4WNEA 4YNDA 4AM9A 4U04A 5DIZA 3WXXA 4G23A 4GA1A 3U4TA 4UQXA 3CK8A 2KCKA 4JHRA 5CHEE 2PL2A 3K9IA 4GCNA 3QWPA 3AS8A 4U0UA 5G05C 4BTAA 4UQZA 3S7DA 5CCMA 2FF4A 2XGOA 2KC7A 4J8FA 3OXLA 5G05J 3RO2A 1YA0A 3UUXA 2FO7A 3VTYA 4KBQA 5JJ6A 2FEZA 4XI0A 4I2ZA 4ABNA 4GPKA 3ZHEA 3VTXA 3CVLA 1W3BA 3QDNA 3PDNA 2WQHA 4Y6WA 5ARFA 1PC2A 5D0QD 1NZNA 1KT0A 3GZ2A 4I9CA 4Y6CA 3ASGA 2NC9A 3OXFA 4CDRA 2XCBA 3ZN3A 4LEUA 3KS2A 5FZSA 4XIFA 4I1AA 3ULQA 2V5FA 2VGYA 2E2EA 5FTPA 2HR2A 1QZ2A 3R9AB 2PZIA 4B94A 1HZ4A 2XGMA 4J0UA 4AY5A 4GZ3A 3MA5A 1KT1A 3Q49B 2PQRA 4JA7A 2AVPA 5FZQA 3TG4A 2P58C 5KJLA 3HYMB 3CKCA 1IYGA 5FT9A 4APOA 3E4BA 4N5CA 2OOEA 2HO1A 3LY8A 4GZ6A 3UQ3A 3ZPJA 5HQ8A 4WNFA 3MKRA 3UPVA 3FWVA 4N2QA 2XEVA 4AY6A 3QOUA 3GZ1A 5EX0A 1WAO1 4UI9C 5C1DA 3Q4AB 2XGSA 3O48A 3SF4A 2LSVA 4G2VA 2XCCA 3CV0A 2GW1A 3KAEA 4JL0A 2QFCA 2HYZA 4YVQC 3ASHA 1HXIA 2C2LA 2Y4TA 5G04C 2I6HA 2XPIA 3Q15A 2YQ8A
chains in the Genus database with same CATH superfamily
3LY7A 3MEKA 1TNUA 3HIZA 3I4RB 3LEWA 2LXMA 4I1MA 3ML8A 1SVXA 2PM7A 2VQ2A 3CSFA 3ULEG 4H7XA 4U63A 2KBXA 3VLEA 1HE8A 5B3SE 3SD5A 4J8EA 2L6JA 2XENA 4HLEA 5G04J 3V30A 4GMLA 3E34A 3DWLG 2C0MA 5AQBA 4BX9A 4WWOA 3LKUA 1OWMA 1UN9A 4PUCA 1SA5A 1PY1A 1V55E 1N52A 3Q79A 3GYZA 4GPMA 3V79K 4KZCA 2CHWA 3APCA 2HM8A 4UQXA 3FHEA 4GCNA 3PZ2A 4DX7D 2H6IA 3C3QA 4LG6A 1X81A 3CVYA 1TR4A 4TV3A 3G2WA 3PDNA 3JQ0A 5ARFA 4CDRA 4I6GA 2QYJA 2R05A 3LVQE 1IQUA 2F0YA 4FHJA 3Q49B 3MKRA 4JPSA 3T8KA 4HFGA 4BWRA 4GAAA 3QKYA 4GZ5A 3NF1A 4YVOA 5AYWD 1K3ZD 5BT1A 4JD2G 4JB8P 2ETAA 5BV0A 4B8CB 2YINA 4KZ0A 1FPPA 3T5XA 5FZRA 4GU5A 4K03A 4F53A 4F3VA 5KJNA 1E90A 1SW6A 3CR3A 3IXEA 4KXKB 3EHQA 3R7RA 2L0TB 3MV2B 3AS5A 4PDXA 3FH7A 3B95A 1H2TC 5FQ8A 3V2OA 1K1AA 3SBSA 1N54A 4N3CA 4FHKA 5CEAA 4HOSA 4JEHA 1S70B 4XX5A 2IF4A 4A1GA 2EILE 3FP3A 2PQNA 4UQYA 3ZYMA 4AP2A 5CEDB 2HE0A 2L9BA 1D8EA 3AS8A 3KSQA 3SHFA 3S7DA 3QC1A 5JMND 4GZCA 4I6EA 2FO1E 5C2YA 4GPKA 1H2VC 1L5JA 3D3MA 4GTMA 1OWLA 3ULQA 3G2SA 2VTBB 4TUMA 1HZ4A 4GTSA 4GZ3A 2PQRA 2AVPA 5BV1A 3UKRG 3FUEA 5CBNA 5ENTD 3G2VA 3P1UA 2M63A 2DCPA 3E33A 2I1KA 2X3MA 3SF4A 2DYRE 2LSVA 4MLPA 2R02A 4UWFA 5CECB 4EZLA 5EX3A 3RKVA 3LPZA 3S7JA 4OVVA 2H6HA 2WPVA 4B89A 1JCQA 3CVNA 4BETA 3EHMA 3SI5A 4N3BA 3FY4A 3QAQA 2H6FA 4KVOA 4L2LA 3S7FA 2P9PG 1IKND 2R59A 3TAXA 5EIBE 3QARA 3FTVA 3ZKJA 1E8XA 4ILHB 1E96B 5CBOA 4DUIA 1FT2A 3C3RA 3FTWA 4M3OA 2DVWA 3UIOC 5FQ6A 3NOCD 4I17A 2LO6A 4ANUA 1WDYA 4G23A 2GRMA 3FUHA 5CRUA 4ANWA 3FUKA 2KC7A 3IBEA 1OXJA 3LJNA 2X6KA 2XRZA 3DSVA 4ILGA 4URKA 1ZB1A 4AOFA 2P9NG 1MX6A 1E7VA 4ZFHA 3TL5A 2P58C 3DXMG 3D9JA 3LJ3A 4UWGA 1QYMA 1LF8A 3TWVA 4UI9C 5CERB 4JZYA 2ETBA 2P9IG 3D9IA 2XCCA 3HVEB 5ENRD 4DX2A 2Y4TA 4A55A 1NL4A 2XPZA 4U8YD 3ZUVB 3J5QB 5KJKA 3J5PA 3V31A 3FTXA 4TXQA 3ASFA 2PNNA 2IO3C 3GW4A 4ANVA 4L2YA 1TJFA 1SQMA 4AV7A 3JUIA 2I1JA 3ZHEB 2XZTG 2DBAA 3HG0D 4HI9A 5KJMA 4CEMA 4NACA 3I5PA 2VSOE 1EF1C 2IY0C 2OEVA 2EIJE 4YDEA 3CKBA 2MHKA 4GTRA 2B6CA 2WB2A 1TYQG 1XNFA 1G3NB 5AAOA 1OCOE 2IU1A 2KM4A 3GZSA 4BTAA 4XKCA 4FC8A 3UUXA 2FO7A 4FULA 2Y69E 4HVBA 2F37A 5ENSD 4GMJA 3QDNA 4GTOA 2XEHA 2AW6A 5KCMA 3FULA 2V5FA 2Y3AA 2XGMA 1N11A 4RVBA 2EIKE 1N9AA 2V8SE 2DZOA 3NZSA 3ZVVA 3Q4AB 3Q7AA 5AJLA 5EILA 2ETCA 1OWNA 5JJ7A 2YQ8A 4FA6A 2GGFA 2X6JA 1TN6A 4HS2A 4H7YA 4G26A 2IQCA 3PUJA 4W9RA 4HRNA 3F6QA 3HRAA 1P5QA 4ACLA 2AXUA 1LD8A 2XHEA 3LDZA 3PS6A 4JW1A 3HDXA 2UY1B 5BPPA 1GW6A 4CT4A 3NOGD 3TG5A 3MYVA 3AS4A 2UWJG 1BI7B 1TJCA 3ABKE 3L6AA 4EQFA 1RZ4A 2BUGA 3PE4A 4QQIA 1H2UA 4G8LA 2CFUA 3JXJA 4MS6A 4JHRA 5CCMA 2FEZA 4I2ZA 1JPLA 3PNLB 3IHVA 4Y6WA 4EZJA 1FVFA 4HBDA 4BERA 3S2AA 5AIJA 3I4GA 4C0EA 2HR2A 2WXLA 4AY5A 1D9SA 1RW2A 5HRYA 4N5QA 3EUVA 3HYMB 3FTSA 3PZ1A 4N5CA 4PS3A 2OEWA 1E8YA 4MBGA 3RRMB 1YMPA 3UXGA 3PEVB 4ILIA 2VGXA 3NAWA 4HOTA 3C72A 4N3AA 2IFUA 5EYPF 3RO3A 1BD8A 2JABA 3UINC 3ABME 4IYPA 3TXNA 3CHOA 3ZGQA 1N0RA 5JHBA 3EIJA 4CDNA 4DJAA 2LXLA 3CIAA 4AVXA 2WXFA 3ONLA 5A23A 3SY2A 3B7TA 5BXOA 3APFA 2F8YA 5AENA 4UI9J 4P29A 3CK9A 4FU3A 1TNZA 5JA4D 4LSZE 5D2MC 1FVHA 4IULA 1SZAA 3DPYA 5LCWJ 2DIWA 2VSYA 3KEAA 3URZA 4IN3B 1ELKA 4NQ0A 3P2BA 4OYSA 4F6RD 3T8MA 2E0IA 3CK7A 4I43A 2C0LA 2OVFA 1DCEA 1OWPA 2GRNB 3AG2E 4EBAA 3U66A 1O1SA 4FP7A 1TNYA 1UN8A 3EHRA 4LNGA 2XRYA 3VTXA 4PH4B 5D0QD 1E8WA 2AXVA 1QZ2A 3PRZA 4OAUC 3FUIA 3HXFA 1EYHA 3JXIA 3U64A 4GTPA 3ZPJA 4HB5A 5T3RA 2LUHA 2GW1A 3FUMA 4BEPA 5JHAA 5ARGA 1UJJA 2CHXA 2FI7A 5B1AE 2VSNA 2R5SA 3PZ3A 2LAHA 4F1SA 1LD7A 1OCZE 3FU0A 1JWFA 2KXPC 3ZYQA 3Q78A 1SA4A 3CVPA 2UY1A 3VLDA 3CVVA 5DBKA 2YHEA 1EPUA 3W9FA 3KEZA 4BX8A 4GMRA 1N0QA 2LNIA 3L08A 2BEDA 4GCOA 2XZDG 2X6FA 3ZFWA 4WWNA 2WXJA 3IV0A 3OTNA 1BI8B 5G2NA 3ZYKA 4O60A 3ZIMA 5M72A 3TGOA 3L13A 2WXHA 3U3WA 3LCAA 3MZLB 3CSTA 2VGEA 3CK8A 2GRRB 5ANRA 5G05C 3CHPA 2WMNA 1N4PA 4ABNA 3L82A 2I2OA 2WXPA 2IO2C 3OXFA 5AJDA 4AJWA 4B94A 2PZIA 1WY6A 3UX4A 3CKCA 3AG3E 3E4BA 2HO1A 5ITZF 2XEVA 3LS8A 1HS6A 3C3OA 4JL0A 2EINE 5FWQA 3SQVA 3SO8A 2RD0A 4OAVB 4UWHA 4N2QA 1UW4B 1X5BA 1FCHA 3FUFA 4YDOA 3ZEFA 2J8SD 3BG1B 3PH0C 5HI7A 3NB2A 3R7QA 1XGWA 4F7AA 3TWWA 2GRPB 2XEEA 3FH5A 4LUNU 3EDTB 3SNXA 2EIME 4DRXE 4JHKA 4K5BA 2BTDA 5D66A 4DPRA 1TNOA 3PNTB 3NQPA 2L0IA 3TWUA 4AM9A 4EPZA 4GA1A 3QWPA 4CCAA 4WWPA 4DX6D 4KBQA 4U8HA 3UM0A 5KBAA 3ZN3A 4U7EB 3ZHEA 3ZRHA 5CMWA 1KT1A 1OY3D 3UT8A 2FULA 5ENOD 4JEUA 3CQGB 1HG2A 2J4BA 3L16A 5EX0A 5ANLA 2WQ7A 3CV0A 2XPYA 1KZPA 2RFMA 2JEKA 4J7WA 2VGXB 4U0SA 3D9NA 2L6BA 5FJYA 2OCCE 4GYYA 2KCVA 1NP7A 2CG2A 1H6OA 5FINA 4DK5A 2P9KG 1V54E 3B7RL 3LXUX 4L1BA 4QFVA 3QJZA 5E76A 3D9MA 1MJ0A 5BNWA 2JLBA 2I9CA 4AEZC 5LFAA 4PS7A 3ZXPA 4WUYA 5AQAA 5EYLA 1TEZA 4U8VD 2X38A 4B0ZA 1NA3A 5FIOA 3Q75A 5A7DB 5KNGA 3BG0B 2ONDA 2XS8A 2NXPA 3ULYA 4G24A 3WXXA 1IHBA 2KCKA 4J8SA 1PAQA 2DYSE 5ENNA 3VTYA 5JJ6A 2WQ6A 3DSSA 4LNUD 3W9GA 3FTYA 4TUUA 4A3TA 1DVPA 1NZNA 3TXMA 4LRZA 3L17A 4XIFA 5FTPA 2VGYA 3R9AB 5LCWC 3D9HA 4RLYA 3TWXA 4APOA 4A63B 4L7TA 4Q69A 4C48B 1WAO1 1HG5A 4UWLA 1OCRE 4EBAG 1MX4A 2QFCA 1O1TA 3HHMA 4DLQA 2IEJA 3UMVA 3PVLA 3QK0A 3MKQA 4G1TA 2FBNA 5LOZA 4U95D 4U07A 2H6GA 3L9TA 3AJIA 5EN5D 4CZ2D 3SZ7A 4Q94A 3RIBA 3MGBA 2WXGA 3FU6A 1ELWA 4UWKA 3ISMC 1MZCA 4DX1A 3RJVA 4EECA 5CCLA 4ME2A 4HRMB 4PS8A 4CDMA 3MKQB 3SGHA 2P9SG 2VYIA 1NA0A 2J07A 3FTUA 2A4ZA 5HKPA 3U4TA 2MYOA 4JHJA 3FEXA 2XGOA 3Q9NC 3C5RA 4KVMA 3ZXSA 3FUNA 3CGHA 3UM2A 4V3IA 3ASGA 2ZISA 3SFZA 4BESA 4BT9A 1S0PA 2ZU6B 3HXDA 5KWDA 4LCTA 3MCXA 1BU9A 2A5EA 1O1RA 2XGSA 4YDWA 4G2VA 3ASHA 4J6IA 1H6KA 1VDYA 5JJTA 3BQOA 3RRUA 2BKKB 4I1OB 3D9KA 4WAFA 1E8ZA 2PM6A 4IRUA 2J09A 3UI2A 1HH8A 3QWWA 3CVXA 3BUAA 2WVIA 4ACKA 3T5VA 4DI3A 4A1SA 1S63A 1KLXA 3E37A 3DSUA 5KNHD 5G55A 4CGVA 3V2XA 4BY6A 2J9QA 1N4SA 2GROB 4RG9A 5EKQD 5FQ4A 1O5MA 3HXCA 1HO8A 4BSZB 3JUEA 3DXKG 4RG6A 3DSTA 3QWVA 4FJZA 3IEGA 1JWGA 4RQIA 4J8DA 1K1BA 1WG0A 3AAAC 1ZU2A 3N71A 4HRLA 1E7UA 1Z3YA 3FUDA 1IQRA 4YNDA 2CG3A 3DRAA 5DIZA 5CHEE 2VSXE 4GTVA 4GB9A 4UQZA 1TN7A 2VJ8A 1INZA 4LNBA 4XZ4A 2P9UG 1OWOA 2J49A 4KT6B 3CVUA 4ZHBA 3EU9A 1AP7A 3MA5A 3TG4A 1Z5SC 2RKKA 2V4LA 3UQ3A 3UPVA 1MX2A 1OCCE 2F8XK 4O1PA 4R7LA 5CRVA 3CHMA 5EIDA 1BPOA 4G11A 2WXNA 5BXUA 1U3CA 2WXKA 2MOWA 4OVUA 3B7BA 2ILRA 2XQ0A 1UG3A 4HQDA 4Q96A 4JA9A 3S7BA 4CT0A 2NSZA 3B7SA 3D9PA 4N2SA 4L9PA 3LYAA 1HFAA 4D10C 2NYJA 3PZDA 4FJYA 4B8AA 3E32A 4RSYA 3WG7E 3TWQA 5AQ9A 5AARA 2MRIA 5A6CA 3DBSA 4GA0A 5LX8A 2KCLA 3ENEA 4HNAD 1OUVA 2RFAA 4FLBA 5ENQD 3RK6A 4E85A 1YCSB 1A17A 4C0MA 2BKGA 4HOUA 3G2TA 4BT8A 4HOQA 1ZBPA 3FDHA 2AXZA 3K9IA 4Z68A 1BLXB 3L54A 3EIQC 1UJKA 5CMYA 2WQHA 3KS2A 2IONA 2WM9A 4EHMA 4I1AA 5BUZA 2E2EA 3UKUG 4TRQA 2WXRA 4GZ6A 5EDSA 3R9MA 1U2VG 3O48A 1MHQA 3EHNA 3CHQA 3RSEG 2I6HA 3BU8A 4B93B 2GRLA 2AJAA 4UI9K 3MX3A 2WXOA 3G2UA 1IXVA 4JVSA 2CHZA 1SZ9A 5E75A 4CYMD 3SFXA 1HX8A 4WNDA 3Q9UC 3D9OA 3DEOA 2R03A 3FEYA 5FQ7A 3EU5A 3ABLE 3ML9A 3MJWA 4UUCA 3JYSA 1TNBA 4BFRA 3CEQA 4L23A 4KYOB 3ZW3A 2ZIRA 4GYWA 1QNFA 3HVEA 2AWIA 3AU5A 2WXQA 4NRHB 2YHCA 3DSWA 5AN8A 3ZU7B 1Z6TA 1KPSB 3OXGA 2VTBA 4JC8A 3PUKA 5BW8C 1JCSA 4MRUA 3FU5A 1N4RA 2PL2A 3ZYLA 1MQSA 3CQCB 4C9BB 3FTZA 1HF8A 3OXLA 4NIKA 4XI0A 1YYHA 1N94A 3QNKA 4XKBA 1KT0A 3GZ2A 1D8DA 1DC2A 2XCBA 4I6JA 5HQ8A 3TWTA 4FLHA 2BF0X 4GTTA 3T9KA 5KJLA 4M7CA 3DSXA 3HXEA 1MYOA 4AY6A 3EJNA 2KZTB 3GZ1A 5C1DA 1A5EA 1NI1A 3FU3A 4YVQC 2HYZA 3FH8A 3RRNB 4KMOA 3Q73A 4JXTA 1QQEA 1DCQA 3MV3B 4XI9A 3TWSA 3CHSA 1S64A 2X6IA 2R17C 3KD7A 2OV8A 3E30A 5IY5E 2ZGDA 4TXPA 4NURA 3FFLA 4GA2A 5LP0A 2R2LA 3IKOB 3AG1E 1EDUA 3PZ4A 4ANXA 2IOLA 3UT4A 1UOHA 3UM1A 3AU4A 3PREA 1Y8MA 3SFYA 3ESKA 2WXIA 3HXBA 4I2WA 1FT1A 4EZKA 4J8YA 2GRQB 3L22A 5G05J 4J8FA 4XE0A 2IJGX 3ASOE 4I9CA 2NC9A 1U3DA 4LEUA 2KZTA 4HLLA 4J0UA 1H19A 2V0PA 1KZOA 1IYGA 5FT9A 3LY8A 4WNFA 1DNPA 3FUJA 2QZAA 5G04C 5J90A 4MKTA 2EQXA 3BEEA 2IOSA 4G25A 3CVWA 2CFZA 3ASDA 5HS0A 4HORA 1OT8A 1Y6IA 4O6FA 2P9LG 3I3NA 4A3VA 1B89A 3X2QE 4ATZD 2V5QC 2YNQA 1K8KG 4K5AB 3CLJA 1LTXA 4ATGA 1Q2ZA 3VLFA 1N4QA 4N39A 3PEUB 1IHGA 3DPDA 3ONKA 2XS1A 2ZXWE 3TJPA 1WM5A 3JQ1A 4I9EA 3Q5MA 4BTBA 1H0AA 3CVQA 3TWRA 1N95A 5T4YA 4F1PA 4BSXA 4CRWA 2Y1LE 3RU0A 3JCKC 4GYOA 3PE3A 4U04A 4K5CA 2FF4A 4E6HA 4LERA 3NBNB 4AXHA 1Z3XA 3OAWA 4X8QA 4DLOA 4JA7A 2DWZA 3U9WA 5FZQA 3AG4E 4XEIG 3SBTB 3B7UX 2OOEA 1HU3A 4HXIA 3IHYA 3KAEA 4U96D 3Q15A 2DZNA 3UT7A 4O1OA 1QBQA 4DX5D 2Y0BG 5ENPD 3NZUA 2LSUA 3KSLA 5H7PA 2WMOA 4HI8A 4YDYA 5D0OD 3UM3A 4WNGA 5T8IA 2X6HA 2V4HC 2Y4UA 2KATA 2J4DA 4TXRA 2B0OE 3UTMA 2P2CP 3ESLA 1ELRA 3Q7FA 1H6PA 2RG8A 3Q47B 3ASNE 3LVRE 2WXMA 3QB2A 4U0ZA 1TN8A 2Q7FA 2QYUA 3C98A 3LY9A 3ZNGA 4K0RA 4AIFA 2QC9A 3UIPC 1JCRA 2ZGGA 4WNEA 5J08A 1JUQA 2J08A 4GTQA 1AWCB 3CHRA 3DEPA 4U0UA 3D9LA 3RO2A 1YA0A 2LAIA 4FADA 1NFIE 2A5UA 3CVLA 2OVBA 1W3BA 5AQ7A 1PC2A 3B13A 4Y6CA 3RAUA 4APFA 4G8KA 5FZSA 3O4ZA 2QY7A 3APDA 5B1BE 3FWVA 3QOUA 4GZDA 4DI4A 4CGWA 1HXIA 2C2LA 2XPIA
chains in the Genus database with same CATH topology
3LY7A 2VGXB 4U0SA 3D9NA 3MEKA 4FA6A 5FJYA 2GGFA 2GRLA 3I4RB 2X6JA 3HIZA 2KCVA 1NP7A 2CG2A 3LEWA 4GYYA 4HS2A 4UI9K 4I1MA 4H7YA 3MX3A 4G26A 2WXOA 3G2UA 4DK5A 3ML8A 4JVSA 2CHZA 2IQCA 1SZ9A 2PM7A 5E75A 2VQ2A 3B7RL 3CSFA 3LXUX 4L1BA 3QJZA 4QFVA 1HX8A 3PUJA 5E76A 4H7XA 4U63A 4W9RA 4WNDA 3D9MA 3D9OA 5BNWA 2JLBA 1P5QA 3FEYA 2I9CA 4AEZC 5FQ7A 4ACLA 2AXUA 3VLEA 1HE8A 3SD5A 4J8EA 2L6JA 5LFAA 4PS7A 2XHEA 3LDZA 3PS6A 4JW1A 3ML9A 4WUYA 4HLEA 3MJWA 3HDXA 3JYSA 2UY1B 5BPPA 5G04J 1GW6A 4BFRA 4GMLA 4CT4A 3CEQA 3TG5A 4L23A 4KYOB 3ZW3A 2C0MA 3MYVA 3AS4A 1TEZA 2UWJG 4GYWA 1TJCA 1QNFA 4BX9A 3HVEA 2AWIA 3AU5A 2WXQA 2X38A 4WWOA 4NRHB 3L6AA 4EQFA 2YHCA 3LKUA 1OWMA 4B0ZA 2BUGA 1NA3A 1Z6TA 1UN9A 4PUCA 1PY1A 3PE4A 5A7DB 1N52A 1H2UA 3GYZA 3OXGA 2VTBA 3BG0B 4JC8A 3PUKA 2ONDA 2NXPA 2CFUA 4KZCA 5BW8C 4G24A 4MRUA 2CHWA 4MS6A 3WXXA 3APCA 2HM8A 3FU5A 4UQXA 2KCKA 4JHRA 4C0EA 2PL2A 4J8SA 1PAQA 3FHEA 4GCNA 3ZYLA 1MQSA 3CQCB 4C9BB 3FTZA 5CCMA 1HF8A 3OXLA 5ENNA 3VTYA 5JJ6A 2FEZA 4XI0A 4I2ZA 2WQ6A 3FTYA 3CVYA 1JPLA 4TUUA 4TV3A 3G2WA 4A3TA 1DVPA 3JQ0A 3PDNA 3IHVA 3PNLB 3QNKA 4XKBA 4Y6WA 5ARFA 1FVFA 4EZJA 1NZNA 1KT0A 3GZ2A 4CDRA 3TXMA 3S2AA 4I6GA 2XCBA 5AIJA 4LRZA 3I4GA 3L17A 4I6JA 4XIFA 2VGYA 3LVQE 5FTPA 2HR2A 1IQUA 2WXLA 3R9AB 4AY5A 5HQ8A 5LCWC 4FLHA 4FHJA 2BF0X 3Q49B 5KJLA 3HYMB 3FTSA 4APOA 4N5CA 3MKRA 4L7TA 4PS3A 4AY6A 4Q69A 3EJNA 2KZTB 1WAO1 3GZ1A 1E8YA 5C1DA 1HG5A 4UWLA 4JPSA 3RRMB 4EBAG 3FU3A 2QFCA 2HYZA 4YVQC 3FH8A 3RRNB 3PEVB 4HFGA 3HHMA 4BWRA 4GAAA 4KMOA 3QKYA 4GZ5A 4ILIA 3NF1A 3UMVA 4YVOA 4JXTA 3PVLA 5AYWD 2VGXA 4DLQA 3QK0A 3MKQA 1QQEA 5BT1A 3MV3B 4XI9A 4G1TA 2FBNA 4HOTA 5LOZA 4N3AA 2IFUA 3RO3A 5BV0A 4B8CB 2YINA 3CHSA 4KZ0A 4IYPA 3T5XA 2X6IA 3TXNA 5FZRA 2R17C 3KD7A 3CHOA 4GU5A 4U07A 3ZGQA 4K03A 2OV8A 5JHBA 3EIJA 3SZ7A 4F3VA 4F53A 5KJNA 1E90A 4NURA 3FFLA 4CDNA 4Q94A 3CR3A 3RIBA 3MGBA 4GA2A 4DJAA 4KXKB 3CIAA 3R7RA 2WXGA 3FU6A 2L0TB 2WXFA 3MV2B 4AVXA 1ELWA 3AS5A 3ONLA 4PDXA 4UWKA 5A23A 3FH7A 5LP0A 1H2TC 3B7TA 3APFA 5FQ8A 3IKOB 3RJVA 4EECA 4UI9J 5AENA 4P29A 1EDUA 3CK9A 4ANXA 3SBSA 2IOLA 5CCLA 4ME2A 4FU3A 1N54A 3UT4A 4N3CA 1FVHA 4FHKA 4IULA 4HOSA 4PS8A 4CDMA 1SZAA 3AU4A 3MKQB 3SGHA 5LCWJ 2VYIA 4JEHA 2DIWA 2VSYA 4XX5A 1NA0A 2IF4A 3PREA 1ELKA 4IN3B 1Y8MA 3P2BA 4NQ0A 4OYSA 3URZA 2J07A 4A1GA 3T8MA 3FTUA 3ESKA 2A4ZA 2E0IA 3CK7A 3FP3A 2PQNA 4I43A 4UQYA 2WXIA 2C0LA 2OVFA 4I2WA 1OWPA 3ZYMA 4AP2A 3U4TA 4EZKA 2L9BA 4JHJA 4EBAA 3U66A 3AS8A 3L22A 3SHFA 3FEXA 3S7DA 3QC1A 2XGOA 4FP7A 4J8FA 4XE0A 5G05J 1UN8A 4GZCA 2XRYA 4I6EA 5C2YA 2IJGX 4GPKA 1H2VC 3VTXA 1L5JA 3D3MA 4KVMA 3ZXSA 4PH4B 3FUNA 5D0QD 3CGHA 4I9CA 4V3IA 1OWLA 2NC9A 3ASGA 1E8WA 1U3DA 4LEUA 2KZTA 3SFZA 3ULQA 3G2SA 2VTBB 4BT9A 2AXVA 1QZ2A 3PRZA 1S0PA 1HZ4A 2ZU6B 3FUIA 4J0UA 4GZ3A 1H19A 2PQRA 2AVPA 5BV1A 1EYHA 3FUEA 2V0PA 1IYGA 5FT9A 3LY8A 4LCTA 3U64A 3ZPJA 3MCXA 4WNFA 3G2VA 3P1UA 2M63A 5T3RA 2DCPA 1DNPA 2I1KA 3FUJA 2XGSA 2X3MA 3SF4A 2LSVA 4G2VA 4MLPA 2GW1A 3FUMA 4UWFA 3ASHA 5G04C 4J6IA 5J90A 4MKTA 5JHAA 5ARGA 2EQXA 1UJJA 1H6KA 2CHXA 3BEEA 2IOSA 1VDYA 4G25A 5EX3A 3RKVA 2FI7A 3LPZA 5JJTA 3CVWA 2CFZA 3RRUA 3ASDA 4I1OB 3D9KA 4HORA 2VSNA 4WAFA 2R5SA 1E8ZA 1Y6IA 2PM6A 4IRUA 3S7JA 2LAHA 5JJ7A 4F1SA 2J09A 1HH8A 3QWWA 3CVXA 2WVIA 4ACKA 4O6FA 3T5VA 3I3NA 4OVVA 3FU0A 4DI3A 4A1SA 1JWFA 2WPVA 1KLXA 3ZYQA 4B89A 4A3VA 3RU0A 3CVPA 3CVNA 2UY1A 1B89A 3VLDA 3EHMA 5G55A 4CGVA 3CVVA 5DBKA 3SI5A 2YHEA 4BY6A 2J9QA 4N3BA 2YNQA 3FY4A 4RG9A 1EPUA 5EKQD 3QAQA 5FQ4A 3KEZA 4BX8A 3CLJA 1HO8A 4ATGA 4KVOA 3VLFA 4L2LA 4RG6A 3QWVA 4N39A 4FJZA 3PEUB 3IEGA 3S7FA 1IHGA 3DPDA 3ONKA 1JWGA 2LNIA 2R59A 3TAXA 3L08A 3QARA 3TJPA 1WM5A 4J8DA 3FTVA 4GCOA 3JQ1A 4I9EA 1E8XA 3Q5MA 3ZFWA 2X6FA 4ILHB 1E96B 4BTBA 1H0AA 3CVQA 1ZU2A 3FTWA 3N71A 4WWNA 5T4YA 4M3OA 2WXJA 3IV0A 3OTNA 5FQ6A 5G2NA 4BSXA 1E7UA 1Z3YA 4I17A 3ZYKA 3FUDA 4CRWA 3ZIMA 5M72A 3TGOA 3L13A 2WXHA 3U3WA 3JCKC 4GYOA 2LO6A 1IQRA 3LCAA 3CSTA 3MZLB 2CG3A 3PE3A 4U04A 4YNDA 5DIZA 4ANUA 4G23A 2GRMA 3FUHA 3CK8A 5CHEE 2VSXE 4ANWA 3FUKA 5ANRA 5G05C 4GB9A 3CHPA 4UQZA 2FF4A 2KC7A 2WMNA 3IBEA 2VJ8A 4E6HA 4LERA 4ABNA 1INZA 4XZ4A 1OWOA 2X6KA 2XRZA 2J49A 4AXHA 1Z3XA 2I2OA 3OAWA 2WXPA 4ILGA 4KT6B 4URKA 3CVUA 3OXFA 4AOFA 5AJDA 4AJWA 4DLOA 4B94A 1E7VA 2PZIA 1WY6A 3MA5A 4JA7A 3TG4A 3TL5A 3U9WA 5FZQA 2P58C 3D9JA 2V4LA 3UX4A 3CKCA 3LJ3A 4UWGA 3B7UX 3SBTB 3E4BA 2OOEA 2HO1A 3UQ3A 3UPVA 1HU3A 1LF8A 4HXIA 2XEVA 3LS8A 4UI9C 4R7LA 1HS6A 3CHMA 4JZYA 3D9IA 3IHYA 2XCCA 3KAEA 4JL0A 3HVEB 1BPOA 5FWQA 2Y4TA 4G11A 2WXNA 2RD0A 4A55A 3Q15A 2XPZA 1U3CA 3UT7A 2WXKA 2MOWA 4OVUA 4UWHA 2ILRA 4N2QA 1UW4B 1X5BA 2XQ0A 1FCHA 1UG3A 3FUFA 4Q96A 4JA9A 3S7BA 3ZEFA 3NZUA 3BG1B 2LSUA 2NSZA 3B7SA 4CT0A 5KJKA 3D9PA 2WMOA 4EZLA 4N2SA 3FTXA 3PH0C 5D0OD 3LYAA 1HFAA 4D10C 5HI7A 3ASFA 3PZDA 4FJYA 4B8AA 3GW4A 4ANVA 4WNGA 3R7QA 4L2YA 1XGWA 5T8IA 2X6HA 4F7AA 1TJFA 2Y4UA 1SQMA 4RSYA 4AV7A 3FH5A 2KATA 2J4DA 3JUIA 2I1JA 4LUNU 2MRIA 3ZHEB 5A6CA 3DBSA 3EDTB 4GA0A 5LX8A 3ESLA 2KCLA 3ENEA 2DBAA 3SNXA 1OUVA 1ELRA 5KJMA 4FLBA 4CEMA 2RG8A 4JHKA 3Q47B 4NACA 3RK6A 3I5PA 2VSOE 3LVRE 1EF1C 2WXMA 3QB2A 2BTDA 4E85A 4DPRA 4U0ZA 1A17A 4C0MA 2Q7FA 3PNTB 4HOUA 3G2TA 4BT8A 3CKBA 4HOQA 3NQPA 2MHKA 2L0IA 3C98A 3LY9A 4K0RA 4AIFA 1ZBPA 3FDHA 2WB2A 1XNFA 4WNEA 4AM9A 4EPZA 5J08A 4GA1A 1JUQA 2J08A 2AXZA 3K9IA 2IU1A 2KM4A 3QWPA 3CHRA 3GZSA 4U0UA 4BTAA 3D9LA 4XKCA 3RO2A 4WWPA 4CCAA 1YA0A 2LAIA 4FC8A 3UUXA 2FO7A 4FADA 4KBQA 3L54A 3EIQC 4FULA 2A5UA 4HVBA 3CVLA 2OVBA 1W3BA 4U8HA 4GMJA 3QDNA 1UJKA 5CMYA 2WQHA 1PC2A 3B13A 4Y6CA 4APFA 2AW6A 5KCMA 3ZN3A 3KS2A 2IONA 2WM9A 3FULA 4I1AA 5FZSA 2V5FA 3ZHEA 2E2EA 5BUZA 2Y3AA 2XGMA 3O4ZA 3ZRHA 5CMWA 1KT1A 3UT8A 4RVBA 2FULA 4JEUA 3CQGB 4TRQA 2WXRA 2QY7A 1HG2A 3APDA 4GZ6A 5EDSA 2J4BA 2V8SE 3FWVA 3L16A 3NZSA 3QOUA 4GZDA 5EX0A 3ZVVA 3Q4AB 4DI4A 5AJLA 3O48A 5ANLA 2WQ7A 1MHQA 3CV0A 3EHNA 4CGWA 2XPYA 3CHQA 1HXIA 2C2LA 1OWNA 2I6HA 2JEKA 2XPIA 2YQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZ5 A;  3LY7 A;  2VGX B;  4U0S A;  3NF1 A;  5ARG A;  4YVO A;  5AYW D;  2VGX A;  3BEE A;  3MEK A;  4G25 A;  5EX3 A;  1QQE A;  5FJY A;  3MV3 B;  3RKV A;  4XI9 A;  5BT1 A;  2FI7 A;  3LPZ A;  2KCV A;  2FBN A;  4G1T A;  4GYY A;  4UI9 K;  5JJT A;  4N3A A;  4HOT A;  3ASD A;  2IFU A;  3RO3 A;  1FCH A;  4HOR A;  4H7Y A;  2VSN A;  4G26 A;  2R5S A;  5JJ7 A;  4JA9 A;  3S7B A;  3S7J A;  1HH8 A;  2LSU A;  3QWW A;  5FZR A;  3KD7 A;  4U07 A;  4O6F A;  5KJK A;  2VQ2 A;  3ZGQ A;  4N2S A;  5D0O D;  3LYA A;  5HI7 A;  4H7X A;  4W9R A;  3SZ7 A;  2WPV A;  1KLX A;  3ASF A;  4WND A;  4A1S A;  4F3V A;  5KJN A;  4BWR A;  3FFL A;  5BNW A;  3GW4 A;  2JLB A;  3CVP A;  3CVN A;  1P5Q A;  2UY1 A;  4WNG A;  3RIB A;  1B89 A;  4GA2 A;  4KXK B;  4CGV A;  4J8E A;  2L6J A;  5DBK A;  2Y4U A;  4BT9 A;  3MV2 B;  1ELW A;  2J9Q A;  2KAT A;  3AS5 A;  4N3B A;  4WUY A;  3JYS A;  4RG9 A;  2UY1 B;  5LCW C;  5EKQ D;  5G04 J;  4CGW A;  3ZHE B;  3CEQ A;  5A6C A;  3EDT B;  4GA0 A;  3TG5 A;  2KCL A;  4KYO B;  2DBA A;  2C0M A;  3RJV A;  3AS4 A;  4UI9 J;  1OUV A;  1ELR A;  2UWJ G;  4GYW A;  4RG6 A;  1TJC A;  3CK9 A;  3QWV A;  4N39 A;  3S7F A;  5KJM A;  3IEG A;  1IHG A;  5CCL A;  4ME2 A;  3Q47 B;  2LNI A;  4NRH B;  4EQF A;  2YHC A;  3TAX A;  3LKU A;  1WM5 A;  4N3C A;  2BUG A;  1NA3 A;  4GCO A;  4J8D A;  4I9E A;  4HOS A;  3Q5M A;  3ZFW A;  1E96 B;  3PE4 A;  5A7D B;  4BTB A;  3CVQ A;  1ZU2 A;  3GYZ A;  2VYI A;  3N71 A;  3OXG A;  4U0Z A;  5LCW J;  1A17 A;  2VSY A;  2Q7F A;  2OND A;  2IF4 A;  1NA0 A;  4HOU A;  4IN3 B;  1Y8M A;  4NQ0 A;  3CKB A;  4HOQ A;  3URZ A;  4BT8 A;  4I17 A;  2MHK A;  5BW8 C;  3ESK A;  3CK7 A;  3FP3 A;  3LY9 A;  3QKY A;  2PQN A;  4AIF A;  5M72 A;  1ZBP A;  3TGO A;  4G24 A;  4UQY A;  3U3W A;  2C0L A;  4GYO A;  3RU0 A;  3LCA A;  3PE3 A;  4I2W A;  1XNF A;  4WNE A;  4YND A;  4AM9 A;  4U04 A;  5DIZ A;  3WXX A;  4G23 A;  4GA1 A;  3U4T A;  4UQX A;  3CK8 A;  2KCK A;  4JHR A;  5CHE E;  2PL2 A;  3K9I A;  4GCN A;  3QWP A;  3AS8 A;  4U0U A;  5G05 C;  4BTA A;  4UQZ A;  3S7D A;  5CCM A;  2FF4 A;  2XGO A;  2KC7 A;  4J8F A;  3OXL A;  5G05 J;  3RO2 A;  1YA0 A;  3UUX A;  2FO7 A;  3VTY A;  4KBQ A;  5JJ6 A;  2FEZ A;  4XI0 A;  4I2Z A;  4ABN A;  4GPK A;  3ZHE A;  3VTX A;  3CVL A;  1W3B A;  3QDN A;  3PDN A;  2WQH A;  4Y6W A;  5ARF A;  1PC2 A;  5D0Q D;  1NZN A;  1KT0 A;  3GZ2 A;  4I9C A;  4Y6C A;  3ASG A;  2NC9 A;  3OXF A;  4CDR A;  2XCB A;  3ZN3 A;  4LEU A;  3KS2 A;  5FZS A;  4XIF A;  4I1A A;  3ULQ A;  2V5F A;  2VGY A;  2E2E A;  5FTP A;  2HR2 A;  1QZ2 A;  3R9A B;  2PZI A;  4B94 A;  1HZ4 A;  2XGM A;  4J0U A;  4AY5 A;  4GZ3 A;  3MA5 A;  1KT1 A;  3Q49 B;  2PQR A;  4JA7 A;  2AVP A;  5FZQ A;  3TG4 A;  2P58 C;  5KJL A;  3HYM B;  3CKC A;  1IYG A;  5FT9 A;  4APO A;  3E4B A;  4N5C A;  2OOE A;  2HO1 A;  3LY8 A;  4GZ6 A;  3UQ3 A;  3ZPJ A;  5HQ8 A;  4WNF A;  3MKR A;  3UPV A;  3FWV A;  4N2Q A;  2XEV A;  4AY6 A;  3QOU A;  3GZ1 A;  5EX0 A;  1WAO 1;  4UI9 C;  5C1D A;  3Q4A B;  2XGS A;  3O48 A;  3SF4 A;  2LSV A;  4G2V A;  2XCC A;  3CV0 A;  2GW1 A;  3KAE A;  4JL0 A;  2QFC A;  2HYZ A;  4YVQ C;  3ASH A;  1HXI A;  2C2L A;  2Y4T A;  5G04 C;  2I6H A;  2XPI A;  3Q15 A;  2YQ8 A; 
#chains in the Genus database with same CATH topology
 3LY7 A;  3MEK A;  1TNU A;  3HIZ A;  3I4R B;  3LEW A;  2LXM A;  4I1M A;  3ML8 A;  1SVX A;  2PM7 A;  2VQ2 A;  3CSF A;  3ULE G;  4H7X A;  4U63 A;  2KBX A;  3VLE A;  1HE8 A;  5B3S E;  3SD5 A;  4J8E A;  2L6J A;  2XEN A;  4HLE A;  5G04 J;  3V30 A;  4GML A;  3E34 A;  3DWL G;  2C0M A;  5AQB A;  4BX9 A;  4WWO A;  3LKU A;  1OWM A;  1UN9 A;  4PUC A;  1SA5 A;  1PY1 A;  1V55 E;  1N52 A;  3Q79 A;  3GYZ A;  4GPM A;  3V79 K;  4KZC A;  2CHW A;  3APC A;  2HM8 A;  4UQX A;  3FHE A;  4GCN A;  3PZ2 A;  4DX7 D;  2H6I A;  3C3Q A;  4LG6 A;  1X81 A;  3CVY A;  1TR4 A;  4TV3 A;  3G2W A;  3PDN A;  3JQ0 A;  5ARF A;  4CDR A;  4I6G A;  2QYJ A;  2R05 A;  3LVQ E;  1IQU A;  2F0Y A;  4FHJ A;  3Q49 B;  3MKR A;  4JPS A;  3T8K A;  4HFG A;  4BWR A;  4GAA A;  3QKY A;  4GZ5 A;  3NF1 A;  4YVO A;  5AYW D;  1K3Z D;  5BT1 A;  4JD2 G;  4JB8 P;  2ETA A;  5BV0 A;  4B8C B;  2YIN A;  4KZ0 A;  1FPP A;  3T5X A;  5FZR A;  4GU5 A;  4K03 A;  4F53 A;  4F3V A;  5KJN A;  1E90 A;  1SW6 A;  3CR3 A;  3IXE A;  4KXK B;  3EHQ A;  3R7R A;  2L0T B;  3MV2 B;  3AS5 A;  4PDX A;  3FH7 A;  3B95 A;  1H2T C;  5FQ8 A;  3V2O A;  1K1A A;  3SBS A;  1N54 A;  4N3C A;  4FHK A;  5CEA A;  4HOS A;  4JEH A;  1S70 B;  4XX5 A;  2IF4 A;  4A1G A;  2EIL E;  3FP3 A;  2PQN A;  4UQY A;  3ZYM A;  4AP2 A;  5CED B;  2HE0 A;  2L9B A;  1D8E A;  3AS8 A;  3KSQ A;  3SHF A;  3S7D A;  3QC1 A;  5JMN D;  4GZC A;  4I6E A;  2FO1 E;  5C2Y A;  4GPK A;  1H2V C;  1L5J A;  3D3M A;  4GTM A;  1OWL A;  3ULQ A;  3G2S A;  2VTB B;  4TUM A;  1HZ4 A;  4GTS A;  4GZ3 A;  2PQR A;  2AVP A;  5BV1 A;  3UKR G;  3FUE A;  5CBN A;  5ENT D;  3G2V A;  3P1U A;  2M63 A;  2DCP A;  3E33 A;  2I1K A;  2X3M A;  3SF4 A;  2DYR E;  2LSV A;  4MLP A;  2R02 A;  4UWF A;  5CEC B;  4EZL A;  5EX3 A;  3RKV A;  3LPZ A;  3S7J A;  4OVV A;  2H6H A;  2WPV A;  4B89 A;  1JCQ A;  3CVN A;  4BET A;  3EHM A;  3SI5 A;  4N3B A;  3FY4 A;  3QAQ A;  2H6F A;  4KVO A;  4L2L A;  3S7F A;  2P9P G;  1IKN D;  2R59 A;  3TAX A;  5EIB E;  3QAR A;  3FTV A;  3ZKJ A;  1E8X A;  4ILH B;  1E96 B;  5CBO A;  4DUI A;  1FT2 A;  3C3R A;  3FTW A;  4M3O A;  2DVW A;  3UIO C;  5FQ6 A;  3NOC D;  4I17 A;  2LO6 A;  4ANU A;  1WDY A;  4G23 A;  2GRM A;  3FUH A;  5CRU A;  4ANW A;  3FUK A;  2KC7 A;  3IBE A;  1OXJ A;  3LJN A;  2X6K A;  2XRZ A;  3DSV A;  4ILG A;  4URK A;  1ZB1 A;  4AOF A;  2P9N G;  1MX6 A;  1E7V A;  4ZFH A;  3TL5 A;  2P58 C;  3DXM G;  3D9J A;  3LJ3 A;  4UWG A;  1QYM A;  1LF8 A;  3TWV A;  4UI9 C;  5CER B;  4JZY A;  2ETB A;  2P9I G;  3D9I A;  2XCC A;  3HVE B;  5ENR D;  4DX2 A;  2Y4T A;  4A55 A;  1NL4 A;  2XPZ A;  4U8Y D;  3ZUV B;  3J5Q B;  5KJK A;  3J5P A;  3V31 A;  3FTX A;  4TXQ A;  3ASF A;  2PNN A;  2IO3 C;  3GW4 A;  4ANV A;  4L2Y A;  1TJF A;  1SQM A;  4AV7 A;  3JUI A;  2I1J A;  3ZHE B;  2XZT G;  2DBA A;  3HG0 D;  4HI9 A;  5KJM A;  4CEM A;  4NAC A;  3I5P A;  2VSO E;  1EF1 C;  2IY0 C;  2OEV A;  2EIJ E;  4YDE A;  3CKB A;  2MHK A;  4GTR A;  2B6C A;  2WB2 A;  1TYQ G;  1XNF A;  1G3N B;  5AAO A;  1OCO E;  2IU1 A;  2KM4 A;  3GZS A;  4BTA A;  4XKC A;  4FC8 A;  3UUX A;  2FO7 A;  4FUL A;  2Y69 E;  4HVB A;  2F37 A;  5ENS D;  4GMJ A;  3QDN A;  4GTO A;  2XEH A;  2AW6 A;  5KCM A;  3FUL A;  2V5F A;  2Y3A A;  2XGM A;  1N11 A;  4RVB A;  2EIK E;  1N9A A;  2V8S E;  2DZO A;  3NZS A;  3ZVV A;  3Q4A B;  3Q7A A;  5AJL A;  5EIL A;  2ETC A;  1OWN A;  5JJ7 A;  2YQ8 A;  4FA6 A;  2GGF A;  2X6J A;  1TN6 A;  4HS2 A;  4H7Y A;  4G26 A;  2IQC A;  3PUJ A;  4W9R A;  4HRN A;  3F6Q A;  3HRA A;  1P5Q A;  4ACL A;  2AXU A;  1LD8 A;  2XHE A;  3LDZ A;  3PS6 A;  4JW1 A;  3HDX A;  2UY1 B;  5BPP A;  1GW6 A;  4CT4 A;  3NOG D;  3TG5 A;  3MYV A;  3AS4 A;  2UWJ G;  1BI7 B;  1TJC A;  3ABK E;  3L6A A;  4EQF A;  1RZ4 A;  2BUG A;  3PE4 A;  4QQI A;  1H2U A;  4G8L A;  2CFU A;  3JXJ A;  4MS6 A;  4JHR A;  5CCM A;  2FEZ A;  4I2Z A;  1JPL A;  3PNL B;  3IHV A;  4Y6W A;  4EZJ A;  1FVF A;  4HBD A;  4BER A;  3S2A A;  5AIJ A;  3I4G A;  4C0E A;  2HR2 A;  2WXL A;  4AY5 A;  1D9S A;  1RW2 A;  5HRY A;  4N5Q A;  3EUV A;  3HYM B;  3FTS A;  3PZ1 A;  4N5C A;  4PS3 A;  2OEW A;  1E8Y A;  4MBG A;  3RRM B;  1YMP A;  3UXG A;  3PEV B;  4ILI A;  2VGX A;  3NAW A;  4HOT A;  3C72 A;  4N3A A;  2IFU A;  5EYP F;  3RO3 A;  1BD8 A;  2JAB A;  3UIN C;  3ABM E;  4IYP A;  3TXN A;  3CHO A;  3ZGQ A;  1N0R A;  5JHB A;  3EIJ A;  4CDN A;  4DJA A;  2LXL A;  3CIA A;  4AVX A;  2WXF A;  3ONL A;  5A23 A;  3SY2 A;  3B7T A;  5BXO A;  3APF A;  2F8Y A;  5AEN A;  4UI9 J;  4P29 A;  3CK9 A;  4FU3 A;  1TNZ A;  5JA4 D;  4LSZ E;  5D2M C;  1FVH A;  4IUL A;  1SZA A;  3DPY A;  5LCW J;  2DIW A;  2VSY A;  3KEA A;  3URZ A;  4IN3 B;  1ELK A;  4NQ0 A;  3P2B A;  4OYS A;  4F6R D;  3T8M A;  2E0I A;  3CK7 A;  4I43 A;  2C0L A;  2OVF A;  1DCE A;  1OWP A;  2GRN B;  3AG2 E;  4EBA A;  3U66 A;  1O1S A;  4FP7 A;  1TNY A;  1UN8 A;  3EHR A;  4LNG A;  2XRY A;  3VTX A;  4PH4 B;  5D0Q D;  1E8W A;  2AXV A;  1QZ2 A;  3PRZ A;  4OAU C;  3FUI A;  3HXF A;  1EYH A;  3JXI A;  3U64 A;  4GTP A;  3ZPJ A;  4HB5 A;  5T3R A;  2LUH A;  2GW1 A;  3FUM A;  4BEP A;  5JHA A;  5ARG A;  1UJJ A;  2CHX A;  2FI7 A;  5B1A E;  2VSN A;  2R5S A;  3PZ3 A;  2LAH A;  4F1S A;  1LD7 A;  1OCZ E;  3FU0 A;  1JWF A;  2KXP C;  3ZYQ A;  3Q78 A;  1SA4 A;  3CVP A;  2UY1 A;  3VLD A;  3CVV A;  5DBK A;  2YHE A;  1EPU A;  3W9F A;  3KEZ A;  4BX8 A;  4GMR A;  1N0Q A;  2LNI A;  3L08 A;  2BED A;  4GCO A;  2XZD G;  2X6F A;  3ZFW A;  4WWN A;  2WXJ A;  3IV0 A;  3OTN A;  1BI8 B;  5G2N A;  3ZYK A;  4O60 A;  3ZIM A;  5M72 A;  3TGO A;  3L13 A;  2WXH A;  3U3W A;  3LCA A;  3MZL B;  3CST A;  2VGE A;  3CK8 A;  2GRR B;  5ANR A;  5G05 C;  3CHP A;  2WMN A;  1N4P A;  4ABN A;  3L82 A;  2I2O A;  2WXP A;  2IO2 C;  3OXF A;  5AJD A;  4AJW A;  4B94 A;  2PZI A;  1WY6 A;  3UX4 A;  3CKC A;  3AG3 E;  3E4B A;  2HO1 A;  5ITZ F;  2XEV A;  3LS8 A;  1HS6 A;  3C3O A;  4JL0 A;  2EIN E;  5FWQ A;  3SQV A;  3SO8 A;  2RD0 A;  4OAV B;  4UWH A;  4N2Q A;  1UW4 B;  1X5B A;  1FCH A;  3FUF A;  4YDO A;  3ZEF A;  2J8S D;  3BG1 B;  3PH0 C;  5HI7 A;  3NB2 A;  3R7Q A;  1XGW A;  4F7A A;  3TWW A;  2GRP B;  2XEE A;  3FH5 A;  4LUN U;  3EDT B;  3SNX A;  2EIM E;  4DRX E;  4JHK A;  4K5B A;  2BTD A;  5D66 A;  4DPR A;  1TNO A;  3PNT B;  3NQP A;  2L0I A;  3TWU A;  4AM9 A;  4EPZ A;  4GA1 A;  3QWP A;  4CCA A;  4WWP A;  4DX6 D;  4KBQ A;  4U8H A;  3UM0 A;  5KBA A;  3ZN3 A;  4U7E B;  3ZHE A;  3ZRH A;  5CMW A;  1KT1 A;  1OY3 D;  3UT8 A;  2FUL A;  5ENO D;  4JEU A;  3CQG B;  1HG2 A;  2J4B A;  3L16 A;  5EX0 A;  5ANL A;  2WQ7 A;  3CV0 A;  2XPY A;  1KZP A;  2RFM A;  2JEK A;  4J7W A;  2VGX B;  4U0S A;  3D9N A;  2L6B A;  5FJY A;  2OCC E;  4GYY A;  2KCV A;  1NP7 A;  2CG2 A;  1H6O A;  5FIN A;  4DK5 A;  2P9K G;  1V54 E;  3B7R L;  3LXU X;  4L1B A;  4QFV A;  3QJZ A;  5E76 A;  3D9M A;  1MJ0 A;  5BNW A;  2JLB A;  2I9C A;  4AEZ C;  5LFA A;  4PS7 A;  3ZXP A;  4WUY A;  5AQA A;  5EYL A;  1TEZ A;  4U8V D;  2X38 A;  4B0Z A;  1NA3 A;  5FIO A;  3Q75 A;  5A7D B;  5KNG A;  3BG0 B;  2OND A;  2XS8 A;  2NXP A;  3ULY A;  4G24 A;  3WXX A;  1IHB A;  2KCK A;  4J8S A;  1PAQ A;  2DYS E;  5ENN A;  3VTY A;  5JJ6 A;  2WQ6 A;  3DSS A;  4LNU D;  3W9G A;  3FTY A;  4TUU A;  4A3T A;  1DVP A;  1NZN A;  3TXM A;  4LRZ A;  3L17 A;  4XIF A;  5FTP A;  2VGY A;  3R9A B;  5LCW C;  3D9H A;  4RLY A;  3TWX A;  4APO A;  4A63 B;  4L7T A;  4Q69 A;  4C48 B;  1WAO 1;  1HG5 A;  4UWL A;  1OCR E;  4EBA G;  1MX4 A;  2QFC A;  1O1T A;  3HHM A;  4DLQ A;  2IEJ A;  3UMV A;  3PVL A;  3QK0 A;  3MKQ A;  4G1T A;  2FBN A;  5LOZ A;  4U95 D;  4U07 A;  2H6G A;  3L9T A;  3AJI A;  5EN5 D;  4CZ2 D;  3SZ7 A;  4Q94 A;  3RIB A;  3MGB A;  2WXG A;  3FU6 A;  1ELW A;  4UWK A;  3ISM C;  1MZC A;  4DX1 A;  3RJV A;  4EEC A;  5CCL A;  4ME2 A;  4HRM B;  4PS8 A;  4CDM A;  3MKQ B;  3SGH A;  2P9S G;  2VYI A;  1NA0 A;  2J07 A;  3FTU A;  2A4Z A;  5HKP A;  3U4T A;  2MYO A;  4JHJ A;  3FEX A;  2XGO A;  3Q9N C;  3C5R A;  4KVM A;  3ZXS A;  3FUN A;  3CGH A;  3UM2 A;  4V3I A;  3ASG A;  2ZIS A;  3SFZ A;  4BES A;  4BT9 A;  1S0P A;  2ZU6 B;  3HXD A;  5KWD A;  4LCT A;  3MCX A;  1BU9 A;  2A5E A;  1O1R A;  2XGS A;  4YDW A;  4G2V A;  3ASH A;  4J6I A;  1H6K A;  1VDY A;  5JJT A;  3BQO A;  3RRU A;  2BKK B;  4I1O B;  3D9K A;  4WAF A;  1E8Z A;  2PM6 A;  4IRU A;  2J09 A;  3UI2 A;  1HH8 A;  3QWW A;  3CVX A;  3BUA A;  2WVI A;  4ACK A;  3T5V A;  4DI3 A;  4A1S A;  1S63 A;  1KLX A;  3E37 A;  3DSU A;  5KNH D;  5G55 A;  4CGV A;  3V2X A;  4BY6 A;  2J9Q A;  1N4S A;  2GRO B;  4RG9 A;  5EKQ D;  5FQ4 A;  1O5M A;  3HXC A;  1HO8 A;  4BSZ B;  3JUE A;  3DXK G;  4RG6 A;  3DST A;  3QWV A;  4FJZ A;  3IEG A;  1JWG A;  4RQI A;  4J8D A;  1K1B A;  1WG0 A;  3AAA C;  1ZU2 A;  3N71 A;  4HRL A;  1E7U A;  1Z3Y A;  3FUD A;  1IQR A;  4YND A;  2CG3 A;  3DRA A;  5DIZ A;  5CHE E;  2VSX E;  4GTV A;  4GB9 A;  4UQZ A;  1TN7 A;  2VJ8 A;  1INZ A;  4LNB A;  4XZ4 A;  2P9U G;  1OWO A;  2J49 A;  4KT6 B;  3CVU A;  4ZHB A;  3EU9 A;  1AP7 A;  3MA5 A;  3TG4 A;  1Z5S C;  2RKK A;  2V4L A;  3UQ3 A;  3UPV A;  1MX2 A;  1OCC E;  2F8X K;  4O1P A;  4R7L A;  5CRV A;  3CHM A;  5EID A;  1BPO A;  4G11 A;  2WXN A;  5BXU A;  1U3C A;  2WXK A;  2MOW A;  4OVU A;  3B7B A;  2ILR A;  2XQ0 A;  1UG3 A;  4HQD A;  4Q96 A;  4JA9 A;  3S7B A;  4CT0 A;  2NSZ A;  3B7S A;  3D9P A;  4N2S A;  4L9P A;  3LYA A;  1HFA A;  4D10 C;  2NYJ A;  3PZD A;  4FJY A;  4B8A A;  3E32 A;  4RSY A;  3WG7 E;  3TWQ A;  5AQ9 A;  5AAR A;  2MRI A;  5A6C A;  3DBS A;  4GA0 A;  5LX8 A;  2KCL A;  3ENE A;  4HNA D;  1OUV A;  2RFA A;  4FLB A;  5ENQ D;  3RK6 A;  4E85 A;  1YCS B;  1A17 A;  4C0M A;  2BKG A;  4HOU A;  3G2T A;  4BT8 A;  4HOQ A;  1ZBP A;  3FDH A;  2AXZ A;  3K9I A;  4Z68 A;  1BLX B;  3L54 A;  3EIQ C;  1UJK A;  5CMY A;  2WQH A;  3KS2 A;  2ION A;  2WM9 A;  4EHM A;  4I1A A;  5BUZ A;  2E2E A;  3UKU G;  4TRQ A;  2WXR A;  4GZ6 A;  5EDS A;  3R9M A;  1U2V G;  3O48 A;  1MHQ A;  3EHN A;  3CHQ A;  3RSE G;  2I6H A;  3BU8 A;  4B93 B;  2GRL A;  2AJA A;  4UI9 K;  3MX3 A;  2WXO A;  3G2U A;  1IXV A;  4JVS A;  2CHZ A;  1SZ9 A;  5E75 A;  4CYM D;  3SFX A;  1HX8 A;  4WND A;  3Q9U C;  3D9O A;  3DEO A;  2R03 A;  3FEY A;  5FQ7 A;  3EU5 A;  3ABL E;  3ML9 A;  3MJW A;  4UUC A;  3JYS A;  1TNB A;  4BFR A;  3CEQ A;  4L23 A;  4KYO B;  3ZW3 A;  2ZIR A;  4GYW A;  1QNF A;  3HVE A;  2AWI A;  3AU5 A;  2WXQ A;  4NRH B;  2YHC A;  3DSW A;  5AN8 A;  3ZU7 B;  1Z6T A;  1KPS B;  3OXG A;  2VTB A;  4JC8 A;  3PUK A;  5BW8 C;  1JCS A;  4MRU A;  3FU5 A;  1N4R A;  2PL2 A;  3ZYL A;  1MQS A;  3CQC B;  4C9B B;  3FTZ A;  1HF8 A;  3OXL A;  4NIK A;  4XI0 A;  1YYH A;  1N94 A;  3QNK A;  4XKB A;  1KT0 A;  3GZ2 A;  1D8D A;  1DC2 A;  2XCB A;  4I6J A;  5HQ8 A;  3TWT A;  4FLH A;  2BF0 X;  4GTT A;  3T9K A;  5KJL A;  4M7C A;  3DSX A;  3HXE A;  1MYO A;  4AY6 A;  3EJN A;  2KZT B;  3GZ1 A;  5C1D A;  1A5E A;  1NI1 A;  3FU3 A;  4YVQ C;  2HYZ A;  3FH8 A;  3RRN B;  4KMO A;  3Q73 A;  4JXT A;  1QQE A;  1DCQ A;  3MV3 B;  4XI9 A;  3TWS A;  3CHS A;  1S64 A;  2X6I A;  2R17 C;  3KD7 A;  2OV8 A;  3E30 A;  5IY5 E;  2ZGD A;  4TXP A;  4NUR A;  3FFL A;  4GA2 A;  5LP0 A;  2R2L A;  3IKO B;  3AG1 E;  1EDU A;  3PZ4 A;  4ANX A;  2IOL A;  3UT4 A;  1UOH A;  3UM1 A;  3AU4 A;  3PRE A;  1Y8M A;  3SFY A;  3ESK A;  2WXI A;  3HXB A;  4I2W A;  1FT1 A;  4EZK A;  4J8Y A;  2GRQ B;  3L22 A;  5G05 J;  4J8F A;  4XE0 A;  2IJG X;  3ASO E;  4I9C A;  2NC9 A;  1U3D A;  4LEU A;  2KZT A;  4HLL A;  4J0U A;  1H19 A;  2V0P A;  1KZO A;  1IYG A;  5FT9 A;  3LY8 A;  4WNF A;  1DNP A;  3FUJ A;  2QZA A;  5G04 C;  5J90 A;  4MKT A;  2EQX A;  3BEE A;  2IOS A;  4G25 A;  3CVW A;  2CFZ A;  3ASD A;  5HS0 A;  4HOR A;  1OT8 A;  1Y6I A;  4O6F A;  2P9L G;  3I3N A;  4A3V A;  1B89 A;  3X2Q E;  4ATZ D;  2V5Q C;  2YNQ A;  1K8K G;  4K5A B;  3CLJ A;  1LTX A;  4ATG A;  1Q2Z A;  3VLF A;  1N4Q A;  4N39 A;  3PEU B;  1IHG A;  3DPD A;  3ONK A;  2XS1 A;  2ZXW E;  3TJP A;  1WM5 A;  3JQ1 A;  4I9E A;  3Q5M A;  4BTB A;  1H0A A;  3CVQ A;  3TWR A;  1N95 A;  5T4Y A;  4F1P A;  4BSX A;  4CRW A;  2Y1L E;  3RU0 A;  3JCK C;  4GYO A;  3PE3 A;  4U04 A;  4K5C A;  2FF4 A;  4E6H A;  4LER A;  3NBN B;  4AXH A;  1Z3X A;  3OAW A;  4X8Q A;  4DLO A;  4JA7 A;  2DWZ A;  3U9W A;  5FZQ A;  3AG4 E;  4XEI G;  3SBT B;  3B7U X;  2OOE A;  1HU3 A;  4HXI A;  3IHY A;  3KAE A;  4U96 D;  3Q15 A;  2DZN A;  3UT7 A;  4O1O A;  1QBQ A;  4DX5 D;  2Y0B G;  5ENP D;  3NZU A;  2LSU A;  3KSL A;  5H7P A;  2WMO A;  4HI8 A;  4YDY A;  5D0O D;  3UM3 A;  4WNG A;  5T8I A;  2X6H A;  2V4H C;  2Y4U A;  2KAT A;  2J4D A;  4TXR A;  2B0O E;  3UTM A;  2P2C P;  3ESL A;  1ELR A;  3Q7F A;  1H6P A;  2RG8 A;  3Q47 B;  3ASN E;  3LVR E;  2WXM A;  3QB2 A;  4U0Z A;  1TN8 A;  2Q7F A;  2QYU A;  3C98 A;  3LY9 A;  3ZNG A;  4K0R A;  4AIF A;  2QC9 A;  3UIP C;  1JCR A;  2ZGG A;  4WNE A;  5J08 A;  1JUQ A;  2J08 A;  4GTQ A;  1AWC B;  3CHR A;  3DEP A;  4U0U A;  3D9L A;  3RO2 A;  1YA0 A;  2LAI A;  4FAD A;  1NFI E;  2A5U A;  3CVL A;  2OVB A;  1W3B A;  5AQ7 A;  1PC2 A;  3B13 A;  4Y6C A;  3RAU A;  4APF A;  4G8K A;  5FZS A;  3O4Z A;  2QY7 A;  3APD A;  5B1B E;  3FWV A;  3QOU A;  4GZD A;  4DI4 A;  4CGW A;  1HXI A;  2C2L A;  2XPI A; 
#chains in the Genus database with same CATH homology
 3LY7 A;  2VGX B;  4U0S A;  3D9N A;  3MEK A;  4FA6 A;  5FJY A;  2GGF A;  2GRL A;  3I4R B;  2X6J A;  3HIZ A;  2KCV A;  1NP7 A;  2CG2 A;  3LEW A;  4GYY A;  4HS2 A;  4UI9 K;  4I1M A;  4H7Y A;  3MX3 A;  4G26 A;  2WXO A;  3G2U A;  4DK5 A;  3ML8 A;  4JVS A;  2CHZ A;  2IQC A;  1SZ9 A;  2PM7 A;  5E75 A;  2VQ2 A;  3B7R L;  3CSF A;  3LXU X;  4L1B A;  3QJZ A;  4QFV A;  1HX8 A;  3PUJ A;  5E76 A;  4H7X A;  4U63 A;  4W9R A;  4WND A;  3D9M A;  3D9O A;  5BNW A;  2JLB A;  1P5Q A;  3FEY A;  2I9C A;  4AEZ C;  5FQ7 A;  4ACL A;  2AXU A;  3VLE A;  1HE8 A;  3SD5 A;  4J8E A;  2L6J A;  5LFA A;  4PS7 A;  2XHE A;  3LDZ A;  3PS6 A;  4JW1 A;  3ML9 A;  4WUY A;  4HLE A;  3MJW A;  3HDX A;  3JYS A;  2UY1 B;  5BPP A;  5G04 J;  1GW6 A;  4BFR A;  4GML A;  4CT4 A;  3CEQ A;  3TG5 A;  4L23 A;  4KYO B;  3ZW3 A;  2C0M A;  3MYV A;  3AS4 A;  1TEZ A;  2UWJ G;  4GYW A;  1TJC A;  1QNF A;  4BX9 A;  3HVE A;  2AWI A;  3AU5 A;  2WXQ A;  2X38 A;  4WWO A;  4NRH B;  3L6A A;  4EQF A;  2YHC A;  3LKU A;  1OWM A;  4B0Z A;  2BUG A;  1NA3 A;  1Z6T A;  1UN9 A;  4PUC A;  1PY1 A;  3PE4 A;  5A7D B;  1N52 A;  1H2U A;  3GYZ A;  3OXG A;  2VTB A;  3BG0 B;  4JC8 A;  3PUK A;  2OND A;  2NXP A;  2CFU A;  4KZC A;  5BW8 C;  4G24 A;  4MRU A;  2CHW A;  4MS6 A;  3WXX A;  3APC A;  2HM8 A;  3FU5 A;  4UQX A;  2KCK A;  4JHR A;  4C0E A;  2PL2 A;  4J8S A;  1PAQ A;  3FHE A;  4GCN A;  3ZYL A;  1MQS A;  3CQC B;  4C9B B;  3FTZ A;  5CCM A;  1HF8 A;  3OXL A;  5ENN A;  3VTY A;  5JJ6 A;  2FEZ A;  4XI0 A;  4I2Z A;  2WQ6 A;  3FTY A;  3CVY A;  1JPL A;  4TUU A;  4TV3 A;  3G2W A;  4A3T A;  1DVP A;  3JQ0 A;  3PDN A;  3IHV A;  3PNL B;  3QNK A;  4XKB A;  4Y6W A;  5ARF A;  1FVF A;  4EZJ A;  1NZN A;  1KT0 A;  3GZ2 A;  4CDR A;  3TXM A;  3S2A A;  4I6G A;  2XCB A;  5AIJ A;  4LRZ A;  3I4G A;  3L17 A;  4I6J A;  4XIF A;  2VGY A;  3LVQ E;  5FTP A;  2HR2 A;  1IQU A;  2WXL A;  3R9A B;  4AY5 A;  5HQ8 A;  5LCW C;  4FLH A;  4FHJ A;  2BF0 X;  3Q49 B;  5KJL A;  3HYM B;  3FTS A;  4APO A;  4N5C A;  3MKR A;  4L7T A;  4PS3 A;  4AY6 A;  4Q69 A;  3EJN A;  2KZT B;  1WAO 1;  3GZ1 A;  1E8Y A;  5C1D A;  1HG5 A;  4UWL A;  4JPS A;  3RRM B;  4EBA G;  3FU3 A;  2QFC A;  2HYZ A;  4YVQ C;  3FH8 A;  3RRN B;  3PEV B;  4HFG A;  3HHM A;  4BWR A;  4GAA A;  4KMO A;  3QKY A;  4GZ5 A;  4ILI A;  3NF1 A;  3UMV A;  4YVO A;  4JXT A;  3PVL A;  5AYW D;  2VGX A;  4DLQ A;  3QK0 A;  3MKQ A;  1QQE A;  5BT1 A;  3MV3 B;  4XI9 A;  4G1T A;  2FBN A;  4HOT A;  5LOZ A;  4N3A A;  2IFU A;  3RO3 A;  5BV0 A;  4B8C B;  2YIN A;  3CHS A;  4KZ0 A;  4IYP A;  3T5X A;  2X6I A;  3TXN A;  5FZR A;  2R17 C;  3KD7 A;  3CHO A;  4GU5 A;  4U07 A;  3ZGQ A;  4K03 A;  2OV8 A;  5JHB A;  3EIJ A;  3SZ7 A;  4F3V A;  4F53 A;  5KJN A;  1E90 A;  4NUR A;  3FFL A;  4CDN A;  4Q94 A;  3CR3 A;  3RIB A;  3MGB A;  4GA2 A;  4DJA A;  4KXK B;  3CIA A;  3R7R A;  2WXG A;  3FU6 A;  2L0T B;  2WXF A;  3MV2 B;  4AVX A;  1ELW A;  3AS5 A;  3ONL A;  4PDX A;  4UWK A;  5A23 A;  3FH7 A;  5LP0 A;  1H2T C;  3B7T A;  3APF A;  5FQ8 A;  3IKO B;  3RJV A;  4EEC A;  4UI9 J;  5AEN A;  4P29 A;  1EDU A;  3CK9 A;  4ANX A;  3SBS A;  2IOL A;  5CCL A;  4ME2 A;  4FU3 A;  1N54 A;  3UT4 A;  4N3C A;  1FVH A;  4FHK A;  4IUL A;  4HOS A;  4PS8 A;  4CDM A;  1SZA A;  3AU4 A;  3MKQ B;  3SGH A;  5LCW J;  2VYI A;  4JEH A;  2DIW A;  2VSY A;  4XX5 A;  1NA0 A;  2IF4 A;  3PRE A;  1ELK A;  4IN3 B;  1Y8M A;  3P2B A;  4NQ0 A;  4OYS A;  3URZ A;  2J07 A;  4A1G A;  3T8M A;  3FTU A;  3ESK A;  2A4Z A;  2E0I A;  3CK7 A;  3FP3 A;  2PQN A;  4I43 A;  4UQY A;  2WXI A;  2C0L A;  2OVF A;  4I2W A;  1OWP A;  3ZYM A;  4AP2 A;  3U4T A;  4EZK A;  2L9B A;  4JHJ A;  4EBA A;  3U66 A;  3AS8 A;  3L22 A;  3SHF A;  3FEX A;  3S7D A;  3QC1 A;  2XGO A;  4FP7 A;  4J8F A;  4XE0 A;  5G05 J;  1UN8 A;  4GZC A;  2XRY A;  4I6E A;  5C2Y A;  2IJG X;  4GPK A;  1H2V C;  3VTX A;  1L5J A;  3D3M A;  4KVM A;  3ZXS A;  4PH4 B;  3FUN A;  5D0Q D;  3CGH A;  4I9C A;  4V3I A;  1OWL A;  2NC9 A;  3ASG A;  1E8W A;  1U3D A;  4LEU A;  2KZT A;  3SFZ A;  3ULQ A;  3G2S A;  2VTB B;  4BT9 A;  2AXV A;  1QZ2 A;  3PRZ A;  1S0P A;  1HZ4 A;  2ZU6 B;  3FUI A;  4J0U A;  4GZ3 A;  1H19 A;  2PQR A;  2AVP A;  5BV1 A;  1EYH A;  3FUE A;  2V0P A;  1IYG A;  5FT9 A;  3LY8 A;  4LCT A;  3U64 A;  3ZPJ A;  3MCX A;  4WNF A;  3G2V A;  3P1U A;  2M63 A;  5T3R A;  2DCP A;  1DNP A;  2I1K A;  3FUJ A;  2XGS A;  2X3M A;  3SF4 A;  2LSV A;  4G2V A;  4MLP A;  2GW1 A;  3FUM A;  4UWF A;  3ASH A;  5G04 C;  4J6I A;  5J90 A;  4MKT A;  5JHA A;  5ARG A;  2EQX A;  1UJJ A;  1H6K A;  2CHX A;  3BEE A;  2IOS A;  1VDY A;  4G25 A;  5EX3 A;  3RKV A;  2FI7 A;  3LPZ A;  5JJT A;  3CVW A;  2CFZ A;  3RRU A;  3ASD A;  4I1O B;  3D9K A;  4HOR A;  2VSN A;  4WAF A;  2R5S A;  1E8Z A;  1Y6I A;  2PM6 A;  4IRU A;  3S7J A;  2LAH A;  5JJ7 A;  4F1S A;  2J09 A;  1HH8 A;  3QWW A;  3CVX A;  2WVI A;  4ACK A;  4O6F A;  3T5V A;  3I3N A;  4OVV A;  3FU0 A;  4DI3 A;  4A1S A;  1JWF A;  2WPV A;  1KLX A;  3ZYQ A;  4B89 A;  4A3V A;  3RU0 A;  3CVP A;  3CVN A;  2UY1 A;  1B89 A;  3VLD A;  3EHM A;  5G55 A;  4CGV A;  3CVV A;  5DBK A;  3SI5 A;  2YHE A;  4BY6 A;  2J9Q A;  4N3B A;  2YNQ A;  3FY4 A;  4RG9 A;  1EPU A;  5EKQ D;  3QAQ A;  5FQ4 A;  3KEZ A;  4BX8 A;  3CLJ A;  1HO8 A;  4ATG A;  4KVO A;  3VLF A;  4L2L A;  4RG6 A;  3QWV A;  4N39 A;  4FJZ A;  3PEU B;  3IEG A;  3S7F A;  1IHG A;  3DPD A;  3ONK A;  1JWG A;  2LNI A;  2R59 A;  3TAX A;  3L08 A;  3QAR A;  3TJP A;  1WM5 A;  4J8D A;  3FTV A;  4GCO A;  3JQ1 A;  4I9E A;  1E8X A;  3Q5M A;  3ZFW A;  2X6F A;  4ILH B;  1E96 B;  4BTB A;  1H0A A;  3CVQ A;  1ZU2 A;  3FTW A;  3N71 A;  4WWN A;  5T4Y A;  4M3O A;  2WXJ A;  3IV0 A;  3OTN A;  5FQ6 A;  5G2N A;  4BSX A;  1E7U A;  1Z3Y A;  4I17 A;  3ZYK A;  3FUD A;  4CRW A;  3ZIM A;  5M72 A;  3TGO A;  3L13 A;  2WXH A;  3U3W A;  3JCK C;  4GYO A;  2LO6 A;  1IQR A;  3LCA A;  3CST A;  3MZL B;  2CG3 A;  3PE3 A;  4U04 A;  4YND A;  5DIZ A;  4ANU A;  4G23 A;  2GRM A;  3FUH A;  3CK8 A;  5CHE E;  2VSX E;  4ANW A;  3FUK A;  5ANR A;  5G05 C;  4GB9 A;  3CHP A;  4UQZ A;  2FF4 A;  2KC7 A;  2WMN A;  3IBE A;  2VJ8 A;  4E6H A;  4LER A;  4ABN A;  1INZ A;  4XZ4 A;  1OWO A;  2X6K A;  2XRZ A;  2J49 A;  4AXH A;  1Z3X A;  2I2O A;  3OAW A;  2WXP A;  4ILG A;  4KT6 B;  4URK A;  3CVU A;  3OXF A;  4AOF A;  5AJD A;  4AJW A;  4DLO A;  4B94 A;  1E7V A;  2PZI A;  1WY6 A;  3MA5 A;  4JA7 A;  3TG4 A;  3TL5 A;  3U9W A;  5FZQ A;  2P58 C;  3D9J A;  2V4L A;  3UX4 A;  3CKC A;  3LJ3 A;  4UWG A;  3B7U X;  3SBT B;  3E4B A;  2OOE A;  2HO1 A;  3UQ3 A;  3UPV A;  1HU3 A;  1LF8 A;  4HXI A;  2XEV A;  3LS8 A;  4UI9 C;  4R7L A;  1HS6 A;  3CHM A;  4JZY A;  3D9I A;  3IHY A;  2XCC A;  3KAE A;  4JL0 A;  3HVE B;  1BPO A;  5FWQ A;  2Y4T A;  4G11 A;  2WXN A;  2RD0 A;  4A55 A;  3Q15 A;  2XPZ A;  1U3C A;  3UT7 A;  2WXK A;  2MOW A;  4OVU A;  4UWH A;  2ILR A;  4N2Q A;  1UW4 B;  1X5B A;  2XQ0 A;  1FCH A;  1UG3 A;  3FUF A;  4Q96 A;  4JA9 A;  3S7B A;  3ZEF A;  3NZU A;  3BG1 B;  2LSU A;  2NSZ A;  3B7S A;  4CT0 A;  5KJK A;  3D9P A;  2WMO A;  4EZL A;  4N2S A;  3FTX A;  3PH0 C;  5D0O D;  3LYA A;  1HFA A;  4D10 C;  5HI7 A;  3ASF A;  3PZD A;  4FJY A;  4B8A A;  3GW4 A;  4ANV A;  4WNG A;  3R7Q A;  4L2Y A;  1XGW A;  5T8I A;  2X6H A;  4F7A A;  1TJF A;  2Y4U A;  1SQM A;  4RSY A;  4AV7 A;  3FH5 A;  2KAT A;  2J4D A;  3JUI A;  2I1J A;  4LUN U;  2MRI A;  3ZHE B;  5A6C A;  3DBS A;  3EDT B;  4GA0 A;  5LX8 A;  3ESL A;  2KCL A;  3ENE A;  2DBA A;  3SNX A;  1OUV A;  1ELR A;  5KJM A;  4FLB A;  4CEM A;  2RG8 A;  4JHK A;  3Q47 B;  4NAC A;  3RK6 A;  3I5P A;  2VSO E;  3LVR E;  1EF1 C;  2WXM A;  3QB2 A;  2BTD A;  4E85 A;  4DPR A;  4U0Z A;  1A17 A;  4C0M A;  2Q7F A;  3PNT B;  4HOU A;  3G2T A;  4BT8 A;  3CKB A;  4HOQ A;  3NQP A;  2MHK A;  2L0I A;  3C98 A;  3LY9 A;  4K0R A;  4AIF A;  1ZBP A;  3FDH A;  2WB2 A;  1XNF A;  4WNE A;  4AM9 A;  4EPZ A;  5J08 A;  4GA1 A;  1JUQ A;  2J08 A;  2AXZ A;  3K9I A;  2IU1 A;  2KM4 A;  3QWP A;  3CHR A;  3GZS A;  4U0U A;  4BTA A;  3D9L A;  4XKC A;  3RO2 A;  4WWP A;  4CCA A;  1YA0 A;  2LAI A;  4FC8 A;  3UUX A;  2FO7 A;  4FAD A;  4KBQ A;  3L54 A;  3EIQ C;  4FUL A;  2A5U A;  4HVB A;  3CVL A;  2OVB A;  1W3B A;  4U8H A;  4GMJ A;  3QDN A;  1UJK A;  5CMY A;  2WQH A;  1PC2 A;  3B13 A;  4Y6C A;  4APF A;  2AW6 A;  5KCM A;  3ZN3 A;  3KS2 A;  2ION A;  2WM9 A;  3FUL A;  4I1A A;  5FZS A;  2V5F A;  3ZHE A;  2E2E A;  5BUZ A;  2Y3A A;  2XGM A;  3O4Z A;  3ZRH A;  5CMW A;  1KT1 A;  3UT8 A;  4RVB A;  2FUL A;  4JEU A;  3CQG B;  4TRQ A;  2WXR A;  2QY7 A;  1HG2 A;  3APD A;  4GZ6 A;  5EDS A;  2J4B A;  2V8S E;  3FWV A;  3L16 A;  3NZS A;  3QOU A;  4GZD A;  5EX0 A;  3ZVV A;  3Q4A B;  4DI4 A;  5AJL A;  3O48 A;  5ANL A;  2WQ7 A;  1MHQ A;  3CV0 A;  3EHN A;  4CGW A;  2XPY A;  3CHQ A;  1HXI A;  2C2L A;  1OWN A;  2I6H A;  2JEK A;  2XPI A;  2YQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...