2C0MA

Apo form of the tpr domain of the pex5p receptor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
297
Chain Sequence
b'DKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 120
structure length 297
sequence length 319
chains with identical sequence B, C, F
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0mA00
3SZ7A 5ARGA 5KJKA 3VTYA 3IEGA 5DIZA 5KJMA 2L6JA 5LCWC 2KCLA 1QQEA 3U4TA 4I2ZA 3OXGA 1HZ4A 4UI9J 2AVPA 4WNDA 4B94A 5M72A 2HO1A 4GYYA 4U07A 1WM5A 3RKVA 2JLBA 5CCMA 3KAEA 5ARFA 2XPIA 4IN3B 4KXKB 3CVQA 4GA1A 1XNFA 3QKYA 2J9QA 2I6HA 2UWJG 3Q15A 4BT9A 4I17A 5JJTA 3MKRA 2HYZA 1WAO1 4U0UA 5G05C 3PE3A 2KCVA 4G24A 3Q47B 4GCOA 4WNFA 2VSYA 3ZHEA 2XCCA 4KBQA 3RO2A 4JHRA 5A7DB 5FJYA 3ZPJA 2OOEA 4G26A 4N2SA 1IHGA 3S7DA 4N5CA 5LCWJ 1ELRA 3SF4A 2PQNA 4UI9K 2UY1A 4I2WA 2VGXB 4GYWA 4HORA 4CGWA 3ULQA 2WPVA 3LYAA 4XI9A 2PL2A 2VYIA 3JYSA 3S7BA 4JA9A 4JA7A 2LSVA 2FI7A 3PDNA 4GYOA 4HOQA 4GCNA 4BTBA 5CCLA 4G25A 4WNEA 4GZ6A 3AS8A 3RIBA 3QDNA 3LCAA 3HYMB 3FFLA 1KT1A 3QWPA 2MHKA 3VTXA 2FO7A 2FEZA 4U0ZA 4UQYA 4J0UA 1P5QA 4G2VA 1HH8A 5KJLA 4I1AA 5JJ6A 1FCHA 3UUXA 2NC9A 1NZNA 4LEUA 3AS4A 3KD7A 2FBNA 2VGXA 1ZBPA 1IYGA 5G04J 4J8EA 4Y6WA 4A1SA 3QOUA 4ABNA 2XGOA 4U0SA 3AS5A 3LY8A 3CK9A 2XGMA 4AM9A 3ASGA 1QZ2A 4ME2A 2YHCA 4O6FA 4I9EA 3WXXA 3GZ2A 4CGVA 3O48A 3Q4AB 3EDTB 3LY7A 3QWWA 2WQHA 3ZFWA 5EKQD 4AIFA 3ZN3A 3ASHA 5A6CA 5FZRA 3CK8A 3GZ1A 2KATA 3S7JA 4UQXA 3CEQA 5EX0A 3LY9A 3RJVA 3MV3B 2LNIA 5BT1A 3GW4A 3PE4A 3MV2B 5HQ8A 3R9AB 3TAXA 4WNGA 4N39A 2YQ8A 3OXFA 4N2QA 5FZSA 1NA0A 1TJCA 4BTAA 4XIFA 4G23A 2C0LA 3CVPA 2E2EA 3K9IA 4RG6A 2XCBA 3LPZA 5FTPA 1KLXA 4Y6CA 4UI9C 3UPVA 4BWRA 4NQ0A 3CKBA 1A17A 2DBAA 3UQ3A 3MEKA 4U04A 3KS2A 2BUGA 1E96B 3CV0A 5D0QD 4HOSA 5C1DA 3ASDA 2Y4TA 2QFCA 3RO3A 4GZ5A 5G05J 4N3AA 4YVOA 2XGSA 2HR2A 2C0MA 3U3WA 4CDRA 4YVQC 5D0OD 3TGOA 4GA0A 3TG5A 3GYZA 4J8FA 5EX3A 3Q5MA 3URZA 4N3CA 1Y8MA 2VQ2A 4UQZA 5BW8C 1ELWA 4HOUA 4H7YA 3CK7A 2UY1B 4AY5A 4RG9A 3CVLA 5DBKA 2VSNA 5HI7A 2P58C 3RU0A 4WUYA 5CHEE 2XEVA 5BNWA 2KCKA 2V5FA 2ONDA 3QWVA 4APOA 3CKCA 3Q49B 4XI0A 3E4BA 4W9RA 1ZU2A 2IF4A 3TG4A 4AY6A 3ASFA 3CVNA 2LSUA 2R5SA 4GZ3A 2C2LA 4GA2A 3ZGQA 1OUVA 2Y4UA 4J8DA 5JJ7A 1PC2A 2KC7A 4NRHB 5KJNA 2GW1A 3FWVA 4GPKA 5FZQA 4YNDA 2IFUA 1HXIA 1NA3A 3S7FA 4JL0A 1KT0A 4H7XA 4HOTA 3MA5A 5G04C 2FF4A 4I9CA 3N71A 3OXLA 3LKUA 1W3BA 4KYOB 2Q7FA 1B89A 4EQFA 5AYWD 3NF1A 4BT8A 3FP3A 4N3BA 2PZIA 5FT9A 4G1TA 3BEEA 1YA0A 3ZHEB 2VGYA 2PQRA 4F3VA 3ESKA
chains in the Genus database with same CATH superfamily
2V5QC 4L23A 5ARGA 1TN6A 5KJMA 2KCLA 1JWFA 4I2ZA 3Q9UC 2WXIA 4I6JA 4B94A 5M72A 4KVOA 2BEDA 1TNYA 1YMPA 2HO1A 3DPDA 4U07A 3D9LA 4KZ0A 2YINA 3KAEA 3QARA 3BQOA 2AXZA 2IO2C 1QBQA 1Z3XA 4IULA 4GA1A 3QKYA 4JB8P 2UWJG 2ETBA 3QJZA 4BT9A 4I17A 5JJTA 2HYZA 2OVFA 3DEPA 4G24A 3Q47B 4KVMA 3UKRG 2VSYA 4FJYA 2X6HA 3JQ1A 3CVUA 4WAFA 4LNUD 3ZPJA 4JXTA 4N2SA 4N5CA 3Q75A 5JMND 2ZISA 1ELRA 4MRUA 2DVWA 1JWGA 3FTSA 5A23A 3TJPA 4I2WA 2LAIA 3TL5A 4HORA 1TNZA 3ULQA 3L13A 2PL2A 2VYIA 4U8HA 2AW6A 4TXRA 3PZDA 1OWMA 1EDUA 2J09A 4J6IA 4BTBA 1UN9A 1MJ0A 3FUNA 4CDMA 3ONKA 3EU5A 1V54E 3QDNA 1AWCB 2R59A 2J4DA 4LRZA 3HYMB 3TWVA 2FO7A 4OVVA 1IQRA 2R05A 3W9FA 4GTQA 3B7BA 4J0UA 2XENA 3FUKA 4TV3A 2KM4A 3D9PA 4C9BB 5KJLA 4QQIA 5JJ6A 1E8YA 4GZDA 5T4YA 1DCEA 3VLDA 4CDNA 2EIME 3UM2A 4LEUA 3C3RA 4AOFA 4LNGA 2R03A 1ZBPA 2IQCA 5G04J 2VTBA 2XS1A 2XGOA 4DX2A 2CHXA 2XGMA 3CGHA 3CK9A 4AM9A 4B8AA 5FQ8A 4ME2A 1HG2A 1D8DA 4DPRA 4GMLA 4D10C 1JUQA 3NZUA 2I1KA 3AG4E 4CEMA 4A63B 5A6CA 1D9SA 2OVBA 3UM0A 3DEOA 2KATA 3S7JA 3MJWA 4FP7A 3SI5A 3CEQA 1U3DA 3LY9A 3S2AA 2EINE 3MV3B 2LNIA 1OCOE 2OCCE 3CR3A 3PE4A 5ENOD 1WY6A 4WNGA 3IV0A 4XIFA 2A5UA 2EIJE 5AENA 1OWPA 2RFAA 3FU5A 3K9IA 4RG6A 1NFIE 2CHZA 3D9OA 5FTPA 1OCCE 2WXPA 5LOZA 4F53A 3APFA 4ANXA 3RSEG 1SW6A 3ABLE 4NQ0A 3CKBA 3CQCB 1DNPA 4PH4B 3D9NA 1MYOA 5D0QD 3MZLB 2XS8A 3UM3A 3LVQE 4LG6A 2Y4TA 1N0QA 2QFCA 1N54A 3T8MA 5BXOA 5G05J 3B7SA 4A3TA 1PY1A 4C48B 4FADA 3UT7A 1N4SA 3FUEA 4DLQA 3V31A 2XGSA 3P1UA 4J7WA 4CRWA 3NOCD 3U3WA 4YVQC 3L08A 3UXGA 3UKUG 3KEAA 4XZ4A 1E8ZA 5EYPF 4ATZD 4WWPA 3AU5A 3TG5A 1S63A 3G2WA 4J8FA 3IBEA 5ENRD 3ISMC 4N3CA 5FWQA 3CK7A 1MHQA 1WDYA 4AV7A 5DBKA 2VSNA 5HI7A 3D9JA 3OTNA 2VSXE 3R7RA 1MX2A 3PZ1A 1ELKA 2KXPC 1BU9A 2F0YA 4APOA 3CKCA 1ZU2A 2IF4A 1FT2A 3D9KA 4NURA 3CVNA 4UWKA 4B0ZA 4HB5A 2C2LA 3NAWA 3JQ0A 3AAAC 3ZGQA 1OUVA 3HDXA 4J8DA 4AVXA 2XRZA 3IHYA 1LD8A 2KC7A 4M7CA 4TXPA 3EIJA 3TXMA 4APFA 3E34A 1D8EA 2WXNA 3FH8A 3FUFA 3EUVA 1NA3A 3RRMB 3S7FA 4JL0A 4GB9A 4HRLA 3RRNB 4BERA 2VTBB 3F6QA 1TN7A 3EJNA 3N71A 3LKUA 4HRNA 3EIQC 1W3BA 3LJ3A 3KSQA 2WMOA 5AYWD 2J07A 3TWUA 3D3MA 2WXGA 5JHAA 4LNBA 3P2BA 3PREA 1HE8A 3V2OA 4RVBA 2PQRA 3AG1E 4F3VA 4C0EA 5EIDA 3SZ7A 3IEGA 5DIZA 3TWRA 2L6JA 2ZU6B 3U4TA 2I2OA 4E6HA 5LX8A 3MYVA 2IO3C 4UUCA 1HZ4A 4UI9J 3UTMA 1PAQA 4FC8A 2XPZA 3TWTA 4HBDA 2I9CA 1N4RA 2OV8A 1OWNA 2V4HC 3LS8A 2B6CA 3ABKE 5CCMA 3SD5A 1Y6IA 4IN3B 4XX5A 5J08A 1VDYA 3FY4A 3EHMA 3D9MA 2I6HA 3TWQA 1MQSA 3SBTB 3Q15A 3JUIA 4U0UA 1FVFA 2GRLA 1V55E 3FULA 2OEVA 4GCOA 2I1JA 3ZHEA 1N4QA 3C98A 4KBQA 5BXUA 3RO2A 4JHRA 4PS8A 3PEVB 1O1SA 1IHGA 4HXIA 5CEDB 5AQBA 4K5BA 4HI8A 1N9AA 3GZSA 2UY1A 2VSOE 2L6BA 4GYWA 4XI9A 3NOGD 3FU3A 3JYSA 3PS6A 3NQPA 1UOHA 3PDNA 5AJLA 3E32A 2J08A 3PNTB 3HG0D 3AS8A 2VGEA 2NSZA 3ZIMA 1N94A 2FEZA 4K5AB 4URKA 2IOSA 4U0ZA 4BX9A 5FIOA 5G2NA 1N11A 2WXKA 3ASOE 5AN8A 3APDA 4I1AA 4U95D 2RKKA 1NZNA 2CHWA 4AP2A 3Q7FA 2R2LA 3KD7A 2VGXA 3CSFA 4OAVB 4ABNA 4UWHA 3FTUA 3FTVA 2DYRE 3LY8A 4DX7D 3ASGA 4ZHBA 1E90A 1NP7A 4M3OA 5EDSA 3AG2E 1H6PA 4A1GA 3GZ2A 4DX1A 3U66A 1H6OA 4CGVA 3O48A 3Q4AB 3EDTB 1IXVA 2ILRA 4J8YA 4XKCA 5BV0A 4L1BA 1FPPA 3ZFWA 2AXUA 3EHQA 4AIFA 4DRXE 3SY2A 4B8CB 3PRZA 4UQXA 5EX0A 1EYHA 3JXJA 3HIZA 3FHEA 5AJDA 1XGWA 4U63A 4N2QA 5FZSA 2ZIRA 4BTAA 3ML9A 2P9KG 4UWGA 1BI7B 3ZW3A 2C0LA 2E2EA 2WMNA 3DXKG 3LDZA 2XCBA 4Y6CA 3SHFA 1N0RA 3LEWA 4GTTA 1A17A 2DBAA 2P9UG 4RSYA 1WG0A 3U64A 4U04A 2FULA 2BUGA 2IY0C 5T3RA 2P9NG 3FEYA 3J5PA 4BETA 2V0PA 4GZ5A 3V79K 4I1MA 4N3AA 1UW4B 3SO8A 3DRAA 2XZDG 2F8YA 4ANVA 3ZYMA 3G2SA 2C0MA 2XPYA 5H7PA 1UN8A 4CDRA 5JHBA 5FINA 3ZXPA 4I6GA 4BESA 4GA0A 4HNAD 2QYJA 1AP7A 5EX3A 1TNUA 4KMOA 1JCSA 5CERB 4CT0A 2VQ2A 5BW8C 3Q7AA 5AARA 1ELWA 3FUIA 3EHNA 4HOUA 1HG5A 3D9HA 5FQ7A 2UY1B 4FHKA 3DXMG 2LUHA 4TRQA 2NYJA 2P58C 2H6HA 1SZAA 4I1OB 3ESLA 2WXQA 4WUYA 1MX6A 1TR4A 3IKOB 3FUHA 1K3ZD 4XI0A 5HRYA 3E4BA 4GMRA 4X8QA 3ZRHA 5AQAA 2DYSE 5KCMA 4EZKA 4AY6A 4CZ2D 4GZ3A 1SZ9A 2QYUA 2Y4UA 2MYOA 5E75A 2Y1LE 1TYQG 2XZTG 3B13A 2GW1A 3TWWA 3AG3E 2RD0A 5LP0A 1DVPA 5FZQA 3VLFA 3UINC 2AJAA 2LAHA 3PVLA 2ZXWE 4Q94A 4H7XA 1GW6A 1K1BA 2J49A 3NBNB 2AXVA 3ZYQA 2EILE 4L2LA 4JVSA 3CVXA 4BSZB 1H2UA 4EQFA 1TJFA 3MCXA 3NF1A 4RLYA 4BT8A 4F7AA 4JHJA 3ZXSA 2PZIA 3AJIA 4XEIG 2OEWA 5CEAA 4JEUA 2DCPA 5BV1A 3ESKA 2GROB 3DWLG 3L54A 5CBNA 2IEJA 4L2YA 4TUUA 4U8YD 1Z5SC 5CECB 3L17A 2WXMA 1INZA 1G3NB 5ANRA 1U2VG 4I43A 3SNXA 1WM5A 4C0MA 4PUCA 3SQVA 3RKVA 2JLBA 2V8SE 2J8SD 4TUMA 4HRMB 3HRAA 5ARFA 4AXHA 5ENSD 4PS3A 2QY7A 4MS6A 1LTXA 4KXKB 3CVQA 1DC2A 4ILGA 1XNFA 5CMYA 2CG3A 3UM1A 1TNOA 3I4GA 4HLEA 2L0TB 3AU4A 3CHSA 1OCRE 1WAO1 5AQ9A 3DSUA 3APCA 1KZOA 1N52A 2F8XK 4WWNA 3HVEA 5T8IA 3C3OA 2XCCA 4TXQA 4P29A 2P9PG 5A7DB 5FJYA 2OOEA 4G26A 3ML8A 2P9LG 3L6AA 3SF4A 2PQNA 4XE0A 4UI9K 4GMJA 5ENTD 2XQ0A 3MKQA 2WVIA 4FHJA 1UG3A 2WQ6A 2WPVA 3LYAA 4GPMA 5B1AE 4Q69A 3S7BA 4JA9A 2LSVA 3EHRA 3ZVVA 5CRVA 4HOQA 4BFRA 2HM8A 4B93B 1O5MA 2GRRB 5CCLA 4LUNU 4WNEA 2X6IA 4GZ6A 3FDHA 3CLJA 3LCAA 4K0RA 3FFLA 4ANWA 3VTXA 2EIKE 2EQXA 3B7UX 1OWOA 4UQYA 1OCZE 3PZ3A 3UUXA 3RK6A 2DWZA 4L7TA 3CIAA 4Q96A 5BPPA 4EBAG 2GGFA 1BLXB 4K03A 2YHEA 2P9SG 5D2MC 2CFZA 1IYGA 1JCRA 5ENPD 4J8EA 3QOUA 4U0SA 3ZYLA 3KSLA 3CHRA 2IJGX 5JA4D 2YHCA 3Q73A 3O4ZA 4O6FA 3OAWA 3G2UA 2B0OE 3DSSA 4LERA 2X6KA 3LY7A 3QWWA 3I3NA 2E0IA 2XHEA 5EKQD 3ZN3A 2ETAA 3T5VA 1UJJA 3HXDA 5ITZF 3CK8A 1N4PA 3GZ1A 2KBXA 3NB2A 5AQ7A 4YDYA 2IU1A 4A55A 5BT1A 3MV2B 4EHMA 4N39A 2YQ8A 2VJ8A 1HS6A 3OXFA 3IHVA 4BSXA 1LF8A 2X6FA 1X81A 1U3CA 4G23A 3KEZA 4DX5D 2LXMA 3CVPA 2ETCA 1S70B 2X6JA 3C5RA 4QFVA 1KLXA 2H6FA 3FTYA 4G11A 3UPVA 2XEEA 2WXLA 3UT4A 4GU5A 1RZ4A 3VLEA 3MEKA 1H19A 3UMVA 3CVVA 3CV0A 4U8VD 2JEKA 5C1DA 3SBSA 3ASDA 2PNNA 3RO3A 5BUZA 5D66A 1BD8A 5CBOA 4KZCA 4HVBA 2IOLA 2F37A 4YDEA 4YVOA 4FU3A 3CHMA 2HR2A 4V3IA 3PZ2A 3EU9A 5D0OD 3W9GA 1NL4A 2Y69E 3TGOA 4NIKA 2H6GA 1ZB1A 2DZOA 3URZA 3QB2A 1Z6TA 2XEHA 4DK5A 4CYMD 1Y8MA 4KT6B 4UQZA 4JEHA 5KWDA 4GZCA 4H7YA 4AY5A 1SA4A 3CVLA 3MKQB 3HXEA 2PM6A 4Z68A 4B89A 4OAUC 1OXJA 2QC9A 3RU0A 1NI1A 5CHEE 4AJWA 2XEVA 2GRPB 4F1PA 3CHOA 4MKTA 4DI4A 4EZLA 3BUAA 5BNWA 4ILIA 2JABA 2V5FA 3ZNGA 3HHMA 3TG4A 5KBAA 3ASFA 2LSUA 2BTDA 2R5SA 4CT4A 3LJNA 4K5CA 2LO6A 4GA2A 2P2CP 3ULEG 3FTWA 3FU6A 5JJ7A 4J8SA 4NRHB 4EBAA 4GTRA 4JZYA 2LXLA 3L82A 1BI8B 1N95A 3X2QE 4GPKA 4BY6A 4BX8A 1HF8A 1FT1A 3Q9NC 1Z3YA 3JCKC 1KT0A 4HOTA 1FVHA 4E85A 5G04C 4N5QA 3JXIA 4YDWA 2FF4A 3UIOC 5KNHD 3D9IA 2CFUA 4I9CA 3ZU7B 4IYPA 3ULYA 3FTZA 1K8KG 5IY5E 3OXLA 5CRUA 5ANLA 1IQUA 3WG7E 3R9MA 4KYOB 4HQDA 2Q7FA 2L9BA 4ILHB 5EILA 3NZSA 4AEZC 4N3BA 1YYHA 5FT9A 3ZYKA 2Y3AA 4MBGA 4CCAA 3BEEA 3E37A 3ZHEB 3ABME 2R17C 2VGYA 4OVUA 3HXCA 4IRUA 5KJKA 3VTYA 5LCWC 1QQEA 1E8XA 3OXGA 3QNKA 2WM9A 3C3QA 2A4ZA 2AVPA 4PS7A 4WNDA 1TN8A 1IKND 4GYYA 4RQIA 1QNFA 1KPSB 4MLPA 3T5XA 4GTOA 3PUJA 4JW1A 2XPIA 4WWOA 3MGBA 5HKPA 4G8KA 3ENEA 3B7RL 2J9QA 4FULA 2R02A 3B7TA 5B1BE 1SVXA 1E7UA 4FJZA 2GRNB 3MKRA 5G05C 3PE3A 2KCVA 3B95A 1O1TA 2BKGA 1SA5A 3Q79A 4WNFA 5HS0A 4LSZE 2DZNA 3G2TA 3JUEA 3V30A 1HFAA 2X3MA 3S7DA 3UX4A 1E7VA 3CHQA 5LCWJ 5E76A 3TWSA 3LVRE 2VGXB 4FA6A 1MX4A 2MOWA 3MX3A 3J5QB 4CGWA 4G8LA 4OYSA 1OWLA 1RW2A 4JA7A 4R7LA 2WXOA 2FI7A 2ZGGA 4GYOA 4YDOA 4JHKA 4GCNA 3BG0B 2AWIA 2H6IA 4G25A 3PUKA 3I5PA 3RIBA 2CG2A 4U7EB 1H2VC 1KT1A 2BKKB 1HO8A 3QWPA 2MHKA 4PDXA 3BU8A 4DLOA 2Y0BG 4F6RD 5J90A 2WXHA 1P5QA 4G2VA 1HH8A 3HXBA 3RAUA 1FCHA 2NC9A 3CQGB 3TXNA 2BF0X 3UI2A 5ENQD 2NXPA 5CMWA 3AS4A 2RG8A 2FBNA 3ZEFA 4JD2G 4Y6WA 4A1SA 3E30A 4GTMA 3AS5A 5FQ4A 3E33A 4FLBA 1K1AA 3V2XA 1Q2ZA 1QZ2A 2QZAA 3I4RB 1MZCA 3WXXA 4I9EA 3UIPC 1IHBA 2KZTA 1O1RA 4A3VA 2WB2A 3QAQA 3FEXA 2WQHA 1UJKA 4F1SA 1QYMA 3ASHA 3DSVA 5FZRA 2WXJA 3SGHA 2YNQA 5B3SE 2RFMA 5EN5D 4HI9A 2DIWA 3LXUX 3RJVA 2X38A 3G2VA 4UWFA 1X5BA 4GTVA 3GW4A 1DCQA 2FO1E 5HQ8A 1OT8A 3T9KA 4O60A 3R9AB 3TAXA 4O1OA 3FUDA 5C2YA 2GRMA 1JPLA 1NA0A 1TJCA 2ZGDA 3DSWA 3PH0C 3FH5A 4GAAA 2MRIA 3LPZA 3FU0A 5G55A 3RRUA 2IONA 3CVYA 4UI9C 2HE0A 3ZUVB 4BWRA 4ANUA 3CHPA 4FLHA 3UQ3A 3Q78A 3KS2A 1E96B 5EIBE 4HOSA 4GTPA 2M63A 2WXFA 1H6KA 3L16A 4HFGA 3BG1B 3CSTA 2GRQB 3SFYA 3L22A 3ZKJA 4DX6D 1EPUA 4HLLA 1L5JA 1LD7A 3GYZA 1S0PA 3Q5MA 1TNBA 3FUJA 4LCTA 1EF1C 4EPZA 3SFZA 5EYLA 4DJAA 4DI3A 4HS2A 3ONLA 4UWLA 4RG9A 3R7QA 3DBSA 1H2TC 3C72A 3PNLB 4U96D 3PZ4A 5FQ6A 5ENNA 3DSTA 5AIJA 1A5EA 2KCKA 2ONDA 2P9IG 3QWVA 3Q49B 4W9RA 2WXRA 3IXEA 4BEPA 4DUIA 5LFAA 3DSXA 3FUMA 3L9TA 4EZJA 4NACA 1H0AA 1S64A 1PC2A 1HX8A 1E8WA 4I6EA 5KJNA 2PM7A 3FWVA 4GTSA 4ATGA 3SFXA 3TWXA 1TEZA 4YNDA 1KZPA 3UT8A 4O1PA 3FTXA 2IFUA 1HXIA 4JPSA 2XRYA 3HXFA 4ACKA 2L0IA 5AAOA 4XKBA 3MA5A 1JCQA 1BPOA 4L9PA 3QC1A 4EECA 1HU3A 2WQ7A 3QK0A 5KNGA 2V4LA 1B89A 2KZTB 2J4BA 3U9WA 2A5EA 3PEUB 4ZFHA 3FP3A 3T8KA 3CVWA 3DPYA 1OY3D 3HVEB 1SQMA 4G1TA 3FH7A 4JC8A 1YCSB 1YA0A 3ASNE 4ACLA
chains in the Genus database with same CATH topology
3SZ7A 3L54A 4L23A 5ARGA 4IRUA 5KJKA 4L2YA 3VTYA 3IEGA 4TUUA 5DIZA 5KJMA 2L6JA 5LCWC 2KCLA 1QQEA 2ZU6B 1JWFA 3L17A 3U4TA 4I2ZA 2WXMA 2I2OA 4E6HA 5LX8A 1INZA 5ANRA 3MYVA 1E8XA 3OXGA 3QNKA 2WM9A 4I43A 2WXIA 4I6JA 1HZ4A 4UI9J 2A4ZA 2AVPA 3SNXA 4PS7A 4WNDA 4B94A 5M72A 1PAQA 4KVOA 2HO1A 3DPDA 4GYYA 4U07A 4FC8A 1WM5A 2XPZA 4C0MA 3D9LA 4PUCA 2I9CA 1QNFA 2OV8A 1OWNA 4MLPA 3T5XA 3RKVA 4KZ0A 2YINA 3LS8A 2JLBA 2V8SE 5CCMA 3PUJA 3KAEA 4JW1A 3QARA 2XPIA 5ARFA 3SD5A 4AXHA 1Y6IA 4IN3B 4PS3A 4WWOA 4XX5A 2AXZA 1VDYA 2QY7A 3MGBA 4MS6A 5J08A 3FY4A 4KXKB 3CVQA 1Z3XA 4IULA 3ENEA 3B7RL 4ILGA 3EHMA 1XNFA 3D9MA 4GA1A 3QKYA 2J9QA 4FULA 5CMYA 3B7TA 2CG3A 2I6HA 2UWJG 1MQSA 3I4GA 3QJZA 3SBTB 3Q15A 4BT9A 2L0TB 3AU4A 3CHSA 1E7UA 4FJZA 4I17A 4HLEA 5JJTA 3JUIA 3MKRA 2HYZA 1WAO1 2OVFA 4U0UA 1FVFA 5G05C 3APCA 3PE3A 2GRLA 2KCVA 4G24A 1N52A 3FULA 3Q47B 4WWNA 3HVEA 5T8IA 4GCOA 4KVMA 4WNFA 2I1JA 2VSYA 3ZHEA 4FJYA 3C98A 2XCCA 2X6HA 4KBQA 3RO2A 3G2TA 3JQ1A 4P29A 3CVUA 4WAFA 4JHRA 5A7DB 5FJYA 3ZPJA 4PS8A 2OOEA 3PEVB 4G26A 4JXTA 1HFAA 4N2SA 1IHGA 2X3MA 3S7DA 3UX4A 4N5CA 1E7VA 4HXIA 3CHQA 5LCWJ 1ELRA 3ML8A 4MRUA 5E76A 3L6AA 3SF4A 2PQNA 4XE0A 3GZSA 3LVRE 3FTSA 1JWGA 4UI9K 2UY1A 2VSOE 4GMJA 5A23A 2XQ0A 3MKQA 2WVIA 3TJPA 4I2WA 2LAIA 2VGXB 4FA6A 4FHJA 2MOWA 1UG3A 3TL5A 4GYWA 3MX3A 4CGWA 2WQ6A 4HORA 3ULQA 2WPVA 3L13A 3LYAA 4XI9A 2PL2A 2VYIA 4OYSA 1OWLA 3FU3A 4U8HA 4Q69A 3JYSA 2AW6A 3S7BA 4JA9A 4JA7A 2LSVA 4R7LA 3PZDA 2WXOA 3ZVVA 2FI7A 3PS6A 3NQPA 1OWMA 1EDUA 2J09A 3PDNA 4GYOA 5AJLA 4HOQA 4JHKA 4GCNA 4J6IA 4BTBA 1UN9A 4BFRA 2HM8A 3BG0B 2AWIA 5CCLA 2J08A 3PNTB 4LUNU 4G25A 4WNEA 3FUNA 4CDMA 3PUKA 2X6IA 3I5PA 4GZ6A 3FDHA 3ONKA 3AS8A 3CLJA 3RIBA 3QDNA 2CG2A 3LCAA 4K0RA 2R59A 2J4DA 1H2VC 4LRZA 2NSZA 3HYMB 3ZIMA 3FFLA 1KT1A 1HO8A 3QWPA 2MHKA 4ANWA 3VTXA 4PDXA 4DLOA 2EQXA 2FO7A 2FEZA 3B7UX 4OVVA 1IQRA 4URKA 2IOSA 4U0ZA 4BX9A 1OWOA 4UQYA 4J0UA 5J90A 5G2NA 2WXHA 1P5QA 3FUKA 4TV3A 2KM4A 2WXKA 3D9PA 4G2VA 1HH8A 3APDA 4C9BB 5KJLA 4I1AA 5JJ6A 1FCHA 1E8YA 4GZDA 2NC9A 3UUXA 3RK6A 5T4YA 3CQGB 3TXNA 1NZNA 4L7TA 3VLDA 3CIAA 2BF0X 2CHWA 4AP2A 4CDNA 4Q96A 5BPPA 2NXPA 4LEUA 4EBAG 2GGFA 5CMWA 4AOFA 3AS4A 2RG8A 4K03A 2YHEA 3KD7A 2FBNA 2VGXA 1ZBPA 2CFZA 3CSFA 1IYGA 2IQCA 5G04J 3ZEFA 4J8EA 2VTBA 4Y6WA 4A1SA 3QOUA 4ABNA 2XGOA 4U0SA 3FTUA 4UWHA 3AS5A 3FTVA 3ZYLA 5FQ4A 3CHRA 3LY8A 2IJGX 2CHXA 2XGMA 3CGHA 3CK9A 3ASGA 4FLBA 4AM9A 4B8AA 5FQ8A 1QZ2A 4ME2A 1E90A 2YHCA 1NP7A 3I4RB 1HG2A 4M3OA 3O4ZA 4O6FA 4I9EA 3WXXA 5EDSA 4DPRA 3OAWA 4A1GA 3G2UA 4GMLA 3GZ2A 4LERA 2KZTA 4D10C 3U66A 4A3VA 2WB2A 1JUQA 4CGVA 2X6KA 3O48A 3Q4AB 3EDTB 2ILRA 3NZUA 3LY7A 2I1KA 3FEXA 3QAQA 4XKCA 3QWWA 2WQHA 4L1BA 1UJKA 3I3NA 2E0IA 2XHEA 4CEMA 3ZFWA 4F1SA 2AXUA 5EKQD 4AIFA 3ZN3A 3ASHA 5A6CA 3T5VA 5FZRA 1UJJA 2WXJA 3SGHA 2YNQA 3CK8A 3GZ1A 2OVBA 4B8CB 2KATA 3PRZA 3S7JA 3MJWA 2DIWA 2IU1A 3LXUX 4FP7A 3CEQA 1U3DA 4UQXA 3LY9A 5EX0A 3S2AA 3SI5A 3RJVA 3MV3B 2LNIA 4A55A 2X38A 3G2VA 4UWFA 5BT1A 1EYHA 1X5BA 3CR3A 3GW4A 3MV2B 3PE4A 5HQ8A 3R9AB 1WY6A 3TAXA 4WNGA 3FUDA 4N39A 3HIZA 3FHEA 5AJDA 2YQ8A 5C2YA 2VJ8A 1XGWA 1HS6A 3OXFA 4U63A 2GRMA 3IHVA 3IV0A 4BSXA 1JPLA 5FZSA 4N2QA 1LF8A 1NA0A 1TJCA 2X6FA 4BTAA 3ML9A 4XIFA 4C0EA 2A5UA 1U3CA 4UWGA 4G23A 3ZW3A 5AENA 2C0LA 3KEZA 3CVPA 2E2EA 1OWPA 3FU5A 3K9IA 2WMNA 2X6JA 3PH0C 3LDZA 3FH5A 4GAAA 4RG6A 2MRIA 2XCBA 2CHZA 3D9OA 3LPZA 3FU0A 4QFVA 5FTPA 1KLXA 5G55A 2WXPA 4Y6CA 3RRUA 2IONA 5LOZA 3FTYA 4G11A 4F53A 3APFA 3CVYA 4ANXA 3SHFA 4UI9C 3UPVA 3LEWA 4BWRA 4NQ0A 3CKBA 4ANUA 2WXLA 3CHPA 4FLHA 3UT4A 3CQCB 1A17A 2DBAA 1DNPA 4GU5A 4PH4B 3UQ3A 4RSYA 3VLEA 3MEKA 3D9NA 3U64A 1H19A 2FULA 3KS2A 4U04A 2BUGA 1E96B 3UMVA 3CVVA 3CV0A 5D0QD 4HOSA 3MZLB 2JEKA 5C1DA 3SBSA 3LVQE 3ASDA 5T3RA 2Y4TA 2M63A 3FEYA 2QFCA 1N54A 2WXFA 1H6KA 3L16A 4HFGA 2V0PA 4GZ5A 5G05J 4I1MA 3B7SA 3RO3A 4N3AA 3T8MA 5BUZA 4A3TA 1PY1A 1UW4B 3BG1B 4KZCA 3UT7A 4FADA 4HVBA 2IOLA 3FUEA 4DLQA 4YVOA 4FU3A 2XGSA 3P1UA 3CHMA 4ANVA 3ZYMA 3G2SA 4CRWA 2HR2A 4V3IA 2C0MA 2XPYA 1UN8A 3CSTA 4CDRA 3U3WA 5JHBA 4YVQC 3L08A 4I6GA 5D0OD 3TGOA 3L22A 4GA0A 4XZ4A 1E8ZA 1EPUA 4WWPA 3AU5A 3TG5A 1L5JA 3G2WA 3GYZA 4J8FA 5EX3A 1S0PA 3Q5MA 3IBEA 3FUJA 3QB2A 4LCTA 3URZA 1Z6TA 1EF1C 4EPZA 4KMOA 4DK5A 4N3CA 3SFZA 4CT0A 1Y8MA 2VQ2A 4KT6B 4UQZA 4JEHA 5BW8C 4DJAA 4GZCA 5FWQA 1ELWA 3FUIA 3EHNA 4HOUA 1HG5A 4DI3A 4H7YA 3CK7A 4HS2A 5FQ7A 2UY1B 4AY5A 3ONLA 4UWLA 1MHQA 4RG9A 3R7QA 4AV7A 3CVLA 3MKQB 4FHKA 5DBKA 2VSNA 5HI7A 3DBSA 2PM6A 3D9JA 3OTNA 4TRQA 1H2TC 2P58C 1SZAA 3PNLB 4B89A 4I1OB 3ESLA 3RU0A 2WXQA 4WUYA 5CHEE 5FQ6A 5ENNA 4AJWA 2XEVA 2VSXE 5AIJA 3CHOA 4MKTA 3R7RA 4DI4A 4EZLA 3IKOB 3FUHA 5BNWA 4ILIA 1ELKA 2KCKA 2V5FA 2ONDA 3QWVA 4APOA 3CKCA 3Q49B 4XI0A 3E4BA 4W9RA 1ZU2A 2WXRA 3ZRHA 2IF4A 3HHMA 3TG4A 3D9KA 4NURA 5KCMA 4EZKA 5LFAA 4AY6A 3ASFA 3CVNA 4UWKA 2LSUA 2BTDA 2R5SA 3FUMA 4CT4A 4B0ZA 4EZJA 4NACA 2LO6A 2C2LA 1SZ9A 4GZ3A 3JQ0A 4GA2A 3ZGQA 1OUVA 2Y4UA 3HDXA 5E75A 4J8DA 1H0AA 3FTWA 4AVXA 3FU6A 5JJ7A 2XRZA 1PC2A 3IHYA 4J8SA 2KC7A 1HX8A 1E8WA 4I6EA 4NRHB 3EIJA 5KJNA 3B13A 4EBAA 2PM7A 3TXMA 2GW1A 3FWVA 4APFA 4JZYA 2RD0A 5LP0A 1DVPA 4ATGA 4GPKA 5FZQA 1TEZA 2WXNA 3VLFA 4YNDA 3FH8A 4BY6A 3FUFA 3UT8A 4BX8A 1HF8A 3FTXA 2IFUA 2LAHA 3PVLA 1HXIA 4JPSA 2XRYA 1NA3A 3RRMB 3S7FA 4ACKA 1Z3YA 4JL0A 2L0IA 3JCKC 4Q94A 1KT0A 4H7XA 4XKBA 3MA5A 1FVHA 4GB9A 5G04C 4E85A 4HOTA 1GW6A 2FF4A 3RRNB 3D9IA 1BPOA 2CFUA 2J49A 2VTBB 4I9CA 3QC1A 4EECA 1HU3A 2WQ7A 4IYPA 3FTZA 2AXVA 3EJNA 3N71A 3OXLA 3LKUA 3ZYQA 3QK0A 3EIQC 1W3BA 2V4LA 5ANLA 1IQUA 4KYOB 4L2LA 4JVSA 2Q7FA 1B89A 3LJ3A 2KZTB 2L9BA 4ILHB 3CVXA 2J4BA 3U9WA 1H2UA 4EQFA 3NZSA 2WMOA 1TJFA 5AYWD 2J07A 3PEUB 3MCXA 3NF1A 4BT8A 4F7AA 4AEZC 3FP3A 4JHJA 3ZXSA 3D3MA 4N3BA 2WXGA 5JHAA 3CVWA 2PZIA 5FT9A 3HVEB 3P2BA 3ZYKA 2Y3AA 1SQMA 3PREA 4G1TA 1HE8A 4CCAA 3FH7A 3BEEA 4JC8A 5BV0A 1YA0A 3ZHEB 2R17C 2VGYA 2DCPA 4JEUA 4RVBA 5BV1A 2PQRA 4F3VA 4OVUA 4ACLA 3ESKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZ7 A;  5ARG A;  5KJK A;  3VTY A;  3IEG A;  5DIZ A;  5KJM A;  2L6J A;  5LCW C;  2KCL A;  1QQE A;  3U4T A;  4I2Z A;  3OXG A;  1HZ4 A;  4UI9 J;  2AVP A;  4WND A;  4B94 A;  5M72 A;  2HO1 A;  4GYY A;  4U07 A;  1WM5 A;  3RKV A;  2JLB A;  5CCM A;  3KAE A;  5ARF A;  2XPI A;  4IN3 B;  4KXK B;  3CVQ A;  4GA1 A;  1XNF A;  3QKY A;  2J9Q A;  2I6H A;  2UWJ G;  3Q15 A;  4BT9 A;  4I17 A;  5JJT A;  3MKR A;  2HYZ A;  1WAO 1;  4U0U A;  5G05 C;  3PE3 A;  2KCV A;  4G24 A;  3Q47 B;  4GCO A;  4WNF A;  2VSY A;  3ZHE A;  2XCC A;  4KBQ A;  3RO2 A;  4JHR A;  5A7D B;  5FJY A;  3ZPJ A;  2OOE A;  4G26 A;  4N2S A;  1IHG A;  3S7D A;  4N5C A;  5LCW J;  1ELR A;  3SF4 A;  2PQN A;  4UI9 K;  2UY1 A;  4I2W A;  2VGX B;  4GYW A;  4HOR A;  4CGW A;  3ULQ A;  2WPV A;  3LYA A;  4XI9 A;  2PL2 A;  2VYI A;  3JYS A;  3S7B A;  4JA9 A;  4JA7 A;  2LSV A;  2FI7 A;  3PDN A;  4GYO A;  4HOQ A;  4GCN A;  4BTB A;  5CCL A;  4G25 A;  4WNE A;  4GZ6 A;  3AS8 A;  3RIB A;  3QDN A;  3LCA A;  3HYM B;  3FFL A;  1KT1 A;  3QWP A;  2MHK A;  3VTX A;  2FO7 A;  2FEZ A;  4U0Z A;  4UQY A;  4J0U A;  1P5Q A;  4G2V A;  1HH8 A;  5KJL A;  4I1A A;  5JJ6 A;  1FCH A;  3UUX A;  2NC9 A;  1NZN A;  4LEU A;  3AS4 A;  3KD7 A;  2FBN A;  2VGX A;  1ZBP A;  1IYG A;  5G04 J;  4J8E A;  4Y6W A;  4A1S A;  3QOU A;  4ABN A;  2XGO A;  4U0S A;  3AS5 A;  3LY8 A;  3CK9 A;  2XGM A;  4AM9 A;  3ASG A;  1QZ2 A;  4ME2 A;  2YHC A;  4O6F A;  4I9E A;  3WXX A;  3GZ2 A;  4CGV A;  3O48 A;  3Q4A B;  3EDT B;  3LY7 A;  3QWW A;  2WQH A;  3ZFW A;  5EKQ D;  4AIF A;  3ZN3 A;  3ASH A;  5A6C A;  5FZR A;  3CK8 A;  3GZ1 A;  2KAT A;  3S7J A;  4UQX A;  3CEQ A;  5EX0 A;  3LY9 A;  3RJV A;  3MV3 B;  2LNI A;  5BT1 A;  3GW4 A;  3PE4 A;  3MV2 B;  5HQ8 A;  3R9A B;  3TAX A;  4WNG A;  4N39 A;  2YQ8 A;  3OXF A;  4N2Q A;  5FZS A;  1NA0 A;  1TJC A;  4BTA A;  4XIF A;  4G23 A;  2C0L A;  3CVP A;  2E2E A;  3K9I A;  4RG6 A;  2XCB A;  3LPZ A;  5FTP A;  1KLX A;  4Y6C A;  4UI9 C;  3UPV A;  4BWR A;  4NQ0 A;  3CKB A;  1A17 A;  2DBA A;  3UQ3 A;  3MEK A;  4U04 A;  3KS2 A;  2BUG A;  1E96 B;  3CV0 A;  5D0Q D;  4HOS A;  5C1D A;  3ASD A;  2Y4T A;  2QFC A;  3RO3 A;  4GZ5 A;  5G05 J;  4N3A A;  4YVO A;  2XGS A;  2HR2 A;  2C0M A;  3U3W A;  4CDR A;  4YVQ C;  5D0O D;  3TGO A;  4GA0 A;  3TG5 A;  3GYZ A;  4J8F A;  5EX3 A;  3Q5M A;  3URZ A;  4N3C A;  1Y8M A;  2VQ2 A;  4UQZ A;  5BW8 C;  1ELW A;  4HOU A;  4H7Y A;  3CK7 A;  2UY1 B;  4AY5 A;  4RG9 A;  3CVL A;  5DBK A;  2VSN A;  5HI7 A;  2P58 C;  3RU0 A;  4WUY A;  5CHE E;  2XEV A;  5BNW A;  2KCK A;  2V5F A;  2OND A;  3QWV A;  4APO A;  3CKC A;  3Q49 B;  4XI0 A;  3E4B A;  4W9R A;  1ZU2 A;  2IF4 A;  3TG4 A;  4AY6 A;  3ASF A;  3CVN A;  2LSU A;  2R5S A;  4GZ3 A;  2C2L A;  4GA2 A;  3ZGQ A;  1OUV A;  2Y4U A;  4J8D A;  5JJ7 A;  1PC2 A;  2KC7 A;  4NRH B;  5KJN A;  2GW1 A;  3FWV A;  4GPK A;  5FZQ A;  4YND A;  2IFU A;  1HXI A;  1NA3 A;  3S7F A;  4JL0 A;  1KT0 A;  4H7X A;  4HOT A;  3MA5 A;  5G04 C;  2FF4 A;  4I9C A;  3N71 A;  3OXL A;  3LKU A;  1W3B A;  4KYO B;  2Q7F A;  1B89 A;  4EQF A;  5AYW D;  3NF1 A;  4BT8 A;  3FP3 A;  4N3B A;  2PZI A;  5FT9 A;  4G1T A;  3BEE A;  1YA0 A;  3ZHE B;  2VGY A;  2PQR A;  4F3V A;  3ESK A; 
#chains in the Genus database with same CATH topology
 2V5Q C;  4L23 A;  5ARG A;  1TN6 A;  5KJM A;  2KCL A;  1JWF A;  4I2Z A;  3Q9U C;  2WXI A;  4I6J A;  4B94 A;  5M72 A;  4KVO A;  2BED A;  1TNY A;  1YMP A;  2HO1 A;  3DPD A;  4U07 A;  3D9L A;  4KZ0 A;  2YIN A;  3KAE A;  3QAR A;  3BQO A;  2AXZ A;  2IO2 C;  1QBQ A;  1Z3X A;  4IUL A;  4GA1 A;  3QKY A;  4JB8 P;  2UWJ G;  2ETB A;  3QJZ A;  4BT9 A;  4I17 A;  5JJT A;  2HYZ A;  2OVF A;  3DEP A;  4G24 A;  3Q47 B;  4KVM A;  3UKR G;  2VSY A;  4FJY A;  2X6H A;  3JQ1 A;  3CVU A;  4WAF A;  4LNU D;  3ZPJ A;  4JXT A;  4N2S A;  4N5C A;  3Q75 A;  5JMN D;  2ZIS A;  1ELR A;  4MRU A;  2DVW A;  1JWG A;  3FTS A;  5A23 A;  3TJP A;  4I2W A;  2LAI A;  3TL5 A;  4HOR A;  1TNZ A;  3ULQ A;  3L13 A;  2PL2 A;  2VYI A;  4U8H A;  2AW6 A;  4TXR A;  3PZD A;  1OWM A;  1EDU A;  2J09 A;  4J6I A;  4BTB A;  1UN9 A;  1MJ0 A;  3FUN A;  4CDM A;  3ONK A;  3EU5 A;  1V54 E;  3QDN A;  1AWC B;  2R59 A;  2J4D A;  4LRZ A;  3HYM B;  3TWV A;  2FO7 A;  4OVV A;  1IQR A;  2R05 A;  3W9F A;  4GTQ A;  3B7B A;  4J0U A;  2XEN A;  3FUK A;  4TV3 A;  2KM4 A;  3D9P A;  4C9B B;  5KJL A;  4QQI A;  5JJ6 A;  1E8Y A;  4GZD A;  5T4Y A;  1DCE A;  3VLD A;  4CDN A;  2EIM E;  3UM2 A;  4LEU A;  3C3R A;  4AOF A;  4LNG A;  2R03 A;  1ZBP A;  2IQC A;  5G04 J;  2VTB A;  2XS1 A;  2XGO A;  4DX2 A;  2CHX A;  2XGM A;  3CGH A;  3CK9 A;  4AM9 A;  4B8A A;  5FQ8 A;  4ME2 A;  1HG2 A;  1D8D A;  4DPR A;  4GML A;  4D10 C;  1JUQ A;  3NZU A;  2I1K A;  3AG4 E;  4CEM A;  4A63 B;  5A6C A;  1D9S A;  2OVB A;  3UM0 A;  3DEO A;  2KAT A;  3S7J A;  3MJW A;  4FP7 A;  3SI5 A;  3CEQ A;  1U3D A;  3LY9 A;  3S2A A;  2EIN E;  3MV3 B;  2LNI A;  1OCO E;  2OCC E;  3CR3 A;  3PE4 A;  5ENO D;  1WY6 A;  4WNG A;  3IV0 A;  4XIF A;  2A5U A;  2EIJ E;  5AEN A;  1OWP A;  2RFA A;  3FU5 A;  3K9I A;  4RG6 A;  1NFI E;  2CHZ A;  3D9O A;  5FTP A;  1OCC E;  2WXP A;  5LOZ A;  4F53 A;  3APF A;  4ANX A;  3RSE G;  1SW6 A;  3ABL E;  4NQ0 A;  3CKB A;  3CQC B;  1DNP A;  4PH4 B;  3D9N A;  1MYO A;  5D0Q D;  3MZL B;  2XS8 A;  3UM3 A;  3LVQ E;  4LG6 A;  2Y4T A;  1N0Q A;  2QFC A;  1N54 A;  3T8M A;  5BXO A;  5G05 J;  3B7S A;  4A3T A;  1PY1 A;  4C48 B;  4FAD A;  3UT7 A;  1N4S A;  3FUE A;  4DLQ A;  3V31 A;  2XGS A;  3P1U A;  4J7W A;  4CRW A;  3NOC D;  3U3W A;  4YVQ C;  3L08 A;  3UXG A;  3UKU G;  3KEA A;  4XZ4 A;  1E8Z A;  5EYP F;  4ATZ D;  4WWP A;  3AU5 A;  3TG5 A;  1S63 A;  3G2W A;  4J8F A;  3IBE A;  5ENR D;  3ISM C;  4N3C A;  5FWQ A;  3CK7 A;  1MHQ A;  1WDY A;  4AV7 A;  5DBK A;  2VSN A;  5HI7 A;  3D9J A;  3OTN A;  2VSX E;  3R7R A;  1MX2 A;  3PZ1 A;  1ELK A;  2KXP C;  1BU9 A;  2F0Y A;  4APO A;  3CKC A;  1ZU2 A;  2IF4 A;  1FT2 A;  3D9K A;  4NUR A;  3CVN A;  4UWK A;  4B0Z A;  4HB5 A;  2C2L A;  3NAW A;  3JQ0 A;  3AAA C;  3ZGQ A;  1OUV A;  3HDX A;  4J8D A;  4AVX A;  2XRZ A;  3IHY A;  1LD8 A;  2KC7 A;  4M7C A;  4TXP A;  3EIJ A;  3TXM A;  4APF A;  3E34 A;  1D8E A;  2WXN A;  3FH8 A;  3FUF A;  3EUV A;  1NA3 A;  3RRM B;  3S7F A;  4JL0 A;  4GB9 A;  4HRL A;  3RRN B;  4BER A;  2VTB B;  3F6Q A;  1TN7 A;  3EJN A;  3N71 A;  3LKU A;  4HRN A;  3EIQ C;  1W3B A;  3LJ3 A;  3KSQ A;  2WMO A;  5AYW D;  2J07 A;  3TWU A;  3D3M A;  2WXG A;  5JHA A;  4LNB A;  3P2B A;  3PRE A;  1HE8 A;  3V2O A;  4RVB A;  2PQR A;  3AG1 E;  4F3V A;  4C0E A;  5EID A;  3SZ7 A;  3IEG A;  5DIZ A;  3TWR A;  2L6J A;  2ZU6 B;  3U4T A;  2I2O A;  4E6H A;  5LX8 A;  3MYV A;  2IO3 C;  4UUC A;  1HZ4 A;  4UI9 J;  3UTM A;  1PAQ A;  4FC8 A;  2XPZ A;  3TWT A;  4HBD A;  2I9C A;  1N4R A;  2OV8 A;  1OWN A;  2V4H C;  3LS8 A;  2B6C A;  3ABK E;  5CCM A;  3SD5 A;  1Y6I A;  4IN3 B;  4XX5 A;  5J08 A;  1VDY A;  3FY4 A;  3EHM A;  3D9M A;  2I6H A;  3TWQ A;  1MQS A;  3SBT B;  3Q15 A;  3JUI A;  4U0U A;  1FVF A;  2GRL A;  1V55 E;  3FUL A;  2OEV A;  4GCO A;  2I1J A;  3ZHE A;  1N4Q A;  3C98 A;  4KBQ A;  5BXU A;  3RO2 A;  4JHR A;  4PS8 A;  3PEV B;  1O1S A;  1IHG A;  4HXI A;  5CED B;  5AQB A;  4K5B A;  4HI8 A;  1N9A A;  3GZS A;  2UY1 A;  2VSO E;  2L6B A;  4GYW A;  4XI9 A;  3NOG D;  3FU3 A;  3JYS A;  3PS6 A;  3NQP A;  1UOH A;  3PDN A;  5AJL A;  3E32 A;  2J08 A;  3PNT B;  3HG0 D;  3AS8 A;  2VGE A;  2NSZ A;  3ZIM A;  1N94 A;  2FEZ A;  4K5A B;  4URK A;  2IOS A;  4U0Z A;  4BX9 A;  5FIO A;  5G2N A;  1N11 A;  2WXK A;  3ASO E;  5AN8 A;  3APD A;  4I1A A;  4U95 D;  2RKK A;  1NZN A;  2CHW A;  4AP2 A;  3Q7F A;  2R2L A;  3KD7 A;  2VGX A;  3CSF A;  4OAV B;  4ABN A;  4UWH A;  3FTU A;  3FTV A;  2DYR E;  3LY8 A;  4DX7 D;  3ASG A;  4ZHB A;  1E90 A;  1NP7 A;  4M3O A;  5EDS A;  3AG2 E;  1H6P A;  4A1G A;  3GZ2 A;  4DX1 A;  3U66 A;  1H6O A;  4CGV A;  3O48 A;  3Q4A B;  3EDT B;  1IXV A;  2ILR A;  4J8Y A;  4XKC A;  5BV0 A;  4L1B A;  1FPP A;  3ZFW A;  2AXU A;  3EHQ A;  4AIF A;  4DRX E;  3SY2 A;  4B8C B;  3PRZ A;  4UQX A;  5EX0 A;  1EYH A;  3JXJ A;  3HIZ A;  3FHE A;  5AJD A;  1XGW A;  4U63 A;  4N2Q A;  5FZS A;  2ZIR A;  4BTA A;  3ML9 A;  2P9K G;  4UWG A;  1BI7 B;  3ZW3 A;  2C0L A;  2E2E A;  2WMN A;  3DXK G;  3LDZ A;  2XCB A;  4Y6C A;  3SHF A;  1N0R A;  3LEW A;  4GTT A;  1A17 A;  2DBA A;  2P9U G;  4RSY A;  1WG0 A;  3U64 A;  4U04 A;  2FUL A;  2BUG A;  2IY0 C;  5T3R A;  2P9N G;  3FEY A;  3J5P A;  4BET A;  2V0P A;  4GZ5 A;  3V79 K;  4I1M A;  4N3A A;  1UW4 B;  3SO8 A;  3DRA A;  2XZD G;  2F8Y A;  4ANV A;  3ZYM A;  3G2S A;  2C0M A;  2XPY A;  5H7P A;  1UN8 A;  4CDR A;  5JHB A;  5FIN A;  3ZXP A;  4I6G A;  4BES A;  4GA0 A;  4HNA D;  2QYJ A;  1AP7 A;  5EX3 A;  1TNU A;  4KMO A;  1JCS A;  5CER B;  4CT0 A;  2VQ2 A;  5BW8 C;  3Q7A A;  5AAR A;  1ELW A;  3FUI A;  3EHN A;  4HOU A;  1HG5 A;  3D9H A;  5FQ7 A;  2UY1 B;  4FHK A;  3DXM G;  2LUH A;  4TRQ A;  2NYJ A;  2P58 C;  2H6H A;  1SZA A;  4I1O B;  3ESL A;  2WXQ A;  4WUY A;  1MX6 A;  1TR4 A;  3IKO B;  3FUH A;  1K3Z D;  4XI0 A;  5HRY A;  3E4B A;  4GMR A;  4X8Q A;  3ZRH A;  5AQA A;  2DYS E;  5KCM A;  4EZK A;  4AY6 A;  4CZ2 D;  4GZ3 A;  1SZ9 A;  2QYU A;  2Y4U A;  2MYO A;  5E75 A;  2Y1L E;  1TYQ G;  2XZT G;  3B13 A;  2GW1 A;  3TWW A;  3AG3 E;  2RD0 A;  5LP0 A;  1DVP A;  5FZQ A;  3VLF A;  3UIN C;  2AJA A;  2LAH A;  3PVL A;  2ZXW E;  4Q94 A;  4H7X A;  1GW6 A;  1K1B A;  2J49 A;  3NBN B;  2AXV A;  3ZYQ A;  2EIL E;  4L2L A;  4JVS A;  3CVX A;  4BSZ B;  1H2U A;  4EQF A;  1TJF A;  3MCX A;  3NF1 A;  4RLY A;  4BT8 A;  4F7A A;  4JHJ A;  3ZXS A;  2PZI A;  3AJI A;  4XEI G;  2OEW A;  5CEA A;  4JEU A;  2DCP A;  5BV1 A;  3ESK A;  2GRO B;  3DWL G;  3L54 A;  5CBN A;  2IEJ A;  4L2Y A;  4TUU A;  4U8Y D;  1Z5S C;  5CEC B;  3L17 A;  2WXM A;  1INZ A;  1G3N B;  5ANR A;  1U2V G;  4I43 A;  3SNX A;  1WM5 A;  4C0M A;  4PUC A;  3SQV A;  3RKV A;  2JLB A;  2V8S E;  2J8S D;  4TUM A;  4HRM B;  3HRA A;  5ARF A;  4AXH A;  5ENS D;  4PS3 A;  2QY7 A;  4MS6 A;  1LTX A;  4KXK B;  3CVQ A;  1DC2 A;  4ILG A;  1XNF A;  5CMY A;  2CG3 A;  3UM1 A;  1TNO A;  3I4G A;  4HLE A;  2L0T B;  3AU4 A;  3CHS A;  1OCR E;  1WAO 1;  5AQ9 A;  3DSU A;  3APC A;  1KZO A;  1N52 A;  2F8X K;  4WWN A;  3HVE A;  5T8I A;  3C3O A;  2XCC A;  4TXQ A;  4P29 A;  2P9P G;  5A7D B;  5FJY A;  2OOE A;  4G26 A;  3ML8 A;  2P9L G;  3L6A A;  3SF4 A;  2PQN A;  4XE0 A;  4UI9 K;  4GMJ A;  5ENT D;  2XQ0 A;  3MKQ A;  2WVI A;  4FHJ A;  1UG3 A;  2WQ6 A;  2WPV A;  3LYA A;  4GPM A;  5B1A E;  4Q69 A;  3S7B A;  4JA9 A;  2LSV A;  3EHR A;  3ZVV A;  5CRV A;  4HOQ A;  4BFR A;  2HM8 A;  4B93 B;  1O5M A;  2GRR B;  5CCL A;  4LUN U;  4WNE A;  2X6I A;  4GZ6 A;  3FDH A;  3CLJ A;  3LCA A;  4K0R A;  3FFL A;  4ANW A;  3VTX A;  2EIK E;  2EQX A;  3B7U X;  1OWO A;  4UQY A;  1OCZ E;  3PZ3 A;  3UUX A;  3RK6 A;  2DWZ A;  4L7T A;  3CIA A;  4Q96 A;  5BPP A;  4EBA G;  2GGF A;  1BLX B;  4K03 A;  2YHE A;  2P9S G;  5D2M C;  2CFZ A;  1IYG A;  1JCR A;  5ENP D;  4J8E A;  3QOU A;  4U0S A;  3ZYL A;  3KSL A;  3CHR A;  2IJG X;  5JA4 D;  2YHC A;  3Q73 A;  3O4Z A;  4O6F A;  3OAW A;  3G2U A;  2B0O E;  3DSS A;  4LER A;  2X6K A;  3LY7 A;  3QWW A;  3I3N A;  2E0I A;  2XHE A;  5EKQ D;  3ZN3 A;  2ETA A;  3T5V A;  1UJJ A;  3HXD A;  5ITZ F;  3CK8 A;  1N4P A;  3GZ1 A;  2KBX A;  3NB2 A;  5AQ7 A;  4YDY A;  2IU1 A;  4A55 A;  5BT1 A;  3MV2 B;  4EHM A;  4N39 A;  2YQ8 A;  2VJ8 A;  1HS6 A;  3OXF A;  3IHV A;  4BSX A;  1LF8 A;  2X6F A;  1X81 A;  1U3C A;  4G23 A;  3KEZ A;  4DX5 D;  2LXM A;  3CVP A;  2ETC A;  1S70 B;  2X6J A;  3C5R A;  4QFV A;  1KLX A;  2H6F A;  3FTY A;  4G11 A;  3UPV A;  2XEE A;  2WXL A;  3UT4 A;  4GU5 A;  1RZ4 A;  3VLE A;  3MEK A;  1H19 A;  3UMV A;  3CVV A;  3CV0 A;  4U8V D;  2JEK A;  5C1D A;  3SBS A;  3ASD A;  2PNN A;  3RO3 A;  5BUZ A;  5D66 A;  1BD8 A;  5CBO A;  4KZC A;  4HVB A;  2IOL A;  2F37 A;  4YDE A;  4YVO A;  4FU3 A;  3CHM A;  2HR2 A;  4V3I A;  3PZ2 A;  3EU9 A;  5D0O D;  3W9G A;  1NL4 A;  2Y69 E;  3TGO A;  4NIK A;  2H6G A;  1ZB1 A;  2DZO A;  3URZ A;  3QB2 A;  1Z6T A;  2XEH A;  4DK5 A;  4CYM D;  1Y8M A;  4KT6 B;  4UQZ A;  4JEH A;  5KWD A;  4GZC A;  4H7Y A;  4AY5 A;  1SA4 A;  3CVL A;  3MKQ B;  3HXE A;  2PM6 A;  4Z68 A;  4B89 A;  4OAU C;  1OXJ A;  2QC9 A;  3RU0 A;  1NI1 A;  5CHE E;  4AJW A;  2XEV A;  2GRP B;  4F1P A;  3CHO A;  4MKT A;  4DI4 A;  4EZL A;  3BUA A;  5BNW A;  4ILI A;  2JAB A;  2V5F A;  3ZNG A;  3HHM A;  3TG4 A;  5KBA A;  3ASF A;  2LSU A;  2BTD A;  2R5S A;  4CT4 A;  3LJN A;  4K5C A;  2LO6 A;  4GA2 A;  2P2C P;  3ULE G;  3FTW A;  3FU6 A;  5JJ7 A;  4J8S A;  4NRH B;  4EBA A;  4GTR A;  4JZY A;  2LXL A;  3L82 A;  1BI8 B;  1N95 A;  3X2Q E;  4GPK A;  4BY6 A;  4BX8 A;  1HF8 A;  1FT1 A;  3Q9N C;  1Z3Y A;  3JCK C;  1KT0 A;  4HOT A;  1FVH A;  4E85 A;  5G04 C;  4N5Q A;  3JXI A;  4YDW A;  2FF4 A;  3UIO C;  5KNH D;  3D9I A;  2CFU A;  4I9C A;  3ZU7 B;  4IYP A;  3ULY A;  3FTZ A;  1K8K G;  5IY5 E;  3OXL A;  5CRU A;  5ANL A;  1IQU A;  3WG7 E;  3R9M A;  4KYO B;  4HQD A;  2Q7F A;  2L9B A;  4ILH B;  5EIL A;  3NZS A;  4AEZ C;  4N3B A;  1YYH A;  5FT9 A;  3ZYK A;  2Y3A A;  4MBG A;  4CCA A;  3BEE A;  3E37 A;  3ZHE B;  3ABM E;  2R17 C;  2VGY A;  4OVU A;  3HXC A;  4IRU A;  5KJK A;  3VTY A;  5LCW C;  1QQE A;  1E8X A;  3OXG A;  3QNK A;  2WM9 A;  3C3Q A;  2A4Z A;  2AVP A;  4PS7 A;  4WND A;  1TN8 A;  1IKN D;  4GYY A;  4RQI A;  1QNF A;  1KPS B;  4MLP A;  3T5X A;  4GTO A;  3PUJ A;  4JW1 A;  2XPI A;  4WWO A;  3MGB A;  5HKP A;  4G8K A;  3ENE A;  3B7R L;  2J9Q A;  4FUL A;  2R02 A;  3B7T A;  5B1B E;  1SVX A;  1E7U A;  4FJZ A;  2GRN B;  3MKR A;  5G05 C;  3PE3 A;  2KCV A;  3B95 A;  1O1T A;  2BKG A;  1SA5 A;  3Q79 A;  4WNF A;  5HS0 A;  4LSZ E;  2DZN A;  3G2T A;  3JUE A;  3V30 A;  1HFA A;  2X3M A;  3S7D A;  3UX4 A;  1E7V A;  3CHQ A;  5LCW J;  5E76 A;  3TWS A;  3LVR E;  2VGX B;  4FA6 A;  1MX4 A;  2MOW A;  3MX3 A;  3J5Q B;  4CGW A;  4G8L A;  4OYS A;  1OWL A;  1RW2 A;  4JA7 A;  4R7L A;  2WXO A;  2FI7 A;  2ZGG A;  4GYO A;  4YDO A;  4JHK A;  4GCN A;  3BG0 B;  2AWI A;  2H6I A;  4G25 A;  3PUK A;  3I5P A;  3RIB A;  2CG2 A;  4U7E B;  1H2V C;  1KT1 A;  2BKK B;  1HO8 A;  3QWP A;  2MHK A;  4PDX A;  3BU8 A;  4DLO A;  2Y0B G;  4F6R D;  5J90 A;  2WXH A;  1P5Q A;  4G2V A;  1HH8 A;  3HXB A;  3RAU A;  1FCH A;  2NC9 A;  3CQG B;  3TXN A;  2BF0 X;  3UI2 A;  5ENQ D;  2NXP A;  5CMW A;  3AS4 A;  2RG8 A;  2FBN A;  3ZEF A;  4JD2 G;  4Y6W A;  4A1S A;  3E30 A;  4GTM A;  3AS5 A;  5FQ4 A;  3E33 A;  4FLB A;  1K1A A;  3V2X A;  1Q2Z A;  1QZ2 A;  2QZA A;  3I4R B;  1MZC A;  3WXX A;  4I9E A;  3UIP C;  1IHB A;  2KZT A;  1O1R A;  4A3V A;  2WB2 A;  3QAQ A;  3FEX A;  2WQH A;  1UJK A;  4F1S A;  1QYM A;  3ASH A;  3DSV A;  5FZR A;  2WXJ A;  3SGH A;  2YNQ A;  5B3S E;  2RFM A;  5EN5 D;  4HI9 A;  2DIW A;  3LXU X;  3RJV A;  2X38 A;  3G2V A;  4UWF A;  1X5B A;  4GTV A;  3GW4 A;  1DCQ A;  2FO1 E;  5HQ8 A;  1OT8 A;  3T9K A;  4O60 A;  3R9A B;  3TAX A;  4O1O A;  3FUD A;  5C2Y A;  2GRM A;  1JPL A;  1NA0 A;  1TJC A;  2ZGD A;  3DSW A;  3PH0 C;  3FH5 A;  4GAA A;  2MRI A;  3LPZ A;  3FU0 A;  5G55 A;  3RRU A;  2ION A;  3CVY A;  4UI9 C;  2HE0 A;  3ZUV B;  4BWR A;  4ANU A;  3CHP A;  4FLH A;  3UQ3 A;  3Q78 A;  3KS2 A;  1E96 B;  5EIB E;  4HOS A;  4GTP A;  2M63 A;  2WXF A;  1H6K A;  3L16 A;  4HFG A;  3BG1 B;  3CST A;  2GRQ B;  3SFY A;  3L22 A;  3ZKJ A;  4DX6 D;  1EPU A;  4HLL A;  1L5J A;  1LD7 A;  3GYZ A;  1S0P A;  3Q5M A;  1TNB A;  3FUJ A;  4LCT A;  1EF1 C;  4EPZ A;  3SFZ A;  5EYL A;  4DJA A;  4DI3 A;  4HS2 A;  3ONL A;  4UWL A;  4RG9 A;  3R7Q A;  3DBS A;  1H2T C;  3C72 A;  3PNL B;  4U96 D;  3PZ4 A;  5FQ6 A;  5ENN A;  3DST A;  5AIJ A;  1A5E A;  2KCK A;  2OND A;  2P9I G;  3QWV A;  3Q49 B;  4W9R A;  2WXR A;  3IXE A;  4BEP A;  4DUI A;  5LFA A;  3DSX A;  3FUM A;  3L9T A;  4EZJ A;  4NAC A;  1H0A A;  1S64 A;  1PC2 A;  1HX8 A;  1E8W A;  4I6E A;  5KJN A;  2PM7 A;  3FWV A;  4GTS A;  4ATG A;  3SFX A;  3TWX A;  1TEZ A;  4YND A;  1KZP A;  3UT8 A;  4O1P A;  3FTX A;  2IFU A;  1HXI A;  4JPS A;  2XRY A;  3HXF A;  4ACK A;  2L0I A;  5AAO A;  4XKB A;  3MA5 A;  1JCQ A;  1BPO A;  4L9P A;  3QC1 A;  4EEC A;  1HU3 A;  2WQ7 A;  3QK0 A;  5KNG A;  2V4L A;  1B89 A;  2KZT B;  2J4B A;  3U9W A;  2A5E A;  3PEU B;  4ZFH A;  3FP3 A;  3T8K A;  3CVW A;  3DPY A;  1OY3 D;  3HVE B;  1SQM A;  4G1T A;  3FH7 A;  4JC8 A;  1YCS B;  1YA0 A;  3ASN E;  4ACL A; 
#chains in the Genus database with same CATH homology
 3SZ7 A;  3L54 A;  4L23 A;  5ARG A;  4IRU A;  5KJK A;  4L2Y A;  3VTY A;  3IEG A;  4TUU A;  5DIZ A;  5KJM A;  2L6J A;  5LCW C;  2KCL A;  1QQE A;  2ZU6 B;  1JWF A;  3L17 A;  3U4T A;  4I2Z A;  2WXM A;  2I2O A;  4E6H A;  5LX8 A;  1INZ A;  5ANR A;  3MYV A;  1E8X A;  3OXG A;  3QNK A;  2WM9 A;  4I43 A;  2WXI A;  4I6J A;  1HZ4 A;  4UI9 J;  2A4Z A;  2AVP A;  3SNX A;  4PS7 A;  4WND A;  4B94 A;  5M72 A;  1PAQ A;  4KVO A;  2HO1 A;  3DPD A;  4GYY A;  4U07 A;  4FC8 A;  1WM5 A;  2XPZ A;  4C0M A;  3D9L A;  4PUC A;  2I9C A;  1QNF A;  2OV8 A;  1OWN A;  4MLP A;  3T5X A;  3RKV A;  4KZ0 A;  2YIN A;  3LS8 A;  2JLB A;  2V8S E;  5CCM A;  3PUJ A;  3KAE A;  4JW1 A;  3QAR A;  2XPI A;  5ARF A;  3SD5 A;  4AXH A;  1Y6I A;  4IN3 B;  4PS3 A;  4WWO A;  4XX5 A;  2AXZ A;  1VDY A;  2QY7 A;  3MGB A;  4MS6 A;  5J08 A;  3FY4 A;  4KXK B;  3CVQ A;  1Z3X A;  4IUL A;  3ENE A;  3B7R L;  4ILG A;  3EHM A;  1XNF A;  3D9M A;  4GA1 A;  3QKY A;  2J9Q A;  4FUL A;  5CMY A;  3B7T A;  2CG3 A;  2I6H A;  2UWJ G;  1MQS A;  3I4G A;  3QJZ A;  3SBT B;  3Q15 A;  4BT9 A;  2L0T B;  3AU4 A;  3CHS A;  1E7U A;  4FJZ A;  4I17 A;  4HLE A;  5JJT A;  3JUI A;  3MKR A;  2HYZ A;  1WAO 1;  2OVF A;  4U0U A;  1FVF A;  5G05 C;  3APC A;  3PE3 A;  2GRL A;  2KCV A;  4G24 A;  1N52 A;  3FUL A;  3Q47 B;  4WWN A;  3HVE A;  5T8I A;  4GCO A;  4KVM A;  4WNF A;  2I1J A;  2VSY A;  3ZHE A;  4FJY A;  3C98 A;  2XCC A;  2X6H A;  4KBQ A;  3RO2 A;  3G2T A;  3JQ1 A;  4P29 A;  3CVU A;  4WAF A;  4JHR A;  5A7D B;  5FJY A;  3ZPJ A;  4PS8 A;  2OOE A;  3PEV B;  4G26 A;  4JXT A;  1HFA A;  4N2S A;  1IHG A;  2X3M A;  3S7D A;  3UX4 A;  4N5C A;  1E7V A;  4HXI A;  3CHQ A;  5LCW J;  1ELR A;  3ML8 A;  4MRU A;  5E76 A;  3L6A A;  3SF4 A;  2PQN A;  4XE0 A;  3GZS A;  3LVR E;  3FTS A;  1JWG A;  4UI9 K;  2UY1 A;  2VSO E;  4GMJ A;  5A23 A;  2XQ0 A;  3MKQ A;  2WVI A;  3TJP A;  4I2W A;  2LAI A;  2VGX B;  4FA6 A;  4FHJ A;  2MOW A;  1UG3 A;  3TL5 A;  4GYW A;  3MX3 A;  4CGW A;  2WQ6 A;  4HOR A;  3ULQ A;  2WPV A;  3L13 A;  3LYA A;  4XI9 A;  2PL2 A;  2VYI A;  4OYS A;  1OWL A;  3FU3 A;  4U8H A;  4Q69 A;  3JYS A;  2AW6 A;  3S7B A;  4JA9 A;  4JA7 A;  2LSV A;  4R7L A;  3PZD A;  2WXO A;  3ZVV A;  2FI7 A;  3PS6 A;  3NQP A;  1OWM A;  1EDU A;  2J09 A;  3PDN A;  4GYO A;  5AJL A;  4HOQ A;  4JHK A;  4GCN A;  4J6I A;  4BTB A;  1UN9 A;  4BFR A;  2HM8 A;  3BG0 B;  2AWI A;  5CCL A;  2J08 A;  3PNT B;  4LUN U;  4G25 A;  4WNE A;  3FUN A;  4CDM A;  3PUK A;  2X6I A;  3I5P A;  4GZ6 A;  3FDH A;  3ONK A;  3AS8 A;  3CLJ A;  3RIB A;  3QDN A;  2CG2 A;  3LCA A;  4K0R A;  2R59 A;  2J4D A;  1H2V C;  4LRZ A;  2NSZ A;  3HYM B;  3ZIM A;  3FFL A;  1KT1 A;  1HO8 A;  3QWP A;  2MHK A;  4ANW A;  3VTX A;  4PDX A;  4DLO A;  2EQX A;  2FO7 A;  2FEZ A;  3B7U X;  4OVV A;  1IQR A;  4URK A;  2IOS A;  4U0Z A;  4BX9 A;  1OWO A;  4UQY A;  4J0U A;  5J90 A;  5G2N A;  2WXH A;  1P5Q A;  3FUK A;  4TV3 A;  2KM4 A;  2WXK A;  3D9P A;  4G2V A;  1HH8 A;  3APD A;  4C9B B;  5KJL A;  4I1A A;  5JJ6 A;  1FCH A;  1E8Y A;  4GZD A;  2NC9 A;  3UUX A;  3RK6 A;  5T4Y A;  3CQG B;  3TXN A;  1NZN A;  4L7T A;  3VLD A;  3CIA A;  2BF0 X;  2CHW A;  4AP2 A;  4CDN A;  4Q96 A;  5BPP A;  2NXP A;  4LEU A;  4EBA G;  2GGF A;  5CMW A;  4AOF A;  3AS4 A;  2RG8 A;  4K03 A;  2YHE A;  3KD7 A;  2FBN A;  2VGX A;  1ZBP A;  2CFZ A;  3CSF A;  1IYG A;  2IQC A;  5G04 J;  3ZEF A;  4J8E A;  2VTB A;  4Y6W A;  4A1S A;  3QOU A;  4ABN A;  2XGO A;  4U0S A;  3FTU A;  4UWH A;  3AS5 A;  3FTV A;  3ZYL A;  5FQ4 A;  3CHR A;  3LY8 A;  2IJG X;  2CHX A;  2XGM A;  3CGH A;  3CK9 A;  3ASG A;  4FLB A;  4AM9 A;  4B8A A;  5FQ8 A;  1QZ2 A;  4ME2 A;  1E90 A;  2YHC A;  1NP7 A;  3I4R B;  1HG2 A;  4M3O A;  3O4Z A;  4O6F A;  4I9E A;  3WXX A;  5EDS A;  4DPR A;  3OAW A;  4A1G A;  3G2U A;  4GML A;  3GZ2 A;  4LER A;  2KZT A;  4D10 C;  3U66 A;  4A3V A;  2WB2 A;  1JUQ A;  4CGV A;  2X6K A;  3O48 A;  3Q4A B;  3EDT B;  2ILR A;  3NZU A;  3LY7 A;  2I1K A;  3FEX A;  3QAQ A;  4XKC A;  3QWW A;  2WQH A;  4L1B A;  1UJK A;  3I3N A;  2E0I A;  2XHE A;  4CEM A;  3ZFW A;  4F1S A;  2AXU A;  5EKQ D;  4AIF A;  3ZN3 A;  3ASH A;  5A6C A;  3T5V A;  5FZR A;  1UJJ A;  2WXJ A;  3SGH A;  2YNQ A;  3CK8 A;  3GZ1 A;  2OVB A;  4B8C B;  2KAT A;  3PRZ A;  3S7J A;  3MJW A;  2DIW A;  2IU1 A;  3LXU X;  4FP7 A;  3CEQ A;  1U3D A;  4UQX A;  3LY9 A;  5EX0 A;  3S2A A;  3SI5 A;  3RJV A;  3MV3 B;  2LNI A;  4A55 A;  2X38 A;  3G2V A;  4UWF A;  5BT1 A;  1EYH A;  1X5B A;  3CR3 A;  3GW4 A;  3MV2 B;  3PE4 A;  5HQ8 A;  3R9A B;  1WY6 A;  3TAX A;  4WNG A;  3FUD A;  4N39 A;  3HIZ A;  3FHE A;  5AJD A;  2YQ8 A;  5C2Y A;  2VJ8 A;  1XGW A;  1HS6 A;  3OXF A;  4U63 A;  2GRM A;  3IHV A;  3IV0 A;  4BSX A;  1JPL A;  5FZS A;  4N2Q A;  1LF8 A;  1NA0 A;  1TJC A;  2X6F A;  4BTA A;  3ML9 A;  4XIF A;  4C0E A;  2A5U A;  1U3C A;  4UWG A;  4G23 A;  3ZW3 A;  5AEN A;  2C0L A;  3KEZ A;  3CVP A;  2E2E A;  1OWP A;  3FU5 A;  3K9I A;  2WMN A;  2X6J A;  3PH0 C;  3LDZ A;  3FH5 A;  4GAA A;  4RG6 A;  2MRI A;  2XCB A;  2CHZ A;  3D9O A;  3LPZ A;  3FU0 A;  4QFV A;  5FTP A;  1KLX A;  5G55 A;  2WXP A;  4Y6C A;  3RRU A;  2ION A;  5LOZ A;  3FTY A;  4G11 A;  4F53 A;  3APF A;  3CVY A;  4ANX A;  3SHF A;  4UI9 C;  3UPV A;  3LEW A;  4BWR A;  4NQ0 A;  3CKB A;  4ANU A;  2WXL A;  3CHP A;  4FLH A;  3UT4 A;  3CQC B;  1A17 A;  2DBA A;  1DNP A;  4GU5 A;  4PH4 B;  3UQ3 A;  4RSY A;  3VLE A;  3MEK A;  3D9N A;  3U64 A;  1H19 A;  2FUL A;  3KS2 A;  4U04 A;  2BUG A;  1E96 B;  3UMV A;  3CVV A;  3CV0 A;  5D0Q D;  4HOS A;  3MZL B;  2JEK A;  5C1D A;  3SBS A;  3LVQ E;  3ASD A;  5T3R A;  2Y4T A;  2M63 A;  3FEY A;  2QFC A;  1N54 A;  2WXF A;  1H6K A;  3L16 A;  4HFG A;  2V0P A;  4GZ5 A;  5G05 J;  4I1M A;  3B7S A;  3RO3 A;  4N3A A;  3T8M A;  5BUZ A;  4A3T A;  1PY1 A;  1UW4 B;  3BG1 B;  4KZC A;  3UT7 A;  4FAD A;  4HVB A;  2IOL A;  3FUE A;  4DLQ A;  4YVO A;  4FU3 A;  2XGS A;  3P1U A;  3CHM A;  4ANV A;  3ZYM A;  3G2S A;  4CRW A;  2HR2 A;  4V3I A;  2C0M A;  2XPY A;  1UN8 A;  3CST A;  4CDR A;  3U3W A;  5JHB A;  4YVQ C;  3L08 A;  4I6G A;  5D0O D;  3TGO A;  3L22 A;  4GA0 A;  4XZ4 A;  1E8Z A;  1EPU A;  4WWP A;  3AU5 A;  3TG5 A;  1L5J A;  3G2W A;  3GYZ A;  4J8F A;  5EX3 A;  1S0P A;  3Q5M A;  3IBE A;  3FUJ A;  3QB2 A;  4LCT A;  3URZ A;  1Z6T A;  1EF1 C;  4EPZ A;  4KMO A;  4DK5 A;  4N3C A;  3SFZ A;  4CT0 A;  1Y8M A;  2VQ2 A;  4KT6 B;  4UQZ A;  4JEH A;  5BW8 C;  4DJA A;  4GZC A;  5FWQ A;  1ELW A;  3FUI A;  3EHN A;  4HOU A;  1HG5 A;  4DI3 A;  4H7Y A;  3CK7 A;  4HS2 A;  5FQ7 A;  2UY1 B;  4AY5 A;  3ONL A;  4UWL A;  1MHQ A;  4RG9 A;  3R7Q A;  4AV7 A;  3CVL A;  3MKQ B;  4FHK A;  5DBK A;  2VSN A;  5HI7 A;  3DBS A;  2PM6 A;  3D9J A;  3OTN A;  4TRQ A;  1H2T C;  2P58 C;  1SZA A;  3PNL B;  4B89 A;  4I1O B;  3ESL A;  3RU0 A;  2WXQ A;  4WUY A;  5CHE E;  5FQ6 A;  5ENN A;  4AJW A;  2XEV A;  2VSX E;  5AIJ A;  3CHO A;  4MKT A;  3R7R A;  4DI4 A;  4EZL A;  3IKO B;  3FUH A;  5BNW A;  4ILI A;  1ELK A;  2KCK A;  2V5F A;  2OND A;  3QWV A;  4APO A;  3CKC A;  3Q49 B;  4XI0 A;  3E4B A;  4W9R A;  1ZU2 A;  2WXR A;  3ZRH A;  2IF4 A;  3HHM A;  3TG4 A;  3D9K A;  4NUR A;  5KCM A;  4EZK A;  5LFA A;  4AY6 A;  3ASF A;  3CVN A;  4UWK A;  2LSU A;  2BTD A;  2R5S A;  3FUM A;  4CT4 A;  4B0Z A;  4EZJ A;  4NAC A;  2LO6 A;  2C2L A;  1SZ9 A;  4GZ3 A;  3JQ0 A;  4GA2 A;  3ZGQ A;  1OUV A;  2Y4U A;  3HDX A;  5E75 A;  4J8D A;  1H0A A;  3FTW A;  4AVX A;  3FU6 A;  5JJ7 A;  2XRZ A;  1PC2 A;  3IHY A;  4J8S A;  2KC7 A;  1HX8 A;  1E8W A;  4I6E A;  4NRH B;  3EIJ A;  5KJN A;  3B13 A;  4EBA A;  2PM7 A;  3TXM A;  2GW1 A;  3FWV A;  4APF A;  4JZY A;  2RD0 A;  5LP0 A;  1DVP A;  4ATG A;  4GPK A;  5FZQ A;  1TEZ A;  2WXN A;  3VLF A;  4YND A;  3FH8 A;  4BY6 A;  3FUF A;  3UT8 A;  4BX8 A;  1HF8 A;  3FTX A;  2IFU A;  2LAH A;  3PVL A;  1HXI A;  4JPS A;  2XRY A;  1NA3 A;  3RRM B;  3S7F A;  4ACK A;  1Z3Y A;  4JL0 A;  2L0I A;  3JCK C;  4Q94 A;  1KT0 A;  4H7X A;  4XKB A;  3MA5 A;  1FVH A;  4GB9 A;  5G04 C;  4E85 A;  4HOT A;  1GW6 A;  2FF4 A;  3RRN B;  3D9I A;  1BPO A;  2CFU A;  2J49 A;  2VTB B;  4I9C A;  3QC1 A;  4EEC A;  1HU3 A;  2WQ7 A;  4IYP A;  3FTZ A;  2AXV A;  3EJN A;  3N71 A;  3OXL A;  3LKU A;  3ZYQ A;  3QK0 A;  3EIQ C;  1W3B A;  2V4L A;  5ANL A;  1IQU A;  4KYO B;  4L2L A;  4JVS A;  2Q7F A;  1B89 A;  3LJ3 A;  2KZT B;  2L9B A;  4ILH B;  3CVX A;  2J4B A;  3U9W A;  1H2U A;  4EQF A;  3NZS A;  2WMO A;  1TJF A;  5AYW D;  2J07 A;  3PEU B;  3MCX A;  3NF1 A;  4BT8 A;  4F7A A;  4AEZ C;  3FP3 A;  4JHJ A;  3ZXS A;  3D3M A;  4N3B A;  2WXG A;  5JHA A;  3CVW A;  2PZI A;  5FT9 A;  3HVE B;  3P2B A;  3ZYK A;  2Y3A A;  1SQM A;  3PRE A;  4G1T A;  1HE8 A;  4CCA A;  3FH7 A;  3BEE A;  4JC8 A;  5BV0 A;  1YA0 A;  3ZHE B;  2R17 C;  2VGY A;  2DCP A;  4JEU A;  4RVB A;  5BV1 A;  2PQR A;  4F3V A;  4OVU A;  4ACL A;  3ESK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...