2C0MA

Apo form of the tpr domain of the pex5p receptor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
319
structure length
297
Chain Sequence
DKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title Recognition of a Functional Peroxisome Type 1 Target by the Dynamic Import Receptor Pex5P.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 120
structure length 297
sequence length 319
chains with identical sequence B, C, F
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c0mA00
5HI7A 4UI9C 2ONDA 1KT0A 3MV2B 3IEGA 2C0MA 3PE4A 3ZGQA 3FP3A 1HZ4A 4N5CA 4N3AA 3SF4A 4HOUA 3KD7A 3OXGA 2Y4TA 3LKUA 1Y8MA 4J8FA 4NQ0A 3HYMB 4I2ZA 5FJYA 4NRHB 3LY9A 2VGXB 3GW4A 4KBQA 2XGSA 4B94A 4J0UA 2MHKA 4GPKA 5CCLA 3Q47B 3AS8A 5FZSA 3TG5A 4WNGA 1XNFA 4G26A 2XPIA 4XI9A 4I9EA 3RJVA 3CK8A 2L6JA 5BNWA 4G1TA 4APOA 2PL2A 5G04C 3ZN3A 2OOEA 4G24A 5EKQD 3ASGA 5D0OD 2XCCA 5LCWJ 3UPVA 3LY8A 4U04A 2KCKA 5KJNA 2KCLA 5G05C 4XI0A 4JA7A 4UI9J 2UWJG 3RO3A 3CK7A 2P58C 3QDNA 3Q4AB 3TAXA 3OXLA 3Q15A 4G2VA 2FO7A 1P5QA 4BT9A 2VGXA 1OUVA 4RG9A 2NC9A 1KT1A 1PC2A 4O6FA 5KJMA 4GYWA 2XGMA 3FWVA 4KYOB 4N2SA 2FF4A 4N3CA 5AYWD 3ZHEB 4YNDA 4HORA 3SZ7A 3QWPA 4N39A 2HO1A 4WUYA 1ZU2A 4UQYA 2KATA 5M72A 2GW1A 4CDRA 3K9IA 3S7FA 3ZFWA 4AY6A 3CV0A 1QQEA 5EX0A 3QOUA 4HOSA 4RG6A 3CVQA 5JJ6A 4U07A 2IFUA 5D0QD 3LPZA 5EX3A 3TG4A 2LNIA 5G04J 4CGWA 3VTYA 1WM5A 4WNFA 4N2QA 4GCOA 1NA0A 4YVOA 1IYGA 5A7DB 3R9AB 4UQZA 2DBAA 5DBKA 5ARGA 3QKYA 4GA2A 3ESKA 4IN3B 3URZA 5G05J 4GYOA 1TJCA 4ABNA 4EQFA 3UQ3A 3ZHEA 4ME2A 3UUXA 4AIFA 2YHCA 4G23A 4WNEA 3AS4A 2LSUA 3OXFA 3KS2A 5FTPA 3PE3A 1E96B 2PQNA 1HH8A 3CKBA 4HOQA 5C1DA 1NA3A 4BT8A 4H7XA 3MKRA 3GYZA 3S7DA 1FCHA 2XGOA 1IHGA 4J8EA 5A6CA 4JHRA 2FI7A 1YA0A 3LCAA 3MV3B 3PDNA 2HYZA 3GZ1A 2C2LA 2PQRA 2C0LA 4JA9A 4KXKB 4HOTA 2Y4UA 2YQ8A 2FEZA 4Y6CA 3ASDA 4GZ3A 2XEVA 2XCBA 3MEKA 3CVNA 2VSYA 3RO2A 3LY7A 3NF1A 4GA1A 5KJLA 3AS5A 3CK9A 1W3BA 2VYIA 2HR2A 3CVPA 5CCMA 4LEUA 3Q49B 2WPVA 3QWVA 4GYYA 4WNDA 4I9CA 4UI9K 3ASHA 2I6HA 3MA5A 3BEEA 4CGVA 4J8DA 4GA0A 4W9RA 2E2EA 4JL0A 4I2WA 5DIZA 4GZ6A 4H7YA 1ELRA 5CHEE 3ZPJA 3CEQA 2KCVA 3U3WA 3E4BA 4U0UA 2UY1B 3ASFA 2WQHA 3VTXA 5BW8C 2JLBA 4G25A 3CVLA 3S7JA 1NZNA 4I17A 3LYAA 3S7BA 1HXIA 2PZIA 4A1SA 5JJ7A 4N3BA 5FZRA 2J9QA 5ARFA 1WAO1 4GZ5A 2R5SA 4BTAA 5KJKA 1B89A 2AVPA 5HQ8A 3RKVA 2KC7A 5JJTA 2BUGA 4U0SA 4F3VA 3JYSA 3ULQA 3Q5MA 4BWRA 3RIBA 2FBNA 1ELWA 4U0ZA 3CKCA 3N71A 4I1AA 5FT9A 2V5FA 1QZ2A 3KAEA 1KLXA 3WXXA 5FZQA 2Q7FA 3EDTB 3O48A 4BTBA 2VGYA 5BT1A 3RU0A 4YVQC 4GCNA 3U4TA 4AM9A 1A17A 2IF4A 2LSVA 3FFLA 4UQXA 5LCWC 2VQ2A 2UY1A 3TGOA 2VSNA 4XIFA 4AY5A 1ZBPA 3QWWA 3GZ2A 2QFCA 4Y6WA
chains in the Genus database with same CATH superfamily
1KT0A 1H2TC 4JPSA 2C0MA 2IY0C 3L82A 3QARA 3FP3A 4N3AA 1UN9A 3I5PA 5E75A 4HI9A 1WG0A 3RK6A 4TXQA 4HOUA 3EU5A 4J6IA 4FP7A 2Y4TA 5JMND 4APFA 2MOWA 1Z6TA 3ZU7B 2X3MA 3ULEG 2ZGDA 2ETAA 3ZXPA 4U8HA 3B13A 2VJ8A 3HG0D 3KSQA 3PUJA 1JPLA 1TNUA 4TUUA 1FT1A 2VTBA 3CR3A 4U8YD 3L13A 4A3TA 2LAIA 1H6PA 3CK8A 3ZEFA 2GROB 4APOA 3D9KA 1WY6A 4J8YA 4G8LA 3PNLB 3CSFA 4G24A 5EKQD 2XCCA 1E8YA 5LCWJ 2WMOA 2EIME 1TN8A 3ISMC 4IYPA 3UM1A 1O1TA 4U04A 3DSSA 2KCKA 5G2NA 5G05C 2DZNA 3CVYA 2ZISA 4A63B 1TNZA 4JA7A 1LD7A 4UI9J 3IHYA 3RO3A 3AJIA 4DI3A 2WXPA 4MRUA 2IO2C 3Q4AB 3TAXA 4E85A 2FO7A 4BT9A 3W9FA 5JHBA 3ML8A 3UMVA 3TJPA 3U64A 4U95D 1PC2A 5KJMA 3NOGD 4GYWA 2XGMA 2P9LG 4TUMA 3FWVA 1FPPA 5BPPA 4J7WA 4HORA 3SZ7A 3WG7E 1IQRA 1G3NB 1HS6A 3QWPA 3EHQA 3SBSA 2F8XK 5G55A 2XZTG 4ANXA 4CDRA 4DK5A 1DCEA 1MX6A 3FULA 1RW2A 5EX0A 2WM9A 1EDUA 5C2YA 3TL5A 3QOUA 3UXGA 4HOSA 4RG6A 4U07A 2IFUA 4JHJA 1D8EA 3TG4A 2GRMA 3JUIA 4GCOA 3HXEA 3QK0A 3DEPA 4YVOA 4JD2G 3V79K 1K3ZD 3EU9A 4LSZE 4KZCA 3ESKA 1SW6A 4ANWA 4HRMB 4JXTA 3V2OA 4DX2A 1JCSA 3ESLA 4UWGA 5EILA 4GTPA 2ZU6B 3J5QB 3UQ3A 4M3OA 4BSZB 2MYOA 2P9IG 2WXQA 3ZYKA 4GU5A 3UUXA 5AENA 3D9JA 3QNKA 4D10C 3IV0A 4MLPA 4G23A 2A5UA 2XHEA 2PM6A 3PZDA 4ZHBA 2XENA 3PUKA 1A5EA 3KS2A 1BI8B 3B7BA 5BV0A 3G2WA 2Y0BG 3MX3A 1HH8A 2DWZA 4PS7A 4HOQA 3QC1A 5C1DA 1U3CA 1NA3A 4H7XA 5AN8A 1X81A 1D8DA 2LO6A 1FCHA 2XGOA 3L22A 2B0OE 1IHGA 3ONKA 3IKOB 3LCAA 3EHNA 3ZYMA 4JC8A 3JUEA 2YINA 2R05A 4KXKB 5ENSD 2Y4UA 2YQ8A 5FWQA 3SGHA 2OCCE 1TN6A 1Z3XA 3UT4A 4PUCA 3CVNA 3ZNGA 4GA1A 2JEKA 4CRWA 1JCQA 3VLFA 4AVXA 3G2VA 3UI2A 4UWKA 4ZFHA 2V0PA 4GTRA 4HLLA 1E8XA 1S0PA 1HG5A 4BFRA 3NOCD 4GA0A 2E2EA 3D9LA 4JL0A 4RQIA 5ENNA 1TNBA 3Q78A 2F37A 3CHSA 5JHAA 1ELRA 2IOSA 4C0EA 1HE8A 1DVPA 3E4BA 4ILHB 3DXMG 4NURA 3VTXA 5BW8C 4LCTA 3S7JA 3L9TA 3LYAA 2PZIA 4A1SA 1UJJA 2F8YA 3GZSA 1RZ4A 2AVPA 3LJNA 2KC7A 2BUGA 3Q5MA 3C72A 3RIBA 3UM2A 3D3MA 4ACKA 2A4ZA 3DSUA 4MKTA 3N71A 1O1SA 4HVBA 3FTUA 1K1BA 4I1AA 2PNNA 5J08A 3CVVA 5FT9A 3ZVVA 3JXIA 3WXXA 1OWLA 3PZ1A 2ETBA 2H6IA 3O48A 4BTBA 4Z68A 2VGYA 4URKA 1NL4A 4Q96A 3FEYA 4JZYA 4AM9A 5KNGA 1A17A 4CYMD 3CHMA 3FFLA 1EPUA 3NZUA 4C48B 4AV7A 4JW1A 1UJKA 4QQIA 3QWWA 4O1OA 4AY5A 3GZ2A 4GB9A 4U63A 2V4LA 5HI7A 5FQ8A 2QC9A 3MV2B 3L6AA 4DLQA 5EN5D 3PE4A 3ZGQA 1HZ4A 1N4PA 1SA5A 2YNQA 4XE0A 3KD7A 2GRRB 3OXGA 3SQVA 2RKKA 2M63A 4J8FA 4B8CB 4NQ0A 3V30A 4F1PA 4GZCA 1YMPA 3SFXA 3T8MA 3VLDA 1N0RA 5IY5E 4KBQA 4DPRA 2XGSA 2XS8A 4B94A 4AOFA 4J0UA 3ZYQA 3ULYA 4GPKA 3Q47B 3PZ4A 3TWQA 3BUAA 4EZJA 2BTDA 2XPIA 5ENTD 1UW4B 3UT7A 4I9EA 2VSXE 5HKPA 3APDA 2VGEA 5G04C 3NBNB 3T8KA 3ZN3A 3FTZA 1DCQA 2OOEA 1WDYA 2H6HA 2BF0X 5D0OD 5B1BE 3LY8A 2OVBA 4FHJA 4HLEA 5HRYA 1TNOA 1UG3A 3IHVA 1TNYA 1GW6A 3Q73A 3QB2A 3OXLA 1Y6IA 4F7AA 2DVWA 1P5QA 1OUVA 4HQDA 1KT1A 2P9NG 3P2BA 4EHMA 4FU3A 5AYWD 3ZHEB 2CHWA 2HM8A 1LTXA 2WXJA 3FDHA 4FJYA 4YDYA 1IKND 4G11A 2L9BA 3K9IA 1QQEA 4M7CA 2XPZA 3FUKA 4ATZD 4DI4A 5JJ6A 2CFUA 3Q9UC 4DUIA 3UKRG 2KZTB 1UN8A 3LPZA 1H2VC 5AARA 4CGWA 3FUEA 4WNFA 4N2QA 3FH5A 2EILE 2ILRA 1IYGA 5A7DB 3FUFA 4FADA 1MX2A 3SFYA 2QYUA 3QKYA 4GA2A 5G05J 3B7TA 5KWDA 2MRIA 2H6GA 1TJCA 4EQFA 4XEIG 3ZHEA 1H19A 4ME2A 2OV8A 4AIFA 4BEPA 4J8SA 4HRNA 1INZA 4WWOA 4TXPA 4F6RD 4A55A 1IXVA 4WNEA 2P2CP 3AS4A 1MHQA 3IBEA 4GAAA 4KT6B 2PQNA 1S70B 3EHRA 3C98A 2KZTA 3FUHA 2J49A 3ZXSA 5BUZA 3D9OA 5LOZA 1OCRE 4J8EA 4O60A 3DPDA 1YA0A 3PDNA 3DXKG 2KM4A 2XPYA 4OAVB 2J09A 2DCPA 2WQ6A 3UIPC 4WWPA 3FY4A 4Y6CA 4QFVA 2V8SE 4LNBA 4FULA 5AQBA 2P9KG 2VSYA 1U3DA 3NF1A 1S64A 2BEDA 2XRYA 1W3BA 3ONLA 2R02A 5FQ4A 2BKGA 5CCMA 1N4RA 2WPVA 2CG2A 1N52A 4XKBA 2E0IA 3HHMA 4ANVA 3R9MA 4N5QA 4UI9K 3ASHA 2PM7A 4B0ZA 3PEUB 1EYHA 1K1AA 4CGVA 1OWPA 4NACA 3LS8A 3C3RA 4I2WA 5DIZA 4GZ6A 5T3RA 2Y1LE 5BXUA 3LEWA 4U0UA 4FC8A 1QBQA 3S7BA 4EZLA 1D9SA 3FUDA 4N3BA 2JABA 1KPSB 2J9QA 5ARFA 4V3IA 2IOLA 2WVIA 2R5SA 4BTAA 1B89A 4EBAG 2ZXWE 5HQ8A 3RKVA 2QY7A 5JJTA 3EUVA 4K03A 3APCA 3PVLA 5D2MC 4JEUA 5CEAA 2IU1A 1N0QA 1DC2A 3DWLG 3CKCA 4P29A 3B95A 3CGHA 2AXZA 3BQOA 4XX5A 4O1PA 1PY1A 2AW6A 3UTMA 2Q7FA 2DZOA 3MKQB 3G2TA 2V5QC 1BI7B 4AXHA 3LVRE 2Y69E 3RU0A 4HBDA 3U4TA 2H6FA 4AP2A 3HXCA 5FIOA 3CVXA 3IXEA 2X6JA 3Q9NC 1ZBPA 2QFCA 2J8SD 3ABKE 2YHEA 3ZKJA 3SY2A 4XKCA 2R2LA 3E33A 2LXLA 4GTSA 4RLYA 4GMJA 2XEHA 2KBXA 2WMNA 3FH7A 3UM3A 1V54E 3P1UA 2I2OA 3HVEB 5D66A 1Y8MA 4GMRA 4HRLA 3Q79A 2AJAA 2VSOE 4B8AA 4I2ZA 5CEDB 5CMYA 4Q69A 1UOHA 4NRHB 3CQGB 1SZ9A 3PEVB 2AXUA 2VGXB 4JHKA 2LUHA 3APFA 2XRZA 5CCLA 4CEMA 2R17C 3MKQA 3Q7FA 3AS8A 3RAUA 5FZSA 3C3QA 3SI5A 2XZDG 4WNGA 3ZYLA 3U9WA 1XNFA 5CBNA 4GTVA 3OAWA 3RJVA 4TXRA 1FVFA 3ZW3A 1N9AA 3SBTB 4CT0A 4G1TA 3G2SA 4RSYA 2PL2A 5T8IA 4LUNU 1TR4A 4EECA 4DX1A 4HI8A 3FH8A 4BX9A 3L16A 3QAQA 4LNUD 4OAUC 3JXJA 3UPVA 5AJDA 4K5CA 3FUJA 4C9BB 2OEWA 3CHOA 3PZ3A 2WB2A 2KCLA 3HVEA 1TN7A 4L9PA 4L7TA 3W9GA 1FVHA 1MYOA 1BLXB 2EIJE 2LXMA 2IJGX 3T5VA 3LXUX 4KVMA 3Q15A 2CHZA 2NSZA 5KNHD 4HB5A 2VGXA 1AWCB 3FU5A 4RG9A 3JQ1A 2NC9A 4PDXA 4F1SA 1O5MA 1OWOA 4KYOB 4N2SA 2HE0A 4KZ0A 1ZB1A 2J07A 5EIBE 4UWFA 3SNXA 4N39A 5J90A 2HO1A 4WUYA 4K5AB 4UQYA 5M72A 2FULA 4G8KA 3MGBA 4L2YA 3J5PA 3ZFWA 4FLHA 4AY6A 3CV0A 2ZIRA 2KXPC 1X5BA 3TWXA 4I6GA 4YDOA 3FU0A 3CVQA 3Q75A 4GTQA 5D0QD 5EX3A 4IULA 4R7LA 3PREA 3FU6A 2LNIA 1QYMA 5G04J 3TWRA 3MJWA 4CZ2D 2I1JA 5EYLA 3R9AB 5KBAA 4K5BA 2DBAA 2RFMA 3JQ0A 3TWWA 4BESA 2GGFA 4DJAA 4IN3B 3URZA 3AG3E 4GYOA 3D9HA 1HX8A 2B6CA 3MZLB 3NAWA 4IRUA 1N11A 2AWIA 4KVOA 4DRXE 3FTXA 1IHBA 2YHCA 2ETCA 4GMLA 4C0MA 4MS6A 2F0YA 3NB2A 3PRZA 5B1AE 5AIJA 3I4RB 3OXFA 1U2VG 5FTPA 2NYJA 4UWHA 3PZ2A 2IEJA 1H2UA 3EJNA 2DYRE 4PH4B 1OCOE 4BT8A 3FUMA 3AU4A 3FTVA 4DX6D 2XQ0A 1Q2ZA 3O4ZA 4CDMA 5FQ7A 4WWNA 4JHRA 2GRLA 3MV3B 2EINE 5FQ6A 1HFAA 2HYZA 2GRPB 4BERA 3GZ1A 2C2LA 2PQRA 4U8VD 2C0LA 4JA9A 2L0IA 3LDZA 4GTOA 4AJWA 2FEZA 4DLOA 4GZ3A 5ANLA 2XEVA 4HNAD 3EHMA 3BU8A 3B7UX 3MEKA 3VLEA 3RO2A 3CHPA 4CDNA 3C3OA 3UIOC 1YCSB 3LVQE 3CK9A 5FINA 2QYJA 4BX8A 4L2LA 2IONA 2VYIA 2HR2A 4YDWA 3CVPA 3AAAC 1NI1A 2P9PG 3TXNA 3QWVA 4EZKA 3DBSA 4CT4A 3U66A 3L54A 3I3NA 4GYYA 3DSWA 4WNDA 4FA6A 1MJ0A 4I1OB 5H7PA 5ENQD 1FT2A 2I6HA 2XEEA 1YYHA 5AJLA 4J8DA 4W9RA 4PS3A 5B3SE 5LX8A 4LRZA 2WQ7A 5CHEE 3CEQA 4L1BA 3U3WA 5BXOA 1SZAA 2UY1B 3ASFA 4XZ4A 2JLBA 3HRAA 3EIJA 4G25A 3HXFA 5AAOA 1MX4A 1NZNA 1SVXA 2RD0A 3HDXA 5FZRA 4I6EA 1WAO1 3FU3A 4BETA 3DSXA 2RG8A 4U0SA 4ILIA 4F3VA 3JYSA 3ULQA 3RRUA 3ASOE 3C5RA 3NZSA 2FBNA 4NIKA 3R7RA 3ZRHA 1OCZE 3B7SA 1SQMA 2J4DA 4CCAA 2WXRA 2I9CA 4RVBA 1QZ2A 2GRQB 2V4HC 1O1RA 1N4SA 4GCNA 5LCWC 1EF1C 2UY1A 4UUCA 3TGOA 2OVFA 2VSNA 3CVWA 4XIFA 5CRUA 3SHFA 4UI9C 1S63A 2ONDA 1MZCA 4ANUA 3IEGA 4U96D 4DX5D 4HFGA 3ZIMA 2J4BA 2CG3A 2CHXA 4N5CA 3UT8A 1HF8A 1H0AA 3SF4A 3S2AA 3FTYA 1OWMA 2WXKA 4I43A 3KSLA 4JB8P 1N54A 3LKUA 4I1MA 4WAFA 3TWUA 3HYMB 1DNPA 5CERB 1JWGA 2NXPA 5FJYA 2L6BA 3LY9A 3GW4A 5CMWA 2MHKA 1NFIE 2X6HA 3HXDA 3KEAA 3TG5A 3D9MA 1MQSA 2A5EA 1JCRA 4G26A 4XI9A 1SA4A 1V55E 3SO8A 1HO8A 4FLBA 3AU5A 2L6JA 3E34A 5BNWA 2Y3AA 2OEVA 3FTWA 3EIQC 5KCMA 3ASGA 4TRQA 4A1GA 4E6HA 2WXNA 2WXFA 5KJNA 2WXHA 4XI0A 4ATGA 2UWJG 3FTSA 3CK7A 2P58C 3QDNA 3CLJA 1BU9A 3UKUG 4OYSA 3B7RL 4YDEA 1HU3A 5EYPF 4G2VA 3LJ3A 4MBGA 5ITZF 4DX7D 1AP7A 1QNFA 3DSVA 3D9NA 4O6FA 3D9PA 3I4GA 3ENEA 3FHEA 2FF4A 4N3CA 1TEZA 4ACLA 1HG2A 4YNDA 4B93B 3UM0A 3X2QE 4TV3A 3F6QA 4JEHA 3RSEG 2XS1A 1ZU2A 2KATA 2GW1A 4F53A 1TYQG 3S7FA 3CVUA 3R7QA 4GPMA 5EIDA 2J08A 3UX4A 5CRVA 5EDSA 5ENRD 1BD8A 1OXJA 1K8KG 3CIAA 5T4YA 2CFZA 1IQUA 2P9SG 3VTYA 3FEXA 1WM5A 4GZDA 1KZOA 1NA0A 1PAQA 3CHRA 1ELKA 1E8ZA 5ANRA 2L0TB 4AEZC 4UQZA 3FUNA 4FJZA 2EIKE 3SD5A 5DBKA 5ARGA 4GTTA 2R03A 3MCXA 4L23A 4LG6A 2R59A 5CBOA 3ABLE 4ABNA 5HS0A 1Z3YA 3NQPA 4FHKA 1OY3D 2ZGGA 4BSXA 2X6IA 3L08A 4BY6A 2DIWA 4ILGA 1XGWA 2EQXA 2LSUA 5AQAA 1H6OA 3TWVA 4X8QA 3PE3A 1E96B 3CKBA 3QJZA 1N94A 2IO3C 2I1KA 4I6JA 3DRAA 2WXMA 3CQCB 3E37A 3KEZA 5LFAA 3ML9A 2X6KA 3MKRA 2LAHA 2BKKB 3GYZA 3S7DA 4LNGA 3BG0B 3T9KA 1E8WA 1Z5SC 3CSTA 1OWNA 5A6CA 4U7EB 2FI7A 3DEOA 2GRNB 3AG1E 1JUQA 2WXOA 1OT8A 4Q94A 3E30A 4HOTA 3AG4E 1N95A 3V2XA 4B89A 2X38A 3ASDA 2XCBA 2FO1E 3TXMA 1E7VA 3LY7A 3T5XA 3Q7AA 5KJLA 3AS5A 1BPOA 5JA4D 4LERA 1VDYA 1E90A 4LEUA 3Q49B 1TJFA 1H6KA 4K0RA 3PS6A 3L17A 3TWSA 4KMOA 5AQ9A 4I9CA 3V31A 3MA5A 2DYSE 3BEEA 3BG1B 2RFAA 4H7YA 3G2UA 1N4QA 2X6FA 3ZUVB 3ZPJA 2WXLA 3PH0C 2KCVA 4HXIA 2WQHA 4JVSA 2QZAA 2IQCA 3CVLA 4I17A 1LD8A 1HXIA 5A23A 1L5JA 5JJ7A 1JWFA 5ENPD 3E32A 1E7UA 4GZ5A 5KJKA 5BV1A 5E76A 1LF8A 4OVUA 3HXBA 3SFZA 4UWLA 4BWRA 1NP7A 1ELWA 5AQ7A 4U0ZA 3HIZA 5CECB 3RRMB 3PNTB 4EPZA 3OTNA 3RRNB 4OVVA 3FUIA 4HS2A 2V5FA 3KAEA 1KLXA 4A3VA 3ASNE 1OCCE 5FZQA 3EDTB 2P9UG 2AXVA 1KZPA 3JCKC 5BT1A 2VTBB 3DPYA 4YVQC 2WXIA 3AG2E 3CHQA 3MYVA 3TWTA 2IF4A 3D9IA 2LSVA 4UQXA 2WXGA 2VQ2A 3ABME 4PS8A 5LP0A 5ENOD 4EBAA 3UINC 3DSTA 4GTMA 4Y6WA
chains in the Genus database with same CATH topology
5HI7A 2YHEA 5FQ8A 4UI9C 4XKCA 2ONDA 1KT0A 3MV2B 3L6AA 4ANUA 3IEGA 4DLQA 1H2TC 4HFGA 2C0MA 4JPSA 3ZIMA 2J4BA 2CG3A 2CHXA 3QARA 4GMJA 3PE4A 3ZGQA 3FP3A 1HZ4A 4N5CA 3UT8A 4N3AA 1HF8A 1UN9A 2WMNA 3FH7A 3I5PA 5E75A 1H0AA 2YNQA 3SF4A 3P1UA 3RK6A 3S2AA 2I2OA 3HVEB 3FTYA 1OWMA 4HOUA 4XE0A 3KD7A 2WXKA 4I43A 3OXGA 4J6IA 4FP7A 1N54A 2Y4TA 3LKUA 4I1MA 1Y8MA 2M63A 4J8FA 4APFA 4B8CB 4NQ0A 4WAFA 3HYMB 2MOWA 1Z6TA 4GZCA 2VSOE 1DNPA 3T8MA 4B8AA 4I2ZA 2X3MA 3VLDA 5CMYA 4Q69A 1JWGA 2NXPA 5FJYA 4NRHB 5CMWA 3CQGB 1SZ9A 3LY9A 3PEVB 2AXUA 2VGXB 3B13A 3GW4A 2VJ8A 4JHKA 4KBQA 4U8HA 4DPRA 2XGSA 4B94A 4AOFA 4J0UA 2MHKA 3APFA 3PUJA 3ZYQA 2XRZA 2X6HA 1JPLA 4CEMA 3Q47B 5CCLA 4GPKA 2R17C 3MKQA 4TUUA 3AS8A 3SI5A 5FZSA 3TG5A 4EZJA 3D9MA 4WNGA 2BTDA 1MQSA 3ZYLA 2VTBA 3CR3A 3U9WA 3L13A 1XNFA 4G26A 4A3TA 2XPIA 4XI9A 2LAIA 1UW4B 3UT7A 1HO8A 3OAWA 4I9EA 3RJVA 4FLBA 2VSXE 3CK8A 3AU5A 2L6JA 5BNWA 1FVFA 3APDA 3ZEFA 3ZW3A 3SBTB 4CT0A 4G1TA 4APOA 2Y3AA 3D9KA 3G2SA 4RSYA 3FTWA 2PL2A 5T8IA 1WY6A 4LUNU 5G04C 3ZN3A 3FTZA 4EECA 2OOEA 3PNLB 3EIQC 3CSFA 3FH8A 4G24A 5EKQD 5KCMA 4BX9A 3ASGA 3L16A 3QAQA 5D0OD 2BF0X 2XCCA 4TRQA 1E8YA 4A1GA 5LCWJ 4E6HA 2WMOA 3UPVA 3LY8A 5AJDA 2OVBA 4FHJA 4IYPA 3FUJA 4HLEA 4C9BB 3CHOA 2WXNA 4U04A 2KCKA 2WXFA 5G2NA 5KJNA 1UG3A 2WB2A 2KCLA 5G05C 3HVEA 3CVYA 2WXHA 3IHVA 4XI0A 4L7TA 1GW6A 4JA7A 1FVHA 4UI9J 4ATGA 3IHYA 2UWJG 3RO3A 2IJGX 3FTSA 4DI3A 3CK7A 2P58C 2WXPA 3CLJA 3QDNA 4MRUA 3T5VA 3LXUX 4OYSA 3B7RL 3QB2A 3Q4AB 3TAXA 1HU3A 4KVMA 4E85A 3OXLA 1Y6IA 3Q15A 4F7AA 4G2VA 3LJ3A 2FO7A 1P5QA 2CHZA 4BT9A 2NSZA 5JHBA 3ML8A 2VGXA 3UMVA 3FU5A 1OUVA 3JQ1A 2NC9A 4RG9A 3TJPA 3U64A 1QNFA 1KT1A 1PC2A 3D9NA 4PDXA 4F1SA 4O6FA 3P2BA 3D9PA 5KJMA 4GYWA 1OWOA 3I4GA 2XGMA 3ENEA 3FHEA 3FWVA 4FU3A 4KYOB 4N2SA 2FF4A 4N3CA 4KZ0A 1TEZA 5AYWD 4ACLA 3ZHEB 1HG2A 2CHWA 4YNDA 5BPPA 4HORA 3SZ7A 2HM8A 2J07A 4TV3A 1IQRA 4UWFA 1HS6A 2WXJA 3FDHA 3QWPA 4FJYA 4N39A 3SNXA 5J90A 2HO1A 4JEHA 3SBSA 4WUYA 1ZU2A 4UQYA 2KATA 4G11A 5M72A 2GW1A 2FULA 4F53A 2L9BA 5G55A 4ANXA 3MGBA 4CDRA 3K9IA 4L2YA 3S7FA 3ZFWA 4FLHA 4AY6A 4DK5A 3CV0A 1QQEA 2XPZA 3FULA 3R7QA 3CVUA 5EX0A 3FUKA 2WM9A 1EDUA 2J08A 5C2YA 3TL5A 3QOUA 3UX4A 1X5BA 4DI4A 4I6GA 4HOSA 5EDSA 4RG6A 3FU0A 3CVQA 5JJ6A 2CFUA 3CIAA 4U07A 2IFUA 4JHJA 5T4YA 2KZTB 1UN8A 2CFZA 1IQUA 5D0QD 3LPZA 5EX3A 1H2VC 4IULA 4R7LA 3TG4A 3PREA 3FU6A 2LNIA 5G04J 2GRMA 3MJWA 4CGWA 2I1JA 3FEXA 1WM5A 3FUEA 3VTYA 4WNFA 4N2QA 3FH5A 4GZDA 3JUIA 4GCOA 1NA0A 1PAQA 3QK0A 3CHRA 1ELKA 2ILRA 4YVOA 1IYGA 1E8ZA 5A7DB 3R9AB 5ANRA 2L0TB 4AEZC 4UQZA 3FUNA 3FUFA 4FADA 2DBAA 3JQ0A 4FJZA 4KZCA 3SD5A 5DBKA 5ARGA 2GGFA 3QKYA 4DJAA 4GA2A 3ESKA 4IN3B 3SHFA 3URZA 4ANWA 3MCXA 4L23A 4JXTA 5G05J 3B7TA 2MRIA 4GYOA 2R59A 1TJCA 3ESLA 4ABNA 4UWGA 1Z3YA 3NQPA 2ZU6B 4EQFA 1HX8A 4FHKA 3UQ3A 4M3OA 3MZLB 4IRUA 3ZHEA 1H19A 2WXQA 2AWIA 4KVOA 4ME2A 3ZYKA 4BSXA 2X6IA 3L08A 4BY6A 4GU5A 3UUXA 5AENA 3D9JA 3FTXA 2DIWA 2OV8A 3QNKA 4AIFA 4D10C 2YHCA 3IV0A 4J8SA 4MLPA 4G23A 4ILGA 1INZA 2A5UA 4WWOA 2XHEA 1XGWA 4GMLA 4C0MA 2PM6A 3PZDA 4A55A 4MS6A 4WNEA 2EQXA 3AS4A 3PRZA 1MHQA 2LSUA 3PUKA 3I4RB 5AIJA 3OXFA 3KS2A 3IBEA 5FTPA 4GAAA 3PE3A 4UWHA 5BV0A 3G2WA 4KT6B 1E96B 2PQNA 1HH8A 3MX3A 3CKBA 1H2UA 3QJZA 4PS7A 4HOQA 3EJNA 3QC1A 5C1DA 1U3CA 4PH4B 3C98A 1NA3A 2I1KA 4I6JA 4BT8A 2KZTA 2WXMA 3CQCB 3FUMA 4H7XA 3AU4A 3FTVA 3KEZA 5LFAA 3ML9A 2X6KA 3FUHA 3MKRA 2LAHA 3GYZA 2J49A 3S7DA 2LO6A 3ZXSA 3BG0B 1FCHA 2XQ0A 2XGOA 3L22A 3O4ZA 1E8WA 5BUZA 3CSTA 3D9OA 1IHGA 5LOZA 1OWNA 4J8EA 5A6CA 4CDMA 5FQ7A 3ONKA 4WWNA 4JHRA 3DPDA 2FI7A 1YA0A 3IKOB 2GRLA 3LCAA 3EHNA 1JUQA 3MV3B 3PDNA 2WXOA 3ZYMA 5FQ6A 1HFAA 2HYZA 4JC8A 2YINA 3GZ1A 4Q94A 2C2LA 2PQRA 2C0LA 4JA9A 4KXKB 4HOTA 2KM4A 2Y4UA 2YQ8A 5FWQA 2XPYA 2L0IA 3LDZA 2J09A 3SGHA 2DCPA 2FEZA 4AJWA 2WQ6A 4WWPA 3FY4A 4B89A 4Y6CA 2X38A 4QFVA 4DLOA 3ASDA 4GZ3A 5ANLA 2XEVA 2V8SE 2XCBA 1Z3XA 3UT4A 3EHMA 3B7UX 4PUCA 4FULA 3MEKA 3TXMA 3CVNA 1E7VA 2VSYA 1U3DA 3VLEA 3RO2A 3LY7A 3NF1A 4GA1A 3T5XA 3CHPA 4CDNA 5KJLA 2JEKA 3AS5A 1BPOA 2XRYA 3LVQE 3CK9A 4BX8A 4CRWA 1W3BA 4L2LA 3ONLA 2IONA 2VYIA 4LERA 1VDYA 2HR2A 1E90A 3CVPA 5FQ4A 5CCMA 4LEUA 3Q49B 2WPVA 2CG2A 3VLFA 4AVXA 1N52A 4XKBA 3G2VA 2E0IA 1TJFA 3HHMA 3TXNA 3QWVA 1H6KA 4K0RA 4EZKA 3DBSA 3PS6A 4UWKA 4CT4A 3U66A 3L17A 2V0PA 4ANVA 3L54A 1E8XA 3I3NA 4GYYA 1S0PA 4KMOA 4WNDA 4FA6A 4I1OB 1HG5A 4I9CA 4UI9K 3ASHA 2I6HA 4BFRA 2PM7A 4B0ZA 3MA5A 3PEUB 1EYHA 3BEEA 4CGVA 5AJLA 4J8DA 1OWPA 4GA0A 4W9RA 2E2EA 3BG1B 3D9LA 4JL0A 4PS3A 4NACA 3LS8A 5ENNA 4I2WA 5DIZA 3CHSA 4GZ6A 5JHAA 4H7YA 3G2UA 5T3RA 5LX8A 1ELRA 2IOSA 2X6FA 4LRZA 2WQ7A 4C0EA 5CHEE 3ZPJA 1HE8A 2WXLA 1DVPA 3CEQA 4L1BA 3PH0C 2KCVA 3U3WA 3E4BA 1SZAA 4ILHB 3LEWA 4NURA 2UY1B 4HXIA 3ASFA 4U0UA 2WQHA 3VTXA 4XZ4A 2JLBA 5BW8C 4JVSA 3EIJA 4FC8A 4G25A 4LCTA 2IQCA 3CVLA 3S7JA 1NZNA 4I17A 3LYAA 3S7BA 4EZLA 5A23A 1HXIA 2PZIA 1L5JA 4A1SA 5JJ7A 3FUDA 2RD0A 4N3BA 1UJJA 3HDXA 5FZRA 1JWFA 4I6EA 2J9QA 5ARFA 1E7UA 4V3IA 3GZSA 2IOLA 1WAO1 2WVIA 2R5SA 4GZ5A 4BTAA 5KJKA 1B89A 3FU3A 5BV1A 4EBAG 5E76A 1LF8A 2AVPA 5HQ8A 3RKVA 2RG8A 2QY7A 2KC7A 5JJTA 2BUGA 4OVUA 4K03A 4ILIA 4U0SA 4F3VA 3JYSA 3ULQA 3APCA 3RRUA 3PVLA 3Q5MA 3NZSA 3SFZA 4UWLA 4BWRA 1NP7A 3RIBA 2FBNA 4JEUA 1ELWA 2IU1A 4U0ZA 3HIZA 3RRMB 3D3MA 3PNTB 4ACKA 4EPZA 2A4ZA 3R7RA 3ZRHA 3B7SA 1SQMA 3CKCA 3OTNA 3N71A 4MKTA 3CGHA 4P29A 2AXZA 4OVVA 2J4DA 3RRNB 4XX5A 3FUIA 4CCAA 2WXRA 3FTUA 4HVBA 2I9CA 4I1AA 5J08A 4HS2A 3CVVA 4RVBA 5FT9A 3ZVVA 1PY1A 1QZ2A 2V5FA 2AW6A 3KAEA 1KLXA 4A3VA 3WXXA 1OWLA 5FZQA 2Q7FA 3EDTB 3MKQB 3G2TA 3O48A 2AXVA 4BTBA 2VGYA 3JCKC 4URKA 4AXHA 5BT1A 4Q96A 3LVRE 2VTBB 3FEYA 4JZYA 3RU0A 4YVQC 2WXIA 4GCNA 3U4TA 3CHQA 4AM9A 3MYVA 1A17A 2IF4A 4AP2A 3CHMA 3D9IA 2LSVA 3FFLA 4UQXA 2WXGA 5LCWC 1EPUA 2VQ2A 1EF1C 3NZUA 2UY1A 4PS8A 4AV7A 3CVXA 3TGOA 5LP0A 4JW1A 2X6JA 2OVFA 2VSNA 3CVWA 1UJKA 4XIFA 4EBAA 1ZBPA 3QWWA 4AY5A 3GZ2A 2QFCA 4GB9A 4Y6WA 4U63A 2V4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HI7 A;  4UI9 C;  2OND A;  1KT0 A;  3MV2 B;  3IEG A;  2C0M A;  3PE4 A;  3ZGQ A;  3FP3 A;  1HZ4 A;  4N5C A;  4N3A A;  3SF4 A;  4HOU A;  3KD7 A;  3OXG A;  2Y4T A;  3LKU A;  1Y8M A;  4J8F A;  4NQ0 A;  3HYM B;  4I2Z A;  5FJY A;  4NRH B;  3LY9 A;  2VGX B;  3GW4 A;  4KBQ A;  2XGS A;  4B94 A;  4J0U A;  2MHK A;  4GPK A;  5CCL A;  3Q47 B;  3AS8 A;  5FZS A;  3TG5 A;  4WNG A;  1XNF A;  4G26 A;  2XPI A;  4XI9 A;  4I9E A;  3RJV A;  3CK8 A;  2L6J A;  5BNW A;  4G1T A;  4APO A;  2PL2 A;  5G04 C;  3ZN3 A;  2OOE A;  4G24 A;  5EKQ D;  3ASG A;  5D0O D;  2XCC A;  5LCW J;  3UPV A;  3LY8 A;  4U04 A;  2KCK A;  5KJN A;  2KCL A;  5G05 C;  4XI0 A;  4JA7 A;  4UI9 J;  2UWJ G;  3RO3 A;  3CK7 A;  2P58 C;  3QDN A;  3Q4A B;  3TAX A;  3OXL A;  3Q15 A;  4G2V A;  2FO7 A;  1P5Q A;  4BT9 A;  2VGX A;  1OUV A;  4RG9 A;  2NC9 A;  1KT1 A;  1PC2 A;  4O6F A;  5KJM A;  4GYW A;  2XGM A;  3FWV A;  4KYO B;  4N2S A;  2FF4 A;  4N3C A;  5AYW D;  3ZHE B;  4YND A;  4HOR A;  3SZ7 A;  3QWP A;  4N39 A;  2HO1 A;  4WUY A;  1ZU2 A;  4UQY A;  2KAT A;  5M72 A;  2GW1 A;  4CDR A;  3K9I A;  3S7F A;  3ZFW A;  4AY6 A;  3CV0 A;  1QQE A;  5EX0 A;  3QOU A;  4HOS A;  4RG6 A;  3CVQ A;  5JJ6 A;  4U07 A;  2IFU A;  5D0Q D;  3LPZ A;  5EX3 A;  3TG4 A;  2LNI A;  5G04 J;  4CGW A;  3VTY A;  1WM5 A;  4WNF A;  4N2Q A;  4GCO A;  1NA0 A;  4YVO A;  1IYG A;  5A7D B;  3R9A B;  4UQZ A;  2DBA A;  5DBK A;  5ARG A;  3QKY A;  4GA2 A;  3ESK A;  4IN3 B;  3URZ A;  5G05 J;  4GYO A;  1TJC A;  4ABN A;  4EQF A;  3UQ3 A;  3ZHE A;  4ME2 A;  3UUX A;  4AIF A;  2YHC A;  4G23 A;  4WNE A;  3AS4 A;  2LSU A;  3OXF A;  3KS2 A;  5FTP A;  3PE3 A;  1E96 B;  2PQN A;  1HH8 A;  3CKB A;  4HOQ A;  5C1D A;  1NA3 A;  4BT8 A;  4H7X A;  3MKR A;  3GYZ A;  3S7D A;  1FCH A;  2XGO A;  1IHG A;  4J8E A;  5A6C A;  4JHR A;  2FI7 A;  1YA0 A;  3LCA A;  3MV3 B;  3PDN A;  2HYZ A;  3GZ1 A;  2C2L A;  2PQR A;  2C0L A;  4JA9 A;  4KXK B;  4HOT A;  2Y4U A;  2YQ8 A;  2FEZ A;  4Y6C A;  3ASD A;  4GZ3 A;  2XEV A;  2XCB A;  3MEK A;  3CVN A;  2VSY A;  3RO2 A;  3LY7 A;  3NF1 A;  4GA1 A;  5KJL A;  3AS5 A;  3CK9 A;  1W3B A;  2VYI A;  2HR2 A;  3CVP A;  5CCM A;  4LEU A;  3Q49 B;  2WPV A;  3QWV A;  4GYY A;  4WND A;  4I9C A;  4UI9 K;  3ASH A;  2I6H A;  3MA5 A;  3BEE A;  4CGV A;  4J8D A;  4GA0 A;  4W9R A;  2E2E A;  4JL0 A;  4I2W A;  5DIZ A;  4GZ6 A;  4H7Y A;  1ELR A;  5CHE E;  3ZPJ A;  3CEQ A;  2KCV A;  3U3W A;  3E4B A;  4U0U A;  2UY1 B;  3ASF A;  2WQH A;  3VTX A;  5BW8 C;  2JLB A;  4G25 A;  3CVL A;  3S7J A;  1NZN A;  4I17 A;  3LYA A;  3S7B A;  1HXI A;  2PZI A;  4A1S A;  5JJ7 A;  4N3B A;  5FZR A;  2J9Q A;  5ARF A;  1WAO 1;  4GZ5 A;  2R5S A;  4BTA A;  5KJK A;  1B89 A;  2AVP A;  5HQ8 A;  3RKV A;  2KC7 A;  5JJT A;  2BUG A;  4U0S A;  4F3V A;  3JYS A;  3ULQ A;  3Q5M A;  4BWR A;  3RIB A;  2FBN A;  1ELW A;  4U0Z A;  3CKC A;  3N71 A;  4I1A A;  5FT9 A;  2V5F A;  1QZ2 A;  3KAE A;  1KLX A;  3WXX A;  5FZQ A;  2Q7F A;  3EDT B;  3O48 A;  4BTB A;  2VGY A;  5BT1 A;  3RU0 A;  4YVQ C;  4GCN A;  3U4T A;  4AM9 A;  1A17 A;  2IF4 A;  2LSV A;  3FFL A;  4UQX A;  5LCW C;  2VQ2 A;  2UY1 A;  3TGO A;  2VSN A;  4XIF A;  4AY5 A;  1ZBP A;  3QWW A;  3GZ2 A;  2QFC A;  4Y6W A; 
#chains in the Genus database with same CATH topology
 1KT0 A;  1H2T C;  4JPS A;  2C0M A;  2IY0 C;  3L82 A;  3QAR A;  3FP3 A;  4N3A A;  1UN9 A;  3I5P A;  5E75 A;  4HI9 A;  1WG0 A;  3RK6 A;  4TXQ A;  4HOU A;  3EU5 A;  4J6I A;  4FP7 A;  2Y4T A;  5JMN D;  4APF A;  2MOW A;  1Z6T A;  3ZU7 B;  2X3M A;  3ULE G;  2ZGD A;  2ETA A;  3ZXP A;  4U8H A;  3B13 A;  2VJ8 A;  3HG0 D;  3KSQ A;  3PUJ A;  1JPL A;  1TNU A;  4TUU A;  1FT1 A;  2VTB A;  3CR3 A;  4U8Y D;  3L13 A;  4A3T A;  2LAI A;  1H6P A;  3CK8 A;  3ZEF A;  2GRO B;  4APO A;  3D9K A;  1WY6 A;  4J8Y A;  4G8L A;  3PNL B;  3CSF A;  4G24 A;  5EKQ D;  2XCC A;  1E8Y A;  5LCW J;  2WMO A;  2EIM E;  1TN8 A;  3ISM C;  4IYP A;  3UM1 A;  1O1T A;  4U04 A;  3DSS A;  2KCK A;  5G2N A;  5G05 C;  2DZN A;  3CVY A;  2ZIS A;  4A63 B;  1TNZ A;  4JA7 A;  1LD7 A;  4UI9 J;  3IHY A;  3RO3 A;  3AJI A;  4DI3 A;  2WXP A;  4MRU A;  2IO2 C;  3Q4A B;  3TAX A;  4E85 A;  2FO7 A;  4BT9 A;  3W9F A;  5JHB A;  3ML8 A;  3UMV A;  3TJP A;  3U64 A;  4U95 D;  1PC2 A;  5KJM A;  3NOG D;  4GYW A;  2XGM A;  2P9L G;  4TUM A;  3FWV A;  1FPP A;  5BPP A;  4J7W A;  4HOR A;  3SZ7 A;  3WG7 E;  1IQR A;  1G3N B;  1HS6 A;  3QWP A;  3EHQ A;  3SBS A;  2F8X K;  5G55 A;  2XZT G;  4ANX A;  4CDR A;  4DK5 A;  1DCE A;  1MX6 A;  3FUL A;  1RW2 A;  5EX0 A;  2WM9 A;  1EDU A;  5C2Y A;  3TL5 A;  3QOU A;  3UXG A;  4HOS A;  4RG6 A;  4U07 A;  2IFU A;  4JHJ A;  1D8E A;  3TG4 A;  2GRM A;  3JUI A;  4GCO A;  3HXE A;  3QK0 A;  3DEP A;  4YVO A;  4JD2 G;  3V79 K;  1K3Z D;  3EU9 A;  4LSZ E;  4KZC A;  3ESK A;  1SW6 A;  4ANW A;  4HRM B;  4JXT A;  3V2O A;  4DX2 A;  1JCS A;  3ESL A;  4UWG A;  5EIL A;  4GTP A;  2ZU6 B;  3J5Q B;  3UQ3 A;  4M3O A;  4BSZ B;  2MYO A;  2P9I G;  2WXQ A;  3ZYK A;  4GU5 A;  3UUX A;  5AEN A;  3D9J A;  3QNK A;  4D10 C;  3IV0 A;  4MLP A;  4G23 A;  2A5U A;  2XHE A;  2PM6 A;  3PZD A;  4ZHB A;  2XEN A;  3PUK A;  1A5E A;  3KS2 A;  1BI8 B;  3B7B A;  5BV0 A;  3G2W A;  2Y0B G;  3MX3 A;  1HH8 A;  2DWZ A;  4PS7 A;  4HOQ A;  3QC1 A;  5C1D A;  1U3C A;  1NA3 A;  4H7X A;  5AN8 A;  1X81 A;  1D8D A;  2LO6 A;  1FCH A;  2XGO A;  3L22 A;  2B0O E;  1IHG A;  3ONK A;  3IKO B;  3LCA A;  3EHN A;  3ZYM A;  4JC8 A;  3JUE A;  2YIN A;  2R05 A;  4KXK B;  5ENS D;  2Y4U A;  2YQ8 A;  5FWQ A;  3SGH A;  2OCC E;  1TN6 A;  1Z3X A;  3UT4 A;  4PUC A;  3CVN A;  3ZNG A;  4GA1 A;  2JEK A;  4CRW A;  1JCQ A;  3VLF A;  4AVX A;  3G2V A;  3UI2 A;  4UWK A;  4ZFH A;  2V0P A;  4GTR A;  4HLL A;  1E8X A;  1S0P A;  1HG5 A;  4BFR A;  3NOC D;  4GA0 A;  2E2E A;  3D9L A;  4JL0 A;  4RQI A;  5ENN A;  1TNB A;  3Q78 A;  2F37 A;  3CHS A;  5JHA A;  1ELR A;  2IOS A;  4C0E A;  1HE8 A;  1DVP A;  3E4B A;  4ILH B;  3DXM G;  4NUR A;  3VTX A;  5BW8 C;  4LCT A;  3S7J A;  3L9T A;  3LYA A;  2PZI A;  4A1S A;  1UJJ A;  2F8Y A;  3GZS A;  1RZ4 A;  2AVP A;  3LJN A;  2KC7 A;  2BUG A;  3Q5M A;  3C72 A;  3RIB A;  3UM2 A;  3D3M A;  4ACK A;  2A4Z A;  3DSU A;  4MKT A;  3N71 A;  1O1S A;  4HVB A;  3FTU A;  1K1B A;  4I1A A;  2PNN A;  5J08 A;  3CVV A;  5FT9 A;  3ZVV A;  3JXI A;  3WXX A;  1OWL A;  3PZ1 A;  2ETB A;  2H6I A;  3O48 A;  4BTB A;  4Z68 A;  2VGY A;  4URK A;  1NL4 A;  4Q96 A;  3FEY A;  4JZY A;  4AM9 A;  5KNG A;  1A17 A;  4CYM D;  3CHM A;  3FFL A;  1EPU A;  3NZU A;  4C48 B;  4AV7 A;  4JW1 A;  1UJK A;  4QQI A;  3QWW A;  4O1O A;  4AY5 A;  3GZ2 A;  4GB9 A;  4U63 A;  2V4L A;  5HI7 A;  5FQ8 A;  2QC9 A;  3MV2 B;  3L6A A;  4DLQ A;  5EN5 D;  3PE4 A;  3ZGQ A;  1HZ4 A;  1N4P A;  1SA5 A;  2YNQ A;  4XE0 A;  3KD7 A;  2GRR B;  3OXG A;  3SQV A;  2RKK A;  2M63 A;  4J8F A;  4B8C B;  4NQ0 A;  3V30 A;  4F1P A;  4GZC A;  1YMP A;  3SFX A;  3T8M A;  3VLD A;  1N0R A;  5IY5 E;  4KBQ A;  4DPR A;  2XGS A;  2XS8 A;  4B94 A;  4AOF A;  4J0U A;  3ZYQ A;  3ULY A;  4GPK A;  3Q47 B;  3PZ4 A;  3TWQ A;  3BUA A;  4EZJ A;  2BTD A;  2XPI A;  5ENT D;  1UW4 B;  3UT7 A;  4I9E A;  2VSX E;  5HKP A;  3APD A;  2VGE A;  5G04 C;  3NBN B;  3T8K A;  3ZN3 A;  3FTZ A;  1DCQ A;  2OOE A;  1WDY A;  2H6H A;  2BF0 X;  5D0O D;  5B1B E;  3LY8 A;  2OVB A;  4FHJ A;  4HLE A;  5HRY A;  1TNO A;  1UG3 A;  3IHV A;  1TNY A;  1GW6 A;  3Q73 A;  3QB2 A;  3OXL A;  1Y6I A;  4F7A A;  2DVW A;  1P5Q A;  1OUV A;  4HQD A;  1KT1 A;  2P9N G;  3P2B A;  4EHM A;  4FU3 A;  5AYW D;  3ZHE B;  2CHW A;  2HM8 A;  1LTX A;  2WXJ A;  3FDH A;  4FJY A;  4YDY A;  1IKN D;  4G11 A;  2L9B A;  3K9I A;  1QQE A;  4M7C A;  2XPZ A;  3FUK A;  4ATZ D;  4DI4 A;  5JJ6 A;  2CFU A;  3Q9U C;  4DUI A;  3UKR G;  2KZT B;  1UN8 A;  3LPZ A;  1H2V C;  5AAR A;  4CGW A;  3FUE A;  4WNF A;  4N2Q A;  3FH5 A;  2EIL E;  2ILR A;  1IYG A;  5A7D B;  3FUF A;  4FAD A;  1MX2 A;  3SFY A;  2QYU A;  3QKY A;  4GA2 A;  5G05 J;  3B7T A;  5KWD A;  2MRI A;  2H6G A;  1TJC A;  4EQF A;  4XEI G;  3ZHE A;  1H19 A;  4ME2 A;  2OV8 A;  4AIF A;  4BEP A;  4J8S A;  4HRN A;  1INZ A;  4WWO A;  4TXP A;  4F6R D;  4A55 A;  1IXV A;  4WNE A;  2P2C P;  3AS4 A;  1MHQ A;  3IBE A;  4GAA A;  4KT6 B;  2PQN A;  1S70 B;  3EHR A;  3C98 A;  2KZT A;  3FUH A;  2J49 A;  3ZXS A;  5BUZ A;  3D9O A;  5LOZ A;  1OCR E;  4J8E A;  4O60 A;  3DPD A;  1YA0 A;  3PDN A;  3DXK G;  2KM4 A;  2XPY A;  4OAV B;  2J09 A;  2DCP A;  2WQ6 A;  3UIP C;  4WWP A;  3FY4 A;  4Y6C A;  4QFV A;  2V8S E;  4LNB A;  4FUL A;  5AQB A;  2P9K G;  2VSY A;  1U3D A;  3NF1 A;  1S64 A;  2BED A;  2XRY A;  1W3B A;  3ONL A;  2R02 A;  5FQ4 A;  2BKG A;  5CCM A;  1N4R A;  2WPV A;  2CG2 A;  1N52 A;  4XKB A;  2E0I A;  3HHM A;  4ANV A;  3R9M A;  4N5Q A;  4UI9 K;  3ASH A;  2PM7 A;  4B0Z A;  3PEU B;  1EYH A;  1K1A A;  4CGV A;  1OWP A;  4NAC A;  3LS8 A;  3C3R A;  4I2W A;  5DIZ A;  4GZ6 A;  5T3R A;  2Y1L E;  5BXU A;  3LEW A;  4U0U A;  4FC8 A;  1QBQ A;  3S7B A;  4EZL A;  1D9S A;  3FUD A;  4N3B A;  2JAB A;  1KPS B;  2J9Q A;  5ARF A;  4V3I A;  2IOL A;  2WVI A;  2R5S A;  4BTA A;  1B89 A;  4EBA G;  2ZXW E;  5HQ8 A;  3RKV A;  2QY7 A;  5JJT A;  3EUV A;  4K03 A;  3APC A;  3PVL A;  5D2M C;  4JEU A;  5CEA A;  2IU1 A;  1N0Q A;  1DC2 A;  3DWL G;  3CKC A;  4P29 A;  3B95 A;  3CGH A;  2AXZ A;  3BQO A;  4XX5 A;  4O1P A;  1PY1 A;  2AW6 A;  3UTM A;  2Q7F A;  2DZO A;  3MKQ B;  3G2T A;  2V5Q C;  1BI7 B;  4AXH A;  3LVR E;  2Y69 E;  3RU0 A;  4HBD A;  3U4T A;  2H6F A;  4AP2 A;  3HXC A;  5FIO A;  3CVX A;  3IXE A;  2X6J A;  3Q9N C;  1ZBP A;  2QFC A;  2J8S D;  3ABK E;  2YHE A;  3ZKJ A;  3SY2 A;  4XKC A;  2R2L A;  3E33 A;  2LXL A;  4GTS A;  4RLY A;  4GMJ A;  2XEH A;  2KBX A;  2WMN A;  3FH7 A;  3UM3 A;  1V54 E;  3P1U A;  2I2O A;  3HVE B;  5D66 A;  1Y8M A;  4GMR A;  4HRL A;  3Q79 A;  2AJA A;  2VSO E;  4B8A A;  4I2Z A;  5CED B;  5CMY A;  4Q69 A;  1UOH A;  4NRH B;  3CQG B;  1SZ9 A;  3PEV B;  2AXU A;  2VGX B;  4JHK A;  2LUH A;  3APF A;  2XRZ A;  5CCL A;  4CEM A;  2R17 C;  3MKQ A;  3Q7F A;  3AS8 A;  3RAU A;  5FZS A;  3C3Q A;  3SI5 A;  2XZD G;  4WNG A;  3ZYL A;  3U9W A;  1XNF A;  5CBN A;  4GTV A;  3OAW A;  3RJV A;  4TXR A;  1FVF A;  3ZW3 A;  1N9A A;  3SBT B;  4CT0 A;  4G1T A;  3G2S A;  4RSY A;  2PL2 A;  5T8I A;  4LUN U;  1TR4 A;  4EEC A;  4DX1 A;  4HI8 A;  3FH8 A;  4BX9 A;  3L16 A;  3QAQ A;  4LNU D;  4OAU C;  3JXJ A;  3UPV A;  5AJD A;  4K5C A;  3FUJ A;  4C9B B;  2OEW A;  3CHO A;  3PZ3 A;  2WB2 A;  2KCL A;  3HVE A;  1TN7 A;  4L9P A;  4L7T A;  3W9G A;  1FVH A;  1MYO A;  1BLX B;  2EIJ E;  2LXM A;  2IJG X;  3T5V A;  3LXU X;  4KVM A;  3Q15 A;  2CHZ A;  2NSZ A;  5KNH D;  4HB5 A;  2VGX A;  1AWC B;  3FU5 A;  4RG9 A;  3JQ1 A;  2NC9 A;  4PDX A;  4F1S A;  1O5M A;  1OWO A;  4KYO B;  4N2S A;  2HE0 A;  4KZ0 A;  1ZB1 A;  2J07 A;  5EIB E;  4UWF A;  3SNX A;  4N39 A;  5J90 A;  2HO1 A;  4WUY A;  4K5A B;  4UQY A;  5M72 A;  2FUL A;  4G8K A;  3MGB A;  4L2Y A;  3J5P A;  3ZFW A;  4FLH A;  4AY6 A;  3CV0 A;  2ZIR A;  2KXP C;  1X5B A;  3TWX A;  4I6G A;  4YDO A;  3FU0 A;  3CVQ A;  3Q75 A;  4GTQ A;  5D0Q D;  5EX3 A;  4IUL A;  4R7L A;  3PRE A;  3FU6 A;  2LNI A;  1QYM A;  5G04 J;  3TWR A;  3MJW A;  4CZ2 D;  2I1J A;  5EYL A;  3R9A B;  5KBA A;  4K5B A;  2DBA A;  2RFM A;  3JQ0 A;  3TWW A;  4BES A;  2GGF A;  4DJA A;  4IN3 B;  3URZ A;  3AG3 E;  4GYO A;  3D9H A;  1HX8 A;  2B6C A;  3MZL B;  3NAW A;  4IRU A;  1N11 A;  2AWI A;  4KVO A;  4DRX E;  3FTX A;  1IHB A;  2YHC A;  2ETC A;  4GML A;  4C0M A;  4MS6 A;  2F0Y A;  3NB2 A;  3PRZ A;  5B1A E;  5AIJ A;  3I4R B;  3OXF A;  1U2V G;  5FTP A;  2NYJ A;  4UWH A;  3PZ2 A;  2IEJ A;  1H2U A;  3EJN A;  2DYR E;  4PH4 B;  1OCO E;  4BT8 A;  3FUM A;  3AU4 A;  3FTV A;  4DX6 D;  2XQ0 A;  1Q2Z A;  3O4Z A;  4CDM A;  5FQ7 A;  4WWN A;  4JHR A;  2GRL A;  3MV3 B;  2EIN E;  5FQ6 A;  1HFA A;  2HYZ A;  2GRP B;  4BER A;  3GZ1 A;  2C2L A;  2PQR A;  4U8V D;  2C0L A;  4JA9 A;  2L0I A;  3LDZ A;  4GTO A;  4AJW A;  2FEZ A;  4DLO A;  4GZ3 A;  5ANL A;  2XEV A;  4HNA D;  3EHM A;  3BU8 A;  3B7U X;  3MEK A;  3VLE A;  3RO2 A;  3CHP A;  4CDN A;  3C3O A;  3UIO C;  1YCS B;  3LVQ E;  3CK9 A;  5FIN A;  2QYJ A;  4BX8 A;  4L2L A;  2ION A;  2VYI A;  2HR2 A;  4YDW A;  3CVP A;  3AAA C;  1NI1 A;  2P9P G;  3TXN A;  3QWV A;  4EZK A;  3DBS A;  4CT4 A;  3U66 A;  3L54 A;  3I3N A;  4GYY A;  3DSW A;  4WND A;  4FA6 A;  1MJ0 A;  4I1O B;  5H7P A;  5ENQ D;  1FT2 A;  2I6H A;  2XEE A;  1YYH A;  5AJL A;  4J8D A;  4W9R A;  4PS3 A;  5B3S E;  5LX8 A;  4LRZ A;  2WQ7 A;  5CHE E;  3CEQ A;  4L1B A;  3U3W A;  5BXO A;  1SZA A;  2UY1 B;  3ASF A;  4XZ4 A;  2JLB A;  3HRA A;  3EIJ A;  4G25 A;  3HXF A;  5AAO A;  1MX4 A;  1NZN A;  1SVX A;  2RD0 A;  3HDX A;  5FZR A;  4I6E A;  1WAO 1;  3FU3 A;  4BET A;  3DSX A;  2RG8 A;  4U0S A;  4ILI A;  4F3V A;  3JYS A;  3ULQ A;  3RRU A;  3ASO E;  3C5R A;  3NZS A;  2FBN A;  4NIK A;  3R7R A;  3ZRH A;  1OCZ E;  3B7S A;  1SQM A;  2J4D A;  4CCA A;  2WXR A;  2I9C A;  4RVB A;  1QZ2 A;  2GRQ B;  2V4H C;  1O1R A;  1N4S A;  4GCN A;  5LCW C;  1EF1 C;  2UY1 A;  4UUC A;  3TGO A;  2OVF A;  2VSN A;  3CVW A;  4XIF A;  5CRU A;  3SHF A;  4UI9 C;  1S63 A;  2OND A;  1MZC A;  4ANU A;  3IEG A;  4U96 D;  4DX5 D;  4HFG A;  3ZIM A;  2J4B A;  2CG3 A;  2CHX A;  4N5C A;  3UT8 A;  1HF8 A;  1H0A A;  3SF4 A;  3S2A A;  3FTY A;  1OWM A;  2WXK A;  4I43 A;  3KSL A;  4JB8 P;  1N54 A;  3LKU A;  4I1M A;  4WAF A;  3TWU A;  3HYM B;  1DNP A;  5CER B;  1JWG A;  2NXP A;  5FJY A;  2L6B A;  3LY9 A;  3GW4 A;  5CMW A;  2MHK A;  1NFI E;  2X6H A;  3HXD A;  3KEA A;  3TG5 A;  3D9M A;  1MQS A;  2A5E A;  1JCR A;  4G26 A;  4XI9 A;  1SA4 A;  1V55 E;  3SO8 A;  1HO8 A;  4FLB A;  3AU5 A;  2L6J A;  3E34 A;  5BNW A;  2Y3A A;  2OEV A;  3FTW A;  3EIQ C;  5KCM A;  3ASG A;  4TRQ A;  4A1G A;  4E6H A;  2WXN A;  2WXF A;  5KJN A;  2WXH A;  4XI0 A;  4ATG A;  2UWJ G;  3FTS A;  3CK7 A;  2P58 C;  3QDN A;  3CLJ A;  1BU9 A;  3UKU G;  4OYS A;  3B7R L;  4YDE A;  1HU3 A;  5EYP F;  4G2V A;  3LJ3 A;  4MBG A;  5ITZ F;  4DX7 D;  1AP7 A;  1QNF A;  3DSV A;  3D9N A;  4O6F A;  3D9P A;  3I4G A;  3ENE A;  3FHE A;  2FF4 A;  4N3C A;  1TEZ A;  4ACL A;  1HG2 A;  4YND A;  4B93 B;  3UM0 A;  3X2Q E;  4TV3 A;  3F6Q A;  4JEH A;  3RSE G;  2XS1 A;  1ZU2 A;  2KAT A;  2GW1 A;  4F53 A;  1TYQ G;  3S7F A;  3CVU A;  3R7Q A;  4GPM A;  5EID A;  2J08 A;  3UX4 A;  5CRV A;  5EDS A;  5ENR D;  1BD8 A;  1OXJ A;  1K8K G;  3CIA A;  5T4Y A;  2CFZ A;  1IQU A;  2P9S G;  3VTY A;  3FEX A;  1WM5 A;  4GZD A;  1KZO A;  1NA0 A;  1PAQ A;  3CHR A;  1ELK A;  1E8Z A;  5ANR A;  2L0T B;  4AEZ C;  4UQZ A;  3FUN A;  4FJZ A;  2EIK E;  3SD5 A;  5DBK A;  5ARG A;  4GTT A;  2R03 A;  3MCX A;  4L23 A;  4LG6 A;  2R59 A;  5CBO A;  3ABL E;  4ABN A;  5HS0 A;  1Z3Y A;  3NQP A;  4FHK A;  1OY3 D;  2ZGG A;  4BSX A;  2X6I A;  3L08 A;  4BY6 A;  2DIW A;  4ILG A;  1XGW A;  2EQX A;  2LSU A;  5AQA A;  1H6O A;  3TWV A;  4X8Q A;  3PE3 A;  1E96 B;  3CKB A;  3QJZ A;  1N94 A;  2IO3 C;  2I1K A;  4I6J A;  3DRA A;  2WXM A;  3CQC B;  3E37 A;  3KEZ A;  5LFA A;  3ML9 A;  2X6K A;  3MKR A;  2LAH A;  2BKK B;  3GYZ A;  3S7D A;  4LNG A;  3BG0 B;  3T9K A;  1E8W A;  1Z5S C;  3CST A;  1OWN A;  5A6C A;  4U7E B;  2FI7 A;  3DEO A;  2GRN B;  3AG1 E;  1JUQ A;  2WXO A;  1OT8 A;  4Q94 A;  3E30 A;  4HOT A;  3AG4 E;  1N95 A;  3V2X A;  4B89 A;  2X38 A;  3ASD A;  2XCB A;  2FO1 E;  3TXM A;  1E7V A;  3LY7 A;  3T5X A;  3Q7A A;  5KJL A;  3AS5 A;  1BPO A;  5JA4 D;  4LER A;  1VDY A;  1E90 A;  4LEU A;  3Q49 B;  1TJF A;  1H6K A;  4K0R A;  3PS6 A;  3L17 A;  3TWS A;  4KMO A;  5AQ9 A;  4I9C A;  3V31 A;  3MA5 A;  2DYS E;  3BEE A;  3BG1 B;  2RFA A;  4H7Y A;  3G2U A;  1N4Q A;  2X6F A;  3ZUV B;  3ZPJ A;  2WXL A;  3PH0 C;  2KCV A;  4HXI A;  2WQH A;  4JVS A;  2QZA A;  2IQC A;  3CVL A;  4I17 A;  1LD8 A;  1HXI A;  5A23 A;  1L5J A;  5JJ7 A;  1JWF A;  5ENP D;  3E32 A;  1E7U A;  4GZ5 A;  5KJK A;  5BV1 A;  5E76 A;  1LF8 A;  4OVU A;  3HXB A;  3SFZ A;  4UWL A;  4BWR A;  1NP7 A;  1ELW A;  5AQ7 A;  4U0Z A;  3HIZ A;  5CEC B;  3RRM B;  3PNT B;  4EPZ A;  3OTN A;  3RRN B;  4OVV A;  3FUI A;  4HS2 A;  2V5F A;  3KAE A;  1KLX A;  4A3V A;  3ASN E;  1OCC E;  5FZQ A;  3EDT B;  2P9U G;  2AXV A;  1KZP A;  3JCK C;  5BT1 A;  2VTB B;  3DPY A;  4YVQ C;  2WXI A;  3AG2 E;  3CHQ A;  3MYV A;  3TWT A;  2IF4 A;  3D9I A;  2LSV A;  4UQX A;  2WXG A;  2VQ2 A;  3ABM E;  4PS8 A;  5LP0 A;  5ENO D;  4EBA A;  3UIN C;  3DST A;  4GTM A;  4Y6W A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  2YHE A;  5FQ8 A;  4UI9 C;  4XKC A;  2OND A;  1KT0 A;  3MV2 B;  3L6A A;  4ANU A;  3IEG A;  4DLQ A;  1H2T C;  4HFG A;  2C0M A;  4JPS A;  3ZIM A;  2J4B A;  2CG3 A;  2CHX A;  3QAR A;  4GMJ A;  3PE4 A;  3ZGQ A;  3FP3 A;  1HZ4 A;  4N5C A;  3UT8 A;  4N3A A;  1HF8 A;  1UN9 A;  2WMN A;  3FH7 A;  3I5P A;  5E75 A;  1H0A A;  2YNQ A;  3SF4 A;  3P1U A;  3RK6 A;  3S2A A;  2I2O A;  3HVE B;  3FTY A;  1OWM A;  4HOU A;  4XE0 A;  3KD7 A;  2WXK A;  4I43 A;  3OXG A;  4J6I A;  4FP7 A;  1N54 A;  2Y4T A;  3LKU A;  4I1M A;  1Y8M A;  2M63 A;  4J8F A;  4APF A;  4B8C B;  4NQ0 A;  4WAF A;  3HYM B;  2MOW A;  1Z6T A;  4GZC A;  2VSO E;  1DNP A;  3T8M A;  4B8A A;  4I2Z A;  2X3M A;  3VLD A;  5CMY A;  4Q69 A;  1JWG A;  2NXP A;  5FJY A;  4NRH B;  5CMW A;  3CQG B;  1SZ9 A;  3LY9 A;  3PEV B;  2AXU A;  2VGX B;  3B13 A;  3GW4 A;  2VJ8 A;  4JHK A;  4KBQ A;  4U8H A;  4DPR A;  2XGS A;  4B94 A;  4AOF A;  4J0U A;  2MHK A;  3APF A;  3PUJ A;  3ZYQ A;  2XRZ A;  2X6H A;  1JPL A;  4CEM A;  3Q47 B;  5CCL A;  4GPK A;  2R17 C;  3MKQ A;  4TUU A;  3AS8 A;  3SI5 A;  5FZS A;  3TG5 A;  4EZJ A;  3D9M A;  4WNG A;  2BTD A;  1MQS A;  3ZYL A;  2VTB A;  3CR3 A;  3U9W A;  3L13 A;  1XNF A;  4G26 A;  4A3T A;  2XPI A;  4XI9 A;  2LAI A;  1UW4 B;  3UT7 A;  1HO8 A;  3OAW A;  4I9E A;  3RJV A;  4FLB A;  2VSX E;  3CK8 A;  3AU5 A;  2L6J A;  5BNW A;  1FVF A;  3APD A;  3ZEF A;  3ZW3 A;  3SBT B;  4CT0 A;  4G1T A;  4APO A;  2Y3A A;  3D9K A;  3G2S A;  4RSY A;  3FTW A;  2PL2 A;  5T8I A;  1WY6 A;  4LUN U;  5G04 C;  3ZN3 A;  3FTZ A;  4EEC A;  2OOE A;  3PNL B;  3EIQ C;  3CSF A;  3FH8 A;  4G24 A;  5EKQ D;  5KCM A;  4BX9 A;  3ASG A;  3L16 A;  3QAQ A;  5D0O D;  2BF0 X;  2XCC A;  4TRQ A;  1E8Y A;  4A1G A;  5LCW J;  4E6H A;  2WMO A;  3UPV A;  3LY8 A;  5AJD A;  2OVB A;  4FHJ A;  4IYP A;  3FUJ A;  4HLE A;  4C9B B;  3CHO A;  2WXN A;  4U04 A;  2KCK A;  2WXF A;  5G2N A;  5KJN A;  1UG3 A;  2WB2 A;  2KCL A;  5G05 C;  3HVE A;  3CVY A;  2WXH A;  3IHV A;  4XI0 A;  4L7T A;  1GW6 A;  4JA7 A;  1FVH A;  4UI9 J;  4ATG A;  3IHY A;  2UWJ G;  3RO3 A;  2IJG X;  3FTS A;  4DI3 A;  3CK7 A;  2P58 C;  2WXP A;  3CLJ A;  3QDN A;  4MRU A;  3T5V A;  3LXU X;  4OYS A;  3B7R L;  3QB2 A;  3Q4A B;  3TAX A;  1HU3 A;  4KVM A;  4E85 A;  3OXL A;  1Y6I A;  3Q15 A;  4F7A A;  4G2V A;  3LJ3 A;  2FO7 A;  1P5Q A;  2CHZ A;  4BT9 A;  2NSZ A;  5JHB A;  3ML8 A;  2VGX A;  3UMV A;  3FU5 A;  1OUV A;  3JQ1 A;  2NC9 A;  4RG9 A;  3TJP A;  3U64 A;  1QNF A;  1KT1 A;  1PC2 A;  3D9N A;  4PDX A;  4F1S A;  4O6F A;  3P2B A;  3D9P A;  5KJM A;  4GYW A;  1OWO A;  3I4G A;  2XGM A;  3ENE A;  3FHE A;  3FWV A;  4FU3 A;  4KYO B;  4N2S A;  2FF4 A;  4N3C A;  4KZ0 A;  1TEZ A;  5AYW D;  4ACL A;  3ZHE B;  1HG2 A;  2CHW A;  4YND A;  5BPP A;  4HOR A;  3SZ7 A;  2HM8 A;  2J07 A;  4TV3 A;  1IQR A;  4UWF A;  1HS6 A;  2WXJ A;  3FDH A;  3QWP A;  4FJY A;  4N39 A;  3SNX A;  5J90 A;  2HO1 A;  4JEH A;  3SBS A;  4WUY A;  1ZU2 A;  4UQY A;  2KAT A;  4G11 A;  5M72 A;  2GW1 A;  2FUL A;  4F53 A;  2L9B A;  5G55 A;  4ANX A;  3MGB A;  4CDR A;  3K9I A;  4L2Y A;  3S7F A;  3ZFW A;  4FLH A;  4AY6 A;  4DK5 A;  3CV0 A;  1QQE A;  2XPZ A;  3FUL A;  3R7Q A;  3CVU A;  5EX0 A;  3FUK A;  2WM9 A;  1EDU A;  2J08 A;  5C2Y A;  3TL5 A;  3QOU A;  3UX4 A;  1X5B A;  4DI4 A;  4I6G A;  4HOS A;  5EDS A;  4RG6 A;  3FU0 A;  3CVQ A;  5JJ6 A;  2CFU A;  3CIA A;  4U07 A;  2IFU A;  4JHJ A;  5T4Y A;  2KZT B;  1UN8 A;  2CFZ A;  1IQU A;  5D0Q D;  3LPZ A;  5EX3 A;  1H2V C;  4IUL A;  4R7L A;  3TG4 A;  3PRE A;  3FU6 A;  2LNI A;  5G04 J;  2GRM A;  3MJW A;  4CGW A;  2I1J A;  3FEX A;  1WM5 A;  3FUE A;  3VTY A;  4WNF A;  4N2Q A;  3FH5 A;  4GZD A;  3JUI A;  4GCO A;  1NA0 A;  1PAQ A;  3QK0 A;  3CHR A;  1ELK A;  2ILR A;  4YVO A;  1IYG A;  1E8Z A;  5A7D B;  3R9A B;  5ANR A;  2L0T B;  4AEZ C;  4UQZ A;  3FUN A;  3FUF A;  4FAD A;  2DBA A;  3JQ0 A;  4FJZ A;  4KZC A;  3SD5 A;  5DBK A;  5ARG A;  2GGF A;  3QKY A;  4DJA A;  4GA2 A;  3ESK A;  4IN3 B;  3SHF A;  3URZ A;  4ANW A;  3MCX A;  4L23 A;  4JXT A;  5G05 J;  3B7T A;  2MRI A;  4GYO A;  2R59 A;  1TJC A;  3ESL A;  4ABN A;  4UWG A;  1Z3Y A;  3NQP A;  2ZU6 B;  4EQF A;  1HX8 A;  4FHK A;  3UQ3 A;  4M3O A;  3MZL B;  4IRU A;  3ZHE A;  1H19 A;  2WXQ A;  2AWI A;  4KVO A;  4ME2 A;  3ZYK A;  4BSX A;  2X6I A;  3L08 A;  4BY6 A;  4GU5 A;  3UUX A;  5AEN A;  3D9J A;  3FTX A;  2DIW A;  2OV8 A;  3QNK A;  4AIF A;  4D10 C;  2YHC A;  3IV0 A;  4J8S A;  4MLP A;  4G23 A;  4ILG A;  1INZ A;  2A5U A;  4WWO A;  2XHE A;  1XGW A;  4GML A;  4C0M A;  2PM6 A;  3PZD A;  4A55 A;  4MS6 A;  4WNE A;  2EQX A;  3AS4 A;  3PRZ A;  1MHQ A;  2LSU A;  3PUK A;  3I4R B;  5AIJ A;  3OXF A;  3KS2 A;  3IBE A;  5FTP A;  4GAA A;  3PE3 A;  4UWH A;  5BV0 A;  3G2W A;  4KT6 B;  1E96 B;  2PQN A;  1HH8 A;  3MX3 A;  3CKB A;  1H2U A;  3QJZ A;  4PS7 A;  4HOQ A;  3EJN A;  3QC1 A;  5C1D A;  1U3C A;  4PH4 B;  3C98 A;  1NA3 A;  2I1K A;  4I6J A;  4BT8 A;  2KZT A;  2WXM A;  3CQC B;  3FUM A;  4H7X A;  3AU4 A;  3FTV A;  3KEZ A;  5LFA A;  3ML9 A;  2X6K A;  3FUH A;  3MKR A;  2LAH A;  3GYZ A;  2J49 A;  3S7D A;  2LO6 A;  3ZXS A;  3BG0 B;  1FCH A;  2XQ0 A;  2XGO A;  3L22 A;  3O4Z A;  1E8W A;  5BUZ A;  3CST A;  3D9O A;  1IHG A;  5LOZ A;  1OWN A;  4J8E A;  5A6C A;  4CDM A;  5FQ7 A;  3ONK A;  4WWN A;  4JHR A;  3DPD A;  2FI7 A;  1YA0 A;  3IKO B;  2GRL A;  3LCA A;  3EHN A;  1JUQ A;  3MV3 B;  3PDN A;  2WXO A;  3ZYM A;  5FQ6 A;  1HFA A;  2HYZ A;  4JC8 A;  2YIN A;  3GZ1 A;  4Q94 A;  2C2L A;  2PQR A;  2C0L A;  4JA9 A;  4KXK B;  4HOT A;  2KM4 A;  2Y4U A;  2YQ8 A;  5FWQ A;  2XPY A;  2L0I A;  3LDZ A;  2J09 A;  3SGH A;  2DCP A;  2FEZ A;  4AJW A;  2WQ6 A;  4WWP A;  3FY4 A;  4B89 A;  4Y6C A;  2X38 A;  4QFV A;  4DLO A;  3ASD A;  4GZ3 A;  5ANL A;  2XEV A;  2V8S E;  2XCB A;  1Z3X A;  3UT4 A;  3EHM A;  3B7U X;  4PUC A;  4FUL A;  3MEK A;  3TXM A;  3CVN A;  1E7V A;  2VSY A;  1U3D A;  3VLE A;  3RO2 A;  3LY7 A;  3NF1 A;  4GA1 A;  3T5X A;  3CHP A;  4CDN A;  5KJL A;  2JEK A;  3AS5 A;  1BPO A;  2XRY A;  3LVQ E;  3CK9 A;  4BX8 A;  4CRW A;  1W3B A;  4L2L A;  3ONL A;  2ION A;  2VYI A;  4LER A;  1VDY A;  2HR2 A;  1E90 A;  3CVP A;  5FQ4 A;  5CCM A;  4LEU A;  3Q49 B;  2WPV A;  2CG2 A;  3VLF A;  4AVX A;  1N52 A;  4XKB A;  3G2V A;  2E0I A;  1TJF A;  3HHM A;  3TXN A;  3QWV A;  1H6K A;  4K0R A;  4EZK A;  3DBS A;  3PS6 A;  4UWK A;  4CT4 A;  3U66 A;  3L17 A;  2V0P A;  4ANV A;  3L54 A;  1E8X A;  3I3N A;  4GYY A;  1S0P A;  4KMO A;  4WND A;  4FA6 A;  4I1O B;  1HG5 A;  4I9C A;  4UI9 K;  3ASH A;  2I6H A;  4BFR A;  2PM7 A;  4B0Z A;  3MA5 A;  3PEU B;  1EYH A;  3BEE A;  4CGV A;  5AJL A;  4J8D A;  1OWP A;  4GA0 A;  4W9R A;  2E2E A;  3BG1 B;  3D9L A;  4JL0 A;  4PS3 A;  4NAC A;  3LS8 A;  5ENN A;  4I2W A;  5DIZ A;  3CHS A;  4GZ6 A;  5JHA A;  4H7Y A;  3G2U A;  5T3R A;  5LX8 A;  1ELR A;  2IOS A;  2X6F A;  4LRZ A;  2WQ7 A;  4C0E A;  5CHE E;  3ZPJ A;  1HE8 A;  2WXL A;  1DVP A;  3CEQ A;  4L1B A;  3PH0 C;  2KCV A;  3U3W A;  3E4B A;  1SZA A;  4ILH B;  3LEW A;  4NUR A;  2UY1 B;  4HXI A;  3ASF A;  4U0U A;  2WQH A;  3VTX A;  4XZ4 A;  2JLB A;  5BW8 C;  4JVS A;  3EIJ A;  4FC8 A;  4G25 A;  4LCT A;  2IQC A;  3CVL A;  3S7J A;  1NZN A;  4I17 A;  3LYA A;  3S7B A;  4EZL A;  5A23 A;  1HXI A;  2PZI A;  1L5J A;  4A1S A;  5JJ7 A;  3FUD A;  2RD0 A;  4N3B A;  1UJJ A;  3HDX A;  5FZR A;  1JWF A;  4I6E A;  2J9Q A;  5ARF A;  1E7U A;  4V3I A;  3GZS A;  2IOL A;  1WAO 1;  2WVI A;  2R5S A;  4GZ5 A;  4BTA A;  5KJK A;  1B89 A;  3FU3 A;  5BV1 A;  4EBA G;  5E76 A;  1LF8 A;  2AVP A;  5HQ8 A;  3RKV A;  2RG8 A;  2QY7 A;  2KC7 A;  5JJT A;  2BUG A;  4OVU A;  4K03 A;  4ILI A;  4U0S A;  4F3V A;  3JYS A;  3ULQ A;  3APC A;  3RRU A;  3PVL A;  3Q5M A;  3NZS A;  3SFZ A;  4UWL A;  4BWR A;  1NP7 A;  3RIB A;  2FBN A;  4JEU A;  1ELW A;  2IU1 A;  4U0Z A;  3HIZ A;  3RRM B;  3D3M A;  3PNT B;  4ACK A;  4EPZ A;  2A4Z A;  3R7R A;  3ZRH A;  3B7S A;  1SQM A;  3CKC A;  3OTN A;  3N71 A;  4MKT A;  3CGH A;  4P29 A;  2AXZ A;  4OVV A;  2J4D A;  3RRN B;  4XX5 A;  3FUI A;  4CCA A;  2WXR A;  3FTU A;  4HVB A;  2I9C A;  4I1A A;  5J08 A;  4HS2 A;  3CVV A;  4RVB A;  5FT9 A;  3ZVV A;  1PY1 A;  1QZ2 A;  2V5F A;  2AW6 A;  3KAE A;  1KLX A;  4A3V A;  3WXX A;  1OWL A;  5FZQ A;  2Q7F A;  3EDT B;  3MKQ B;  3G2T A;  3O48 A;  2AXV A;  4BTB A;  2VGY A;  3JCK C;  4URK A;  4AXH A;  5BT1 A;  4Q96 A;  3LVR E;  2VTB B;  3FEY A;  4JZY A;  3RU0 A;  4YVQ C;  2WXI A;  4GCN A;  3U4T A;  3CHQ A;  4AM9 A;  3MYV A;  1A17 A;  2IF4 A;  4AP2 A;  3CHM A;  3D9I A;  2LSV A;  3FFL A;  4UQX A;  2WXG A;  5LCW C;  1EPU A;  2VQ2 A;  1EF1 C;  3NZU A;  2UY1 A;  4PS8 A;  4AV7 A;  3CVX A;  3TGO A;  5LP0 A;  4JW1 A;  2X6J A;  2OVF A;  2VSN A;  3CVW A;  1UJK A;  4XIF A;  4EBA A;  1ZBP A;  3QWW A;  4AY5 A;  3GZ2 A;  2QFC A;  4GB9 A;  4Y6W A;  4U63 A;  2V4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...