2C0SA

Nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
b'MNVTKLNDRIEAKKKELIYLVEKYGFTHHKVISFSQELDRLLNLLIELKTKKKRYSLLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSERVED DOMAIN PROTEIN
molecule tags Transferase
source organism Bacillus anthracis str. ames
publication title Structural characterization of Spo0E-like protein-aspartic acid phosphatases that regulate sporulation in bacilli.
pubmed doi rcsb
total genus 25
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09388 SpoOE-like Spo0E like sporulation regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c0sA00
2BZBA 2C0SA
chains in the Genus database with same CATH superfamily
4UEMA 2WSSV 3OVUA 2M6IA 1N33T 3AE2A 2XUEA 4O2AE 4C90A 4DV7T 3ZKRA 3LK2B 4TV8E 3E08A 5AQIB 2BS2A 2PJQA 3MXZA 4IDOA 2V8SV 3G06A 4KP3C 3WI3A 2Y8DA 4CZZB 1I6ZA 2BBHA 1LVFA 4I4TE 2VQET 5L2LA 2WU5A 3P4QA 5JDFA 2PTFA 3AXJB 4CI1B 2XJ7A 1UX5A 1HTJF 2KMFA 4IDNA 3AA7B 4N78D 3MACA 4TWFA 5FY7A 3EHZA 5HAXA 4EGWA 2CCQA 2IDOB 3CX7B 1HF8A 4YTPA 5BMVE 4X1KE 3PUWF 2EHOC 2WY2A 4JI6T 3P4SA 5A1LA 2ES0A 2CMRA 3AEGA 3AE4A 3F2EA 3RX6A 4DUZT 3QC9A 1XWMA 2LM2A 4TNVA 4UVCB 5HXRA 3ZT5A 3PU8A 5J1GA 5L47A 2SPCA 1MMDA 1E7PA 1BR0A 1VCSA 3BQIA 3FXDB 2UXDT 4IE7A 2WMOA 3HL6A 4IDPA 4Q25A 2LSKA 3ZC1A 5JVDE 3EAMA 5HEOA 3O1IA 2KSRA 5AQQB 4DR3T 3T8OA 1MIYA 4ZZCA 4GK0E 4QHOA 4QH5A 2LSYA 3UQ7A 3CQCB 3QUJA 4DV1T 2VB6A 3P4RA 3RGLA 1W9RA 4H63H 2EHOD 4F8HA 4DVDA 5L3EB 4LF7T 3LSVA 5AQUB 3ETUA 2C5KT 1G8XA 1W0BA 4JUYA 3RH3A 3KVBA 2X9WA 2RPAA 5HWXA 2WP9A 2L9QA 4JI3T 3RC3A 4DR7T 3FZKB 2X66A 4AI6A 3MA9A 5HEJA 4IE6A 3PUSA 1ZHCA 4ZS2A 5AQGB 3GWHA 4H9PC 2DWGA 2V6XA 4HGAA 2FJEA 2BS3A 5E0OA 3KBTA 3K3OA 2W2UA 3L09A 3NRXA 4YSZA 5H6QB 1W09A 4BJNA 4CXXA 2HN1A 2V5CA 3DTOA 5ABEA 4PW8A 1OEDC 5JDMA 5LBQB 5AQHB 4AQFA 1N32T 3RRWA 3UU4A 3LBXB 3AEEA 3OPCA 3AVRA 1IJ5A 5JDGA 2BDEA 3QOFA 3PE0A 3ZT7A 1J5ET 1N34T 3Q5XA 2WQYA 5JDLA 3UU3A 3Q5EA 4G63A 4HEAA 3QNUA 2W00A 4PJJA 3I0OA 3AE9A 5ADXL 3IHRA 2H89A 5HXSA 2XZEA 3JAFA 3OYZA 4TNWA 4IHJE 2XAHB 4DBQA 5L4EA 4CN6A 1D0YA 1X9BA 2PFVA 3B57A 4HN9A 5AQMB 3HKBE 3S4UA 2B76A 2E9XA 3Q9DA 2G0UA 3HI2A 2WDQA 3AECA 2V7JA 4UF0A 2CXLA 5FXWA 5JDNA 1HX1B 2LRLA 5HEHA 3ZMTB 2KXPB 4EXTA 2K9AA 2NWBA 4MALA 4WW0A 4XBFB 4QXBB 4ZI2D 2PBIA 1YXRA 4YY3T 4X66T 2WMNA 2WAUA 2X67A 1VCTA 2JMHA 3TKLB 3TLUA 4U72A 2XY8B 4H9NC 1BR2A 4PJNA 5LHIB 2W4XA 2OV9A 1MNDA 1G73A 3I0QA 4YJ3E 1LVKA 1H7CA 1S94A 2A72A 2W62A 2WCAA 5GONE 5IHYA 2QVAA 2V7MA 3WAKA 2BVLA 1OEDE 2YU2A 4IDZA 4GYRA 3RKGA 4KI0F 5LJMA 2WM9A 2XSBA 3N9LA 2Q9QD 4LMLA 4TUYE 3Q2MA 4LFCT 4FJOA 4I43B 4O4LE 4AXPA 4JYAT 2XQ7A 5LYJE 3E0ZA 4UXNB 2IW5B 1ZV4X 4HFBA 5CFBA 4UV9B 2DL1A 2CWOA 2X9HA 1OEDB 2LKGA 2LLYA 3QK6A 4KBMB 4MBQA 3P8CD 5FY0A 5JRCB 5FVLA 3O1HA 3IA3A 4YTMA 2YN6A 4ZS3A 2IC9A 4JI7T 2B1EA 2N1GA 3FZFB 4EIWA 2W66A 4UV8B 3MK7C 5FMNA 4AKRB 4U2ZA 3B13A 2LSGA 3AEAA 4JI1T 4DR4T 3RPUA 4E7SA 3LK3B 4ZEYA 4IE4A 2Q9QC 3UTKA 4NUVA 4H63V 4OYKA 1S35A 2WWVA 1T8BA 4DV6T 3AA6B 2X9YA 3PUVF 4LF9T 4UELA 2QYWA 2K48A 4HFIA 2ODUA 3ABVA 3GN5A 2WZHA 3RI5A 2H7VC 3ZYKA 2WB5A 5BR8T 2VQFT 3ZMSB 4KX6A 3CPZA 4JI5T 1WYCA 3ZMVB 3E22E 5FYMA 2VVSA 4O8SA 2XAFB 2J1DG 3PU3A 2RA1A 3PURA 3AEBA 3RYFE 2BKNA 1YD8G 2ACXA 2R6GF 4EOZB 3VU7H 5J2TE 5LMUT 5AQRB 2LKHA 3ZLIA 3FHNA 5C8YE 1M7KA 5F3JA 5AQFB 3ZSSA 2V7KA 4MHCA 4TV9E 5KDMC 3BQLA 2XQ4A 4WZXA 4U74A 2CBJA 4C91A 1WR6A 4DMVA 1I94T 3NWIA 1W0AA 3N2GE 2X0LB 1LRZA 1Z0PA 3NZPA 3O4XE 4A97A 3ZSTA 5FNVE 4ERRA 4YHHT 3BQKA 2LJLA 3K1SA 4HE8A 4IL4A 2MBGA 3LBXA 4TZ4C 4UIGA 1VOMA 4AIUA 4JI0T 1NWMX 3NVOA 2WZIA 4QWNB 3SOLA 3KBUA 2NP9A 1BR1A 3PUQA 4HTEA 4GKJT 2V1DB 4CI3B 5KMGP 4KHPT 3CX6B 4DUYT 2KWIB 3W15B 4QH4A 3FBLA 2KNDA 3AA1B 3HR0A 3N9QA 5L4HA 1L0VA 1UX4A 1XDOA 2JQQA 2CEAA 4U2YA 5FVKA 4YHJA 3CMLA 1D1CA 1KK7A 3P7IA 1VRBA 2XQ6A 2Y6XA 4DBRA 4UVBB 4B3MT 4QKNA 2LHRA 5HWYA 2VKDA 5L3BB 4YJ2E 1SHZC 1IJ6A 1Z8UA 3F57A 3ZYMA 5LJNA 2BG9E 5LGTB 2CLYC 3C50A 1J1JA 5C3JA 2XM1A 2JRKA 2XQYA 2WDRA 1V9DA 4XZCA 5EK4A 2UXCT 3QB5A 1WFDA 1FIOA 3IBPA 5LP6E 2LRKA 3AAEB 3OJAA 4ZHQE 4H9RC 4PFPA 1FMWA 1MMNA 3NBXX 1XZYA 2C0SA 2W63A 5LGNB 5AQJB 4K0UA 3NZQA 2VKJA 4IGUA 2JQ9A 4JV5T 1HNWT 1DU2A 2BVMA 3EABA 5EK3A 2BBJA 4Z90A 2IHR1 3RYIE 3SRZA 3OBVE 4OYJA 3RYHE 2ZM8A 3JC6D 4TX5A 4HFHA 3TLVA 4TN7B 4EAHA 2VURA 4ZZBA 5LG4A 4YT0A 3RKOA 4BJMA 1X79A 4H9OC 2W67A 3V5UA 3Q5WA 5DQVA 4Z8XA 1HFAA 4UVAB 3UU8A 5JR9C 3SS1A 5KX5E 2HPJA 1QSDA 1YW0A 4U33A 3RIUA 4AISA 2V7LA 4B6XA 5FXZA 4DV2T 4O4HE 3ONLC 3AE8A 4QH1A 4ZOLE 3VHLA 3ZJ1A 2GK9A 2XQ3A 3ZMUB 4COFA 3M3ZB 3N2KE 1HNXT 3N9OA 2Q9QA 1HCIA 2J4GA 4QX7B 2V6YA 4ANJA 2BG9C 2WWUA 3RC8A 2CPTA 1EZ3A 3MZKB 2DHRA 3K3QC 3PV0F 4UF0B 4UR9A 5IYZE 2LT3A 4DR6T 2HHHT 3UUNA 2YINA 4ILUA 5HCJA 4JEHB 2W0GA 3ZYLA 3SFDA 1AJ3A 4G2AA 2CWYA 2VWAA 2UXNB 4DV3T 2XSAA 2XQ5A 5LOVE 4A5XA 2IAKA 2M67A 5LG3A 1XMQT 1KNZA 2DCFA 4MFRA 4OFZA 3IF8B 4QXHB 4GOUA 3UT5E 3EUHA 1KFYA 2LSIA 2M6BA 4I50E 2EHOB 1XMOT 2EHOA 3V5SA 1U5PA 3EDVA 3JADA 2CRBA 4WYVA 3JCFA 4F6RC 4NXNT 2JQKA 3RHWA 3ZC0A 2ZM0A 5CA0E 4EZHA 1XDPA 4YSXA 2BKOA 1JNRA 2RP4A 4PFOA 2ACZA 3J9X1 3CQXC 2YDQA 4KUMB 4AKHA 1CUNA 4HWHA 3MKDA 3OYXA 3AE7A 3I1AA 4X62T 2NTYA 1IBLT 4NUUA 2UU9T 2QGSA 4OX9T 1T7SA 2W61A 3RRCA 3P4PA 4LFAT 1ZKEA 2LEHA 3LK42 3L8RA 4HFVA 4O4JE 2IC6A 4P09A 4ZXLA 3CQGB 1Y01A 4X20E 2K5BB 1GQEA 1O3XA 2XHEB 2XQ8A 3LFMA 4LMJA 2VASA 1J5WA 1KEYA 1M62A 2LOSA 3AEDA 3RQUA 1E2AA 1MMAA 4GIWA 2DI4A 3R6NA 4DMWA 5CJ5A 2WS3A 5JR9B 2A3DA 3H37A 5LHHB 2UXBT 1UURA 5EK2A 1D1BA 2J62A 2XASB 2ZMAA 3DJBA 2I0MA 4V1Av 2KT9A 1Y64B 2X68A 3ETVA 3SWHA 3VR8A 3DP7A 4NIQA 4EEDA 5AQNB 2UUBT 2XAJB 4DIDB 2YOEA 2AE9A 4U3CA 2YDSA 4PK6A 3C4ZA 5ABFB 3OTOT 3FXEB 5KXJA 2V26A 3U3IA 3EI0A 2YEVC 2JJ9A 3H3AA 4ZI3C 2XM2A 4LFBT 2J47A 3PDYA 2JPFA 2MTQA 2A2FX 2LE8A 1SE7A 2E9XD 3N9NA 3U78A 2DLRA 2LM9A 3J7Yq 5J2UE 4EZ4A 4AQFC 2FUPA 5F5WA 4HFCA 3T1YT 1WCRA 3UULA 5HXCA 5DQWA 5LBMA 2QA7A 5ABGA 5C2TA 5JDQA 5LMNT 4AQYT 3AAAB 5LGUB 4EYYR 2E5LT 2QRXA 3ZCIA 1OWAA 4DNDA 4K0KT 4YXDA 4CXYA 2NW9A 3ANWA 4LF4T 3K3NA 1T98A 2HN2A 1ZP0A 4X1YE 2UXXB 3UU6A 4TWDA 4YTNA 3AVSA 3A8YC 1CHUA 3RF1A 1LKXA 2VL8A 4ISTA 2VKHA 4YLHA 2VKOA 3PJAJ 4H9QC 2KZ7B 4HFDA 3UUXB 3RQWA 4EV6A 4OHFA 4WBNE 3D0TA 3L39A 4M1PA 5DABA 3TLWA 5CB4E 2XAGB 3FZHB 3CIRA 2ZM6T 4IREA 1HR0T 2A9UA 2E5VA 2PG8A 2I6HA 3LG7A 4ILCA 3VKGA 4JI8T 1WYBA 2K24A 4HKAA 2FJAA 5LNKA 1E1HB 2VVNA 4GK5E 1HX8A 2DWKA 4L0RA 4WBOA 1XNRT 3WAJA 3KV6A 4DR1T 1D0ZA 3JAEA 2LHNA 3AXJA 3PUXF 2NR4A 4PAGA 3AE6A 5FXXA 4ASKA 3FZLB 5FY1A 1FEWA 4KMCA 1NENA 2FJDA 3FBZA 3ZN1B 4A98A 3CK6A 1YKHB 1IBMT 4IIJE 5JH7E 1OXZA 1NEKA 3GMIA 4L9IA 4PK5A 5FXVA 5H6RB 4JI4T 2H3RA 2D0TA 3RIFA 3P4WA 4DV5T 5HXEA 2IMLA 4Z91A 1FJGT 3ZCJA 3O1JA 2MPKA 3N5LA 1HG5A 5FL0A 2YDRA 3FZMB 3PJAA 4ISSA 1B7TA 2BZBA 2CBIA 3NKZA 4EEBA 5FL1A 5HXHA 1HNZT 3AB3B 1HS7A 3I9YA 3JC6C 1UGOA 2C5IT 5IWAT 4HWCA 1UCUA 4GYSA 1FMVA 2JQHA 3HKEE 2C5JA 5AQOB 2KLQA 4HWDA 3GA8A 2N2NA 1WRDA 4TWHA 3KINB 4HWIB 3C98B 3PUAA 5HYAA 4IE0A 2DNXA 1T72A 2D0UA 4PNIA 5HEGA 3VRBA 3FB2A 2Y48B 3KVAA 2CXDA 1D1AA 4L5GA 5HCMA 1MIWA 2CXFA 3TLTA 3PTRB 5LA6E 3ONJA 3B5MA 4JBWF 5AQSB 3N9MA 1KNRA 1US7B 3H3MA 5AQPB 4O2BE 4IT4A 4P0AA 2D9DA 1OEDA 4HWFA 2FBWA 3K8PC 4AKIA 4BAYB 2MOZA 5EZYE 2KINB 4CN1A 4X65T 1D0XA 2Q9QB 2BKPA 2FJBA 4GKKT 4DV4T 1QLBA 2JMKA 2L8KA 2X0HA 4QXCB 3C51A 4DR5T 2P9BA 3ZN0B 4OK0A 3C64A 2JIWA 1NAFA 2YU1A 1WR0A 3EDUA 4J2CA 1SUMB 2D5UA 2HH7A 4JLEA 5DJQC 3VR9A 1QUUA 4CN4A 2UUCT 2WU2A 4X64T 3AEFA 4PJLA 2V7IA 4MLKA 4PK4A 5ABHA 3N2OA 4ZI3D 4JI2T 4CI2B 2VK9A 5AQKB 2E9XC 3UFEA 5CGMA 5LHGB 1XNQT 5CA1E 2ZM2A 1HG2A 4A56A 4YSYA 2NW7A 3UU5A 2KWHA 2CHOA 4DR2T 5ETWA 3AA0B 3KV5A 5LCYA 5L3CB 2F4VT 5IUXA 5AQTB 2E8IA 1ZEEA 2MYSA 2E2AA 3KV4A 4FI5A 2K3WA 3ZMZB 3C4WA 4PJMA 4EB6E 2X51A 3CKDA 1IZNB 3NRYA 4X5TA 4EYUA 3ZEFB 5L3FB 4AQGA 3CX8B 4QX8B 4B3RT 5JQGE 2YK0A 1YKEB 1IBKT 1R8IA 4O4IE 2LSJA 3LJCA 4X1IE 1U4QA 3X1DA 5JDHA 3VKHA 2Z6EA 2XQAA 5JREA 4YFSA 4P1NA 2XAQB 2YKSA 1SA0E 3UUBA 2ODVA 3Q5DA 1UUSA 2CHNA 4IE5A 3AE1A 4XAXB 2WBLA 2WDVA 5L3DB 4IL9A 4CQIA 2OA5A 2CM0A 4U7YA 2CLYB 2XQ9A 4I55E 4ILBA 2D2SA 2VL0A 2HPLA 2XTLA 2IUBA 3SFEA 5TAOA 1N36T 4AKLA 3A5XA 3AE3A 3MJXA 3HKCE 3F31A 4JEUB 2CE7A 2X9XA 5AFUL 3KFWX 3AE5A 3ZPOA 1MNEA 4KHZF 2I59A 3BK9A 3KV9A 4LF8T 3KDSE 1YQ3A 4P0BA 5FP3A 5HEUA 3A7MA 5LB7B 3RIAA 4ADZA 4LF6T 2L3LA 3IEEA 5ABFA 1MIVA 1MMGA 2H88A 2X0YA 2XPKA 3AAIA 5AQLB 3GN5B 3ZJ2A 4LF5T 1UK5A 3HKDE 3ZT6A 4ILAA 3P50A 3UUMA 2ZLYA 3ESLA 1IAPA 2NOXA 3CWZB 3QB5K 2N9DA 3TLSA 2OLTA 1YQ4A 4HFEA 3LDQB 5JRCA 5M4YA 3VRAA 4U31A 1BR4A 3HA4A 2AXDS 2V6YB 3RLFF 1WLXA 4IDQA 3O9XA 3RIUC 3CVRA 4B3TT 3T1HT 4LMKA 4U7IA 4DV0T 3ANWB 3I9WA 2E9XB 5JR9A 3UFGA 4ZI7E 5AQVB 2BS4A 3ONXA 4E7ZA 4I0UA 2V5DA 3R84B 1KNPA 5LXTE 3M65A 4NPPA 5L3GB 3PUZF 2NW8A 1KF6A 2UUAT 2CA5A 2IIUA 3RYCE 4BA9A 4B3ST 2H7OA 4H9SE 5F8PA 3OKQA 5JTGA 2MAWA 1JNZA 3UQ4A 2LOPA 3PUGA 3PUYF 4WNKA 5FKYA 4CXWA 3C4XA 1ZOYA 4NXMT 4ZI2C 3N9PA 3L3PA 4DO0A 4AKGA 2BG9A 2BG9B 2NTXA 3EVYA 5J0ZA
chains in the Genus database with same CATH topology
4UEMA 2WSSV 2XUEA 4O2AE 4C90A 3LK2B 4TV8E 3E08A 2PJQA 3MXZA 4KP3C 3WI3A 2Y8DA 4CZZB 1LVFA 4I4TE 5L2LA 5JDFA 4CI1B 1UX5A 1HTJF 2KMFA 4N78D 3AA7B 5FY7A 3MACA 5HAXA 2CCQA 3CX7B 1HF8A 5BMVE 4X1KE 2EHOC 5A1LA 2ES0A 2CMRA 3F2EA 3RX6A 3QC9A 4UVCB 5HXRA 3PU8A 5J1GA 2SPCA 1MMDA 1BR0A 3FXDB 3BQIA 4IE7A 2WMOA 3HL6A 3ZC1A 2LSKA 5JVDE 3O1IA 3T8OA 1MIYA 4GK0E 4QHOA 2LSYA 3CQCB 3QUJA 2VB6A 4H63H 2EHOD 4DVDA 5L3EB 3ETUA 2C5KT 1G8XA 4JUYA 5HWXA 3RH3A 3KVBA 2X9WA 2L9QA 3RC3A 4AI6A 3MA9A 4IE6A 3PUSA 1ZHCA 4ZS2A 3GWHA 4H9PC 2DWGA 4HGAA 5E0OA 3KBTA 3K3OA 3L09A 3NRXA 5H6QB 4CXXA 3DTOA 4PW8A 5LBQB 4AQFA 3RRWA 3LBXB 3AVRA 1IJ5A 5JDGA 2BDEA 3PE0A 3Q5XA 5JDLA 4G63A 4HEAA 4PJJA 2W00A 3I0OA 5ADXL 3IHRA 5HXSA 3OYZA 4IHJE 2XAHB 4DBQA 1D0YA 2PFVA 3B57A 4HN9A 3HKBE 3S4UA 2E9XA 3Q9DA 2G0UA 3HI2A 5JDNA 2V7JA 4UF0A 2CXLA 5FXWA 3ZMTB 2KXPB 4EXTA 2K9AA 2NWBA 4MALA 4WW0A 4XBFB 4QXBB 4ZI2D 2PBIA 2WMNA 2WAUA 2X67A 2JMHA 3TKLB 4U72A 4PJNA 4H9NC 1BR2A 5LHIB 1MNDA 1G73A 3I0QA 4YJ3E 1LVKA 1H7CA 1S94A 2A72A 2W62A 5GONE 5IHYA 2V7MA 3WAKA 2BVLA 2YU2A 4IDZA 4GYRA 5LJMA 2WM9A 3N9LA 2Q9QD 4TUYE 3Q2MA 4FJOA 4I43B 4O4LE 4AXPA 5LYJE 3E0ZA 4UXNB 2IW5B 1ZV4X 4UV9B 2CWOA 2X9HA 3QK6A 4KBMB 4MBQA 5JRCB 3P8CD 5FY0A 3O1HA 4ZS3A 2IC9A 2B1EA 2N1GA 4EIWA 4UV8B 3MK7C 5FMNA 4AKRB 3B13A 2LSGA 3RPUA 4E7SA 3LK3B 4IE4A 2Q9QC 3UTKA 4NUVA 4H63V 4OYKA 1S35A 3AA6B 2X9YA 4UELA 2K48A 2ODUA 3GN5A 2H7VC 3ZYKA 3ZMSB 3CPZA 1WYCA 3ZMVB 3E22E 5FYMA 4O8SA 2XAFB 2J1DG 3PU3A 2RA1A 3PURA 3RYFE 1YD8G 2ACXA 4EOZB 5J2TE 3VU7H 3ZLIA 3FHNA 5C8YE 5F3JA 2V7KA 4MHCA 4TV9E 5KDMC 3BQLA 4U74A 4C91A 1WR6A 4DMVA 3N2GE 2X0LB 1LRZA 1Z0PA 3NZPA 3O4XE 4ERRA 5FNVE 3BQKA 2LJLA 4HE8A 2MBGA 3LBXA 4TZ4C 4UIGA 1VOMA 1NWMX 4QWNB 3SOLA 3KBUA 1BR1A 2NP9A 3PUQA 4HTEA 2V1DB 4CI3B 5KMGP 3CX6B 2KWIB 3W15B 5M4YA 3FBLA 2KNDA 3AA1B 3HR0A 3N9QA 1UX4A 2JQQA 2CEAA 4YHJA 3CMLA 3P7IA 1KK7A 1VRBA 2Y6XA 4DBRA 4UVBB 4QKNA 2LHRA 5HWYA 2VKDA 5L3BB 4YJ2E 1SHZC 1IJ6A 3F57A 3ZYMA 5LJNA 5LGTB 2CLYC 3C50A 2JRKA 2XQYA 1V9DA 4XZCA 5EK4A 1FIOA 3IBPA 5LP6E 3AAEB 3OJAA 4ZHQE 4H9RC 4PFPA 1FMWA 1MMNA 3NBXX 2C0SA 2W63A 5LGNB 4K0UA 3NZQA 2VKJA 4IGUA 2BVMA 5EK3A 3RYIE 3SRZA 3OBVE 4OYJA 3RYHE 2ZM8A 3JC6D 4TX5A 4EAHA 4TN7B 5LG4A 3RKOA 4BJMA 1X79A 4H9OC 1AJ3A 3V5UA 3Q5WA 5DQVA 4Z8XA 1HFAA 4UVAB 5JR9C 5KX5E 3SS1A 2HPJA 1QSDA 1YW0A 4B6XA 2V7LA 5FXZA 4O4HE 3VHLA 4ZOLE 3ZJ1A 2GK9A 3ZMUB 3N2KE 3N9OA 2Q9QA 1HCIA 4QX7B 4ANJA 2WWUA 3RC8A 1EZ3A 3MZKB 2DHRA 3K3QC 4UF0B 5IYZE 2LT3A 3UUNA 2YINA 4ILUA 4JEHB 2W0GA 3ZYLA 4G2AA 2CWYA 2VWAA 2UXNB 5LOVE 2IAKA 2M67A 1KNZA 2DCFA 4MFRA 4OFZA 3IF8B 4QXHB 4GOUA 3UT5E 3EUHA 2LSIA 4I50E 2EHOB 2EHOA 3V5SA 1U5PA 3EDVA 4F6RC 3ZC0A 2ZM0A 5CA0E 4EZHA 2RP4A 4PFOA 3J9X1 3CQXC 4KUMB 4AKHA 1CUNA 3MKDA 3OYXA 3I1AA 2NTYA 4NUUA 2QGSA 2W61A 3RRCA 1ZKEA 2LEHA 3LK42 4HFVA 4O4JE 2IC6A 4P09A 3CQGB 4X20E 2K5BB 1O3XA 2XHEB 3LFMA 2VASA 2LOSA 4GIWA 1MMAA 3R6NA 2DI4A 4DMWA 5LHHB 5JR9B 2A3DA 3H37A 5EK2A 1D1BA 2XASB 2ZMAA 3DJBA 4V1Av 2KT9A 1Y64B 2X68A 3ETVA 3SWHA 3DP7A 2XAJB 4PK6A 3C4ZA 3FXEB 2V26A 3U3IA 2YEVC 2JJ9A 3H3AA 4ZI3C 3PDYA 2JPFA 2MTQA 2A2FX 2LE8A 3N9NA 2E9XD 3U78A 3J7Yq 2DLRA 2LM9A 5J2UE 4EZ4A 4AQFC 5JDQA 3UULA 5HXCA 5DQWA 5LBMA 2QA7A 3AAAB 5LGUB 4EYYR 3ZCIA 1OWAA 4DNDA 4CXYA 2NW9A 3ANWA 3K3NA 1T98A 4X1YE 2UXXB 3AVSA 1LKXA 2VL8A 4ISTA 2VKHA 4YLHA 2VKOA 4H9QC 3UUXB 2KZ7B 4OHFA 4WBNE 3D0TA 4M1PA 5DABA 5CB4E 2XAGB 2PG8A 3LG7A 3VKGA 1WYBA 2K24A 4HKAA 5LNKA 1E1HB 4GK5E 1HX8A 2DWKA 4L0RA 4WBOA 3WAJA 3KV6A 1D0ZA 5FXXA 2LHNA 4PAGA 4ASKA 4BJNA 5FY1A 1FEWA 4KMCA 3FBZA 3ZN1B 1YKHB 4IIJE 5JH7E 1OXZA 3GMIA 4PK5A 4L9IA 5FXVA 5H6RB 2H3RA 2D0TA 5HXEA 3ZCJA 3O1JA 3N5LA 1HG5A 4ISSA 5HXHA 5JDMA 1B7TA 2BZBA 3AB3B 1HS7A 3I9YA 3JC6C 2C5IT 1UCUA 4GYSA 1FMVA 3HKEE 2C5JA 2KLQA 3GA8A 2N2NA 1WRDA 3KINB 3C98B 3PUAA 5HYAA 4IE0A 2DNXA 2D0UA 4PNIA 3FB2A 2Y48B 3KVAA 2CXDA 1D1AA 4L5GA 1MIWA 2CXFA 3PTRB 5LA6E 3N9MA 1US7B 4O2BE 4P0AA 4AKIA 3K8PC 4BAYB 2MOZA 5EZYE 2KINB 1D0XA 2Q9QB 2JMKA 2L8KA 4QXCB 3C51A 2P9BA 3ZN0B 4OK0A 3C64A 3EDUA 1NAFA 2YU1A 4J2CA 4JLEA 5DJQC 2D5UA 2HH7A 1QUUA 4PJLA 2V7IA 4MLKA 4PK4A 3N2OA 4ZI3D 4CI2B 2VK9A 5LHGB 2E9XC 3UFEA 5CA1E 2ZM2A 1HG2A 4A56A 2NW7A 2KWHA 5ETWA 3AA0B 3KV5A 5LCYA 5L3CB 2E8IA 1ZEEA 2MYSA 3KV4A 4FI5A 3ZMZB 3C4WA 4PJMA 4EB6E 2X51A 3CKDA 1IZNB 3NRYA 4EYUA 3ZEFB 5L3FB 4AQGA 3CX8B 4QX8B 5JQGE 2YK0A 1YKEB 4O4IE 2LSJA 3LJCA 4X1IE 1U4QA 5JDHA 3VKHA 2Z6EA 5JREA 4YFSA 2XAQB 1SA0E 2ODVA 4IE5A 4XAXB 2WBLA 5L3DB 4CQIA 2OA5A 2CM0A 2CLYB 4I55E 2D2SA 2HPLA 2XTLA 5TAOA 4AKLA 3A5XA 3MJXA 3HKCE 3F31A 4JEUB 2CE7A 2X9XA 5AFUL 3KFWX 3ZPOA 1MNEA 2I59A 3BK9A 3KV9A 3KDSE 4P0BA 5FP3A 4ADZA 2L3LA 3IEEA 1MIVA 1MMGA 3AAIA 3ZJ2A 3GN5B 3HKDE 3UUMA 3ESLA 2ZLYA 1IAPA 2NOXA 3CWZB 5JRCA 2N9DA 1BR4A 3HA4A 1WLXA 3O9XA 3CVRA 3ANWB 3I9WA 2E9XB 5JR9A 4ZI7E 3ONXA 4E7ZA 3R84B 5LXTE 3M65A 5L3GB 2NW8A 2CA5A 3RYCE 4BA9A 2H7OA 4H9SE 5F8PA 3OKQA 4CXWA 2LOPA 3PUGA 4WNKA 3C4XA 4ZI2C 3N9PA 3L3PA 4DO0A 4AKGA 2X66A 1D1CA 2NTXA 3EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZB A;  2C0S A; 
#chains in the Genus database with same CATH topology
 4UEM A;  2WSS V;  3OVU A;  2M6I A;  1N33 T;  3AE2 A;  2XUE A;  4O2A E;  4C90 A;  4DV7 T;  3ZKR A;  3LK2 B;  4TV8 E;  3E08 A;  5AQI B;  2BS2 A;  2PJQ A;  3MXZ A;  4IDO A;  2V8S V;  3G06 A;  4KP3 C;  3WI3 A;  2Y8D A;  4CZZ B;  1I6Z A;  2BBH A;  1LVF A;  4I4T E;  2VQE T;  5L2L A;  2WU5 A;  3P4Q A;  5JDF A;  2PTF A;  3AXJ B;  4CI1 B;  2XJ7 A;  1UX5 A;  1HTJ F;  2KMF A;  4IDN A;  3AA7 B;  4N78 D;  3MAC A;  4TWF A;  5FY7 A;  3EHZ A;  5HAX A;  4EGW A;  2CCQ A;  2IDO B;  3CX7 B;  1HF8 A;  4YTP A;  5BMV E;  4X1K E;  3PUW F;  2EHO C;  2WY2 A;  4JI6 T;  3P4S A;  5A1L A;  2ES0 A;  2CMR A;  3AEG A;  3AE4 A;  3F2E A;  3RX6 A;  4DUZ T;  3QC9 A;  1XWM A;  2LM2 A;  4TNV A;  4UVC B;  5HXR A;  3ZT5 A;  3PU8 A;  5J1G A;  5L47 A;  2SPC A;  1MMD A;  1E7P A;  1BR0 A;  1VCS A;  3BQI A;  3FXD B;  2UXD T;  4IE7 A;  2WMO A;  3HL6 A;  4IDP A;  4Q25 A;  2LSK A;  3ZC1 A;  5JVD E;  3EAM A;  5HEO A;  3O1I A;  2KSR A;  5AQQ B;  4DR3 T;  3T8O A;  1MIY A;  4ZZC A;  4GK0 E;  4QHO A;  4QH5 A;  2LSY A;  3UQ7 A;  3CQC B;  3QUJ A;  4DV1 T;  2VB6 A;  3P4R A;  3RGL A;  1W9R A;  4H63 H;  2EHO D;  4F8H A;  4DVD A;  5L3E B;  4LF7 T;  3LSV A;  5AQU B;  3ETU A;  2C5K T;  1G8X A;  1W0B A;  4JUY A;  3RH3 A;  3KVB A;  2X9W A;  2RPA A;  5HWX A;  2WP9 A;  2L9Q A;  4JI3 T;  3RC3 A;  4DR7 T;  3FZK B;  2X66 A;  4AI6 A;  3MA9 A;  5HEJ A;  4IE6 A;  3PUS A;  1ZHC A;  4ZS2 A;  5AQG B;  3GWH A;  4H9P C;  2DWG A;  2V6X A;  4HGA A;  2FJE A;  2BS3 A;  5E0O A;  3KBT A;  3K3O A;  2W2U A;  3L09 A;  3NRX A;  4YSZ A;  5H6Q B;  1W09 A;  4BJN A;  4CXX A;  2HN1 A;  2V5C A;  3DTO A;  5ABE A;  4PW8 A;  1OED C;  5JDM A;  5LBQ B;  5AQH B;  4AQF A;  1N32 T;  3RRW A;  3UU4 A;  3LBX B;  3AEE A;  3OPC A;  3AVR A;  1IJ5 A;  5JDG A;  2BDE A;  3QOF A;  3PE0 A;  3ZT7 A;  1J5E T;  1N34 T;  3Q5X A;  2WQY A;  5JDL A;  3UU3 A;  3Q5E A;  4G63 A;  4HEA A;  3QNU A;  2W00 A;  4PJJ A;  3I0O A;  3AE9 A;  5ADX L;  3IHR A;  2H89 A;  5HXS A;  2XZE A;  3JAF A;  3OYZ A;  4TNW A;  4IHJ E;  2XAH B;  4DBQ A;  5L4E A;  4CN6 A;  1D0Y A;  1X9B A;  2PFV A;  3B57 A;  4HN9 A;  5AQM B;  3HKB E;  3S4U A;  2B76 A;  2E9X A;  3Q9D A;  2G0U A;  3HI2 A;  2WDQ A;  3AEC A;  2V7J A;  4UF0 A;  2CXL A;  5FXW A;  5JDN A;  1HX1 B;  2LRL A;  5HEH A;  3ZMT B;  2KXP B;  4EXT A;  2K9A A;  2NWB A;  4MAL A;  4WW0 A;  4XBF B;  4QXB B;  4ZI2 D;  2PBI A;  1YXR A;  4YY3 T;  4X66 T;  2WMN A;  2WAU A;  2X67 A;  1VCT A;  2JMH A;  3TKL B;  3TLU A;  4U72 A;  2XY8 B;  4H9N C;  1BR2 A;  4PJN A;  5LHI B;  2W4X A;  2OV9 A;  1MND A;  1G73 A;  3I0Q A;  4YJ3 E;  1LVK A;  1H7C A;  1S94 A;  2A72 A;  2W62 A;  2WCA A;  5GON E;  5IHY A;  2QVA A;  2V7M A;  3WAK A;  2BVL A;  1OED E;  2YU2 A;  4IDZ A;  4GYR A;  3RKG A;  4KI0 F;  5LJM A;  2WM9 A;  2XSB A;  3N9L A;  2Q9Q D;  4LML A;  4TUY E;  3Q2M A;  4LFC T;  4FJO A;  4I43 B;  4O4L E;  4AXP A;  4JYA T;  2XQ7 A;  5LYJ E;  3E0Z A;  4UXN B;  2IW5 B;  1ZV4 X;  4HFB A;  5CFB A;  4UV9 B;  2DL1 A;  2CWO A;  2X9H A;  1OED B;  2LKG A;  2LLY A;  3QK6 A;  4KBM B;  4MBQ A;  3P8C D;  5FY0 A;  5JRC B;  5FVL A;  3O1H A;  3IA3 A;  4YTM A;  2YN6 A;  4ZS3 A;  2IC9 A;  4JI7 T;  2B1E A;  2N1G A;  3FZF B;  4EIW A;  2W66 A;  4UV8 B;  3MK7 C;  5FMN A;  4AKR B;  4U2Z A;  3B13 A;  2LSG A;  3AEA A;  4JI1 T;  4DR4 T;  3RPU A;  4E7S A;  3LK3 B;  4ZEY A;  4IE4 A;  2Q9Q C;  3UTK A;  4NUV A;  4H63 V;  4OYK A;  1S35 A;  2WWV A;  1T8B A;  4DV6 T;  3AA6 B;  2X9Y A;  3PUV F;  4LF9 T;  4UEL A;  2QYW A;  2K48 A;  4HFI A;  2ODU A;  3ABV A;  3GN5 A;  2WZH A;  3RI5 A;  2H7V C;  3ZYK A;  2WB5 A;  5BR8 T;  2VQF T;  3ZMS B;  4KX6 A;  3CPZ A;  4JI5 T;  1WYC A;  3ZMV B;  3E22 E;  5FYM A;  2VVS A;  4O8S A;  2XAF B;  2J1D G;  3PU3 A;  2RA1 A;  3PUR A;  3AEB A;  3RYF E;  2BKN A;  1YD8 G;  2ACX A;  2R6G F;  4EOZ B;  3VU7 H;  5J2T E;  5LMU T;  5AQR B;  2LKH A;  3ZLI A;  3FHN A;  5C8Y E;  1M7K A;  5F3J A;  5AQF B;  3ZSS A;  2V7K A;  4MHC A;  4TV9 E;  5KDM C;  3BQL A;  2XQ4 A;  4WZX A;  4U74 A;  2CBJ A;  4C91 A;  1WR6 A;  4DMV A;  1I94 T;  3NWI A;  1W0A A;  3N2G E;  2X0L B;  1LRZ A;  1Z0P A;  3NZP A;  3O4X E;  4A97 A;  3ZST A;  5FNV E;  4ERR A;  4YHH T;  3BQK A;  2LJL A;  3K1S A;  4HE8 A;  4IL4 A;  2MBG A;  3LBX A;  4TZ4 C;  4UIG A;  1VOM A;  4AIU A;  4JI0 T;  1NWM X;  3NVO A;  2WZI A;  4QWN B;  3SOL A;  3KBU A;  2NP9 A;  1BR1 A;  3PUQ A;  4HTE A;  4GKJ T;  2V1D B;  4CI3 B;  5KMG P;  4KHP T;  3CX6 B;  4DUY T;  2KWI B;  3W15 B;  4QH4 A;  3FBL A;  2KND A;  3AA1 B;  3HR0 A;  3N9Q A;  5L4H A;  1L0V A;  1UX4 A;  1XDO A;  2JQQ A;  2CEA A;  4U2Y A;  5FVK A;  4YHJ A;  3CML A;  1D1C A;  1KK7 A;  3P7I A;  1VRB A;  2XQ6 A;  2Y6X A;  4DBR A;  4UVB B;  4B3M T;  4QKN A;  2LHR A;  5HWY A;  2VKD A;  5L3B B;  4YJ2 E;  1SHZ C;  1IJ6 A;  1Z8U A;  3F57 A;  3ZYM A;  5LJN A;  2BG9 E;  5LGT B;  2CLY C;  3C50 A;  1J1J A;  5C3J A;  2XM1 A;  2JRK A;  2XQY A;  2WDR A;  1V9D A;  4XZC A;  5EK4 A;  2UXC T;  3QB5 A;  1WFD A;  1FIO A;  3IBP A;  5LP6 E;  2LRK A;  3AAE B;  3OJA A;  4ZHQ E;  4H9R C;  4PFP A;  1FMW A;  1MMN A;  3NBX X;  1XZY A;  2C0S A;  2W63 A;  5LGN B;  5AQJ B;  4K0U A;  3NZQ A;  2VKJ A;  4IGU A;  2JQ9 A;  4JV5 T;  1HNW T;  1DU2 A;  2BVM A;  3EAB A;  5EK3 A;  2BBJ A;  4Z90 A;  2IHR 1;  3RYI E;  3SRZ A;  3OBV E;  4OYJ A;  3RYH E;  2ZM8 A;  3JC6 D;  4TX5 A;  4HFH A;  3TLV A;  4TN7 B;  4EAH A;  2VUR A;  4ZZB A;  5LG4 A;  4YT0 A;  3RKO A;  4BJM A;  1X79 A;  4H9O C;  2W67 A;  3V5U A;  3Q5W A;  5DQV A;  4Z8X A;  1HFA A;  4UVA B;  3UU8 A;  5JR9 C;  3SS1 A;  5KX5 E;  2HPJ A;  1QSD A;  1YW0 A;  4U33 A;  3RIU A;  4AIS A;  2V7L A;  4B6X A;  5FXZ A;  4DV2 T;  4O4H E;  3ONL C;  3AE8 A;  4QH1 A;  4ZOL E;  3VHL A;  3ZJ1 A;  2GK9 A;  2XQ3 A;  3ZMU B;  4COF A;  3M3Z B;  3N2K E;  1HNX T;  3N9O A;  2Q9Q A;  1HCI A;  2J4G A;  4QX7 B;  2V6Y A;  4ANJ A;  2BG9 C;  2WWU A;  3RC8 A;  2CPT A;  1EZ3 A;  3MZK B;  2DHR A;  3K3Q C;  3PV0 F;  4UF0 B;  4UR9 A;  5IYZ E;  2LT3 A;  4DR6 T;  2HHH T;  3UUN A;  2YIN A;  4ILU A;  5HCJ A;  4JEH B;  2W0G A;  3ZYL A;  3SFD A;  1AJ3 A;  4G2A A;  2CWY A;  2VWA A;  2UXN B;  4DV3 T;  2XSA A;  2XQ5 A;  5LOV E;  4A5X A;  2IAK A;  2M67 A;  5LG3 A;  1XMQ T;  1KNZ A;  2DCF A;  4MFR A;  4OFZ A;  3IF8 B;  4QXH B;  4GOU A;  3UT5 E;  3EUH A;  1KFY A;  2LSI A;  2M6B A;  4I50 E;  2EHO B;  1XMO T;  2EHO A;  3V5S A;  1U5P A;  3EDV A;  3JAD A;  2CRB A;  4WYV A;  3JCF A;  4F6R C;  4NXN T;  2JQK A;  3RHW A;  3ZC0 A;  2ZM0 A;  5CA0 E;  4EZH A;  1XDP A;  4YSX A;  2BKO A;  1JNR A;  2RP4 A;  4PFO A;  2ACZ A;  3J9X 1;  3CQX C;  2YDQ A;  4KUM B;  4AKH A;  1CUN A;  4HWH A;  3MKD A;  3OYX A;  3AE7 A;  3I1A A;  4X62 T;  2NTY A;  1IBL T;  4NUU A;  2UU9 T;  2QGS A;  4OX9 T;  1T7S A;  2W61 A;  3RRC A;  3P4P A;  4LFA T;  1ZKE A;  2LEH A;  3LK4 2;  3L8R A;  4HFV A;  4O4J E;  2IC6 A;  4P09 A;  4ZXL A;  3CQG B;  1Y01 A;  4X20 E;  2K5B B;  1GQE A;  1O3X A;  2XHE B;  2XQ8 A;  3LFM A;  4LMJ A;  2VAS A;  1J5W A;  1KEY A;  1M62 A;  2LOS A;  3AED A;  3RQU A;  1E2A A;  1MMA A;  4GIW A;  2DI4 A;  3R6N A;  4DMW A;  5CJ5 A;  2WS3 A;  5JR9 B;  2A3D A;  3H37 A;  5LHH B;  2UXB T;  1UUR A;  5EK2 A;  1D1B A;  2J62 A;  2XAS B;  2ZMA A;  3DJB A;  2I0M A;  4V1A v;  2KT9 A;  1Y64 B;  2X68 A;  3ETV A;  3SWH A;  3VR8 A;  3DP7 A;  4NIQ A;  4EED A;  5AQN B;  2UUB T;  2XAJ B;  4DID B;  2YOE A;  2AE9 A;  4U3C A;  2YDS A;  4PK6 A;  3C4Z A;  5ABF B;  3OTO T;  3FXE B;  5KXJ A;  2V26 A;  3U3I A;  3EI0 A;  2YEV C;  2JJ9 A;  3H3A A;  4ZI3 C;  2XM2 A;  4LFB T;  2J47 A;  3PDY A;  2JPF A;  2MTQ A;  2A2F X;  2LE8 A;  1SE7 A;  2E9X D;  3N9N A;  3U78 A;  2DLR A;  2LM9 A;  3J7Y q;  5J2U E;  4EZ4 A;  4AQF C;  2FUP A;  5F5W A;  4HFC A;  3T1Y T;  1WCR A;  3UUL A;  5HXC A;  5DQW A;  5LBM A;  2QA7 A;  5ABG A;  5C2T A;  5JDQ A;  5LMN T;  4AQY T;  3AAA B;  5LGU B;  4EYY R;  2E5L T;  2QRX A;  3ZCI A;  1OWA A;  4DND A;  4K0K T;  4YXD A;  4CXY A;  2NW9 A;  3ANW A;  4LF4 T;  3K3N A;  1T98 A;  2HN2 A;  1ZP0 A;  4X1Y E;  2UXX B;  3UU6 A;  4TWD A;  4YTN A;  3AVS A;  3A8Y C;  1CHU A;  3RF1 A;  1LKX A;  2VL8 A;  4IST A;  2VKH A;  4YLH A;  2VKO A;  3PJA J;  4H9Q C;  2KZ7 B;  4HFD A;  3UUX B;  3RQW A;  4EV6 A;  4OHF A;  4WBN E;  3D0T A;  3L39 A;  4M1P A;  5DAB A;  3TLW A;  5CB4 E;  2XAG B;  3FZH B;  3CIR A;  2ZM6 T;  4IRE A;  1HR0 T;  2A9U A;  2E5V A;  2PG8 A;  2I6H A;  3LG7 A;  4ILC A;  3VKG A;  4JI8 T;  1WYB A;  2K24 A;  4HKA A;  2FJA A;  5LNK A;  1E1H B;  2VVN A;  4GK5 E;  1HX8 A;  2DWK A;  4L0R A;  4WBO A;  1XNR T;  3WAJ A;  3KV6 A;  4DR1 T;  1D0Z A;  3JAE A;  2LHN A;  3AXJ A;  3PUX F;  2NR4 A;  4PAG A;  3AE6 A;  5FXX A;  4ASK A;  3FZL B;  5FY1 A;  1FEW A;  4KMC A;  1NEN A;  2FJD A;  3FBZ A;  3ZN1 B;  4A98 A;  3CK6 A;  1YKH B;  1IBM T;  4IIJ E;  5JH7 E;  1OXZ A;  1NEK A;  3GMI A;  4L9I A;  4PK5 A;  5FXV A;  5H6R B;  4JI4 T;  2H3R A;  2D0T A;  3RIF A;  3P4W A;  4DV5 T;  5HXE A;  2IML A;  4Z91 A;  1FJG T;  3ZCJ A;  3O1J A;  2MPK A;  3N5L A;  1HG5 A;  5FL0 A;  2YDR A;  3FZM B;  3PJA A;  4ISS A;  1B7T A;  2BZB A;  2CBI A;  3NKZ A;  4EEB A;  5FL1 A;  5HXH A;  1HNZ T;  3AB3 B;  1HS7 A;  3I9Y A;  3JC6 C;  1UGO A;  2C5I T;  5IWA T;  4HWC A;  1UCU A;  4GYS A;  1FMV A;  2JQH A;  3HKE E;  2C5J A;  5AQO B;  2KLQ A;  4HWD A;  3GA8 A;  2N2N A;  1WRD A;  4TWH A;  3KIN B;  4HWI B;  3C98 B;  3PUA A;  5HYA A;  4IE0 A;  2DNX A;  1T72 A;  2D0U A;  4PNI A;  5HEG A;  3VRB A;  3FB2 A;  2Y48 B;  3KVA A;  2CXD A;  1D1A A;  4L5G A;  5HCM A;  1MIW A;  2CXF A;  3TLT A;  3PTR B;  5LA6 E;  3ONJ A;  3B5M A;  4JBW F;  5AQS B;  3N9M A;  1KNR A;  1US7 B;  3H3M A;  5AQP B;  4O2B E;  4IT4 A;  4P0A A;  2D9D A;  1OED A;  4HWF A;  2FBW A;  3K8P C;  4AKI A;  4BAY B;  2MOZ A;  5EZY E;  2KIN B;  4CN1 A;  4X65 T;  1D0X A;  2Q9Q B;  2BKP A;  2FJB A;  4GKK T;  4DV4 T;  1QLB A;  2JMK A;  2L8K A;  2X0H A;  4QXC B;  3C51 A;  4DR5 T;  2P9B A;  3ZN0 B;  4OK0 A;  3C64 A;  2JIW A;  1NAF A;  2YU1 A;  1WR0 A;  3EDU A;  4J2C A;  1SUM B;  2D5U A;  2HH7 A;  4JLE A;  5DJQ C;  3VR9 A;  1QUU A;  4CN4 A;  2UUC T;  2WU2 A;  4X64 T;  3AEF A;  4PJL A;  2V7I A;  4MLK A;  4PK4 A;  5ABH A;  3N2O A;  4ZI3 D;  4JI2 T;  4CI2 B;  2VK9 A;  5AQK B;  2E9X C;  3UFE A;  5CGM A;  5LHG B;  1XNQ T;  5CA1 E;  2ZM2 A;  1HG2 A;  4A56 A;  4YSY A;  2NW7 A;  3UU5 A;  2KWH A;  2CHO A;  4DR2 T;  5ETW A;  3AA0 B;  3KV5 A;  5LCY A;  5L3C B;  2F4V T;  5IUX A;  5AQT B;  2E8I A;  1ZEE A;  2MYS A;  2E2A A;  3KV4 A;  4FI5 A;  2K3W A;  3ZMZ B;  3C4W A;  4PJM A;  4EB6 E;  2X51 A;  3CKD A;  1IZN B;  3NRY A;  4X5T A;  4EYU A;  3ZEF B;  5L3F B;  4AQG A;  3CX8 B;  4QX8 B;  4B3R T;  5JQG E;  2YK0 A;  1YKE B;  1IBK T;  1R8I A;  4O4I E;  2LSJ A;  3LJC A;  4X1I E;  1U4Q A;  3X1D A;  5JDH A;  3VKH A;  2Z6E A;  2XQA A;  5JRE A;  4YFS A;  4P1N A;  2XAQ B;  2YKS A;  1SA0 E;  3UUB A;  2ODV A;  3Q5D A;  1UUS A;  2CHN A;  4IE5 A;  3AE1 A;  4XAX B;  2WBL A;  2WDV A;  5L3D B;  4IL9 A;  4CQI A;  2OA5 A;  2CM0 A;  4U7Y A;  2CLY B;  2XQ9 A;  4I55 E;  4ILB A;  2D2S A;  2VL0 A;  2HPL A;  2XTL A;  2IUB A;  3SFE A;  5TAO A;  1N36 T;  4AKL A;  3A5X A;  3AE3 A;  3MJX A;  3HKC E;  3F31 A;  4JEU B;  2CE7 A;  2X9X A;  5AFU L;  3KFW X;  3AE5 A;  3ZPO A;  1MNE A;  4KHZ F;  2I59 A;  3BK9 A;  3KV9 A;  4LF8 T;  3KDS E;  1YQ3 A;  4P0B A;  5FP3 A;  5HEU A;  3A7M A;  5LB7 B;  3RIA A;  4ADZ A;  4LF6 T;  2L3L A;  3IEE A;  5ABF A;  1MIV A;  1MMG A;  2H88 A;  2X0Y A;  2XPK A;  3AAI A;  5AQL B;  3GN5 B;  3ZJ2 A;  4LF5 T;  1UK5 A;  3HKD E;  3ZT6 A;  4ILA A;  3P50 A;  3UUM A;  2ZLY A;  3ESL A;  1IAP A;  2NOX A;  3CWZ B;  3QB5 K;  2N9D A;  3TLS A;  2OLT A;  1YQ4 A;  4HFE A;  3LDQ B;  5JRC A;  5M4Y A;  3VRA A;  4U31 A;  1BR4 A;  3HA4 A;  2AXD S;  2V6Y B;  3RLF F;  1WLX A;  4IDQ A;  3O9X A;  3RIU C;  3CVR A;  4B3T T;  3T1H T;  4LMK A;  4U7I A;  4DV0 T;  3ANW B;  3I9W A;  2E9X B;  5JR9 A;  3UFG A;  4ZI7 E;  5AQV B;  2BS4 A;  3ONX A;  4E7Z A;  4I0U A;  2V5D A;  3R84 B;  1KNP A;  5LXT E;  3M65 A;  4NPP A;  5L3G B;  3PUZ F;  2NW8 A;  1KF6 A;  2UUA T;  2CA5 A;  2IIU A;  3RYC E;  4BA9 A;  4B3S T;  2H7O A;  4H9S E;  5F8P A;  3OKQ A;  5JTG A;  2MAW A;  1JNZ A;  3UQ4 A;  2LOP A;  3PUG A;  3PUY F;  4WNK A;  5FKY A;  4CXW A;  3C4X A;  1ZOY A;  4NXM T;  4ZI2 C;  3N9P A;  3L3P A;  4DO0 A;  4AKG A;  2BG9 A;  2BG9 B;  2NTX A;  3EVY A;  5J0Z A; 
#chains in the Genus database with same CATH homology
 4UEM A;  2WSS V;  2XUE A;  4O2A E;  4C90 A;  3LK2 B;  4TV8 E;  3E08 A;  2PJQ A;  3MXZ A;  4KP3 C;  3WI3 A;  2Y8D A;  4CZZ B;  1LVF A;  4I4T E;  5L2L A;  5JDF A;  4CI1 B;  1UX5 A;  1HTJ F;  2KMF A;  4N78 D;  3AA7 B;  5FY7 A;  3MAC A;  5HAX A;  2CCQ A;  3CX7 B;  1HF8 A;  5BMV E;  4X1K E;  2EHO C;  5A1L A;  2ES0 A;  2CMR A;  3F2E A;  3RX6 A;  3QC9 A;  4UVC B;  5HXR A;  3PU8 A;  5J1G A;  2SPC A;  1MMD A;  1BR0 A;  3FXD B;  3BQI A;  4IE7 A;  2WMO A;  3HL6 A;  3ZC1 A;  2LSK A;  5JVD E;  3O1I A;  3T8O A;  1MIY A;  4GK0 E;  4QHO A;  2LSY A;  3CQC B;  3QUJ A;  2VB6 A;  4H63 H;  2EHO D;  4DVD A;  5L3E B;  3ETU A;  2C5K T;  1G8X A;  4JUY A;  5HWX A;  3RH3 A;  3KVB A;  2X9W A;  2L9Q A;  3RC3 A;  4AI6 A;  3MA9 A;  4IE6 A;  3PUS A;  1ZHC A;  4ZS2 A;  3GWH A;  4H9P C;  2DWG A;  4HGA A;  5E0O A;  3KBT A;  3K3O A;  3L09 A;  3NRX A;  5H6Q B;  4CXX A;  3DTO A;  4PW8 A;  5LBQ B;  4AQF A;  3RRW A;  3LBX B;  3AVR A;  1IJ5 A;  5JDG A;  2BDE A;  3PE0 A;  3Q5X A;  5JDL A;  4G63 A;  4HEA A;  4PJJ A;  2W00 A;  3I0O A;  5ADX L;  3IHR A;  5HXS A;  3OYZ A;  4IHJ E;  2XAH B;  4DBQ A;  1D0Y A;  2PFV A;  3B57 A;  4HN9 A;  3HKB E;  3S4U A;  2E9X A;  3Q9D A;  2G0U A;  3HI2 A;  5JDN A;  2V7J A;  4UF0 A;  2CXL A;  5FXW A;  3ZMT B;  2KXP B;  4EXT A;  2K9A A;  2NWB A;  4MAL A;  4WW0 A;  4XBF B;  4QXB B;  4ZI2 D;  2PBI A;  2WMN A;  2WAU A;  2X67 A;  2JMH A;  3TKL B;  4U72 A;  4PJN A;  4H9N C;  1BR2 A;  5LHI B;  1MND A;  1G73 A;  3I0Q A;  4YJ3 E;  1LVK A;  1H7C A;  1S94 A;  2A72 A;  2W62 A;  5GON E;  5IHY A;  2V7M A;  3WAK A;  2BVL A;  2YU2 A;  4IDZ A;  4GYR A;  5LJM A;  2WM9 A;  3N9L A;  2Q9Q D;  4TUY E;  3Q2M A;  4FJO A;  4I43 B;  4O4L E;  4AXP A;  5LYJ E;  3E0Z A;  4UXN B;  2IW5 B;  1ZV4 X;  4UV9 B;  2CWO A;  2X9H A;  3QK6 A;  4KBM B;  4MBQ A;  5JRC B;  3P8C D;  5FY0 A;  3O1H A;  4ZS3 A;  2IC9 A;  2B1E A;  2N1G A;  4EIW A;  4UV8 B;  3MK7 C;  5FMN A;  4AKR B;  3B13 A;  2LSG A;  3RPU A;  4E7S A;  3LK3 B;  4IE4 A;  2Q9Q C;  3UTK A;  4NUV A;  4H63 V;  4OYK A;  1S35 A;  3AA6 B;  2X9Y A;  4UEL A;  2K48 A;  2ODU A;  3GN5 A;  2H7V C;  3ZYK A;  3ZMS B;  3CPZ A;  1WYC A;  3ZMV B;  3E22 E;  5FYM A;  4O8S A;  2XAF B;  2J1D G;  3PU3 A;  2RA1 A;  3PUR A;  3RYF E;  1YD8 G;  2ACX A;  4EOZ B;  5J2T E;  3VU7 H;  3ZLI A;  3FHN A;  5C8Y E;  5F3J A;  2V7K A;  4MHC A;  4TV9 E;  5KDM C;  3BQL A;  4U74 A;  4C91 A;  1WR6 A;  4DMV A;  3N2G E;  2X0L B;  1LRZ A;  1Z0P A;  3NZP A;  3O4X E;  4ERR A;  5FNV E;  3BQK A;  2LJL A;  4HE8 A;  2MBG A;  3LBX A;  4TZ4 C;  4UIG A;  1VOM A;  1NWM X;  4QWN B;  3SOL A;  3KBU A;  1BR1 A;  2NP9 A;  3PUQ A;  4HTE A;  2V1D B;  4CI3 B;  5KMG P;  3CX6 B;  2KWI B;  3W15 B;  5M4Y A;  3FBL A;  2KND A;  3AA1 B;  3HR0 A;  3N9Q A;  1UX4 A;  2JQQ A;  2CEA A;  4YHJ A;  3CML A;  3P7I A;  1KK7 A;  1VRB A;  2Y6X A;  4DBR A;  4UVB B;  4QKN A;  2LHR A;  5HWY A;  2VKD A;  5L3B B;  4YJ2 E;  1SHZ C;  1IJ6 A;  3F57 A;  3ZYM A;  5LJN A;  5LGT B;  2CLY C;  3C50 A;  2JRK A;  2XQY A;  1V9D A;  4XZC A;  5EK4 A;  1FIO A;  3IBP A;  5LP6 E;  3AAE B;  3OJA A;  4ZHQ E;  4H9R C;  4PFP A;  1FMW A;  1MMN A;  3NBX X;  2C0S A;  2W63 A;  5LGN B;  4K0U A;  3NZQ A;  2VKJ A;  4IGU A;  2BVM A;  5EK3 A;  3RYI E;  3SRZ A;  3OBV E;  4OYJ A;  3RYH E;  2ZM8 A;  3JC6 D;  4TX5 A;  4EAH A;  4TN7 B;  5LG4 A;  3RKO A;  4BJM A;  1X79 A;  4H9O C;  1AJ3 A;  3V5U A;  3Q5W A;  5DQV A;  4Z8X A;  1HFA A;  4UVA B;  5JR9 C;  5KX5 E;  3SS1 A;  2HPJ A;  1QSD A;  1YW0 A;  4B6X A;  2V7L A;  5FXZ A;  4O4H E;  3VHL A;  4ZOL E;  3ZJ1 A;  2GK9 A;  3ZMU B;  3N2K E;  3N9O A;  2Q9Q A;  1HCI A;  4QX7 B;  4ANJ A;  2WWU A;  3RC8 A;  1EZ3 A;  3MZK B;  2DHR A;  3K3Q C;  4UF0 B;  5IYZ E;  2LT3 A;  3UUN A;  2YIN A;  4ILU A;  4JEH B;  2W0G A;  3ZYL A;  4G2A A;  2CWY A;  2VWA A;  2UXN B;  5LOV E;  2IAK A;  2M67 A;  1KNZ A;  2DCF A;  4MFR A;  4OFZ A;  3IF8 B;  4QXH B;  4GOU A;  3UT5 E;  3EUH A;  2LSI A;  4I50 E;  2EHO B;  2EHO A;  3V5S A;  1U5P A;  3EDV A;  4F6R C;  3ZC0 A;  2ZM0 A;  5CA0 E;  4EZH A;  2RP4 A;  4PFO A;  3J9X 1;  3CQX C;  4KUM B;  4AKH A;  1CUN A;  3MKD A;  3OYX A;  3I1A A;  2NTY A;  4NUU A;  2QGS A;  2W61 A;  3RRC A;  1ZKE A;  2LEH A;  3LK4 2;  4HFV A;  4O4J E;  2IC6 A;  4P09 A;  3CQG B;  4X20 E;  2K5B B;  1O3X A;  2XHE B;  3LFM A;  2VAS A;  2LOS A;  4GIW A;  1MMA A;  3R6N A;  2DI4 A;  4DMW A;  5LHH B;  5JR9 B;  2A3D A;  3H37 A;  5EK2 A;  1D1B A;  2XAS B;  2ZMA A;  3DJB A;  4V1A v;  2KT9 A;  1Y64 B;  2X68 A;  3ETV A;  3SWH A;  3DP7 A;  2XAJ B;  4PK6 A;  3C4Z A;  3FXE B;  2V26 A;  3U3I A;  2YEV C;  2JJ9 A;  3H3A A;  4ZI3 C;  3PDY A;  2JPF A;  2MTQ A;  2A2F X;  2LE8 A;  3N9N A;  2E9X D;  3U78 A;  3J7Y q;  2DLR A;  2LM9 A;  5J2U E;  4EZ4 A;  4AQF C;  5JDQ A;  3UUL A;  5HXC A;  5DQW A;  5LBM A;  2QA7 A;  3AAA B;  5LGU B;  4EYY R;  3ZCI A;  1OWA A;  4DND A;  4CXY A;  2NW9 A;  3ANW A;  3K3N A;  1T98 A;  4X1Y E;  2UXX B;  3AVS A;  1LKX A;  2VL8 A;  4IST A;  2VKH A;  4YLH A;  2VKO A;  4H9Q C;  3UUX B;  2KZ7 B;  4OHF A;  4WBN E;  3D0T A;  4M1P A;  5DAB A;  5CB4 E;  2XAG B;  2PG8 A;  3LG7 A;  3VKG A;  1WYB A;  2K24 A;  4HKA A;  5LNK A;  1E1H B;  4GK5 E;  1HX8 A;  2DWK A;  4L0R A;  4WBO A;  3WAJ A;  3KV6 A;  1D0Z A;  5FXX A;  2LHN A;  4PAG A;  4ASK A;  4BJN A;  5FY1 A;  1FEW A;  4KMC A;  3FBZ A;  3ZN1 B;  1YKH B;  4IIJ E;  5JH7 E;  1OXZ A;  3GMI A;  4PK5 A;  4L9I A;  5FXV A;  5H6R B;  2H3R A;  2D0T A;  5HXE A;  3ZCJ A;  3O1J A;  3N5L A;  1HG5 A;  4ISS A;  5HXH A;  5JDM A;  1B7T A;  2BZB A;  3AB3 B;  1HS7 A;  3I9Y A;  3JC6 C;  2C5I T;  1UCU A;  4GYS A;  1FMV A;  3HKE E;  2C5J A;  2KLQ A;  3GA8 A;  2N2N A;  1WRD A;  3KIN B;  3C98 B;  3PUA A;  5HYA A;  4IE0 A;  2DNX A;  2D0U A;  4PNI A;  3FB2 A;  2Y48 B;  3KVA A;  2CXD A;  1D1A A;  4L5G A;  1MIW A;  2CXF A;  3PTR B;  5LA6 E;  3N9M A;  1US7 B;  4O2B E;  4P0A A;  4AKI A;  3K8P C;  4BAY B;  2MOZ A;  5EZY E;  2KIN B;  1D0X A;  2Q9Q B;  2JMK A;  2L8K A;  4QXC B;  3C51 A;  2P9B A;  3ZN0 B;  4OK0 A;  3C64 A;  3EDU A;  1NAF A;  2YU1 A;  4J2C A;  4JLE A;  5DJQ C;  2D5U A;  2HH7 A;  1QUU A;  4PJL A;  2V7I A;  4MLK A;  4PK4 A;  3N2O A;  4ZI3 D;  4CI2 B;  2VK9 A;  5LHG B;  2E9X C;  3UFE A;  5CA1 E;  2ZM2 A;  1HG2 A;  4A56 A;  2NW7 A;  2KWH A;  5ETW A;  3AA0 B;  3KV5 A;  5LCY A;  5L3C B;  2E8I A;  1ZEE A;  2MYS A;  3KV4 A;  4FI5 A;  3ZMZ B;  3C4W A;  4PJM A;  4EB6 E;  2X51 A;  3CKD A;  1IZN B;  3NRY A;  4EYU A;  3ZEF B;  5L3F B;  4AQG A;  3CX8 B;  4QX8 B;  5JQG E;  2YK0 A;  1YKE B;  4O4I E;  2LSJ A;  3LJC A;  4X1I E;  1U4Q A;  5JDH A;  3VKH A;  2Z6E A;  5JRE A;  4YFS A;  2XAQ B;  1SA0 E;  2ODV A;  4IE5 A;  4XAX B;  2WBL A;  5L3D B;  4CQI A;  2OA5 A;  2CM0 A;  2CLY B;  4I55 E;  2D2S A;  2HPL A;  2XTL A;  5TAO A;  4AKL A;  3A5X A;  3MJX A;  3HKC E;  3F31 A;  4JEU B;  2CE7 A;  2X9X A;  5AFU L;  3KFW X;  3ZPO A;  1MNE A;  2I59 A;  3BK9 A;  3KV9 A;  3KDS E;  4P0B A;  5FP3 A;  4ADZ A;  2L3L A;  3IEE A;  1MIV A;  1MMG A;  3AAI A;  3ZJ2 A;  3GN5 B;  3HKD E;  3UUM A;  3ESL A;  2ZLY A;  1IAP A;  2NOX A;  3CWZ B;  5JRC A;  2N9D A;  1BR4 A;  3HA4 A;  1WLX A;  3O9X A;  3CVR A;  3ANW B;  3I9W A;  2E9X B;  5JR9 A;  4ZI7 E;  3ONX A;  4E7Z A;  3R84 B;  5LXT E;  3M65 A;  5L3G B;  2NW8 A;  2CA5 A;  3RYC E;  4BA9 A;  2H7O A;  4H9S E;  5F8P A;  3OKQ A;  4CXW A;  2LOP A;  3PUG A;  4WNK A;  3C4X A;  4ZI2 C;  3N9P A;  3L3P A;  4DO0 A;  4AKG A;  2X66 A;  1D1C A;  2NTX A;  3EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...