2C0SA

Nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
MNVTKLNDRIEAKKKELIYLVEKYGFTHHKVISFSQELDRLLNLLIELKTKKKRYSLLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSERVED DOMAIN PROTEIN
publication title Structural characterization of Spo0E-like protein-aspartic acid phosphatases that regulate sporulation in bacilli.
pubmed doi rcsb
source organism Bacillus anthracis str. ames
molecule tags Transferase
total genus 25
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09388 SpoOE-like Spo0E like sporulation regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2c0sA00
2C0SA 2BZBA
chains in the Genus database with same CATH superfamily
2QVAA 2WU2A 1WLXA 3ANWB 2F4VT 4O4IE 3WAJA 3O9XA 4IIJE 3J7Yq 2AXDS 3I9YA 1MMDA 2VL0A 2X66A 3JC6C 5JQGE 2NW9A 3FB2A 2NWBA 2XY8B 2YN6A 2H88A 3HL6A 3UQ4A 3QC9A 2JMHA 4H9NC 2LRLA 5LCYA 2X51A 3M3ZB 5LGNB 2W66A 2KT9A 3C4WA 4YLHA 1HNXT 5LHIB 4DV1T 2LLYA 4UXNB 4ILCA 1VCSA 4IDOA 2J4GA 2WAUA 1T8BA 3QK6A 5JVDE 3AEGA 1WR6A 3KV9A 4F8HA 5LJNA 4NPPA 3N5LA 3PJAA 5FY7A 4HN9A 3DJBA 2FBWA 4DV6T 3TLWA 1QSDA 4ZXLA 4DMWA 3I0OA 3IBPA 4X62T 4YFSA 1V9DA 1YQ3A 5EK4A 1L0VA 2LKHA 2EHOA 1U4QA 1UUSA 3FZLB 2NTYA 4IL9A 2W00A 3RYFE 5EZYE 3LFMA 4I4TE 5AQSB 3A5XA 1ZHCA 4EB6E 2AE9A 3AAIA 3MACA 2LM2A 3GMIA 4BA9A 4B3ST 3UU3A 5JDFA 2WB5A 2KLQA 4DR6T 3C4ZA 2MBGA 3N2GE 4NIQA 2NW7A 3ZSTA 4AKHA 4X20E 3ZCIA 2E9XA 3LBXA 4LF6T 1OEDB 4QKNA 5HYAA 4HFEA 4ZI3C 4CI3B 4E7ZA 3UUXB 4YJ2E 4YTMA 1D0XA 4DV0T 5HCMA 4H63H 5GONE 5LBMA 5HXHA 4HFBA 4BAYB 2E5LT 4EIWA 1N33T 2EHOB 2X9HA 4KP3C 4AI6A 4H63V 2XQAA 2WS3A 2UXBT 1UGOA 3RIUA 2VKOA 1HCIA 3RX6A 4COFA 4IE7A 3P4RA 4CN4A 5AQVB 1S94A 1UX5A 1W0AA 1JNZA 4H9QC 4WYVA 5HAXA 4ZI7E 4HWFA 4DR4T 2E5VA 1E1HB 2B76A 1D1AA 1X79A 3CPZA 5AQTB 4TWDA 1KNZA 4IDQA 5IWAT 2NR4A 3LBXB 4DR1T 4QH5A 4DR7T 5L3EB 5FXWA 5JDNA 5JTGA 4PJMA 4TWHA 2KWHA 2MAWA 5LXTE 3VRBA 4JYAT 5F5WA 1IBMT 1E2AA 1UK5A 4U3CA 5FP3A 3RGLA 1YW0A 3B5MA 2XQ9A 4LF8T 1WR0A 2BS3A 2WDVA 4JI1T 3N9OA 1MIWA 3OPCA 3VKGA 3CQGB 4ZEYA 4MFRA 1QUUA 4Z90A 5HXRA 2LSIA 2XQ6A 3AB3B 5TAOA 2J47A 2XPKA 2YDSA 1FMWA 3CQCB 1YKHB 3Q5WA 1J5WA 2XTLA 3ONLC 2DLRA 5JDHA 1WCRA 2CE7A 4OFZA 4CI1B 2NOXA 3K3NA 2H7OA 5KMGP 4EYUA 1QLBA 4FI5A 1NWMX 3RYIE 5H6QB 4QXHB 4AQGA 3FZMB 3ONJA 2LSJA 2Z6EA 2WDRA 4MHCA 4GK0E 2N9DA 2W61A 2XHEB 3BQLA 5LMNT 3KV5A 3PUGA 1ZOYA 1UCUA 4DV3T 1BR1A 2XAHB 4U33A 3KDSE 4IE4A 5JR9A 3NKZA 4GK5E 5AQPB 4C90A 5JH7E 3OJAA 1J5ET 5L3FB 5L4EA 1J1JA 4DR3T 1BR2A 3BQKA 3IHRA 2LSYA 2ZLYA 4DBRA 4IE6A 5LMUT 3O1HA 4X64T 5JDMA 2VQFT 5HEGA 2XQ5A 3PUZF 3UFEA 2C5IT 3ZN1B 5HXCA 2IAKA 3K3QC 2HH7A 4DR2T 5JDLA 2BS4A 2QGSA 4AKGA 4K0UA 2LKGA 3ONXA 2WU5A 1LVKA 1IJ5A 3HKDE 3SFEA 3AXJA 2D0UA 3AEDA 3PUXF 2K24A 2WMOA 1DU2A 3JAEA 2BKNA 2XAQB 5J2UE 2BG9E 2K9AA 4AQYT 5DABA 4XBFB 2LHNA 3F31A 3RYCE 2CCQA 3ZT7A 3K8PC 2D5UA 4A97A 5JR9B 2VASA 5FL1A 3AE4A 3ZJ1A 4JI8T 4JEHB 3AE9A 1HTJF 2PJQA 3QUJA 4EOZB 2FJDA 4YHHT 5AQQB 4CXYA 2M6BA 1H7CA 2QYWA 2WQYA 1Z0PA 2DI4A 3R84B 1XWMA 1XMOT 3EDUA 5AQGB 4YXDA 3RQUA 3HKCE 4Z91A 2YOEA 1W09A 3ZYLA 2KSRA 4UR9A 5F8PA 2LOSA 4DV4T 3BK9A 5FY0A 2IW5B 3RIFA 4EZ4A 3L8RA 3EI0A 1FIOA 1BR4A 4ILUA 5CGMA 1MIYA 4H9SE 3QB5K 4AXPA 2L3LA 5A1LA 3ZMTB 4HFIA 2MOZA 3PJAJ 1YD8G 4HEAA 5LHHB 2KXPB 5L2LA 5KX5E 3B57A 4HWCA 4CN6A 5DJQC 2L8KA 4CI2B 3P4WA 1YXRA 2RP4A 2RPAA 2XQ4A 5LNKA 4ZI2C 4KX6A 1MNEA 4I50E 3UULA 4NUVA 2D2SA 3RHWA 3P4SA 3QNUA 1OXZA 5AQNB 1WFDA 2CXLA 4H9RC 4LMKA 3AA6B 4PK6A 2HN2A 3IA3A 1U5PA 2PG8A 1KFYA 4UIGA 1HNWT 4UF0A 3PTRB 2XJ7A 3SOLA 2C5JA 1SHZC 2W4XA 3FBLA 2XAJB 5ETWA 2N2NA 4UELA 2BKOA 2DWKA 3UT5E 4YTNA 2XSBA 5AQUB 5FXZA 3SS1A 5L3CB 2X0LB 2BG9A 2A2FX 5HEUA 3AVSA 2BS2A 2EHOD 2CBJA 5JRCA 2V7KA 1KF6A 4ADZA 4A56A 4CXXA 4UV9B 3ZC1A 2YEVC 1Y01A 2V6YA 3T1YT 4X1IE 2V7MA 3P4QA 4GYSA 3U3IA 5JDGA 5ABHA 3ZT6A 5AQFB 3N2OA 5HEOA 4L9IA 3AAAB 5ABFA 4PFOA 4AKLA 2IC9A 1WYBA 2JJ9A 2VK9A 4UVCB 4EV6A 2KMFA 3FXDB 2E9XD 4YT0A 2X68A 4Q25A 5AQJB 3LK2B 3TLUA 4UF0B 4KBMB 3ZYKA 3AE3A 3VRAA 2FJBA 3S4UA 2WMNA 2Y6XA 5E0OA 2BVLA 2VL8A 2BG9B 1US7B 4IDZA 2VKHA 3EDVA 3EUHA 4I43B 1XNRT 5JRCB 3MJXA 5LJMA 4PAGA 2BDEA 3NRYA 2FJAA 4JI2T 3RRCA 3N9NA 3DP7A 2HPJA 3EABA 1IJ6A 2CWOA 1N34T 3N2KE 1HX1B 1W0BA 3RH3A 4ERRA 4V1Av 1G8XA 1MMGA 4LF7T 5M4YA 2C0SA 4QH4A 5ABFB 4TV8E 3N9QA 2XM2A 4HWHA 4PFPA 2V7IA 3ZJ2A 2BZBA 4J2CA 4JI0T 3AA7B 4LMJA 4GKKT 4X5TA 2BKPA 2MPKA 3ZMSB 3M65A 5L3GB 5HWXA 2Q9QA 3V5UA 2E9XB 4GIWA 3PURA 5AQOB 2WY2A 4PK5A 4PK4A 5BMVE 2V6XA 1ZV4X 4JLEA 2X9WA 2XAFB 3N9PA 3V5SA 3K1SA 3JC6D 4JI5T 3VU7H 2ES0A 1IZNB 4WBOA 3C98B 3Q9DA 5LP6E 2KINB 3O4XE 2CLYB 3F57A 2WWUA 1XZYA 1VOMA 2CEAA 3E0ZA 3ZLIA 2ZMAA 3VKHA 3UUMA 4U2YA 2IUBA 2OA5A 3T1HT 3PUWF 2CXFA 5HXSA 3F2EA 3FZFB 5HCJA 1LVFA 2LEHA 4AKIA 2IC6A 5ADXL 3ZC0A 4TV9E 2JQHA 3ZMZB 1IBLT 3RRWA 3C4XA 3HR0A 2UXCT 4X65T 4K0KT 5L47A 3VR9A 4PW8A 1IBKT 1M7KA 2CPTA 1B7TA 2Q9QB 3SFDA 3AECA 4ZOLE 4AISA 3OVUA 2HN1A 2VURA 2L9QA 1UX4A 3AA0B 4YTPA 4ILAA 1SE7A 4O4HE 3KV6A 5LGUB 4XZCA 5LHGB 5AQHB 1I94T 1UURA 4HKAA 4EZHA 3VR8A 4XAXB 3MKDA 4LFCT 2W2UA 4DO0A 4DVDA 4U7IA 3E22E 4G2AA 1S35A 2D0TA 3RYHE 4YSYA 1OEDC 2VVSA 3UUNA 4GOUA 1D1BA 5LYJE 3AAEB 5EK3A 1SUMB 1D0YA 4DUZT 2XM1A 3UU4A 1T98A 3RF1A 2JQQA 1D1CA 3FBZA 2X67A 2MTQA 2KZ7B 2JQ9A 3UFGA 4TUYE 2EHOC 4U74A 4DV5T 2I0MA 2DL1A 1XDPA 3L09A 3ZMUB 3JCFA 2Y48B 3MZKB 3AE2A 1HS7A 1N36T 3JAFA 5DQVA 5L3DB 3FXEB 4IE5A 4IL4A 4TWFA 3I0QA 3ABVA 2LOPA 3FZHB 4U31A 4X1KE 3TKLB 2JQKA 5F3JA 2DHRA 4IDPA 1AJ3A 4H9PC 3UU6A 2PBIA 3QB5A 2OLTA 4CQIA 3ETUA 1N32T 1VRBA 2LRKA 4HWDA 4CZZB 4P0AA 5FYMA 3AEFA 5HEJA 2V5DA 5JREA 4EEBA 2BBJA 3PUVF 2FUPA 2I59A 2V1DB 4KHZF 2WM9A 1MNDA 2CM0A 4HFDA 2J1DG 3PU8A 3AE5A 3ANWA 4YHJA 1WYCA 4UVAB 3BQIA 3O1JA 4UVBB 4PJNA 2IHR1 3C64A 3KV4A 4Z8XA 4O2AE 3DTOA 1OWAA 2VB6A 1LKXA 3PE0A 4LFBT 4JI6T 1HFAA 3AVRA 3EVYA 4QH1A 2W62A 4L0RA 4ZS2A 2GK9A 2H3RA 2X0HA 5LB7B 3Q2MA 3PUQA 4OYJA 3CKDA 3AXJB 5AQKB 2A9UA 2B1EA 5CA1E 2ZM0A 4OK0A 4L5GA 5JDQA 2V8SV 4MBQA 4HTEA 4MALA 4O4JE 4OHFA 5CFBA 5C3JA 2XASB 3N9LA 1KNRA 4G63A 2UXNB 3E08A 5AQLB 2Y8DA 4HGAA 5J0ZA 1FEWA 3PU3A 2CWYA 5KXJA 2H89A 3GN5A 3IF8B 4ILBA 5FKYA 3ETVA 2FJEA 2XAGB 3UU8A 3H37A 3AE8A 1FJGT 5LG3A 4UEMA 3CX6B 5J1GA 4I0UA 3CWZB 4JI4T 2NW8A 3HKEE 2XQYA 4QWNB 3ZT5A 1FMVA 3NVOA 1KK7A 1D0ZA 2CXDA 4QX8B 4P1NA 3UTKA 5ABGA 3FZKB 3C50A 4PNIA 1HX8A 4ASKA 3PUAA 4TNWA 4GKJT 3L3PA 1HG5A 4CN1A 4X1YE 2R6GF 3OYZA 2LJLA 4IHJE 1SA0E 2C5KT 2JIWA 2RA1A 2XQ7A 4DNDA 2BVMA 5L4HA 4DBQA 1NAFA 4KUMB 2QRXA 2JPFA 4EAHA 1OEDA 2CA5A 4U2ZA 3PUSA 5LBQB 2D9DA 4CXWA 4O4LE 4AQFC 4IE0A 5CA0E 3QOFA 1NEKA 5DQWA 4YSXA 4GYRA 2JMKA 3NZQA 2WDQA 5AFUL 2UUBT 1T72A 3CX8B 3UUBA 3MA9A 4UV8B 3GN5B 4HFVA 3FHNA 2LT3A 3I1AA 4BJMA 2WZHA 2CMRA 4LF9T 1MMAA 1MMNA 1ZEEA 3U78A 2LM9A 5JR9C 3KFWX 3P4PA 2YDRA 4AIUA 2VQET 3TLVA 4NXNT 2ZM8A 3A8YC 2J62A 3RC3A 1YQ4A 3O1IA 4A5XA 2ZM2A 2V5CA 5J2TE 2VKDA 4WZXA 3CQXC 3RI5A 3LK3B 4DIDB 4ZZBA 3AEBA 2YDQA 4O2BE 2PTFA 3NRXA 3J9X1 5LGTB 4IGUA 1CUNA 1ZKEA 5FXXA 5FVLA 4AKRB 3OYXA 4WBNE 2LHRA 2WZIA 2V6YB 2M67A 2G0UA 4HFCA 2OV9A 4PJJA 1XDOA 3D0TA 4JEUB 4A98A 4YY3T 5AQIB 3ZSSA 3EAMA 4O8SA 2W0GA 3P50A 3KBUA 4TX5A 4DR5T 3G06A 4PJLA 5LA6E 5IUXA 3VHLA 4F6RC 2CRBA 4JI3T 2XSAA 3NBXX 4OYKA 4JBWF 4LF5T 2Q9QD 2DWGA 3C51A 3P8CD 3CX7B 3RKOA 4X66T 2IDOB 2YKSA 2UXDT 1VCTA 3KINB 1G73A 2KNDA 2YU2A 3P7IA 3UU5A 5L3BB 2VVNA 5FVKA 2E2AA 5EK2A 2W63A 4NXMT 4HFHA 3OTOT 4ZZCA 4ZI2D 2JRKA 5BR8T 4TZ4C 3WI3A 1X9BA 5LG4A 1CHUA 4OX9T 3H3MA 3MK7C 3SRZA 3ZCJA 4DUYT 1BR0A 2PFVA 1HG2A 2YK0A 4QXBB 4JI7T 3MXZA 3JADA 3KVAA 4ZS3A 4KMCA 2UXXB 4P09A 4H9OC 4IT4A 4U72A 2LSKA 1WRDA 2IIUA 2KWIB 2QA7A 3IEEA 5HEHA 3L39A 3ZYMA 4C91A 1KNPA 2DCFA 3AE7A 4U7YA 3NWIA 4M1PA 2VWAA 4JV5T 2ODUA 1XMQT 2V26A 3GA8A 1MIVA 2V7LA 1HF8A 5H6RB 5C8YE 2YU1A 2BBHA 3CMLA 4DMVA 5ABEA 4B6XA 4LF4T 2HHHT 4ISSA 3LK42 2XUEA 2CBIA 3AEEA 5FNVE 2SPCA 1Y64B 2K3WA 4AQFA 4EYYR 4NUUA 4QXCB 2I6HA 3LG7A 4HWIB 2N1GA 4EGWA 3HA4A 2ODVA 4KI0F 3CIRA 4DV7T 1M62A 3NZPA 3TLSA 3CK6A 3AE1A 4WW0A 3ZKRA 3I9WA 5FY1A 2BG9C 5FMNA 2E8IA 2K5BB 3R6NA 1W9RA 3Q5XA 3AE6A 4ZI3D 1T7SA 4B3RT 3LJCA 3RQWA 3AEAA 4YJ3E 1I6ZA 4HE8A 2XQ8A 3PV0F 4TNVA 4MLKA 4B3TT 2YINA 3TLTA 4TN7B 2CHOA 2LE8A 3ESLA 3LSVA 3RLFF 2H7VC 3UQ7A 1Z8UA 2XZEA 5CB4E 2K48A 4JUYA 2LSGA 4QHOA 2M6IA 1IAPA 2A3DA 3ZPOA 2WCAA 1R8IA 2NP9A 3H3AA 5CJ5A 4WNKA 1JNRA 5IYZE 1OEDE 3B13A 1NENA 4ISTA 3Q5DA 3PDYA 2WSSV 1EZ3A 3RKGA 2E9XC 2IMLA 3A7MA 5HXEA 3GWHA 1E7PA 3KBTA 4LFAT 3WAKA 1HNZT 4ANJA 5HWYA 2VKJA 3HI2A 3ZEFB 3EHZA 3OBVE 4P0BA 2X9XA 2ZM6T 3X1DA 2W67A 3K3OA 3HKBE 2UUCT 2ACXA 3CVRA 2P9BA 2CLYC 1KEYA 5C2TA 5AQRB 3OKQA 4ZHQE 3W15B 3LDQB 3RPUA 4EXTA 3AA1B 3ZN0B 4FJOA 1YKEB 3RIUC 2X9YA 2WWVA 1XNQT 2V7JA 4KHPT 5IHYA 3T8OA 1HR0T 1GQEA 2HPLA 3KVBA 2ACZA 5KDMC 2A72A 3ZMVB 3SWHA 1O3XA 2NTXA 5AQMB 4B3MT 2WBLA 2XQ3A 4IDNA 4QX7B 2UUAT 3Q5EA 1ZP0A 2MYSA 4YSZA 5FL0A 4BJNA 2Q9QC 3PUYF 4IREA 4I55E 2WP9A 1LRZA 4EEDA 5FXVA 5LOVE 4E7SA 4LMLA 3RC8A 2UU9T 4N78D 2CHNA 3N9MA 4DV2T 3RIAA 2X0YA 2DNXA
chains in the Genus database with same CATH topology
3NRXA 2OA5A 1LVKA 2CXFA 1IJ5A 1WLXA 3J9X1 5HXSA 3HKDE 3F2EA 3ANWB 4O4IE 3WAJA 2D0UA 5LGTB 3O9XA 4IGUA 4IIJE 1LVFA 2LEHA 2K24A 2WMOA 3J7Yq 1CUNA 2IC6A 4AKIA 5ADXL 3ZC0A 3I9YA 4TV9E 1ZKEA 5FXXA 2XAQB 1MMDA 5J2UE 2K9AA 2X66A 5DABA 3ZMZB 4XBFB 2LHNA 3JC6C 3F31A 3RRWA 3RYCE 3C4XA 4AKRB 3HR0A 5JQGE 2CCQA 2NW9A 3OYXA 3FB2A 4WBNE 2NWBA 2LHRA 3HL6A 2M67A 2G0UA 3QC9A 4PJJA 2JMHA 3D0TA 3K8PC 4JEUB 2D5UA 4H9NC 5LCYA 2X51A 4PW8A 5JR9B 2VASA 5LGNB 4O8SA 3ZJ1A 2W0GA 2KT9A 1B7TA 2Q9QB 3KBUA 3C4WA 4JEHB 4YLHA 1HTJF 2PJQA 4TX5A 3QUJA 4ZOLE 4PJLA 5LA6E 4EOZB 5LHIB 3VHLA 4F6RC 4CXYA 3NBXX 2L9QA 4OYKA 1UX4A 4UXNB 1H7CA 3AA0B 2Q9QD 2WAUA 1Z0PA 2DWGA 3C51A 2DI4A 3P8CD 3CX7B 3R84B 3QK6A 5JVDE 4O4HE 3EDUA 3KV6A 3RKOA 5LGUB 1WR6A 4XZCA 3KV9A 5LHGB 5LJNA 4HKAA 3N5LA 4EZHA 3KINB 3HKCE 5FY7A 4HN9A 1G73A 4XAXB 3MKDA 2KNDA 3DJBA 2YU2A 3ZYLA 4DO0A 4DVDA 3P7IA 5L3BB 5F8PA 3E22E 4G2AA 2LOSA 1S35A 2D0TA 5EK2A 3BK9A 2W63A 3RYHE 5FY0A 2IW5B 1QSDA 4ZI2D 4DMWA 3I0OA 2JRKA 3IBPA 3UUNA 4EZ4A 4GOUA 4TZ4C 3WI3A 1D1BA 1FIOA 5LG4A 4YFSA 1V9DA 5EK4A 5LYJE 2EHOA 1BR4A 1U4QA 4ILUA 1MIYA 4H9SE 3AAEB 3MK7C 5EK3A 4AXPA 3SRZA 3ZCJA 1D0YA 2L3LA 2NTYA 5A1LA 1BR0A 3ZMTB 1T98A 2W00A 2MOZA 3RYFE 5EZYE 2PFVA 1YD8G 2JQQA 3LFMA 4HEAA 4I4TE 5LHHB 1HG2A 3A5XA 1ZHCA 1D1CA 2YK0A 3FBZA 4QXBB 2KXPB 5L2LA 4EB6E 5KX5E 3AAIA 3MACA 3MXZA 3B57A 2X67A 3GMIA 2MTQA 3KVAA 4ZS3A 4BA9A 2KZ7B 4KMCA 4TUYE 2EHOC 4U74A 5DJQC 2UXXB 2L8KA 4P09A 5JDFA 4H9OC 4CI2B 4U72A 3L09A 3ZMUB 2LSKA 1WRDA 2Y48B 2KLQA 2KWIB 2RP4A 3MZKB 2QA7A 3IEEA 1HS7A 3C4ZA 2MBGA 5LNKA 3N2GE 3ZYMA 5DQVA 2NW7A 4C91A 4ZI2C 5L3DB 4AKHA 3FXEB 4IE5A 4X20E 3ZCIA 2E9XA 2DCFA 3LBXA 1MNEA 3I0QA 4I50E 3UULA 4NUVA 4QKNA 2LOPA 2D2SA 4M1PA 2VWAA 5HYAA 2ODUA 4X1KE 3TKLB 2V26A 3GA8A 5F3JA 2DHRA 4ZI3C 1MIVA 2V7LA 1OXZA 4CI3B 1HF8A 5H6RB 1AJ3A 4E7ZA 4H9PC 5C8YE 2CXLA 4H9RC 3UUXB 2PBIA 3AA6B 2YU1A 4YJ2E 4PK6A 1U5PA 1D0XA 2PG8A 3CMLA 4UIGA 4UF0A 4CQIA 4H63H 4DMVA 3ETUA 5GONE 1VRBA 3PTRB 4B6XA 3SOLA 5LBMA 5HXHA 2C5JA 4ISSA 3LK42 2XUEA 4CZZB 1SHZC 5FNVE 4P0AA 5FYMA 2SPCA 3FBLA 2XAJB 5ETWA 4BAYB 1Y64B 4EIWA 2N2NA 5JREA 4UELA 2EHOB 2DWKA 3UT5E 4AQFA 2I59A 2V1DB 2X9HA 4KP3C 4EYYR 2WM9A 4NUUA 1MNDA 2CM0A 4QXCB 5FXZA 3SS1A 4AI6A 5L3CB 4H63V 2X0LB 2J1DG 2A2FX 3PU8A 2VKOA 1HCIA 3ANWA 4YHJA 3RX6A 3LG7A 1WYCA 2N1GA 3AVSA 2EHOD 4UVAB 3HA4A 5JRCA 4IE7A 2V7KA 3BQIA 2ODVA 1S94A 3O1JA 4UVBB 4PJNA 3C64A 1UX5A 3KV4A 4Z8XA 4ADZA 4O2AE 3DTOA 1OWAA 2VB6A 4A56A 1LKXA 3PE0A 3NZPA 4H9QC 4CXXA 1HFAA 3AVRA 3EVYA 4UV9B 5HAXA 4ZI7E 3ZC1A 2YEVC 2W62A 4L0RA 4WW0A 4X1IE 2V7MA 3I9WA 4ZS2A 5FY1A 5FMNA 1E1HB 2GK9A 4GYSA 3U3IA 2E8IA 2H3RA 5JDGA 1D1AA 1X79A 3CPZA 3Q2MA 2K5BB 3PUQA 3Q5XA 3CKDA 4OYJA 3N2OA 3R6NA 4ZI3D 1KNZA 2B1EA 4L9IA 5CA1E 3AAAB 3LBXB 2ZM0A 4OK0A 4PFOA 4AKLA 5L3EB 5FXWA 2IC9A 5JDNA 4L5GA 5JDQA 3LJCA 4PJMA 1WYBA 2JJ9A 2VK9A 4YJ3E 2KWHA 4HE8A 4UVCB 2KMFA 4MBQA 4MLKA 3FXDB 2E9XD 5LXTE 2YINA 4HTEA 4MALA 4O4JE 2X68A 4TN7B 4OHFA 2LE8A 3ESLA 3LK2B 2H7VC 4UF0B 2XASB 3N9LA 5FP3A 4KBMB 5CB4E 4G63A 3ZYKA 2K48A 2UXNB 3E08A 2Y8DA 4JUYA 1YW0A 4HGAA 1FEWA 3PU3A 2LSGA 2CWYA 4QHOA 3GN5A 1IAPA 3IF8B 3S4UA 2WMNA 3N9OA 2A3DA 1MIWA 3ETVA 2Y6XA 3ZPOA 5E0OA 3VKGA 3CQGB 2BVLA 2XAGB 2NP9A 3H3AA 4MFRA 1QUUA 2VL8A 1US7B 4WNKA 4IDZA 5IYZE 2VKHA 3EDVA 3B13A 3H37A 5HXRA 2LSIA 3AB3B 3EUHA 4I43B 5JRCB 3MJXA 4ISTA 5TAOA 5LJMA 4PAGA 4UEMA 3PDYA 2WSSV 3CX6B 5J1GA 2BDEA 3NRYA 1EZ3A 3CWZB 2NW8A 2E9XC 3HKEE 5HXEA 1FMWA 2XQYA 3CQCB 3RRCA 3GWHA 1YKHB 3Q5WA 3N9NA 3DP7A 3KBTA 4QWNB 3WAKA 2XTLA 1FMVA 2HPJA 1KK7A 4ANJA 1IJ6A 1D0ZA 2CXDA 2DLRA 4QX8B 2CWOA 3UTKA 5HWYA 3N2KE 5JDHA 2CE7A 2VKJA 4OFZA 3RH3A 4ERRA 3C50A 3HI2A 4PNIA 1HX8A 3ZEFB 4V1Av 4CI1B 4ASKA 1G8XA 1MMGA 2NOXA 3OBVE 3PUAA 4P0BA 3K3NA 5M4YA 2H7OA 3L3PA 1HG5A 2X9XA 4X1YE 2C0SA 3K3OA 3OYZA 2LJLA 4IHJE 1SA0E 2C5KT 2RA1A 3HKBE 5KMGP 2ACXA 4TV8E 4DNDA 2BVMA 3N9QA 3CVRA 4FI5A 4EYUA 1NWMX 4DBQA 2P9BA 3RYIE 2CLYC 1NAFA 4KUMB 5H6QB 4QXHB 2JPFA 4AQGA 4PFPA 2LSJA 2Z6EA 4EAHA 2V7IA 3OKQA 4ZHQE 3W15B 3ZJ2A 2CA5A 2BZBA 4MHCA 3PUSA 5LBQB 4CXWA 4O4LE 4GK0E 2N9DA 2W61A 4J2CA 2XHEB 3BQLA 3RPUA 3AA7B 4EXTA 4AQFC 4IE0A 3AA1B 5CA0E 3KV5A 3PUGA 3ZN0B 4FJOA 5DQWA 4GYRA 2JMKA 3NZQA 5AFUL 1UCUA 3ZMSB 1YKEB 3M65A 1BR1A 2XAHB 3KDSE 4IE4A 5JR9A 2X9YA 5L3GB 5HWXA 2V7JA 3CX8B 4GK5E 4C90A 3MA9A 2Q9QA 5IHYA 3T8OA 5JH7E 3OJAA 4UV8B 2HPLA 3GN5B 3KVBA 3FHNA 4HFVA 3V5UA 2E9XB 4GIWA 5L3FB 3PURA 5KDMC 4PK5A 4PK4A 2LT3A 2A72A 3ZMVB 3SWHA 1O3XA 2NTXA 5BMVE 1BR2A 3BQKA 2WBLA 1ZV4X 4JLEA 3I1AA 2X9WA 2XAFB 2LSYA 3IHRA 3N9PA 4BJMA 3V5SA 4QX7B 2CMRA 1MMAA 2ZLYA 3JC6D 4DBRA 1MMNA 1ZEEA 4IE6A 3VU7H 2ES0A 1IZNB 4WBOA 3U78A 3C98B 2MYSA 2LM9A 3O1HA 5JR9C 3Q9DA 3KFWX 5JDMA 4BJNA 2Q9QC 5LP6E 2KINB 2ZM8A 3O4XE 4I55E 2CLYB 3RC3A 3UFEA 3F57A 2C5IT 3O1IA 5HXCA 3ZN1B 2WWUA 1LRZA 5FXVA 5LOVE 4E7SA 2IAKA 3RC8A 2ZM2A 5J2TE 2VKDA 4N78D 1VOMA 3CQXC 3K3QC 2CEAA 2HH7A 3E0ZA 3LK3B 3ZLIA 5JDLA 3N9MA 2QGSA 2ZMAA 4AKGA 4O2BE 4K0UA 3VKHA 2DNXA 3ONXA 3UUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0S A;  2BZB A; 
#chains in the Genus database with same CATH topology
 2QVA A;  2WU2 A;  1WLX A;  3ANW B;  2F4V T;  4O4I E;  3WAJ A;  3O9X A;  4IIJ E;  3J7Y q;  2AXD S;  3I9Y A;  1MMD A;  2VL0 A;  2X66 A;  3JC6 C;  5JQG E;  2NW9 A;  3FB2 A;  2NWB A;  2XY8 B;  2YN6 A;  2H88 A;  3HL6 A;  3UQ4 A;  3QC9 A;  2JMH A;  4H9N C;  2LRL A;  5LCY A;  2X51 A;  3M3Z B;  5LGN B;  2W66 A;  2KT9 A;  3C4W A;  4YLH A;  1HNX T;  5LHI B;  4DV1 T;  2LLY A;  4UXN B;  4ILC A;  1VCS A;  4IDO A;  2J4G A;  2WAU A;  1T8B A;  3QK6 A;  5JVD E;  3AEG A;  1WR6 A;  3KV9 A;  4F8H A;  5LJN A;  4NPP A;  3N5L A;  3PJA A;  5FY7 A;  4HN9 A;  3DJB A;  2FBW A;  4DV6 T;  3TLW A;  1QSD A;  4ZXL A;  4DMW A;  3I0O A;  3IBP A;  4X62 T;  4YFS A;  1V9D A;  1YQ3 A;  5EK4 A;  1L0V A;  2LKH A;  2EHO A;  1U4Q A;  1UUS A;  3FZL B;  2NTY A;  4IL9 A;  2W00 A;  3RYF E;  5EZY E;  3LFM A;  4I4T E;  5AQS B;  3A5X A;  1ZHC A;  4EB6 E;  2AE9 A;  3AAI A;  3MAC A;  2LM2 A;  3GMI A;  4BA9 A;  4B3S T;  3UU3 A;  5JDF A;  2WB5 A;  2KLQ A;  4DR6 T;  3C4Z A;  2MBG A;  3N2G E;  4NIQ A;  2NW7 A;  3ZST A;  4AKH A;  4X20 E;  3ZCI A;  2E9X A;  3LBX A;  4LF6 T;  1OED B;  4QKN A;  5HYA A;  4HFE A;  4ZI3 C;  4CI3 B;  4E7Z A;  3UUX B;  4YJ2 E;  4YTM A;  1D0X A;  4DV0 T;  5HCM A;  4H63 H;  5GON E;  5LBM A;  5HXH A;  4HFB A;  4BAY B;  2E5L T;  4EIW A;  1N33 T;  2EHO B;  2X9H A;  4KP3 C;  4AI6 A;  4H63 V;  2XQA A;  2WS3 A;  2UXB T;  1UGO A;  3RIU A;  2VKO A;  1HCI A;  3RX6 A;  4COF A;  4IE7 A;  3P4R A;  4CN4 A;  5AQV B;  1S94 A;  1UX5 A;  1W0A A;  1JNZ A;  4H9Q C;  4WYV A;  5HAX A;  4ZI7 E;  4HWF A;  4DR4 T;  2E5V A;  1E1H B;  2B76 A;  1D1A A;  1X79 A;  3CPZ A;  5AQT B;  4TWD A;  1KNZ A;  4IDQ A;  5IWA T;  2NR4 A;  3LBX B;  4DR1 T;  4QH5 A;  4DR7 T;  5L3E B;  5FXW A;  5JDN A;  5JTG A;  4PJM A;  4TWH A;  2KWH A;  2MAW A;  5LXT E;  3VRB A;  4JYA T;  5F5W A;  1IBM T;  1E2A A;  1UK5 A;  4U3C A;  5FP3 A;  3RGL A;  1YW0 A;  3B5M A;  2XQ9 A;  4LF8 T;  1WR0 A;  2BS3 A;  2WDV A;  4JI1 T;  3N9O A;  1MIW A;  3OPC A;  3VKG A;  3CQG B;  4ZEY A;  4MFR A;  1QUU A;  4Z90 A;  5HXR A;  2LSI A;  2XQ6 A;  3AB3 B;  5TAO A;  2J47 A;  2XPK A;  2YDS A;  1FMW A;  3CQC B;  1YKH B;  3Q5W A;  1J5W A;  2XTL A;  3ONL C;  2DLR A;  5JDH A;  1WCR A;  2CE7 A;  4OFZ A;  4CI1 B;  2NOX A;  3K3N A;  2H7O A;  5KMG P;  4EYU A;  1QLB A;  4FI5 A;  1NWM X;  3RYI E;  5H6Q B;  4QXH B;  4AQG A;  3FZM B;  3ONJ A;  2LSJ A;  2Z6E A;  2WDR A;  4MHC A;  4GK0 E;  2N9D A;  2W61 A;  2XHE B;  3BQL A;  5LMN T;  3KV5 A;  3PUG A;  1ZOY A;  1UCU A;  4DV3 T;  1BR1 A;  2XAH B;  4U33 A;  3KDS E;  4IE4 A;  5JR9 A;  3NKZ A;  4GK5 E;  5AQP B;  4C90 A;  5JH7 E;  3OJA A;  1J5E T;  5L3F B;  5L4E A;  1J1J A;  4DR3 T;  1BR2 A;  3BQK A;  3IHR A;  2LSY A;  2ZLY A;  4DBR A;  4IE6 A;  5LMU T;  3O1H A;  4X64 T;  5JDM A;  2VQF T;  5HEG A;  2XQ5 A;  3PUZ F;  3UFE A;  2C5I T;  3ZN1 B;  5HXC A;  2IAK A;  3K3Q C;  2HH7 A;  4DR2 T;  5JDL A;  2BS4 A;  2QGS A;  4AKG A;  4K0U A;  2LKG A;  3ONX A;  2WU5 A;  1LVK A;  1IJ5 A;  3HKD E;  3SFE A;  3AXJ A;  2D0U A;  3AED A;  3PUX F;  2K24 A;  2WMO A;  1DU2 A;  3JAE A;  2BKN A;  2XAQ B;  5J2U E;  2BG9 E;  2K9A A;  4AQY T;  5DAB A;  4XBF B;  2LHN A;  3F31 A;  3RYC E;  2CCQ A;  3ZT7 A;  3K8P C;  2D5U A;  4A97 A;  5JR9 B;  2VAS A;  5FL1 A;  3AE4 A;  3ZJ1 A;  4JI8 T;  4JEH B;  3AE9 A;  1HTJ F;  2PJQ A;  3QUJ A;  4EOZ B;  2FJD A;  4YHH T;  5AQQ B;  4CXY A;  2M6B A;  1H7C A;  2QYW A;  2WQY A;  1Z0P A;  2DI4 A;  3R84 B;  1XWM A;  1XMO T;  3EDU A;  5AQG B;  4YXD A;  3RQU A;  3HKC E;  4Z91 A;  2YOE A;  1W09 A;  3ZYL A;  2KSR A;  4UR9 A;  5F8P A;  2LOS A;  4DV4 T;  3BK9 A;  5FY0 A;  2IW5 B;  3RIF A;  4EZ4 A;  3L8R A;  3EI0 A;  1FIO A;  1BR4 A;  4ILU A;  5CGM A;  1MIY A;  4H9S E;  3QB5 K;  4AXP A;  2L3L A;  5A1L A;  3ZMT B;  4HFI A;  2MOZ A;  3PJA J;  1YD8 G;  4HEA A;  5LHH B;  2KXP B;  5L2L A;  5KX5 E;  3B57 A;  4HWC A;  4CN6 A;  5DJQ C;  2L8K A;  4CI2 B;  3P4W A;  1YXR A;  2RP4 A;  2RPA A;  2XQ4 A;  5LNK A;  4ZI2 C;  4KX6 A;  1MNE A;  4I50 E;  3UUL A;  4NUV A;  2D2S A;  3RHW A;  3P4S A;  3QNU A;  1OXZ A;  5AQN B;  1WFD A;  2CXL A;  4H9R C;  4LMK A;  3AA6 B;  4PK6 A;  2HN2 A;  3IA3 A;  1U5P A;  2PG8 A;  1KFY A;  4UIG A;  1HNW T;  4UF0 A;  3PTR B;  2XJ7 A;  3SOL A;  2C5J A;  1SHZ C;  2W4X A;  3FBL A;  2XAJ B;  5ETW A;  2N2N A;  4UEL A;  2BKO A;  2DWK A;  3UT5 E;  4YTN A;  2XSB A;  5AQU B;  5FXZ A;  3SS1 A;  5L3C B;  2X0L B;  2BG9 A;  2A2F X;  5HEU A;  3AVS A;  2BS2 A;  2EHO D;  2CBJ A;  5JRC A;  2V7K A;  1KF6 A;  4ADZ A;  4A56 A;  4CXX A;  4UV9 B;  3ZC1 A;  2YEV C;  1Y01 A;  2V6Y A;  3T1Y T;  4X1I E;  2V7M A;  3P4Q A;  4GYS A;  3U3I A;  5JDG A;  5ABH A;  3ZT6 A;  5AQF B;  3N2O A;  5HEO A;  4L9I A;  3AAA B;  5ABF A;  4PFO A;  4AKL A;  2IC9 A;  1WYB A;  2JJ9 A;  2VK9 A;  4UVC B;  4EV6 A;  2KMF A;  3FXD B;  2E9X D;  4YT0 A;  2X68 A;  4Q25 A;  5AQJ B;  3LK2 B;  3TLU A;  4UF0 B;  4KBM B;  3ZYK A;  3AE3 A;  3VRA A;  2FJB A;  3S4U A;  2WMN A;  2Y6X A;  5E0O A;  2BVL A;  2VL8 A;  2BG9 B;  1US7 B;  4IDZ A;  2VKH A;  3EDV A;  3EUH A;  4I43 B;  1XNR T;  5JRC B;  3MJX A;  5LJM A;  4PAG A;  2BDE A;  3NRY A;  2FJA A;  4JI2 T;  3RRC A;  3N9N A;  3DP7 A;  2HPJ A;  3EAB A;  1IJ6 A;  2CWO A;  1N34 T;  3N2K E;  1HX1 B;  1W0B A;  3RH3 A;  4ERR A;  4V1A v;  1G8X A;  1MMG A;  4LF7 T;  5M4Y A;  2C0S A;  4QH4 A;  5ABF B;  4TV8 E;  3N9Q A;  2XM2 A;  4HWH A;  4PFP A;  2V7I A;  3ZJ2 A;  2BZB A;  4J2C A;  4JI0 T;  3AA7 B;  4LMJ A;  4GKK T;  4X5T A;  2BKP A;  2MPK A;  3ZMS B;  3M65 A;  5L3G B;  5HWX A;  2Q9Q A;  3V5U A;  2E9X B;  4GIW A;  3PUR A;  5AQO B;  2WY2 A;  4PK5 A;  4PK4 A;  5BMV E;  2V6X A;  1ZV4 X;  4JLE A;  2X9W A;  2XAF B;  3N9P A;  3V5S A;  3K1S A;  3JC6 D;  4JI5 T;  3VU7 H;  2ES0 A;  1IZN B;  4WBO A;  3C98 B;  3Q9D A;  5LP6 E;  2KIN B;  3O4X E;  2CLY B;  3F57 A;  2WWU A;  1XZY A;  1VOM A;  2CEA A;  3E0Z A;  3ZLI A;  2ZMA A;  3VKH A;  3UUM A;  4U2Y A;  2IUB A;  2OA5 A;  3T1H T;  3PUW F;  2CXF A;  5HXS A;  3F2E A;  3FZF B;  5HCJ A;  1LVF A;  2LEH A;  4AKI A;  2IC6 A;  5ADX L;  3ZC0 A;  4TV9 E;  2JQH A;  3ZMZ B;  1IBL T;  3RRW A;  3C4X A;  3HR0 A;  2UXC T;  4X65 T;  4K0K T;  5L47 A;  3VR9 A;  4PW8 A;  1IBK T;  1M7K A;  2CPT A;  1B7T A;  2Q9Q B;  3SFD A;  3AEC A;  4ZOL E;  4AIS A;  3OVU A;  2HN1 A;  2VUR A;  2L9Q A;  1UX4 A;  3AA0 B;  4YTP A;  4ILA A;  1SE7 A;  4O4H E;  3KV6 A;  5LGU B;  4XZC A;  5LHG B;  5AQH B;  1I94 T;  1UUR A;  4HKA A;  4EZH A;  3VR8 A;  4XAX B;  3MKD A;  4LFC T;  2W2U A;  4DO0 A;  4DVD A;  4U7I A;  3E22 E;  4G2A A;  1S35 A;  2D0T A;  3RYH E;  4YSY A;  1OED C;  2VVS A;  3UUN A;  4GOU A;  1D1B A;  5LYJ E;  3AAE B;  5EK3 A;  1SUM B;  1D0Y A;  4DUZ T;  2XM1 A;  3UU4 A;  1T98 A;  3RF1 A;  2JQQ A;  1D1C A;  3FBZ A;  2X67 A;  2MTQ A;  2KZ7 B;  2JQ9 A;  3UFG A;  4TUY E;  2EHO C;  4U74 A;  4DV5 T;  2I0M A;  2DL1 A;  1XDP A;  3L09 A;  3ZMU B;  3JCF A;  2Y48 B;  3MZK B;  3AE2 A;  1HS7 A;  1N36 T;  3JAF A;  5DQV A;  5L3D B;  3FXE B;  4IE5 A;  4IL4 A;  4TWF A;  3I0Q A;  3ABV A;  2LOP A;  3FZH B;  4U31 A;  4X1K E;  3TKL B;  2JQK A;  5F3J A;  2DHR A;  4IDP A;  1AJ3 A;  4H9P C;  3UU6 A;  2PBI A;  3QB5 A;  2OLT A;  4CQI A;  3ETU A;  1N32 T;  1VRB A;  2LRK A;  4HWD A;  4CZZ B;  4P0A A;  5FYM A;  3AEF A;  5HEJ A;  2V5D A;  5JRE A;  4EEB A;  2BBJ A;  3PUV F;  2FUP A;  2I59 A;  2V1D B;  4KHZ F;  2WM9 A;  1MND A;  2CM0 A;  4HFD A;  2J1D G;  3PU8 A;  3AE5 A;  3ANW A;  4YHJ A;  1WYC A;  4UVA B;  3BQI A;  3O1J A;  4UVB B;  4PJN A;  2IHR 1;  3C64 A;  3KV4 A;  4Z8X A;  4O2A E;  3DTO A;  1OWA A;  2VB6 A;  1LKX A;  3PE0 A;  4LFB T;  4JI6 T;  1HFA A;  3AVR A;  3EVY A;  4QH1 A;  2W62 A;  4L0R A;  4ZS2 A;  2GK9 A;  2H3R A;  2X0H A;  5LB7 B;  3Q2M A;  3PUQ A;  4OYJ A;  3CKD A;  3AXJ B;  5AQK B;  2A9U A;  2B1E A;  5CA1 E;  2ZM0 A;  4OK0 A;  4L5G A;  5JDQ A;  2V8S V;  4MBQ A;  4HTE A;  4MAL A;  4O4J E;  4OHF A;  5CFB A;  5C3J A;  2XAS B;  3N9L A;  1KNR A;  4G63 A;  2UXN B;  3E08 A;  5AQL B;  2Y8D A;  4HGA A;  5J0Z A;  1FEW A;  3PU3 A;  2CWY A;  5KXJ A;  2H89 A;  3GN5 A;  3IF8 B;  4ILB A;  5FKY A;  3ETV A;  2FJE A;  2XAG B;  3UU8 A;  3H37 A;  3AE8 A;  1FJG T;  5LG3 A;  4UEM A;  3CX6 B;  5J1G A;  4I0U A;  3CWZ B;  4JI4 T;  2NW8 A;  3HKE E;  2XQY A;  4QWN B;  3ZT5 A;  1FMV A;  3NVO A;  1KK7 A;  1D0Z A;  2CXD A;  4QX8 B;  4P1N A;  3UTK A;  5ABG A;  3FZK B;  3C50 A;  4PNI A;  1HX8 A;  4ASK A;  3PUA A;  4TNW A;  4GKJ T;  3L3P A;  1HG5 A;  4CN1 A;  4X1Y E;  2R6G F;  3OYZ A;  2LJL A;  4IHJ E;  1SA0 E;  2C5K T;  2JIW A;  2RA1 A;  2XQ7 A;  4DND A;  2BVM A;  5L4H A;  4DBQ A;  1NAF A;  4KUM B;  2QRX A;  2JPF A;  4EAH A;  1OED A;  2CA5 A;  4U2Z A;  3PUS A;  5LBQ B;  2D9D A;  4CXW A;  4O4L E;  4AQF C;  4IE0 A;  5CA0 E;  3QOF A;  1NEK A;  5DQW A;  4YSX A;  4GYR A;  2JMK A;  3NZQ A;  2WDQ A;  5AFU L;  2UUB T;  1T72 A;  3CX8 B;  3UUB A;  3MA9 A;  4UV8 B;  3GN5 B;  4HFV A;  3FHN A;  2LT3 A;  3I1A A;  4BJM A;  2WZH A;  2CMR A;  4LF9 T;  1MMA A;  1MMN A;  1ZEE A;  3U78 A;  2LM9 A;  5JR9 C;  3KFW X;  3P4P A;  2YDR A;  4AIU A;  2VQE T;  3TLV A;  4NXN T;  2ZM8 A;  3A8Y C;  2J62 A;  3RC3 A;  1YQ4 A;  3O1I A;  4A5X A;  2ZM2 A;  2V5C A;  5J2T E;  2VKD A;  4WZX A;  3CQX C;  3RI5 A;  3LK3 B;  4DID B;  4ZZB A;  3AEB A;  2YDQ A;  4O2B E;  2PTF A;  3NRX A;  3J9X 1;  5LGT B;  4IGU A;  1CUN A;  1ZKE A;  5FXX A;  5FVL A;  4AKR B;  3OYX A;  4WBN E;  2LHR A;  2WZI A;  2V6Y B;  2M67 A;  2G0U A;  4HFC A;  2OV9 A;  4PJJ A;  1XDO A;  3D0T A;  4JEU B;  4A98 A;  4YY3 T;  5AQI B;  3ZSS A;  3EAM A;  4O8S A;  2W0G A;  3P50 A;  3KBU A;  4TX5 A;  4DR5 T;  3G06 A;  4PJL A;  5LA6 E;  5IUX A;  3VHL A;  4F6R C;  2CRB A;  4JI3 T;  2XSA A;  3NBX X;  4OYK A;  4JBW F;  4LF5 T;  2Q9Q D;  2DWG A;  3C51 A;  3P8C D;  3CX7 B;  3RKO A;  4X66 T;  2IDO B;  2YKS A;  2UXD T;  1VCT A;  3KIN B;  1G73 A;  2KND A;  2YU2 A;  3P7I A;  3UU5 A;  5L3B B;  2VVN A;  5FVK A;  2E2A A;  5EK2 A;  2W63 A;  4NXM T;  4HFH A;  3OTO T;  4ZZC A;  4ZI2 D;  2JRK A;  5BR8 T;  4TZ4 C;  3WI3 A;  1X9B A;  5LG4 A;  1CHU A;  4OX9 T;  3H3M A;  3MK7 C;  3SRZ A;  3ZCJ A;  4DUY T;  1BR0 A;  2PFV A;  1HG2 A;  2YK0 A;  4QXB B;  4JI7 T;  3MXZ A;  3JAD A;  3KVA A;  4ZS3 A;  4KMC A;  2UXX B;  4P09 A;  4H9O C;  4IT4 A;  4U72 A;  2LSK A;  1WRD A;  2IIU A;  2KWI B;  2QA7 A;  3IEE A;  5HEH A;  3L39 A;  3ZYM A;  4C91 A;  1KNP A;  2DCF A;  3AE7 A;  4U7Y A;  3NWI A;  4M1P A;  2VWA A;  4JV5 T;  2ODU A;  1XMQ T;  2V26 A;  3GA8 A;  1MIV A;  2V7L A;  1HF8 A;  5H6R B;  5C8Y E;  2YU1 A;  2BBH A;  3CML A;  4DMV A;  5ABE A;  4B6X A;  4LF4 T;  2HHH T;  4ISS A;  3LK4 2;  2XUE A;  2CBI A;  3AEE A;  5FNV E;  2SPC A;  1Y64 B;  2K3W A;  4AQF A;  4EYY R;  4NUU A;  4QXC B;  2I6H A;  3LG7 A;  4HWI B;  2N1G A;  4EGW A;  3HA4 A;  2ODV A;  4KI0 F;  3CIR A;  4DV7 T;  1M62 A;  3NZP A;  3TLS A;  3CK6 A;  3AE1 A;  4WW0 A;  3ZKR A;  3I9W A;  5FY1 A;  2BG9 C;  5FMN A;  2E8I A;  2K5B B;  3R6N A;  1W9R A;  3Q5X A;  3AE6 A;  4ZI3 D;  1T7S A;  4B3R T;  3LJC A;  3RQW A;  3AEA A;  4YJ3 E;  1I6Z A;  4HE8 A;  2XQ8 A;  3PV0 F;  4TNV A;  4MLK A;  4B3T T;  2YIN A;  3TLT A;  4TN7 B;  2CHO A;  2LE8 A;  3ESL A;  3LSV A;  3RLF F;  2H7V C;  3UQ7 A;  1Z8U A;  2XZE A;  5CB4 E;  2K48 A;  4JUY A;  2LSG A;  4QHO A;  2M6I A;  1IAP A;  2A3D A;  3ZPO A;  2WCA A;  1R8I A;  2NP9 A;  3H3A A;  5CJ5 A;  4WNK A;  1JNR A;  5IYZ E;  1OED E;  3B13 A;  1NEN A;  4IST A;  3Q5D A;  3PDY A;  2WSS V;  1EZ3 A;  3RKG A;  2E9X C;  2IML A;  3A7M A;  5HXE A;  3GWH A;  1E7P A;  3KBT A;  4LFA T;  3WAK A;  1HNZ T;  4ANJ A;  5HWY A;  2VKJ A;  3HI2 A;  3ZEF B;  3EHZ A;  3OBV E;  4P0B A;  2X9X A;  2ZM6 T;  3X1D A;  2W67 A;  3K3O A;  3HKB E;  2UUC T;  2ACX A;  3CVR A;  2P9B A;  2CLY C;  1KEY A;  5C2T A;  5AQR B;  3OKQ A;  4ZHQ E;  3W15 B;  3LDQ B;  3RPU A;  4EXT A;  3AA1 B;  3ZN0 B;  4FJO A;  1YKE B;  3RIU C;  2X9Y A;  2WWV A;  1XNQ T;  2V7J A;  4KHP T;  5IHY A;  3T8O A;  1HR0 T;  1GQE A;  2HPL A;  3KVB A;  2ACZ A;  5KDM C;  2A72 A;  3ZMV B;  3SWH A;  1O3X A;  2NTX A;  5AQM B;  4B3M T;  2WBL A;  2XQ3 A;  4IDN A;  4QX7 B;  2UUA T;  3Q5E A;  1ZP0 A;  2MYS A;  4YSZ A;  5FL0 A;  4BJN A;  2Q9Q C;  3PUY F;  4IRE A;  4I55 E;  2WP9 A;  1LRZ A;  4EED A;  5FXV A;  5LOV E;  4E7S A;  4LML A;  3RC8 A;  2UU9 T;  4N78 D;  2CHN A;  3N9M A;  4DV2 T;  3RIA A;  2X0Y A;  2DNX A; 
#chains in the Genus database with same CATH homology
 3NRX A;  2OA5 A;  1LVK A;  2CXF A;  1IJ5 A;  1WLX A;  3J9X 1;  5HXS A;  3HKD E;  3F2E A;  3ANW B;  4O4I E;  3WAJ A;  2D0U A;  5LGT B;  3O9X A;  4IGU A;  4IIJ E;  1LVF A;  2LEH A;  2K24 A;  2WMO A;  3J7Y q;  1CUN A;  2IC6 A;  4AKI A;  5ADX L;  3ZC0 A;  3I9Y A;  4TV9 E;  1ZKE A;  5FXX A;  2XAQ B;  1MMD A;  5J2U E;  2K9A A;  2X66 A;  5DAB A;  3ZMZ B;  4XBF B;  2LHN A;  3JC6 C;  3F31 A;  3RRW A;  3RYC E;  3C4X A;  4AKR B;  3HR0 A;  5JQG E;  2CCQ A;  2NW9 A;  3OYX A;  3FB2 A;  4WBN E;  2NWB A;  2LHR A;  3HL6 A;  2M67 A;  2G0U A;  3QC9 A;  4PJJ A;  2JMH A;  3D0T A;  3K8P C;  4JEU B;  2D5U A;  4H9N C;  5LCY A;  2X51 A;  4PW8 A;  5JR9 B;  2VAS A;  5LGN B;  4O8S A;  3ZJ1 A;  2W0G A;  2KT9 A;  1B7T A;  2Q9Q B;  3KBU A;  3C4W A;  4JEH B;  4YLH A;  1HTJ F;  2PJQ A;  4TX5 A;  3QUJ A;  4ZOL E;  4PJL A;  5LA6 E;  4EOZ B;  5LHI B;  3VHL A;  4F6R C;  4CXY A;  3NBX X;  2L9Q A;  4OYK A;  1UX4 A;  4UXN B;  1H7C A;  3AA0 B;  2Q9Q D;  2WAU A;  1Z0P A;  2DWG A;  3C51 A;  2DI4 A;  3P8C D;  3CX7 B;  3R84 B;  3QK6 A;  5JVD E;  4O4H E;  3EDU A;  3KV6 A;  3RKO A;  5LGU B;  1WR6 A;  4XZC A;  3KV9 A;  5LHG B;  5LJN A;  4HKA A;  3N5L A;  4EZH A;  3KIN B;  3HKC E;  5FY7 A;  4HN9 A;  1G73 A;  4XAX B;  3MKD A;  2KND A;  3DJB A;  2YU2 A;  3ZYL A;  4DO0 A;  4DVD A;  3P7I A;  5L3B B;  5F8P A;  3E22 E;  4G2A A;  2LOS A;  1S35 A;  2D0T A;  5EK2 A;  3BK9 A;  2W63 A;  3RYH E;  5FY0 A;  2IW5 B;  1QSD A;  4ZI2 D;  4DMW A;  3I0O A;  2JRK A;  3IBP A;  3UUN A;  4EZ4 A;  4GOU A;  4TZ4 C;  3WI3 A;  1D1B A;  1FIO A;  5LG4 A;  4YFS A;  1V9D A;  5EK4 A;  5LYJ E;  2EHO A;  1BR4 A;  1U4Q A;  4ILU A;  1MIY A;  4H9S E;  3AAE B;  3MK7 C;  5EK3 A;  4AXP A;  3SRZ A;  3ZCJ A;  1D0Y A;  2L3L A;  2NTY A;  5A1L A;  1BR0 A;  3ZMT B;  1T98 A;  2W00 A;  2MOZ A;  3RYF E;  5EZY E;  2PFV A;  1YD8 G;  2JQQ A;  3LFM A;  4HEA A;  4I4T E;  5LHH B;  1HG2 A;  3A5X A;  1ZHC A;  1D1C A;  2YK0 A;  3FBZ A;  4QXB B;  2KXP B;  5L2L A;  4EB6 E;  5KX5 E;  3AAI A;  3MAC A;  3MXZ A;  3B57 A;  2X67 A;  3GMI A;  2MTQ A;  3KVA A;  4ZS3 A;  4BA9 A;  2KZ7 B;  4KMC A;  4TUY E;  2EHO C;  4U74 A;  5DJQ C;  2UXX B;  2L8K A;  4P09 A;  5JDF A;  4H9O C;  4CI2 B;  4U72 A;  3L09 A;  3ZMU B;  2LSK A;  1WRD A;  2Y48 B;  2KLQ A;  2KWI B;  2RP4 A;  3MZK B;  2QA7 A;  3IEE A;  1HS7 A;  3C4Z A;  2MBG A;  5LNK A;  3N2G E;  3ZYM A;  5DQV A;  2NW7 A;  4C91 A;  4ZI2 C;  5L3D B;  4AKH A;  3FXE B;  4IE5 A;  4X20 E;  3ZCI A;  2E9X A;  2DCF A;  3LBX A;  1MNE A;  3I0Q A;  4I50 E;  3UUL A;  4NUV A;  4QKN A;  2LOP A;  2D2S A;  4M1P A;  2VWA A;  5HYA A;  2ODU A;  4X1K E;  3TKL B;  2V26 A;  3GA8 A;  5F3J A;  2DHR A;  4ZI3 C;  1MIV A;  2V7L A;  1OXZ A;  4CI3 B;  1HF8 A;  5H6R B;  1AJ3 A;  4E7Z A;  4H9P C;  5C8Y E;  2CXL A;  4H9R C;  3UUX B;  2PBI A;  3AA6 B;  2YU1 A;  4YJ2 E;  4PK6 A;  1U5P A;  1D0X A;  2PG8 A;  3CML A;  4UIG A;  4UF0 A;  4CQI A;  4H63 H;  4DMV A;  3ETU A;  5GON E;  1VRB A;  3PTR B;  4B6X A;  3SOL A;  5LBM A;  5HXH A;  2C5J A;  4ISS A;  3LK4 2;  2XUE A;  4CZZ B;  1SHZ C;  5FNV E;  4P0A A;  5FYM A;  2SPC A;  3FBL A;  2XAJ B;  5ETW A;  4BAY B;  1Y64 B;  4EIW A;  2N2N A;  5JRE A;  4UEL A;  2EHO B;  2DWK A;  3UT5 E;  4AQF A;  2I59 A;  2V1D B;  2X9H A;  4KP3 C;  4EYY R;  2WM9 A;  4NUU A;  1MND A;  2CM0 A;  4QXC B;  5FXZ A;  3SS1 A;  4AI6 A;  5L3C B;  4H63 V;  2X0L B;  2J1D G;  2A2F X;  3PU8 A;  2VKO A;  1HCI A;  3ANW A;  4YHJ A;  3RX6 A;  3LG7 A;  1WYC A;  2N1G A;  3AVS A;  2EHO D;  4UVA B;  3HA4 A;  5JRC A;  4IE7 A;  2V7K A;  3BQI A;  2ODV A;  1S94 A;  3O1J A;  4UVB B;  4PJN A;  3C64 A;  1UX5 A;  3KV4 A;  4Z8X A;  4ADZ A;  4O2A E;  3DTO A;  1OWA A;  2VB6 A;  4A56 A;  1LKX A;  3PE0 A;  3NZP A;  4H9Q C;  4CXX A;  1HFA A;  3AVR A;  3EVY A;  4UV9 B;  5HAX A;  4ZI7 E;  3ZC1 A;  2YEV C;  2W62 A;  4L0R A;  4WW0 A;  4X1I E;  2V7M A;  3I9W A;  4ZS2 A;  5FY1 A;  5FMN A;  1E1H B;  2GK9 A;  4GYS A;  3U3I A;  2E8I A;  2H3R A;  5JDG A;  1D1A A;  1X79 A;  3CPZ A;  3Q2M A;  2K5B B;  3PUQ A;  3Q5X A;  3CKD A;  4OYJ A;  3N2O A;  3R6N A;  4ZI3 D;  1KNZ A;  2B1E A;  4L9I A;  5CA1 E;  3AAA B;  3LBX B;  2ZM0 A;  4OK0 A;  4PFO A;  4AKL A;  5L3E B;  5FXW A;  2IC9 A;  5JDN A;  4L5G A;  5JDQ A;  3LJC A;  4PJM A;  1WYB A;  2JJ9 A;  2VK9 A;  4YJ3 E;  2KWH A;  4HE8 A;  4UVC B;  2KMF A;  4MBQ A;  4MLK A;  3FXD B;  2E9X D;  5LXT E;  2YIN A;  4HTE A;  4MAL A;  4O4J E;  2X68 A;  4TN7 B;  4OHF A;  2LE8 A;  3ESL A;  3LK2 B;  2H7V C;  4UF0 B;  2XAS B;  3N9L A;  5FP3 A;  4KBM B;  5CB4 E;  4G63 A;  3ZYK A;  2K48 A;  2UXN B;  3E08 A;  2Y8D A;  4JUY A;  1YW0 A;  4HGA A;  1FEW A;  3PU3 A;  2LSG A;  2CWY A;  4QHO A;  3GN5 A;  1IAP A;  3IF8 B;  3S4U A;  2WMN A;  3N9O A;  2A3D A;  1MIW A;  3ETV A;  2Y6X A;  3ZPO A;  5E0O A;  3VKG A;  3CQG B;  2BVL A;  2XAG B;  2NP9 A;  3H3A A;  4MFR A;  1QUU A;  2VL8 A;  1US7 B;  4WNK A;  4IDZ A;  5IYZ E;  2VKH A;  3EDV A;  3B13 A;  3H37 A;  5HXR A;  2LSI A;  3AB3 B;  3EUH A;  4I43 B;  5JRC B;  3MJX A;  4IST A;  5TAO A;  5LJM A;  4PAG A;  4UEM A;  3PDY A;  2WSS V;  3CX6 B;  5J1G A;  2BDE A;  3NRY A;  1EZ3 A;  3CWZ B;  2NW8 A;  2E9X C;  3HKE E;  5HXE A;  1FMW A;  2XQY A;  3CQC B;  3RRC A;  3GWH A;  1YKH B;  3Q5W A;  3N9N A;  3DP7 A;  3KBT A;  4QWN B;  3WAK A;  2XTL A;  1FMV A;  2HPJ A;  1KK7 A;  4ANJ A;  1IJ6 A;  1D0Z A;  2CXD A;  2DLR A;  4QX8 B;  2CWO A;  3UTK A;  5HWY A;  3N2K E;  5JDH A;  2CE7 A;  2VKJ A;  4OFZ A;  3RH3 A;  4ERR A;  3C50 A;  3HI2 A;  4PNI A;  1HX8 A;  3ZEF B;  4V1A v;  4CI1 B;  4ASK A;  1G8X A;  1MMG A;  2NOX A;  3OBV E;  3PUA A;  4P0B A;  3K3N A;  5M4Y A;  2H7O A;  3L3P A;  1HG5 A;  2X9X A;  4X1Y E;  2C0S A;  3K3O A;  3OYZ A;  2LJL A;  4IHJ E;  1SA0 E;  2C5K T;  2RA1 A;  3HKB E;  5KMG P;  2ACX A;  4TV8 E;  4DND A;  2BVM A;  3N9Q A;  3CVR A;  4FI5 A;  4EYU A;  1NWM X;  4DBQ A;  2P9B A;  3RYI E;  2CLY C;  1NAF A;  4KUM B;  5H6Q B;  4QXH B;  2JPF A;  4AQG A;  4PFP A;  2LSJ A;  2Z6E A;  4EAH A;  2V7I A;  3OKQ A;  4ZHQ E;  3W15 B;  3ZJ2 A;  2CA5 A;  2BZB A;  4MHC A;  3PUS A;  5LBQ B;  4CXW A;  4O4L E;  4GK0 E;  2N9D A;  2W61 A;  4J2C A;  2XHE B;  3BQL A;  3RPU A;  3AA7 B;  4EXT A;  4AQF C;  4IE0 A;  3AA1 B;  5CA0 E;  3KV5 A;  3PUG A;  3ZN0 B;  4FJO A;  5DQW A;  4GYR A;  2JMK A;  3NZQ A;  5AFU L;  1UCU A;  3ZMS B;  1YKE B;  3M65 A;  1BR1 A;  2XAH B;  3KDS E;  4IE4 A;  5JR9 A;  2X9Y A;  5L3G B;  5HWX A;  2V7J A;  3CX8 B;  4GK5 E;  4C90 A;  3MA9 A;  2Q9Q A;  5IHY A;  3T8O A;  5JH7 E;  3OJA A;  4UV8 B;  2HPL A;  3GN5 B;  3KVB A;  3FHN A;  4HFV A;  3V5U A;  2E9X B;  4GIW A;  5L3F B;  3PUR A;  5KDM C;  4PK5 A;  4PK4 A;  2LT3 A;  2A72 A;  3ZMV B;  3SWH A;  1O3X A;  2NTX A;  5BMV E;  1BR2 A;  3BQK A;  2WBL A;  1ZV4 X;  4JLE A;  3I1A A;  2X9W A;  2XAF B;  2LSY A;  3IHR A;  3N9P A;  4BJM A;  3V5S A;  4QX7 B;  2CMR A;  1MMA A;  2ZLY A;  3JC6 D;  4DBR A;  1MMN A;  1ZEE A;  4IE6 A;  3VU7 H;  2ES0 A;  1IZN B;  4WBO A;  3U78 A;  3C98 B;  2MYS A;  2LM9 A;  3O1H A;  5JR9 C;  3Q9D A;  3KFW X;  5JDM A;  4BJN A;  2Q9Q C;  5LP6 E;  2KIN B;  2ZM8 A;  3O4X E;  4I55 E;  2CLY B;  3RC3 A;  3UFE A;  3F57 A;  2C5I T;  3O1I A;  5HXC A;  3ZN1 B;  2WWU A;  1LRZ A;  5FXV A;  5LOV E;  4E7S A;  2IAK A;  3RC8 A;  2ZM2 A;  5J2T E;  2VKD A;  4N78 D;  1VOM A;  3CQX C;  3K3Q C;  2CEA A;  2HH7 A;  3E0Z A;  3LK3 B;  3ZLI A;  5JDL A;  3N9M A;  2QGS A;  2ZMA A;  4AKG A;  4O2B E;  4K0U A;  3VKH A;  2DNX A;  3ONX A;  3UUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...