2C1EB

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
b'ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2c1eB00
2C2KB 1I51B 2H54B 3KJNB 2QLJB 3EDQB 3KJFB 3R7SB 1I3OB 1SC4B 2HBRB 4ZVOB 1RWOB 2QLFB 2XYGB 1PAUB 1RWNB 1IBCB 1RHJB 2QLBB 2Y0BB 3RJMB 3R6GB 2QL9B 2C2MB 2HBYB 1RWKB 1SC3B 2XZTB 1GFWB 1RWVB 1QTNB 2H65B 4LSZB 2P2CB 2C1EB 1RWWB 3EDRB 3P45B 5K20B 4ZVPB 2FQQB 4DCJB 4DCPB 2H51B 2H4WB 3IBCB 3R7NB 3R6LB 3KJQB 3D6FB 5IC6B 3GJSB 2XYHB 2QL7B 1RWPB 3IBFB 2CJYB 2HBQB 2HBZB 2XZDB 2H5JB 2Y1LB 4ZVQB 5IC4B 2QL5B 2C2OB 4ZVRB 1RHUB 1RHKB 1RHMB 2C2ZB 4ZVUB 2H4YB 2CNNB 3SIPB 1RWXB 3GJQB 4ZVTB 2DKOB 2CNOB 4DCOB 1PYOB 1F9EB 1ICEB 3QNWB 3GJRB 2H48B 4JB8B 2CNKB 2CNLB 2CJXB 2XYPB 1RWMB 3D6MB 3P4UB 1QDUB 1RHRB 3R5JB 1RE1B 1BMQB 3D6HB 3GJTB 2CDRB 1RHQB 3NS7B 1NMEB 4ZVSB 1SC1B 2H5IB 3R7BB
chains in the Genus database with same CATH superfamily
4K7QA 4M5HA 2V34A 3DRSA 3HHDA 3BQ1A 3BR8A 1JLEA 3B82A 4K5RA 3I4HX 1SUQA 4F7VA 3J7YI 5DG9A 2IMOA 3TW0A 3VQTA 2VPZB 1NZAA 5A8WB 1Q8IA 1FRIA 5EWFA 1FJ7A 2IBKA 1RAGB 2IC3B 1R0BG 2BOAA 4X4OA 1DQ9A 2V4QA 2E1MC 4JI2F 2W8KA 5KG0A 5HROB 3ILOA 3QLHB 3G82A 2V6AA 4JI3F 1IM4A 4DR3F 3SV3A 2YKQA 2HRTA 4FZVA 4D3HA 4B9NA 2XNRA 2XS5A 5F9LA 1YG0A 2C2MB 4NRUA 1YRUA 5E3QA 1NDLA 4OV6A 3QGHA 3JYTA 2R2TA 4QCLA 3KG0A 3EUNA 3OXLA 3W61A 3HZGA 3AQPA 3VHQA 1VBXA 3JTOA 4A46A 3KG4A 4LSZB 1WEZA 4I6YA 3UNGC 1RWWB 1L3TA 1IR2A 3OSPA 5K20B 1F5BA 2DRAA 1RT2B 4QJVA 1T9WA 2H51B 3PYDA 1MU2B 1U4BA 5CXTA 1TAQA 4K4SA 4YEAA 1HQ2A 4DX7A 5KT2A 2ZH5A 4YB1P 4DL6A 3CJRA 3QJPA 2XYHB 2XQCA 4ZJOA 3MAAA 4V19X 2WW4A 1Y4ZB 3FC9A 2MLYA 3PHEA 1GT8A 4K4WA 5KT4A 1JXEA 1NSKL 3I0SB 2MXYA 2B7CB 3J7Z5 2XM3A 2WTFA 1TL3B 4F4WA 5K9FA 5D3GA 4NLYA 4CO5A 2VODA 4LFBF 3JQKA 5B08A 2IRXA 1QD1A 2EFOA 5T41A 4CM0A 2L08A 1VR6A 3PIPQ 2QFJA 3OQ2A 1RHUB 2OSQA 4NMXA 3D1HA 4DV2F 1HBNA 3P5BP 2JLEA 4AQYJ 3PACA 2FVRA 3C3LA 3I6PA 4NCGA 2JEGA 3MTKA 2W4CA 2GQ2A 3D1QA 3R3TA 1FEEA 1NUEA 2X1AA 4QR1A 2XGQA 2V2VA 2U2FA 1JKHB 5GAGU 3ET6A 5GAEU 3EMTA 4RUCA 1N0UA 3WHIA 4EYIB 2DITA 4C8KA 1ZAVA 1F60B 4ED5A 3QWUA 4B9MA 2IPOB 2LU1A 2CQ3A 2CADA 3BSOA 2PDAA 2HIQA 2M4MA 1AA1B 3MMJA 4CLPA 2ZE2A 3E8OA 5B0FA 2HK2A 4WKYA 1SL1A 2V94A 1U48A 4PEOA 2ZJRQ 1NO8A 3ET6B 1TP7A 3J80U 2YNFA 4NCBA 3DM2A 3MCSA 2CNKB 3C6TB 5FDLB 5H9FJ 3ZXWA 5HVHA 5KOXA 4USUA 5HP1A 3RB4A 3D6TB 3UE2A 1J5OB 3MM8B 2F9DA 4RJVA 2RH3A 1HNZJ 4RW8B 3I9V9 2NXEA 1UW4A 3TQEA 3QYYA 2V8PA 3W64A 3OJSA 2V2QA 3Q24A 4NLQA 2G0IA 1SH3A 4NOHA 2GFFA 1G7CB 3GB0A 2MHNA 2W7OA 2RRAA 4DLEA 1FXDA 4XAKA 3QJJA 4YFUA 3HI9A 5AE2A 3UVJA 3JQMA 2D9PA 2Z0GA 4AXIA 2GVDA 2IIHA 2VH7A 5BYQA 4Y0FA 3DRXA 4LR9A 1SJRA 1NHKL 1NK7A 2B4PA 4K4TA 1FFSB 1S1XB 2BMBA 5KFXA 5DDPC 2VUGA 5LSOA 2PA3A 3KHGA 2ZH1A 1REVB 3SZ2A 3CMES 4TY9A 2QT7A 3HP6A 4FS1A 1RAHB 2LXFA 4WBFA 1R8PA 5ETVA 3OBIA 3UPFA 3HVRA 4B3TJ 3HZEA 2D69A 2HQCA 4IRKA 1GH8A 3H25A 1YJUA 4ZN3A 3IR7B 3H5UA 2HGMA 2RU3A 2E1PA 3MECB 4EK2A 1MLAA 4DUZJ 1KOOA 1VRUB 4ZK7M 2NXJA 3WC2A 1K44A 2MKCA 1NK4A 3N6NA 2D74B 2DHXA 4FNHA 2MKHA 1YX2A 1SJ3P 4ZVOB 4DSJA 4W98A 2YWKA 2DT9A 2YPZA 4P7TA 4X84A 3AJ2A 3AQOA 4NPOA 4ZPVR 1JLQB 2XZWA 1S0OA 2PMWA 2B51A 4HKQA 4Y2AA 4K2XA 3BGRA 4EWTA 3RJMB 3PHTA 4BBYA 1FKAF 4B3TF 2FYXA 1A6LA 3G8QA 4OV1A 1NB7A 5J2MB 1HI0P 1RTDA 4WU2A 4KY3A 2ZH6A 2XMJA 1NK0A 1QTMA 1L3SA 2F3JA 2C42A 4ED0A 5HROA 3RB3A 1RAAB 2JC1A 2ZBPA 4F0MA 1HHQA 3KUHA 3TZXA 1VQ4S 4NLGA 3AB4B 2FLOA 3CD7A 3OR1A 1FRXA 3QFWA 1BLUA 4IFYA 4TY8B 4CZCA 3MUTP 5L1IA 1NK5A 4UOCA 1BC6A 2HAIA 3KDOA 2E5LJ 2RQCA 3QWPA 4PUOB 1S7IA 4ZVPB 4DR4F 2B4VA 2OLWA 1HW8A 3LUYA 4QU6A 2EBEA 3G6ES 4DV6J 2RIJA 3RW7A 5IQQA 4EGLA 2KXNB 2LU2A 2Q6CA 5IC6B 4X62F 2KVQE 1WF2A 3GSDA 3RAXA 4X66J 4DS4A 4WYLA 2B6AB 3U7JA 5F0UA 3KMSA 4AFFA 5GVQA 2AYGA 4A8FA 2XZDB 3BPDA 4LF5J 4CLFA 3DN9A 3T9NA 2BZ2A 2IM2A 4GKKF 5L1KA 4ANCA 3DNCA 2FHJD 4P2MA 4RW6B 3K59A 3O2IA 3MM6B 2HNYA 1R0AA 2UXBF 4B3MJ 1SKSA 2O1PA 2X1FA 2AYBA 3CB4A 1RI7A 3DLGA 3QAUA 1SC6A 3RR8A 4IG3A 1KLNA 1NCLA 1SKUB 2W9BB 4AXJA 2CNNB 1HBMA 2ZD1B 2ASDA 3C14B 2KFNA 3FEYB 2H1YA 4HH1A 3CJKB 4HI1A 1WJ9A 2KKHA 3IO1A 1CC8A 5BXIA 2EK1A 2R8GA 1TKXB 5D8HB 1RTJB 5J2NB 4N5SA 2BKPA 1RBAA 3CJSA 3CJ0A 3GE9A 4N47A 1F9EB 5HSPA 1FDNA 5DGAA 3RB6A 3LP0A 2O67A 5J2PA 3PYEA 2O5DA 3BREA 1AYEA 3NCPA 4P73A 2IVFB 1IM6A 4C0BA 1FDDA 1IR1A 5DM7Q 4OYWA 4WFAQ 1D8YA 1HWIA 2OSRA 4TQSA 2EFGA 4DFPA 2QG9B 1JLFB 1F9FA 4M95A 1R6YA 2Y1IA 5IXUA 3D6MB 3B6BA 3SFGA 3W7BA 4ZJLA 4KKOA 3JSMB 1TL3A 5D3GB 4B9TA 1MMNA 3T1AA 4EI2A 1HD1A 2CQHA 3MM7A 3QZ7A 3G86A 2DIVA 2HVEA 1VOMA 2YNIB 3KLHB 4GKJF 2XI2A 1FRMA 1TMJA 3HHLB 4HR2A 4OI4A 4P7VA 4P71A 5DRKA 3HMJG 4OYAA 2ZOGA 3B54A 2YQ3A 1F5CA 4KHMA 2W24A 5K5MA 4ZMMA 3NAIA 1KOHA 2AJ2A 3C6UB 1BWVA 2H5IB 1HBUA 4OYXA 2VFTA 3HULA 4N77A 3PX4A 2EKNA 4FF2A 1T9XA 3BGFA 4URSA 4AL6A 4WPAA 2PFDA 5M2PA 3RW6A 3MM7B 3MPUB 4Q45A 4P72A 4PR6A 4U7UK 5EGYA 2VQFJ 4BLGA 3M9OB 2DCLA 5DDQC 2KFYA 3X3UA 5HLFA 4ILMA 2NUUG 4PPZA 4J9QA 4EO8A 1I51B 2MKSA 1RXOB 1PYSB 4DLGA 4I6WA 3QMQA 2I6WA 2UU9F 4PXBA 4Y2KA 2WZ1A 3UDCA 3EGNA 3ZZOA 1VIXA 1NJYA 1IKWA 1RTHA 3CJ4A 5HATA 2AJ1A 1DTTB 1V5IB 3P3DA 1P1LA 3IG1A 2V67A 3V2UC 2XMUA 4PG8A 2HFZA 3W65A 1P9YA 3GYXB 3FK4A 5F0WA 5HL7Q 2PEBA 3HD2A 1TKXA 2D9OA 2Y3YA 3I82A 3QGGA 4NEYA 4TYBA 4UT4A 1QAYA 2KM8B 3PR4A 2EG2A 5CQGA 5CD4A 1NDPA 1QSYA 3OVBA 3W8PA 2IC3A 1X4GA 1Y9OA 4ZPDA 4IYQA 2JWNA 1RWVB 2J6SA 4IR1A 1LXJA 1FESA 2DNPA 2V50A 2A10A 2QGFB 2AX1A 2PMHA 4KBIA 4RKUC 2MGZA 1LWEB 2LKZA 2QV6A 4E8UA 4ZP8A 2RDDA 3I0RA 3HHEA 1KHVA 4ED2A 5CD4H 1S0MA 3PW4A 5EX0A 4UY8T 2OFHX 2Y0SD 4I2QA 5HMYA 1OO0B 1J5EF 4PG5A 3H2VE 4FF4A 5ETLA 3IRXB 2NPFA 3CD0A 1R0AB 4FYVB 4KHRA 3TI0A 4WZMA 1D9FA 5J2PB 5LL6d 1SL0A 3ZC4A 1M5SA 3NGRA 1LFPA 3J81j 2DEIA 3HVTA 5E7OB 3PKMA 4I67A 3FSYA 1VCTA 4ZPBA 5F8JA 3MR2A 2B8QA 2RJZA 1S49A 3KK1B 4LRFA 3BR9A 2OTJS 1U0HB 2J5AA 1TFWA 2B6AA 4LRDA 5EWGA 3W2WA 3DOLA 3EXCX 1H2TZ 3VGUA 3C66A 5D77A 5ETTA 3ZNJ1 2J9EA 2ZFHA 2R7QA 3GILA 4Z7YA 1DY3A 1R43A 1X0FA 2R7UA 1S9EA 3GTYX 3PRDA 2CPDA 4XO0A 2HLUA 1R89A 1RKIA 4OL8A 5KFAA 1NB2A 3SV4A 2NSBA 2QA1A 2HRYA 3BDEA 3DMJA 4N56A 3KLEA 4L72B 1HYSA 4WF9Q 1YQHA 2NLWA 2QYCA 3NEKA 3GJQB 4Y2IA 4EFAC 4NLVA 1RTDB 2Q1LA 3QSYB 3BKUA 3V4MA 3PYGA 3BGRB 1C1BB 4FDFA 2ZKUA 4UW2A 1N88A 2K3IA 2RS2A 1V3SA 1SI9A 4L73A 2AP6A 2Q6BA 2IM1A 4ED7A 3PXGa 4U8VA 4C97A 5GMKa 3TAMA 2ZUGA 1XMOJ 2HYIB 4C8OA 1HNVA 3G82B 1ICEB 2DISA 1RAJA 1VQ6S 1RLCL 2VC0A 3IWLA 3HVWA 5JXSA 4GRSA 4DFMA 1S1WB 2CJKA 3P8BB 4DPWA 4RO0A 1Q5YA 1C1BA 2E66A 2OAUA 1GMWD 1RACB 2KXHA 3DLEA 1I5OB 4FXVA 1N32F 2XSJB 1WG5A 4FYWB 3MR7A 2UXDJ 2VPXB 1FRLA 4ICLA 5F9NA 1N5YB 2IAJB 3RBEA 5A0YA 3MECA 4WIQA 3VZIA 3TAQA 3DC2A 3DRSB 4RBVA 4Y3CA 1I94F 1RHQB 4TLQA 1S9GA 1EP4A 3MMCB 4OI1A 4QPXA 1Y5NB 2CJAA 4G1PA 4IFVA 2ZNZA 4J90A 3M9NB 2DCUB 5IV3A 4I2PB 4KRWA 4C9DA 1CQNA 4I69A 4EZ9A 3L3CA 3A12A 4ZS6A 5KFWA 4RPFA 5U47A 1YZ6A 4K4VA 1RT4A 1PC4A 3GSIA 3I96A 3WBZA 1ROFA 1IJFB 1LQ9A 3CNQP 4F3QA 5C2CA 3V4IB 5H9FK 4J9KA 4Y65A 3SBMA 5IZHA 1N5TA 2OPPA 4WP3A 2V8DA 1J5OA 3HKWA 3H5XA 1X4DA 4CIOA 4YN3B 1SJ4P 4W92B 3J7AN 1SC4B 5KT3A 2FTRA 1CC7A 3HSZA 4IG0A 1X4HA 4FPRA 4UQGA 3J7ZT 2F8MA 2WONB 3DRPA 3R2CJ 4NL5A 3W5XA 3K5PA 3T5KA 3DKDA 2XYGB 5HQ8A 3ZZUA 4OZLA 1V3RA 4PQUA 4WP9A 3OXGA 3EGVA 4FN5A 5D15A 3NMAA 4J91A 2ZZMA 3TJAA 2PMZD 2HAFA 2ZEJA 1SH2A 3VTIA 3M1VA 1KVJA 2C2EA 1N5VA 4ES3A 2YPYA 5I3QA 1GK8A 1T02A 4ZCKA 3HJFA 4ID5B 1WOPA 2E7VA 1SH0A 5K8MA 2WCXA 1LK5A 3LF0A 3O44A 5B0BA 4FF3A 4F3MA 1RAFB 1PJ5A 5HQLA 4B3RF 2H9ZA 3W60A 2UVRA 1VQSA 2OUGA 2B8PA 1RAOA 2RD5C 4MT1A 4OX8A 3AY0A 1VRUA 3BKFA 4P9SA 1CSJA 1X7VA 5E3AA 1WF0A 3AD7C 2FQQB 1HNIA 1B0TA 4USTA 3BO2A 1KQGB 4DCPB 2IM3A 5A8RB 4WKRA 2BRKA 1N5QA 2EC2A 2LP4A 3BYRA 5HVGA 3CCWA 1UCNA 3D67A 1DHMA 3H0PA 2WK4A 5D6GA 4MKBA 1ZS6A 4ZLPA 1UVLA 2HWHA 4KGXB 5KG7A 3KOAA 4RUAA 3NOCA 2RKIA 3M2UA 2YKPA 3A8JA 4X64F 1KQSR 1K73T 5AXMA 2G1HA 3OVSA 3MDFA 4Y6IA 2V9KA 4C2MA 5K8OA 3BDPA 3KJVA 2BRLA 1T9VA 2DHGA 4IO1A 3EX7B 2I1RA 1U0SA 2L9NA 1OJ4A 2IRUA 3R9LA 2HHTA 1OQ3A 2B4UA 2EFQA 4M63A 3VALA 4B3SJ 2GAGC 4ZVUB 2VV5A 2G1DA 1N33F 4ATNA 1TKZB 4WWSA 3GYNA 4JBCA 2I2YA 1S0VA 1HA1A 3N4WA 4I2PA 3GR1A 2NR0A 2B9YA 2D7SA 1D8ZA 3HHLA 3SCIE 3OTCA 4F8RA 3GU0A 2HQIA 2L41A 4F50A 1FX4A 4H4MA 1FTRA 1HNWF 3CO0P 4KPCA 1JLFA 4MKYA 5IT9U 1FRJA 2VZ9A 2KT5A 2DYAA 4OZJA 1WSRA 1BUXA 2J7KA 1KD1T 4IO9Q 2DH7A 4CNZA 4ZHRB 4O0IA 1UVIA 2AEMA 5HN0A 4N41A 1F3FA 1NEEA 2AYEA 1FJGJ 2MZRA 3QIPA 3ISZA 1XJWB 3CDBA 3JS9A 2E9TA 2YNHB 3AOCA 1RTJA 5J2NA 2F40A 3ETOA 1IKYB 3KUEA 1QE1B 1YJWS 2BYCA 3CCVS 2VKZG 2XS2A 2F4FA 2GGPB 2IVYA 2ROEA 2JNJA 3UWTA 1L3KA 5E2QA 1VMBA 5HMXA 2ZHBA 1FD8A 3VV2B 2K2PA 3N6LA 4I64A 2AF6A 4QWCA 2AJQA 3GJTB 1RADB 1PCAA 3NS7B 4FYDA 1O0PA 4DPYA 2HMIA 2LA4A 1B4SA 4CLSA 2VFRA 1Y11A 2ZKTA 5DG8A 1QAIA 3J7A1 1S76D 2EW9A 2BM0A 1Q5VA 3D3BJ 4HACB 3H90A 2XULA 4IH5A 4LT6A 3SCKE 1HI1A 3VAFA 2IJRA 3FBFA 1OPZA 4ZITA 2F1FA 4P10A 3GIJA 3G6YA 3C2PA 4YMEA 2OHDA 1T9UA 3NGDA 4DR5F 3RYLA 1T9YA 1J2VA 2KDOA 4LVOP 3UNYA 2CPFA 5L1JA 1S6UA 3N9UC 3RR7A 4ER8A 4CLYA 2MTLA 1HMVA 5HK4A 2VG7B 5AXKA 3J80Y 1T3NA 2FVCA 1RWOB 4LF6F 3DU6A 4Q2MA 5ETSA 4CI0B 4YY3J 1HHSA 3MWBA 3PY8A 2RNEA 2VD3A 4J9MA 5LJ5Y 1U1RA 2EFPA 4EBDA 3MI7X 3IS9A 4JV0A 4DQIA 2IY5B 2HS3A 1RUSA 4A8MP 1YHQS 2BJ1A 1P27B 1VQ9S 3U1NA 3K8VA 2W9AA 1U6FA 2OELA 2JC0A 1QVGR 4OYIA 4H54A 2MSTA 1UTAA 3OR1B 3KK2B 2GO8A 3CULA 4EBCA 3T1HJ 2JLFA 3CGIA 3NXZA 4DSEA 4UF4A 1KP6A 2EG1A 4IH7A 4URQU 4ED4A 4LFBJ 2OPRB 5E5NA 2PO4A 1KTQA 5A8KB 4DX8H 4DUZF 5J2MA 1UZHA 2J0SD 2PFFB 2DPIA 3OFHA 3DMJB 5KG3A 4M94A 3PVXA 2DRBA 2BV3A 1FWLA 2ZM6J 1YJ9S 1XK8A 3SFUA 1HW9A 3B4DA 3CCSS 3IM9A 1P1TA 2YKOA 1FX2A 3ENQA 3NY0A 5K8PA 1CJUA 4NXNJ 3FNNA 3ITHA 3SDEB 4ZCMA 4N76A 4OI0A 2HBZB 2FJVA 4P6QA 4IDKB 1C4CA 5L46A 2QX0A 4A8QA 4B3OB 4DL3A 4J9RA 2W2QP 1HQUA 3BYPA 2D1CA 1HBOA 4I68A 3MCOA 4M5IA 4CTAB 1HQEB 3NS5A 2FGCA 1FHTA 5DO2A 5DDOC 1VI7A 4LIWA 2C3OA 3L7OA 5JMNA 4LF7J 2ZHAA 1RT3A 2HFSA 4CT9A 1RHKB 3DU5A 2OPSB 3Q89A 1RLDA 4OZ5A 4HEA9 2A6OA 2CPXA 2CQ0A 1URRA 2CKWA 4ZP6A 4RBTA 3ZTOA 4LREA 5L39A 2LEAA 5IWAJ 2H3EB 4JI1F 5DDRC 4RW8A 4H4KC 2OJ3A 1UVMA 1IWAA 1NBEB 3DDIA 3G2XA 1T7PA 4FBUA 4OHYA 2IFXA 2Q43A 1OIAA 3FSXA 4A8WA 1PYOB 1FDBA 3FEZA 4IRCA 3L9ZA 2XMVA 3GIMA 1O51A 4EO6A 1TK5A 4KTQA 1QE1A 1VDHA 3DOKB 2Z30B 4DUTA 2QFIA 4J5OA 1UEKA 4CYUB 2VQEF 1HFEL 1LV5A 2XEXA 1CBKA 4ZVGA 4DUYF 1JJ2R 3HX9A 3NGUA 4F04B 2XYPB 4JYAJ 2V2KA 1FRKA 1SL2A 1RT7B 3D54A 4CLUA 1FTCA 3QSIA 3T6JA 3MXHP 4DV3J 1KVIA 2XMKA 3OXFA 4JV5J 1EETA 4OLOA 2J8SA 5KFKA 1KSPA 1IBMF 4F02A 2GJFA 4WP8A 1AW0A 5ITHA 2XWXA 2VICA 2DIUA 4ECUA 2PIIA 1TAUA 1PBAA 1DRZA 3PDNA 1YSJA 4ZVEA 1JMTA 5RUBA 1FF2A 2EK6A 4WTYA 1U2RA 3BSCA 3RRHA 5CYMA 2G4BA 3VF0B 4YB6A 1VBZA 1SV5A 5LMNJ 1CJTA 1IJEB 1SB6A 1I6JA 3QRPA 1LWFA 1CJKB 3M2VB 4UY85 1XC9A 3Q2SC 3NMRA 1KQKA 4I4BA 3H2LA 2LLZA 4XDCA 1TZ0A 2MZJA 2CQBA 1UWBB 2DB1A 2H54B 2LEPA 3E51A 4UUWA 2HFOA 3I0SA 4Z2XA 4RU2A 5AXLA 2UUCF 5KOWA 2UVWA 3VZHA 1Q1KA 1HQEA 3QQCD 1C0UA 1VBKA 3G6XA 1UFLA 1TL1B 4QR2A 5KFOA 1GMUA 5GAHU 3MEEA 1WC5A 1TUWA 2DBBA 1C4AA 4CH0S 3EVOA 3QZ8A 2BEFA 1XNRJ 2E9RX 4B17A 3WC0A 4I0WA 3P6YC 1RBOB 1VHFA 4KKOB 2DHSA 4K59A 4NMLA 4CO3A 3R6GB 2BE7D 3I31A 1JLBB 2M5YA 2E7XA 2VF3A 5CZXA 2I5JB 3OL8A 5DG7A 4Z7CA 1TL4A 3OD2A 2BACA 6AT1B 5H9EJ 3MR6A 3MCMA 4IUFA 4OI6A 1EARA 1UETA 4JI8F 2V8VA 2R7OA 2VQEJ 2FLLA 4CO4A 4F4AA 2YH0A 2J6TA 1WC1A 2XG8A 3KK3B 4LBPA 1WI8A 1CULA 2Z58B 5G4DA 2VA2A 1YITS 2HG4A 3CCZA 3CT9A 3D7SB 3LOUA 4KYZA 4F36A 3FVYA 1TELA 3NCRA 4RNMA 4DCJB 1DLOB 1Q7YT 4GKJJ 3P49B 3J81U 4LR7A 2DEJA 1CVJA 2F7VA 2AWZA 3KJQB 2LEBA 1S97A 4YB5A 4ZCLA 3IWNC 2LQ5A 1RTIA 1RWPB 3FZ2A 4HL9A 4BHQA 1RISA 3IR6B 3OTOJ 1YK9A 3G6VA 1SUQB 1NJWA 4PWDA 2YKNB 4IG3B 3N79A 3OR2B 4NCAA 3RG6A 1WHXA 3GCXP 8RUCA 3EPGA 1VRTB 4P75A 4ZVQB 2OEMA 2DHHA 4EUVA 2K06A 2LA6A 5F8MA 3POTB 2HFUA 5C2GA 3PO4A 4ZVRB 2G2ZA 2DY9A 3OFGA 1Q0NA 1VBYA 4K5SA 5D0GA 2LVWA 2UUCJ 3I9ZA 3MPDA 2UVUA 4YOEA 4PG4A 2MQPA 4DQRA 2M7SA 2W8LA 4PWUA 2FZGB 2IVMA 2MB0B 3MMCA 3M6WA 4GVBA 4QIWD 3OT9A 4LMZA 1VRTA 2A0FB 2J9CA 3EVMA 1IKVB 5SUHA 2DK2A 3EXYA 4RLEA 2CQ4A 2YKNA 3WQPA 2UU9J 1K9MT 2YX4A 2CNOB 3W2VA 1F2GA 3EICA 1R8CA 5DM6Q 2FVSA 1K0TA 3PEHA 4LF9J 2VBWA 1U02A 2BVZA 5GAGI 4P74A 2B9XA 2DGUA 1X4AA 2HS4A 4EU0A 2N3OA 1WORA 2Z56B 3L09A 2OPRA 1GTEA 2FJDB 4MMOA 1NDKA 4OHZA 4AD6A 5HO4A 2GHWA 5FLXU 3KHLA 2YKAA 4WU3A 1Q82T 5CCLA 5DQIA 1QVFR 5HJXA 1VC5A 1HNZF 4UZBA 2QLWA 2CQGA 1V3ZA 3IAS9 1V9OA 1X4FA 3KK3A 3HJVA 4PABA 4X62J 4NEZA 3MUMP 3KLGA 3HPOA 4F2SA 3M8WA 4O3RA 5IT9Y 2ASYA 1RQ0A 3FKBA 5HMWA 4ZIWA 1YIJS 1DLOA 1SIWB 3W63A 1WG1A 4MFBA 1RE1B 4LQ9A 2OI2A 1JLEB 4LF6J 2VONA 1N36J 3CCJS 2CDRB 4ETXA 4UUXA 3TYTA 3BGUA 2F4VF 2E1RA 1R6VA 4B3MF 1YBAA 5C5JA 1X4EA 4F4ZA 3UFCX 5DGBA 4R0JA 4C8LA 1Q4RA 2FY8A 2ZHOA 2CVEA 5CH7B 1FVQA 2NSCA 3W66A 2JH3A 3FZBA 4CM2A 2W2MP 2ZDOA 3M30B 1M5HA 4DPTA 5FLXY 3MFHA 3L7PA 1EX8A 1WC3A 3N5FA 2GS8A 4HH0A 3PM9A 5B0AA 3CJ3A 2B5JA 4PYAA 5KFGA 3TRGA 1YZ7A 4DBQA 3OL6A 4DV2J 3O3LA 4M5DA 2YWEA 3QJLA 1JQGA 1MG7A 1GEHA 4PQAA 3CCMS 5I42A 2AGQA 2HBRB 2DNHA 3CC2S 1AFIA 1DARA 5F8LA 2FHOB 2JLGA 1LWEA 2KHDA 1LW0B 2CQCA 2H5EA 1RT1A 3IAM9 4USMA 4MKVA 2Z2ZA 2WVDA 3K57A 4JV2A 3MAAB 4NRTA 2NZ4A 2UUBF 4OHWA 2YNFB 5B0CA 1N5YA 2HHPA 4K0KF 4OJHA 3FBCA 3GV5B 2VPWB 3PW7A 1LNQA 1D09B 3UN5A 4ZP9A 1MU2A 1SVDA 2HBYB 2QE5A 3IA0A 4NI2A 3T41A 3OUYB 2FLNA 1VFJA 4GC7A 5HP1B 1QTNB 5KFBA 3B78A 3ISND 2XI3A 3A4TA 2OIHA 3MEKA 1FT8A 4WTOB 4F4YA 1EIYB 1UPPA 2MHEA 1IKYA 4PRFA 2PA8D 4Q43A 1S57A 3CVKA 2YVSA 3IGNA 4CLKA 2YNHA 1FDAA 2BE9B 2H4WB 2FHKA 1T03B 3KTQA 1ZETA 3VQSA 2B4OA 3AA8A 3J81Y 1T8EA 4DU8A 5KFNA 3PIOQ 1NZ8A 1RTZA 4KV8B 1U26A 1U2FA 4W4MA 4MYTA 3AXMA 4RX6A 3F41A 4RW7B 4O4GA 5IM0A 1NHVA 1IBKJ 4ZOSA 2JZ5A 4RL1A 2R2UA 2H5JB 2K7KA 2J0QD 3DOKA 1FXRA 2N4DA 5L9NA 4X4SA 1N48A 1XMQJ 3IWXA 1HBUB 1SCJB 2HS0A 1KEKA 3KJVB 2ALYB 3DLGB 2OPPB 3KDNA 4DMZA 1NNDA 3NLCA 3PJ9A 1X4CA 2Y8YA 1NDCA 3OHAA 1APSA 1Z2LA 2NYIA 2C2ZB 2CG8A 2YWWA 3DLKA 4NE9C 4N7TA 2ZWPA 1QJHA 5I3UA 5BYSA 4Q7AA 2VFUA 2EXUA 2O01C 4RW4A 2R8IA 3G4SS 2MZTA 3NBPB 4OX9F 3SDEA 1U49A 2E44A 1N0VC 5F8HA 2L9WA 5KG5A 3UI3A 4DS5A 3QGPA 4LIRA 2EVZA 4CTAA 3P96A 2UV8G 2J9DA 3M05A 4O44A 3WDOA 5AE1A 2BQUA 1OYDA 1Y7PA 1AROP 1EZZB 3CSKA 1T05B 4U7UD 3EJMA 2VFVA 2NREA 4NLPA 3QT6A 1B0PA 1ZBTA 2GIQA 2QLXA 2VFSA 5ETPA 1NSQA 3CTRA 3BJYA 4MAKA 3U27A 2LQ9A 2PT0A 3C19A 2GW8A 1K1QA 3E01B 5KFPA 3CCES 1AUSL 2UUWA 4KE5A 3AA9A 1UKUA 4TKTA 4JV1A 4Q0BB 2R7TA 2J76E 1FVSA 3VAJA 1FJGF 5A8KA 1TK0A 4NI2B 3CJTA 2HQ3A 1NJZA 1RYSA 3D1OA 1X31C 1RAEB 1OY6A 4RWWA 3JAMU 2IYGA 1WHVA 2YNGA 3S6EA 3I5AA 3KWMA 5A8WA 2GQCA 3NWGA 4CO1A 1TKTB 2WOMB 4DV1J 2QIFA 2DNNA 3EGWB 4NLXA 2KHCA 2VA3A 1TL7A 4LFCF 4YR3A 1MWYA 1N5SA 3MM6A 3LGMA 3O6QA 4OMFG 2F9JA 2OO4A 4BS2A 2RF2A 4G3IA 2DR6A 2MKKA 2MZQA 1GX6A 5DLFA 3QFHA 1KBRA 2YKMA 4B3SF 2RQ4A 4QIEA 2AHOB 3H42A 4KO0B 5DS7A 2R2SA 1ELOA 1N54B 4IFVB 2UXCJ 1KR4A 5KFHA 3KK1A 1R0CB 4LF9F 3TJ9A 1NHUA 3KLFA 2KJVA 2ASJA 1EQMA 1RAIB 1RT4B 1BQMA 3MCNA 3UR0A 1RCOB 1XR7A 2R7RA 2NXCA 1H2UX 2AX0A 1Q78A 2DY1A 4O3OA 4HT5A 4LF4J 2KVIA 4OYPA 4DV7F 2N82B 1X5PA 3RAMA 4I7FA 4HYKA 4ECYA 1VC6A 1SKRA 3V6JA 3FCWA 4NYPA 2K1RA 1NSPA 1FKPB 3ONQA 2DR9A 3TNVA 4J37A 4CH7A 3VGVA 3S01A 1SPBP 1WG4A 3DFEA 1KN6A 1F6TA 4WFXA 1P6TA 2GAHC 4KH1B 1UFKA 3NGSA 3CPWR 1U1MA 1TKDA 4KR0B 2MSSA 1ZPWX 3G8TA 2XSJA 3T9ZA 1JLGB 4DL7A 4LSNA 4OZ0A 2B3TB 4HHUA 2E5JA 2W2OP 3JTNA 3TA2A 3OTEA 4ZPAA 3DHWC 4QWDA 1U45A 4MK7A 4U96A 9RUBA 2DNGA 2QC3A 5M2RA 2COLA 3HFZB 2GMHA 4ZLLA 1DJ0A 4YR2A 3AD8C 1MSWD 4B9SA 2MKYA 1TQLA 5L9XA 2VBXA 5JJBA 1QSSA 2ABYA 3M2RA 4DQPA 1VQ7S 3WIUA 2VG6B 2E5LF 1UW9A 4DR4J 3W2VB 2NXNA 5LMNF 2I5JA 3H8YA 4X4TA 5IC4B 4E0DA 1F5AA 1DAXA 2RHSB 3CW2C 1RYRA 2VC1A 6FDRA 3BQ2A 3LO3A 1ZOTA 2HK3A 1GX5A 1VGYA 4NASA 4TN2A 2C2OB 3M8PA 2PI4A 4DR6J 1XEZA 3TJ8A 2UUAF 1B7FA 5KT5A 1KHWA 2RS8A 2CYYA 3TVYA 5LMUJ 2GVDB 1X5TA 4W90B 2RUGA 3U02A 3SIPB 2AEFA 1JB0C 4OIXA 1BHNA 1X8DA 2W9CB 2FLPA 2CJQA 3LQVA 1N6QA 2MQNA 3DGVA 2R8HA 4OLPA 1RSCA 2M8HA 1DBDA 2V69A 4NLSA 4DQSA 3OL9A 4K2JA 4ERDA 4AUKA 2AYMA 3DHXA 1H3DA 3FCVA 3I0RB 2WB1D 1P9QC 4OJ3A 5D4NA 5F3TA 3UR3C 1FO1A 3D3CJ 4YY3F 4OZ1A 1PC5A 1VLOA 2BDPA 4KJIA 3SI8A 4X4NA 1SQEA 2VBZA 1W7WA 2MYFA 1S12A 5FDLA 3N01A 3T6BA 4UOGA 1XQIA 3VR1A 2EWHA 2RDIA 4JI4J 2NQPA 3D5MA 4RW7A 5FJ4A 4KC5A 2HRUA 4CLTA 3BO3A 2UXDF 3M8PB 2WVFA 2HVIA 2A3JA 4V19J 3CJ5A 2ZE2B 3BQ0A 3MFIA 1RGVA 1T03A 4ED8A 2ZUAA 1E6YA 4G1IA 4ES1A 4L6V3 1HNIB 1N8RT 1VQPS 3R5JB 3FFIB 1YTYA 1KFDA 2DH8A 1WEXA 2IBOA 2APOA 3PR5B 1S10A 2DGWA 2AJ4A 1R7IA 4ELTA 1BMQB 4CT8A 1EB0A 1OWXA 1TL5A 2KT3A 4GMKA 2Z8QA 4G6VB 2CAJA 2R7VA 3W5ZA 2MDAA 3PYFA 2EC0A 3O1LA 4I6AA 4ZDNA 2LQJA 2FZKB 2ZOMA 1TMMA 3OPKA 2JFKA 3PJXA 2DR5A 1S6OA 4LSNB 2FJXA 5F8GA 3KNGA 4DUYJ 5KFQA 4JI7J 1CPZA 3VAGA 3RBXA 5D0EA 5EX3A 2PGCA 4R5PB 2BJEA 2CPYA 2HVZA 1KNZA 1GXTA 4YR0A 2Y9HA 3PX0A 2BANB 1RT6B 2CPJA 2WONA 1I3OB 3HDSA 4DPXA 1PJ7A 1VK8A 5E3PA 1UJ5A 4CRJA 3GP9A 3M8RA 3MR5A 3NNHA 2O3DA 4H4KA 2D3ZA 1Y10A 2W1BA 1OSCA 3CDAA 2C22A 3PNIA 5B0EA 4AYBD 3NRBA 2W9CA 3K58A 3DDKA 1KC8T 5I4MA 3MEGA 4DI6A 3D9BA 2O66A 1HNXJ 3DRRA 2VU5A 4RBUA 5HI7A 5C24B 1NU4A 1WOOA 2QZ8A 2CUYA 3MR3A 3DXBA 3KLFB 2JFDA 4DV5J 3BN4A 1IR0A 5DJBA 5DQHA 2E5IA 4X4RA 5KG2A 1GFWB 2DGXA 3HFVA 3M30A 4ZPWR 3OLAA 3B8HA 3I55S 2H65B 2EKYA 2C1EB 2VL1A 1CG2A 3DI6B 1GXUA 1ZAXA 3MMBB 3VGSA 3Q8SB 2CZVC 1S48A 2ATCB 3BF4A 3JSBA 4LF2A 4U9RA 4ECXA 4FS2A 2M88A 1OYEA 1W25A 2DGTA 4DV0F 1JLGA 3ICLA 2R7SA 4P2FA 5EWEA 3R6LB 4MH8A 3EM1A 3ZO7A 4ZLNA 3HHLC 4R8UB 3RRGA 4F2RA 4RR5A 1N52B 3OSNA 1Q95G 1N32J 3LGNA 2GMLA 3K5OA 3AAWB 3KK2A 2X3GA 1HL6A 4KFBA 4QPTA 3LPYA 1KTVA 2DNOA 2P9EA 1AB8A 1URNA 3LP2B 5KAKA 3KLEB 3V6KA 2MKIA 2FVQA 2HNYB 3QRRA 2BJDA 2XB2D 4J9OA 3RBDA 1U2CA 4RW6A 3VGTA 4GO7X 2YY3A 3VVUA 1D9DA 4OFZA 3HK2A 4F0KA 2ZBQA 4J9LA 3PG9A 3Q86A 1ZM2A 3ZNUA 5IT4A 4M5NA 3TX0A 5H9EK 4PXCA 1IKVA 2C28A 1Y3KA 1BQNB 1KLMA 1WC0A 4LVNP 2NPIA 2XMAA 4DG1B 4DFJA 2DVIA 3J7YU 1NPKA 4YHHJ 3HHNB 3VVTA 1JLAB 4TYAA 3OTDA 4FPIA 4A8SA 3W2WB 4HI2A 4DL5A 3IRXA 1OY9A 1NLKL 5T7LB 3TUIC 4MKAA 5CAAA 4XTTA 2CG4A 3KKFA 2GCFA 4OYOA 5D0HA 2UUTA 4TQRA 1XMQF 4DZ6A 4JI5F 3LAKA 2KM8C 2WW8A 3DCAA 3GV8B 3MM5A 1WHYA 3U1LA 1YJRA 2XY6A 2WSFC 5FIIA 1Y5IB 3GJRB 4L74A 5KFIA 3OW2R 5KFEA 4UOHA 5CHCB 4I56A 2YWHA 4JI0J 3UD5A 2HZAA 3UCGA 2CQDA 2KL8A 2YNGB 3KLIB 3OFFA 4HHHA 4QIVA 1S72S 4A8KA 2XHWA 4C3MA 3TARA 2FY1A 2QRRA 4X65J 1WKKA 1TVRB 4NZ0A 3LP1B 2GGPA 2A2CA 3M6UA 5F41A 2ZDPA 1VS3A 3CD6S 3MOJB 1DFDA 2ILZA 1LWCA 1Y0HA 3D6HB 4FVMA 3SXLA 2HHHJ 4ECSA 4OZNA 5LXYA 3K0JA 4NZ6A 2MPUA 4H4OB 3TAMB 3ZTRA 3BO4A 4ZJQA 1K1SA 1RCXB 5KT6A 3R7BB 2KU7A 4B02A 2IMWP 4LUBA 3CJ2A 3FQKA 3I32A 2UZAA 2KB2A 3MMAA 2QSWA 2IM0A 4DJBA 3CDUA 2C3UA 4URGA 4QW9A 1OQ6A 3SCJE 3VAMA 3HLUA 2FB0A 1T9TA 4F3OA 1DTQB 1FK9B 3KXDA 3A3NB 4RNFA 2OEJA 1F3VA 2NYHA 1OY8A 3ILIA 4RUHA 4ES2A 2GMJA 2EFVA 2B0GA 3EYZA 1S99A 2QYGA 4WXOA 1SQFA 2LDIA 2W01A 4LFAJ 2V63A 2X3DA 3Q8QB 1U6BA 4ED6A 1R31A 3M7VA 1A9NB 5I3UB 2XCAA 1R8HA 4YDDB 2RSQA 4D3GA 2ZITA 4K8RA 4RNOA 3W62A 7FDRA 3GR0A 4OYMA 2GIRA 1J27A 1F2HA 4O0NA 4QQBA 2CZ9A 2HQGA 1RHJB 4QBUA 2QLBB 1S1TA 4NLOA 2GHPA 2Y0BB 4PXEA 1N33J 3CD5A 3BSAA 4IOBA 1JLCB 2QMUB 1ZM9A 5ETOA 3NKYA 5ETMA 2YNIA 2F8EX 1RTIB 2F65A 1CJTB 4OZ2A 4WE1B 4DDFA 1UWBA 1QLNA 2J6UA 3CDEA 2D3OR 3R2DJ 4TXSA 1FI4A 2RT3A 4PG6A 2DGSA 2CPEA 4PG7A 3CO9A 4QWBA 1PO6A 3R1HA 4A47A 3N0VA 4KV8A 3PW5A 2F63A 4ZVFA 3EDRB 1WEYA 2YBVA 2R4FA 5MAOA 2E1CA 1KRPA 1U1PA 4M1KA 3T5JA 3TO8A 2G9OA 4RNNA 4JI8J 2QMXA 4N8OA 3R7NB 4Q8FA 2X7IA 2ACMA 2MQ8A 1BWEA 2VG5B 4OX7A 2ILYA 2IJFA 2L9DA 2HNZA 3FBBA 2Z2MA 1EETB 2QSFA 4YUDA 4FKXA 1UVKA 2E7WA 2B56A 1D3WA 3VAHA 1SIZA 2HBQB 4ELVA 4K4UA 2OGUA 4XIUA 1NJIT 1RT7A 1X4BA 3K2YA 5JUMA 2MQMA 4F4XA 2ZD1A 3M9MB 4USJC 4M5MA 2JX2A 4FF1A 1VQLS 1XMBA 2CJBA 2LQ8A 3HVAA 1DTTA 2X1BA 4QOTA 4PCQA 3SCLE 5BR8F 2VIHA 1HIYA 4WK1A 2BJ3A 3JXOA 5G0RB 4NCGB 4DQQA 1YJNS 2BQRA 1RT1B 1U1LA 2FGOA 1QY7A 2RRNA 2B9WA 5A2QU 2CPHA 3PKYA 3KHRA 3EZ5A 4WK3A 3GFYA 4C48A 4L75A 5KFMA 3UN2A 2HNDB 2XBPA 4DR7F 3MPWA 2W25A 2AJFE 4WXWA 3MEDB 1LWFB 3M2VA 3CCTA 1QM9A 3RB0A 1ACMB 1GMVA 4KH0B 4OX6A 1FCAA 2Z2LA 4IG0B 5ADZA 5AT1B 5IS2A 3BS9A 1DQAA 3QAEA 3TZZA 5KT7A 4EEYA 1G4CA 2WSEC 3G96A 2EI5A 3KNAA 1BQMB 2BQ3A 1WUUA 1IKXA 3IM8A 4ZVHA 3G9CA 1DQ8A 4K4XA 5IFMA 3MZIA 5K14B 1C0TA 1UZDA 2AGOA 4GKKJ 4C4WA 5L8RC 3T5LA 3Q22A 4IQXA 1DZ5A 5KFRA 2C2DA 2CA9A 2HHXA 2VB6A 1CJUB 3AXKA 2MY8A 4NX9A 2HVHA 3GONA 4M5JA 1YRTA 1NXIA 3HSDA 1S4EA 1UEUA 4IDKA 4B3OA 2BKOA 4OI2A 1LOUA 1WOSA 2MY7A 2R3VA 4JI0F 3WX8A 1S6PA 4A8XA 3HXMA 2VOOA 2RVJA 2AW0A 1K0VA 2AZ3A 3MAHA 3W5YA 2RDJA 3QATA 4EZ6A 3T19A 3GG1A 2ZH7A 2Z57B 5A0YB 2WAQD 2E5GA 1D9AA 2PSZA 4B9UA 3HCXA 1S7HA 4IFYB 1XBWA 4IRDA 1HHTP 4QZVB 2DPJA 2DO0A 2PEHA 4GC6A 3FDSA 2BOPA 4ITSA 5JVGQ 1UVJA 4Y28C 3DGPB 3CCUS 4HT7A 1MROA 4ID8A 2IRYA 4ZPTR 3CMAS 3QT8A 1IQZA 1JJCB 4EMDA 3CXCR 2ERRA 2C2KB 1KFSA 3QRQA 2WHOA 2Q3PA 3DI6A 3MMBA 2CQIA 4CLZA 4DFKA 4NXMJ 2R42A 4LF8J 2GVZB 1XNQJ 3G8SA 2HKEA 2PE8A 2Z2YB 3R7SB 1TK8A 4USWA 1REVA 3FQLA 3SSRA 4WFNQ 4XPCA 1AXQA 2JJ4D 4GVBB 1Y00A 1UP1A 2DNYA 4F26A 4KPYA 4B3RJ 1B70B 4QYZJ 3ZZZA 2C3YA 2JHEA 3A8EA 3UCZP 5CYQB 1NKEA 1NM2A 2B9EA 4O3PA 4FBTA 1XR6A 3W9HA 3ITHB 1MMDA 1G3OA 4Q44A 1Q53A 2KRBA 2QL9B 2ZM6F 3HVTB 1PBUA 2DNZA 3JQJA 4HACA 2E29A 1IKXB 1V6HA 3JSRA 1SC3B 2BUNA 4C0OC 1Q8BA 4FXDA 5KFYA 3TZWA 5JVHQ 2VJUA 1TFYA 2BW2A 1RA7A 2BANA 1PKUA 4WZQA 4FYYB 2KXFA 3MM8A 1BE4A 2W7PA 2RB7A 4ECTA 4PUOA 4C8ZA 3JAMY 2HHHF 1WTFA 2X1GA 3CIZA 2UXCF 3DYAB 1R8AA 3EZUA 3CF5Q 4BDPA 2JEJA 1CJKA 3CMQA 3QIDA 2AMCB 3R8YA 4USKA 5MLCV 3HT3A 3V81A 4KHPF 4LF1A 2CFXA 2ADBA 5FD1A 1H73A 1K8AT 3KYLA 4X66F 2MKJA 5A2QY 1U24A 3FMBA 1JK9B 2C3PA 3C16B 4U8YA 3PW0A 1Q86T 2DGQA 4ELUA 4DX5A 4DPUA 1EKRA 4ECRA 1H6KX 1Y5LB 3R97A 1VQKS 4P52A 1HPZB 1H7WA 1ZM3A 2ZH8A 1KWMA 3LALA 1ZA2B 4HTJA 1REGX 2XMMA 3H5SA 5ETRA 1EAYC 1AZSB 2D3UA 5F3ZA 3PX6A 3RZAA 5GMDA 4H4MB 5T14A 4IR9A 1MNEA 1WHWA 4DR5J 1Z1ZA 2HSEB 4YHHF 4TU9A 5E33A 2DD8S 4Q5VA 1IKWB 3A8KA 4DR1J 4JI1J 1JLCA 4ZVTB 4B08A 4LQ3A 1KVKA 1YJTA 3W3SA 3IG1B 2MLZA 4NLDA 2AIRB 4F0HA 4GVLA 3RTVA 4ECWA 1N34F 3FUYA 1FJCA 1A7GE 4DCOB 2KI2A 3UQSA 2CRLA 5KFJA 3AHPA 3QBCA 3AJ1A 4X4QA 2OMOA 3DLKB 5HBMA 4QWEA 1LW0A 2R9LA 3DOMB 4DL2A 4XDDA 3UD3P 3UVJB 2FC9A 3DXSX 2M8DB 3QO9B 3PV8A 5IT0A 2EEYA 1SJQA 2KG0A 4OX9J 3BV8A 4IH6A 5AE3A 4F4KA 1BXNA 3HKZD 4NLWA 1Q8LA 2MMYA 4DHVA 1RT3B 3RUBL 4CLWA 1S1VB 2IHR1 2QA4S 1LWXA 2ATLA 1FXLA 2YQ1A 2MQOA 3S8SA 1DTQA 1FK9A 1LK7A 3D0HE 5CYMB 4DU7A 5HBMB 3OV7A 4X4UA 1QDUB 3L7UA 3US5A 4Z37A 1PILA 3HO1A 2GX8A 4A48A 3TEGA 3T1HF 1RT2A 3ZZ0A 1T95A 4F67A 4Y2MA 3IR5B 4DXLA 1NKCA 2WB4A 1VQ5S 3V5RA 5DQGA 1ZTTA 2P6TA 3K8WA 2W4DA 4QIGA 1CJVB 3OFEA 4FVCA 3RBZA 2NXUA 3THTA 1K47A 1TUVA 1KKHA 2DNMA 1UPMB 1SC1B 3FCHA 3H7HB 4TLRA 5GAEI 3PFOA 5J1EB 2AEJA 4MIWA 4O4GB 5IM0B 1RT5B 1TUGB 2AKWB 3C8YA 7AT1B 1B64A 1UL3A 2RQMA 1TVRA 2BW7A 3MHYA 2E5HA 4C8MA 5A76A 4WJBA 3K89A 3TX8A 2RHQB 3OTOF 2ZOFA 3M6VA 1GXLA 1B7YB 3CCQS 4JYAF 1V5VA 3Q0AA 1KONA 2IJNA 2FC8A 1NK9A 1FA0A 2UUAJ 4KHPJ 1XERA 1G1XA 3LP0B 3NP5A 2G0JA 3DLJA 2J9DE 3IC1A 3N6MA 4PXDA 5E0OA 1X5OA 4DWIA 1FNXH 3ZZPA 4C98A 1H2VZ 1VYAA 5F8NA 5KG6A 4O3NA 2FJWA 1LW2A 4XK8C 5EUHA 1O5JA 3GFXA 1SJ1A 3Q8VA 2XTJP 3D0GE 2OFGX 3IS9B 3V6HA 3DDNA 3FGVA 2MJNA 4NYZA 4X64J 4RW9A 3CC7S 3I4PA 4KAIA 4ECVA 1ZPVA 5KFZA 1LEOA 1MMLA 1QAJA 2PC6A 1W2BR 2BR0A 2J7WA 1H98A 4DOZA 1UJ4A 4QYRA 5CYQA 3M32A 3BEGB 3MTJA 2LECA 2ZJQQ 1WKJA 2HHQA 5B09A 4O3SA 1D0EA 2V2ZA 4WFZA 2RU9A 2MLXA 4M8LA 4C3LA 3M8YA 3NWRA 3GV7B 2PI5A 4J9VA 5I3PA 4P2XA 1B0VA 3NNCA 4O4RA 1WELA 1XTZA 4TY8A 4LSLB 3W8GA 5EHHA 5KFFA 4ICLB 2HHSA 3AOBA 2I38A 3F73A 2AV5A 2WVBA 4USHA 3C16A 4C6AA 1QAXA 3DGPA 3G71S 4CDIA 3IFEA 4WCEQ 3TUPA 4S0MA 3K7RA 1VQNS 5DZ6A 2GNKA 2QL5B 5LM7E 2KG1A 1AT1B 2ZNYA 4KGVB 2BE2A 4DSLA 2FHMA 4WIIA 3O5TB 4OYBA 4LSLA 5HAOA 3ULHA 3FMWA 4YB7A 3ZFVA 3KLGB 2HWTA 5AXNA 4LRBA 2HHUA 1QUVA 1IN0A 3GMGA 2VG7A 2DXDA 1M5OC 1S0NA 2JEFA 4JI6J 5CZVA 1WWHA 2XNQA 4RWXA 2ZH4A 3PCOB 4GO5X 2XO7A 2M3DA 4LJMA 5DZ7A 3DLHA 1HNXF 3DLLQ 3I56S 4J7CA 2DKOB 2E9ZA 3KHHA 4DR6F 1XR5A 3OTBA 2VDIA 4HDHA 1RWUA 1B99A 3ADAC 1JWWA 1WDTA 1YWXA 4K50A 3HD1A 2KN4A 3DLBA 4RW4B 1TKZA 1VQOS 2L3MA 3LW5C 1PSDA 2K3KA 3GIRA 3QNWB 5IOLA 3W1YC 2OPQB 4J9PA 3D2WA 1HARA 2MZSA 2RQKA 3POTA 3BB5A 5KG1A 1IVZA 1FFWB 4DSIA 3JTPA 2CJXB 1X9MA 1JJ4A 3A8IA 3AOAA 5KFSA 1YGYA 1C1CB 2HLTA 4MIBA 1G2EA 2LCWA 1U7LA 4MIAA 4RW9B 1RHRB 4I1TA 4KGZB 4MK9A 4KGKA 1NH7A 4TVAB 1RK8A 1UJ6A 2UVVA 1IBLJ 2AZ1A 4LR8A 3TVZA 1S1WA 1MWQA 1RT6A 3H20A 2NZCA 3MEDA 3HFKA 4DV4J 4J9SA 2ASLA 3LP2A 2GJ2A 1S6QB 5C42A 4ZVSB 1BQXA 3GG0A 5BYRA 3VCDA 3W9JA 4ZLJA 1YI2S 9ATCB 4LF5F 3QIPB 4WYWA 3GCWP 4UTGA 5D4OA 3GIKA 2PN6A 5E41A 1T94A 2DNLA 5E3RA 3LGHA 3THVA 4C7QA 3CCRS 5GADI 2P8IA 1RZMA 1S1UA 3MPYA 1AFJA 2R7XA 4ANEA 3R5BA 1WTBA 3TQ1A 3FEXB 1RT5A 1UVNA 1YVFA 2XWYA 2JVOA 5KFTA 1WC4A 2KJWA 3Q8UA 2GJIA 1E6VA 1HKAA 2DNQA 2WSCC 2ZC3A 2DR8A 2FHJA 2HGNA 5J1NA 3FSIA 1T05A 2OKQA 4IOAQ 1LXNA 5BJRA 1UMJA 2FDNA 3KLVA 1RWNB 1S1VA 2P9GA 3EWGA 1U8WA 1U25A 2ALZA 1RKJA 4Q2LA 3U1MA 3OLBA 1S6QA 1ZAWA 3IXQA 3KG1A 1GMWA 4KIAA 3TA1A 5KFDA 3T1YF 2Y8WA 1C0UB 2FJBB 3SMZA 4ENOA 1NRKA 1U1KA 3DRPB 4AQYF 2AGPA 5LSLA 3V81B 4UZCA 1L3VA 3E2EA 1PAEX 3MEEB 2XLIA 4DV1F 2DR7A 2MJUA 4I2QB 1OS5A 4M5DB 4JP8A 4DSKA 2HFVA 1FEHA 1S1TB 4LBHA 5LT5A 3AT1B 4A8YA 1GQEA 3H2UB 2BXJA 2ZBIA 3PZPA 1SV5B 1PGZA 2RKIB 3M2UB 3UN3A 4B9LA 1E6VB 2D41A 1VJWA 2HIYA 3I5BA 2Y1JA 2HPUA 2I8EA 4RNHA 3KLHA 1XNQF 2MEWA 1R3NA 2QJ3A 1U09A 4X2BA 2UUBJ 4JI7F 1OPIA 2BJ7A 3LH2S 1ZH5A 2YTCA 3K5NA 3NG8A 1FD2A 5LSRA 5J2QA 5B0DA 2A1BA 1EKSA 3JYTB 3ZTSA 1EJ7L 2VOPA 2G2YA 1NSAA 2VG6A 1YKWA 4IQMA 4U67Q 2J8AA 2ZH3A 2HZVA 3FRZA 3IGVA 2XGPA 2AT1B 3M8QA 3FFIA 1FJEB 2D3O1 1RP5A 2ZC4A 2QA2A 4ECQA 4JV5F 2GC8A 2CVIA 3C15A 4NXMF 1U8SA 1IBLF 3HHKA 3HF5A 3GQCA 3CJKA 2HGLA 1U1NA 5HMZA 4DR1F 1CS4B 1HNVB 3RGIA 2W9BA 2VQFF 3LA0A 4QR0A 1YJ7A 2CJ9A 1X0PA 3SQGB 4ANDA 1LWCB 4CYUA 4TU8A 2VJVA 4PQUB 1JXVA 4DN9A 5HLFB 2XLKA 4WE1A 1JNZB 2V4JA 3LP1A 3VWSA 4LF4F 1RU1A 1HWKA 3TUJC 2VHGA 3IP0A 4KGMA 1M1KT 5LOQA 1TR0A 3KLIA 1FFGB 1RJJA 1C1CA 2BA9A 3MF5A 8ATCB 3M8ZA 2V9WA 3MAQA 1QUPA 3A3PB 2ROGA 4ZIVA 5B0GA 3CCLS 1N6QB 1M5VC 3PFEA 2JDJA 2CQ1A 4U6PA 2DXFA 2H48B 2N7CA 1H38A 2CNLB 1HNWJ 3DOLB 5D4PA 1KS2A 2V8GA 5KFLA 4CP5A 2V68A 2OPSA 2RRBA 2FD2A 2ZVIA 3AFGA 4DN0A 3MM9B 3IBWA 3T3FA 1S4FA 4QIFA 1C0TB 2ZH9A 2JSXA 1F1BB 1S59A 2GHVC 2OMLA 5KFUA 1YDLA 1WKLA 4C11A 3GIIA 1O6XA 1FERA 3OR2A 2HHVA 1MWZA 1MN7A 3F44A 4R25A 3UCUP 3ILJA 2CQPA 1EP4B 4E98A 3LTOA 5CCMA 1R27B 4PWDB 4YS2A 3M2RB 2BE2B 4LFAF 1VRQC 4EBEA 3NNAA 2KT2A 4KB7A 1DURA 2GVZA 2LFVA 4NA2A 1X9WA 2LMIA 3ZTQA 1L5UA 5HJYA 1QSLA 1FNMA 1HWLA 3THPA 2XO6A 3EVWA 3ZZYA 1JXLA 3W9IA 2HQFA 4FYXB 2ZVSA 3HHLD 1MROB 3PEJA 4ILRA 3B4MA 3AB2B 5THWA 5C25B 3CJQA 5EDWA 1N56A 4TNOA 4USIA 3H5YA 3TA0A 3D28A 4NYOA 1W2IA 1UEVA 2I9SA 3HSGA 2EFNA 2HWIA 2W7AA 1HWJA 3ENAA 5KFVA 2HHWA 1HWUA 4DF8A 4P2SA 4Y34A 1CQMA 3WIVA 4E2FB 2LXIA 1RA6A 4XPEA 3JSMA 2C3MA 1CJVA 2M70A 1M5PC 2BM1A 1OSDA 1S6PB 3OL7A 2VG5A 3F0NA 5T7LA 4ZN1A 2M52A 1JJHA 2E1AA 1O8BA 1S1XA 1TU0B 3KUGA 4O44B 2EBGA 1Z2ZA 5SZTA 3R1LA 2M2BA 1IXKA 2K8GA 2CWXA 3TP2A 5GAHI 2IA0A 4BC7A 2KH9A 4QYZK 4WFYA 4BC9A 1N36F 3P45B 1CEZA 2AU0A 2OH2A 4FKYA 5A6PA 2CIMA 2P9CA 1TV6B 3FJ2A 4ZKAA 3CC4S 2HNDA 1ULRA 1R8BA 3PRVA 2NCKL 5ETQA 1NAQA 4QWAA 2QA4G 2KO1A 2M9KA 3NAHA 4LRAA 2IA6A 4AL7A 4C8YA 2NUHA 4KT0C 2JOQA 1NJXA 1Q8KA 4BWJA 3WX4A 3X1LB 3IMQJ 3MOZA 3BH6B 3ZZTA 2AJ0A 3C6TA 4KFBB 2XY7A 4U7CA 1Q79A 3IBFB 4LRCA 3TR5A 1RBLA 3ETMA 5KTQA 1AUDA 3C15B 2IDEA 3AD9C 2DTJA 2BJ9A 5DETA 2DNKA 3QT5A 2M0GB 3UW1A 1VIOA 3NS6A 1FRHA 2HVDA 3SQGA 2OEKA 2R2RA 4F25A 3C46A 2HNZB 3R5CA 4AE5A 2ZBRA 5L38A 3TANA 1I94J 2V5HG 4M5GA 8AT1B 5D78A 2R8KA 2LXUA 5J2QB 4YDXA 4L3KA 2FVPA 1SXLA 2H4YB 4C0HA 5J1EA 4TU7A 3MD1A 1E6YB 2YWFA 3OUYA 1G6BA 1S77D 4DR7J 4HTIA 3MMAB 3M8QB 3ENVA 3K5MA 3O8WA 4OHVA 1Q16B 5C42B 4RZRA 3NGTA 1H7XA 1BD6A 2BKNA 3K17A 4NZ7A 5C24A 5K8NA 3VAKA 1NK6A 4ZPCA 2HQDA 1T0TV 3RAQA 2SXLA 3QO9A 7FD1A 3CWJA 3CJ8A 4USVA 3C14A 2R7WA 4J9UE 1GNKA 3MPVA 1P8GA 3OVAA 3NBPA 3CDWA 1IBMJ 4ZCIA 1JX4A 2FPHX 3JSYA 4JB8B 4OJGA 3UD4P 2RILA 1N34J 1X60A 2BABA 4DV5F 4X4VA 4JI6F 4ALZA 3H4DA 4DL4A 3DOMA 3EGZA 2FZCB 3P4UB 2J0XA 4UOFA 3HSJA 4FP9A 3TUZC 1HBOB 4R5PA 3MM5B 4CWBA 2VBYA 3Q83A 1TV6A 1Z4UA 2G0CA 4CQ1A 6FD1A 3PW2A 3DM2B 1FKOA 1S9FA 5HANA 3H98A 1HR0F 5LXRA 3A1YG 4LBIA 2V0NA 2XHCA 2A18A 1WNEA 2A2DA 5A8RA 4ED1A 1NMEB 1AZSA 1UFWA 5L1LA 2VPYB 2BJ8A 4DSFA 1XWLA 3ELHA 3N5BA 1HPZA 1UA1A 2IAJA 3R5GA 1W26A 2ACYA 1FWKA 3R5AA 4M5KA 1WF1A 4NLUA 4PAAA 3DRYA 4AT1B 1T3OA 2FJAB 3ENWA 3Q8PB 1NK8A 1SQGA 4CO0A 3CE8A 2V8HA 1ZM4A 4H4OA 4IKAA 4DR2F 3KJNB 1XNRF 3TEHB 1J5EJ 3BPSP 3FRYA 5C25A 3KJFB 2EPIA 2UP1A 4LF7F 2IDLA 4MFBB 1VLYA 3R5DA 1MW7A 3M1VB 5E3CA 5CABA 3LWMA 3TAPA 4JUZA 2OTLS 1PYTA 2JVRA 2JRSA 4DZDA 2DXEA 3DYAA 2CPIA 4MTPA 3SEOA 4JOUA 4ZP7A 4X4PA 1PAUB 3L95X 3CEDA 3AODA 1IBCB 5AJ3J 2XCPA 2LQBA 1HBMB 1NKBA 4FNIA 1VQMS 2DJWA 2DNRA 2YX1A 4NXNF 2KTQA 1FWPA 2KZZA 3S1TA 2XSFA 2BBEA 1WD6A 3F56A 2Q79A 3BZQA 3I5CA 3T5HA 3G87A 1PG5B 3E3XA 1IQTA 3CIMA 4M5LA 2OPQA 1YBTA 2U1AA 3GPAA 1RU2A 5KG4A 4DV0J 2P2CB 2VDHA 1MN9A 3GZ7A 5M2UA 5I42B 4DF4A 1SJFA 3D4JA 3M32B 1U0HA 2WVCA 1HLWA 3BH7B 2GZOA 2G2OA 1F9HA 4NA3A 2YX7A 3SYZA 3EZOA 1S9GB 4QW8A 4KSEB 4X65F 1B3TA 1KQFB 3V4IA 2DGVA 2RUSA 3UDVA 4DV3F 1JLAA 1U1QA 4G1QA 2YKMB 3D66A 3GJSB 4V1Ak 5GMEA 3EPIA 4DG1A 2QL7B 2QTWA 3MEGB 2V4RA 2J7UA 3Q8YA 2QMWA 3AH6A 4JI3J 2NS1B 3A13A 1OMSA 4DR3J 2CJYB 4OZ3A 4G65A 4PYDA 1TL7B 1LW2B 2Y1LB 2GA7A 1CS4A 2MQQA 1RABB 3JB9k 1XIQA 4PWWA 4JI2J 4PZVA 3SSSA 4IOCQ 2MGZB 2P5VA 2N7YA 2XS7A 3FBEA 4ZA1A 5HVFA 3MUVP 4R8UA 2V4JB 1VC0A 2Y1RI 2DO4A 4O23A 4YQWA 1YJVA 2XLJA 4RUBA 1U1OA 1EHWA 1LFWA 2ZZTA 3MGJA 3GFZA 4C3KA 3DLEB 2LDYA 2IYIA 2YH1A 1RWXB 2OP5A 3HT0A 4ZHRA 3TZYA 3E01A 5AJ3F 1VK3A 1JLBA 3M8SA 2C2NA 2ZH2A 4J9NA 1F0XA 2WVEA 1T11A 4Q0BA 3KMQA 1ITPA 3BSNA 1YRXA 1S9EB 4N8NA 4Q8EA 2ADCA 5K14A 1H74A 1D1UA 4LF8F 2DRDA 4QU7A 1PJ6A 3NCQA 2HFNA 4DV4F 3KFWX 1EQ0A 5H1SV 1RTHB 2JL9A 2ZWOA 3DRRB 2ZBCA 2ZZNA 2VASA 1VQ8S 3QGIA 1RWMB 1UWAA 3SQOP 1IWGA 3L4BC 3Q2TC 3D68A 2CPZA 3BBBA 4O3QA 4HDGA 3H40A 4JI4F 2LYVA 4ILLA 2FJEB 1WI6A 5F8IA 1ZYQA 1M1HA 3LAMA 4NWBA 2N4CA 2YXLA 2ZJPQ 5D4LA 4LFCJ 3ISNC 1HR0J 5G0RA 1FKOB 2GQQA 3C6UA 5BR8J 3WZ0A 3NGKA 4EYHB 2C2RA 1HD0A 4MK8A 5D0RA 2YWGA 1ZZNA 2HMIB 2HEKA 4BCAA 4Y2CA 1M90T 2F5GA 2FIUA 3K5LA 2WBRA 4CH1A 2X51A 1NPRA 2AQ4A 3A3OB 4YP3A 3QT7A 1FE4A 1N4LA 2I0XA 1X9SA 2J0WA 1XN9A 2CDQA 2PD1A 2QLJB 1X5SA 1YLXA 1S1UB 2BX6A 2W2NP 3EDQB 3ILLA 4CO2A 4RU9A 2A6MA 3LWLA 5LJ3Y 4DV6F 1U47A 1I1GA 3BBFA 2N3LA 1H72C 1CULB 3BGLA 2XC9A 3GYGA 4B9VA 4ID5A 4A8OA 1ZTWA 4ETZA 2KYZA 2QLFB 4A4JA 4CLLA 1HBNB 2AD9A 3CUNA 3NL0A 1JKHA 3TWZA 1JNRB 1Y3JA 2MQLA 2GV1A 3QLHA 1Q81T 1H0HB 3S7RA 4K0KJ 3MD3A 4CNYA 3GLJA 4HVZA 3PRBA 5B7WA 2Z4PA 5IWAF 1YBUA 2R8JA 1RWKB 4MJKA 1S79A 2XZTB 3RU0A 1FE0A 2POKA 2CXEA 4PPDA 4L76A 3SSQA 3GWCA 3AJDA 1TL1A 1TTHB 1VJQA 3IRWP 3M4XA 2WRMA 3I87A 3RRKA 3ZTPA 4PKDB 5IQ6A 3UDEA 3P5TL 3H59A 2P6SA 4DR2J 3IBCB 3LPEA 2QO3A 3BKTA 4Y00A 3OJUA 2XMWA 2W4PA 3D6FB 2B5JB 1WACA 2W2PP 4KQZA 1BY9A 2CWKA 1RDRA 2XY5A 3PTWA 1NPPA 2FUG9 1JIHA 3VAIA 3TVKA 4DV7J 1UAWA 1SKWA 1FNOA 4OI3A 1LKZA 1HQUB 4UQTA 1WDDA 3IN5A 2QN6B 2F4VJ 1PIEA 3LANA 2ROPA 4FXWA 2JEIA 4HHJA 1BQNA 1KLMB 1VHIA 4HLBA 1U6ZA 5J1PA 3BBCA 2XMTA 3GFHA 4NLTA 2G13A 2OD4A 2RE1A 4BWMA 3HM9A 5GADU 4ECZA 2RF2B 3NOGA 3UO0A 1VQYA 4DX6A 1ZZFA 2RMLA 3H4BA 3V6DA 3MURP 1RHMB 1IBKF 1GTHA 2Q66A 4DL0C 5EN1A 4K4YA 1ZA1B 2B43A 4OHXA 1VISA 1Q7LB 2GO9A 1L3UA 1TKTA 2WOMA 2KYXA 5LMUF 3R27A 1M0SA 1BGXT 3OHBA 3T1YJ 3N28A 3PJWA 2YQ0A 4OQJA 2RAQA 4CCHA 5KFCA 4NA1A 1KDNA 4WFBQ 1JLQA 3EE3A 4ED3A 1M5KC 2CZ4A 4K4ZA 1WC6A 5DLGA 2K7JA 1HI8A 4L3NA 2L48A 4DPOA 4JI5J 1HYSB 3Q23A 2K1RB 1NH8A 3BGOP 2KRRA 3UDLA 2KFZA 1WSVA 5CYJA 4AL5A 2HZCA 2F8HA 2GIFA 4MYUA 5ETKA 3V6DB 2KZMA 5A6WA 2UV8A 1RB0A 2HURA 1FKPA 1GAOA 4NLRA 5IV4A 5HQMA 3BN7A 2DH9A 3TOQA 1SBRA 2DHAA 2WBMA 1C2PA 3ZZRA 4I7FB 2HW3A 1HMVB 4R0EA 2MZ1A 3MM9A 4C8NA 2UXBJ 1UA0A 1M1GA 4G1QB 1XMOF 3BM7A 2QEXS 1S5ZA 2CQ2A 4C11B 3Q8RB 1A0OB 3M6XA 2OD6A 2VKRA 4U95A 5C7PA 5CA5A 1CLFA 1IUJA 5ETNA 4DEZA 3PO5A 3QPIA 4OJ1A 2DGOA 4KO0A 3D0IE 4OYZA 2B7BB
chains in the Genus database with same CATH topology
2C2KB 1I51B 2H54B 3KJNB 2QLJB 3EDQB 3KJFB 3R7SB 1I3OB 1SC4B 2HBRB 4ZVOB 1RWOB 2QLFB 2XYGB 1PAUB 1RWNB 1IBCB 1RHJB 2QLBB 2Y0BB 3RJMB 3R6GB 2QL9B 2C2MB 2HBYB 1RWKB 1SC3B 2XZTB 1GFWB 1RWVB 1QTNB 2H65B 4LSZB 2P2CB 2C1EB 1RWWB 3EDRB 3P45B 5K20B 4ZVPB 2FQQB 4DCJB 4DCPB 2H51B 2H4WB 3IBCB 3R7NB 3R6LB 3KJQB 3D6FB 5IC6B 3GJSB 2XYHB 2QL7B 1RWPB 3IBFB 2CJYB 2HBQB 2HBZB 2XZDB 2H5JB 2Y1LB 4ZVQB 5IC4B 2QL5B 2C2OB 4ZVRB 1RHUB 1RHKB 1RHMB 2C2ZB 4ZVUB 2H4YB 2CNNB 3SIPB 1RWXB 3GJQB 4ZVTB 2DKOB 2CNOB 4DCOB 1PYOB 1F9EB 1ICEB 3QNWB 3GJRB 2H48B 4JB8B 2CNKB 2CNLB 2CJXB 2XYPB 1RWMB 3D6MB 3P4UB 1QDUB 1RHRB 3R5JB 1RE1B 1BMQB 3D6HB 3GJTB 2CDRB 1RHQB 3NS7B 1NMEB 4ZVSB 1SC1B 2H5IB 3R7BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2K B;  1I51 B;  2H54 B;  3KJN B;  2QLJ B;  3EDQ B;  3KJF B;  3R7S B;  1I3O B;  1SC4 B;  2HBR B;  4ZVO B;  1RWO B;  2QLF B;  2XYG B;  1PAU B;  1RWN B;  1IBC B;  1RHJ B;  2QLB B;  2Y0B B;  3RJM B;  3R6G B;  2QL9 B;  2C2M B;  2HBY B;  1RWK B;  1SC3 B;  2XZT B;  1GFW B;  1RWV B;  1QTN B;  2H65 B;  4LSZ B;  2P2C B;  2C1E B;  1RWW B;  3EDR B;  3P45 B;  5K20 B;  4ZVP B;  2FQQ B;  4DCJ B;  4DCP B;  2H51 B;  2H4W B;  3IBC B;  3R7N B;  3R6L B;  3KJQ B;  3D6F B;  5IC6 B;  3GJS B;  2XYH B;  2QL7 B;  1RWP B;  3IBF B;  2CJY B;  2HBQ B;  2HBZ B;  2XZD B;  2H5J B;  2Y1L B;  4ZVQ B;  5IC4 B;  2QL5 B;  2C2O B;  4ZVR B;  1RHU B;  1RHK B;  1RHM B;  2C2Z B;  4ZVU B;  2H4Y B;  2CNN B;  3SIP B;  1RWX B;  3GJQ B;  4ZVT B;  2DKO B;  2CNO B;  4DCO B;  1PYO B;  1F9E B;  1ICE B;  3QNW B;  3GJR B;  2H48 B;  4JB8 B;  2CNK B;  2CNL B;  2CJX B;  2XYP B;  1RWM B;  3D6M B;  3P4U B;  1QDU B;  1RHR B;  3R5J B;  1RE1 B;  1BMQ B;  3D6H B;  3GJT B;  2CDR B;  1RHQ B;  3NS7 B;  1NME B;  4ZVS B;  1SC1 B;  2H5I B;  3R7B B; 
#chains in the Genus database with same CATH topology
 4K7Q A;  4M5H A;  2V34 A;  3DRS A;  3HHD A;  3BQ1 A;  3BR8 A;  1JLE A;  3B82 A;  4K5R A;  3I4H X;  1SUQ A;  4F7V A;  3J7Y I;  5DG9 A;  2IMO A;  3TW0 A;  3VQT A;  2VPZ B;  1NZA A;  5A8W B;  1Q8I A;  1FRI A;  5EWF A;  1FJ7 A;  2IBK A;  1RAG B;  2IC3 B;  1R0B G;  2BOA A;  4X4O A;  1DQ9 A;  2V4Q A;  2E1M C;  4JI2 F;  2W8K A;  5KG0 A;  5HRO B;  3ILO A;  3QLH B;  3G82 A;  2V6A A;  4JI3 F;  1IM4 A;  4DR3 F;  3SV3 A;  2YKQ A;  2HRT A;  4FZV A;  4D3H A;  4B9N A;  2XNR A;  2XS5 A;  5F9L A;  1YG0 A;  2C2M B;  4NRU A;  1YRU A;  5E3Q A;  1NDL A;  4OV6 A;  3QGH A;  3JYT A;  2R2T A;  4QCL A;  3KG0 A;  3EUN A;  3OXL A;  3W61 A;  3HZG A;  3AQP A;  3VHQ A;  1VBX A;  3JTO A;  4A46 A;  3KG4 A;  4LSZ B;  1WEZ A;  4I6Y A;  3UNG C;  1RWW B;  1L3T A;  1IR2 A;  3OSP A;  5K20 B;  1F5B A;  2DRA A;  1RT2 B;  4QJV A;  1T9W A;  2H51 B;  3PYD A;  1MU2 B;  1U4B A;  5CXT A;  1TAQ A;  4K4S A;  4YEA A;  1HQ2 A;  4DX7 A;  5KT2 A;  2ZH5 A;  4YB1 P;  4DL6 A;  3CJR A;  3QJP A;  2XYH B;  2XQC A;  4ZJO A;  3MAA A;  4V19 X;  2WW4 A;  1Y4Z B;  3FC9 A;  2MLY A;  3PHE A;  1GT8 A;  4K4W A;  5KT4 A;  1JXE A;  1NSK L;  3I0S B;  2MXY A;  2B7C B;  3J7Z 5;  2XM3 A;  2WTF A;  1TL3 B;  4F4W A;  5K9F A;  5D3G A;  4NLY A;  4CO5 A;  2VOD A;  4LFB F;  3JQK A;  5B08 A;  2IRX A;  1QD1 A;  2EFO A;  5T41 A;  4CM0 A;  2L08 A;  1VR6 A;  3PIP Q;  2QFJ A;  3OQ2 A;  1RHU B;  2OSQ A;  4NMX A;  3D1H A;  4DV2 F;  1HBN A;  3P5B P;  2JLE A;  4AQY J;  3PAC A;  2FVR A;  3C3L A;  3I6P A;  4NCG A;  2JEG A;  3MTK A;  2W4C A;  2GQ2 A;  3D1Q A;  3R3T A;  1FEE A;  1NUE A;  2X1A A;  4QR1 A;  2XGQ A;  2V2V A;  2U2F A;  1JKH B;  5GAG U;  3ET6 A;  5GAE U;  3EMT A;  4RUC A;  1N0U A;  3WHI A;  4EYI B;  2DIT A;  4C8K A;  1ZAV A;  1F60 B;  4ED5 A;  3QWU A;  4B9M A;  2IPO B;  2LU1 A;  2CQ3 A;  2CAD A;  3BSO A;  2PDA A;  2HIQ A;  2M4M A;  1AA1 B;  3MMJ A;  4CLP A;  2ZE2 A;  3E8O A;  5B0F A;  2HK2 A;  4WKY A;  1SL1 A;  2V94 A;  1U48 A;  4PEO A;  2ZJR Q;  1NO8 A;  3ET6 B;  1TP7 A;  3J80 U;  2YNF A;  4NCB A;  3DM2 A;  3MCS A;  2CNK B;  3C6T B;  5FDL B;  5H9F J;  3ZXW A;  5HVH A;  5KOX A;  4USU A;  5HP1 A;  3RB4 A;  3D6T B;  3UE2 A;  1J5O B;  3MM8 B;  2F9D A;  4RJV A;  2RH3 A;  1HNZ J;  4RW8 B;  3I9V 9;  2NXE A;  1UW4 A;  3TQE A;  3QYY A;  2V8P A;  3W64 A;  3OJS A;  2V2Q A;  3Q24 A;  4NLQ A;  2G0I A;  1SH3 A;  4NOH A;  2GFF A;  1G7C B;  3GB0 A;  2MHN A;  2W7O A;  2RRA A;  4DLE A;  1FXD A;  4XAK A;  3QJJ A;  4YFU A;  3HI9 A;  5AE2 A;  3UVJ A;  3JQM A;  2D9P A;  2Z0G A;  4AXI A;  2GVD A;  2IIH A;  2VH7 A;  5BYQ A;  4Y0F A;  3DRX A;  4LR9 A;  1SJR A;  1NHK L;  1NK7 A;  2B4P A;  4K4T A;  1FFS B;  1S1X B;  2BMB A;  5KFX A;  5DDP C;  2VUG A;  5LSO A;  2PA3 A;  3KHG A;  2ZH1 A;  1REV B;  3SZ2 A;  3CME S;  4TY9 A;  2QT7 A;  3HP6 A;  4FS1 A;  1RAH B;  2LXF A;  4WBF A;  1R8P A;  5ETV A;  3OBI A;  3UPF A;  3HVR A;  4B3T J;  3HZE A;  2D69 A;  2HQC A;  4IRK A;  1GH8 A;  3H25 A;  1YJU A;  4ZN3 A;  3IR7 B;  3H5U A;  2HGM A;  2RU3 A;  2E1P A;  3MEC B;  4EK2 A;  1MLA A;  4DUZ J;  1KOO A;  1VRU B;  4ZK7 M;  2NXJ A;  3WC2 A;  1K44 A;  2MKC A;  1NK4 A;  3N6N A;  2D74 B;  2DHX A;  4FNH A;  2MKH A;  1YX2 A;  1SJ3 P;  4ZVO B;  4DSJ A;  4W98 A;  2YWK A;  2DT9 A;  2YPZ A;  4P7T A;  4X84 A;  3AJ2 A;  3AQO A;  4NPO A;  4ZPV R;  1JLQ B;  2XZW A;  1S0O A;  2PMW A;  2B51 A;  4HKQ A;  4Y2A A;  4K2X A;  3BGR A;  4EWT A;  3RJM B;  3PHT A;  4BBY A;  1FKA F;  4B3T F;  2FYX A;  1A6L A;  3G8Q A;  4OV1 A;  1NB7 A;  5J2M B;  1HI0 P;  1RTD A;  4WU2 A;  4KY3 A;  2ZH6 A;  2XMJ A;  1NK0 A;  1QTM A;  1L3S A;  2F3J A;  2C42 A;  4ED0 A;  5HRO A;  3RB3 A;  1RAA B;  2JC1 A;  2ZBP A;  4F0M A;  1HHQ A;  3KUH A;  3TZX A;  1VQ4 S;  4NLG A;  3AB4 B;  2FLO A;  3CD7 A;  3OR1 A;  1FRX A;  3QFW A;  1BLU A;  4IFY A;  4TY8 B;  4CZC A;  3MUT P;  5L1I A;  1NK5 A;  4UOC A;  1BC6 A;  2HAI A;  3KDO A;  2E5L J;  2RQC A;  3QWP A;  4PUO B;  1S7I A;  4ZVP B;  4DR4 F;  2B4V A;  2OLW A;  1HW8 A;  3LUY A;  4QU6 A;  2EBE A;  3G6E S;  4DV6 J;  2RIJ A;  3RW7 A;  5IQQ A;  4EGL A;  2KXN B;  2LU2 A;  2Q6C A;  5IC6 B;  4X62 F;  2KVQ E;  1WF2 A;  3GSD A;  3RAX A;  4X66 J;  4DS4 A;  4WYL A;  2B6A B;  3U7J A;  5F0U A;  3KMS A;  4AFF A;  5GVQ A;  2AYG A;  4A8F A;  2XZD B;  3BPD A;  4LF5 J;  4CLF A;  3DN9 A;  3T9N A;  2BZ2 A;  2IM2 A;  4GKK F;  5L1K A;  4ANC A;  3DNC A;  2FHJ D;  4P2M A;  4RW6 B;  3K59 A;  3O2I A;  3MM6 B;  2HNY A;  1R0A A;  2UXB F;  4B3M J;  1SKS A;  2O1P A;  2X1F A;  2AYB A;  3CB4 A;  1RI7 A;  3DLG A;  3QAU A;  1SC6 A;  3RR8 A;  4IG3 A;  1KLN A;  1NCL A;  1SKU B;  2W9B B;  4AXJ A;  2CNN B;  1HBM A;  2ZD1 B;  2ASD A;  3C14 B;  2KFN A;  3FEY B;  2H1Y A;  4HH1 A;  3CJK B;  4HI1 A;  1WJ9 A;  2KKH A;  3IO1 A;  1CC8 A;  5BXI A;  2EK1 A;  2R8G A;  1TKX B;  5D8H B;  1RTJ B;  5J2N B;  4N5S A;  2BKP A;  1RBA A;  3CJS A;  3CJ0 A;  3GE9 A;  4N47 A;  1F9E B;  5HSP A;  1FDN A;  5DGA A;  3RB6 A;  3LP0 A;  2O67 A;  5J2P A;  3PYE A;  2O5D A;  3BRE A;  1AYE A;  3NCP A;  4P73 A;  2IVF B;  1IM6 A;  4C0B A;  1FDD A;  1IR1 A;  5DM7 Q;  4OYW A;  4WFA Q;  1D8Y A;  1HWI A;  2OSR A;  4TQS A;  2EFG A;  4DFP A;  2QG9 B;  1JLF B;  1F9F A;  4M95 A;  1R6Y A;  2Y1I A;  5IXU A;  3D6M B;  3B6B A;  3SFG A;  3W7B A;  4ZJL A;  4KKO A;  3JSM B;  1TL3 A;  5D3G B;  4B9T A;  1MMN A;  3T1A A;  4EI2 A;  1HD1 A;  2CQH A;  3MM7 A;  3QZ7 A;  3G86 A;  2DIV A;  2HVE A;  1VOM A;  2YNI B;  3KLH B;  4GKJ F;  2XI2 A;  1FRM A;  1TMJ A;  3HHL B;  4HR2 A;  4OI4 A;  4P7V A;  4P71 A;  5DRK A;  3HMJ G;  4OYA A;  2ZOG A;  3B54 A;  2YQ3 A;  1F5C A;  4KHM A;  2W24 A;  5K5M A;  4ZMM A;  3NAI A;  1KOH A;  2AJ2 A;  3C6U B;  1BWV A;  2H5I B;  1HBU A;  4OYX A;  2VFT A;  3HUL A;  4N77 A;  3PX4 A;  2EKN A;  4FF2 A;  1T9X A;  3BGF A;  4URS A;  4AL6 A;  4WPA A;  2PFD A;  5M2P A;  3RW6 A;  3MM7 B;  3MPU B;  4Q45 A;  4P72 A;  4PR6 A;  4U7U K;  5EGY A;  2VQF J;  4BLG A;  3M9O B;  2DCL A;  5DDQ C;  2KFY A;  3X3U A;  5HLF A;  4ILM A;  2NUU G;  4PPZ A;  4J9Q A;  4EO8 A;  1I51 B;  2MKS A;  1RXO B;  1PYS B;  4DLG A;  4I6W A;  3QMQ A;  2I6W A;  2UU9 F;  4PXB A;  4Y2K A;  2WZ1 A;  3UDC A;  3EGN A;  3ZZO A;  1VIX A;  1NJY A;  1IKW A;  1RTH A;  3CJ4 A;  5HAT A;  2AJ1 A;  1DTT B;  1V5I B;  3P3D A;  1P1L A;  3IG1 A;  2V67 A;  3V2U C;  2XMU A;  4PG8 A;  2HFZ A;  3W65 A;  1P9Y A;  3GYX B;  3FK4 A;  5F0W A;  5HL7 Q;  2PEB A;  3HD2 A;  1TKX A;  2D9O A;  2Y3Y A;  3I82 A;  3QGG A;  4NEY A;  4TYB A;  4UT4 A;  1QAY A;  2KM8 B;  3PR4 A;  2EG2 A;  5CQG A;  5CD4 A;  1NDP A;  1QSY A;  3OVB A;  3W8P A;  2IC3 A;  1X4G A;  1Y9O A;  4ZPD A;  4IYQ A;  2JWN A;  1RWV B;  2J6S A;  4IR1 A;  1LXJ A;  1FES A;  2DNP A;  2V50 A;  2A10 A;  2QGF B;  2AX1 A;  2PMH A;  4KBI A;  4RKU C;  2MGZ A;  1LWE B;  2LKZ A;  2QV6 A;  4E8U A;  4ZP8 A;  2RDD A;  3I0R A;  3HHE A;  1KHV A;  4ED2 A;  5CD4 H;  1S0M A;  3PW4 A;  5EX0 A;  4UY8 T;  2OFH X;  2Y0S D;  4I2Q A;  5HMY A;  1OO0 B;  1J5E F;  4PG5 A;  3H2V E;  4FF4 A;  5ETL A;  3IRX B;  2NPF A;  3CD0 A;  1R0A B;  4FYV B;  4KHR A;  3TI0 A;  4WZM A;  1D9F A;  5J2P B;  5LL6 d;  1SL0 A;  3ZC4 A;  1M5S A;  3NGR A;  1LFP A;  3J81 j;  2DEI A;  3HVT A;  5E7O B;  3PKM A;  4I67 A;  3FSY A;  1VCT A;  4ZPB A;  5F8J A;  3MR2 A;  2B8Q A;  2RJZ A;  1S49 A;  3KK1 B;  4LRF A;  3BR9 A;  2OTJ S;  1U0H B;  2J5A A;  1TFW A;  2B6A A;  4LRD A;  5EWG A;  3W2W A;  3DOL A;  3EXC X;  1H2T Z;  3VGU A;  3C66 A;  5D77 A;  5ETT A;  3ZNJ 1;  2J9E A;  2ZFH A;  2R7Q A;  3GIL A;  4Z7Y A;  1DY3 A;  1R43 A;  1X0F A;  2R7U A;  1S9E A;  3GTY X;  3PRD A;  2CPD A;  4XO0 A;  2HLU A;  1R89 A;  1RKI A;  4OL8 A;  5KFA A;  1NB2 A;  3SV4 A;  2NSB A;  2QA1 A;  2HRY A;  3BDE A;  3DMJ A;  4N56 A;  3KLE A;  4L72 B;  1HYS A;  4WF9 Q;  1YQH A;  2NLW A;  2QYC A;  3NEK A;  3GJQ B;  4Y2I A;  4EFA C;  4NLV A;  1RTD B;  2Q1L A;  3QSY B;  3BKU A;  3V4M A;  3PYG A;  3BGR B;  1C1B B;  4FDF A;  2ZKU A;  4UW2 A;  1N88 A;  2K3I A;  2RS2 A;  1V3S A;  1SI9 A;  4L73 A;  2AP6 A;  2Q6B A;  2IM1 A;  4ED7 A;  3PXG a;  4U8V A;  4C97 A;  5GMK a;  3TAM A;  2ZUG A;  1XMO J;  2HYI B;  4C8O A;  1HNV A;  3G82 B;  1ICE B;  2DIS A;  1RAJ A;  1VQ6 S;  1RLC L;  2VC0 A;  3IWL A;  3HVW A;  5JXS A;  4GRS A;  4DFM A;  1S1W B;  2CJK A;  3P8B B;  4DPW A;  4RO0 A;  1Q5Y A;  1C1B A;  2E66 A;  2OAU A;  1GMW D;  1RAC B;  2KXH A;  3DLE A;  1I5O B;  4FXV A;  1N32 F;  2XSJ B;  1WG5 A;  4FYW B;  3MR7 A;  2UXD J;  2VPX B;  1FRL A;  4ICL A;  5F9N A;  1N5Y B;  2IAJ B;  3RBE A;  5A0Y A;  3MEC A;  4WIQ A;  3VZI A;  3TAQ A;  3DC2 A;  3DRS B;  4RBV A;  4Y3C A;  1I94 F;  1RHQ B;  4TLQ A;  1S9G A;  1EP4 A;  3MMC B;  4OI1 A;  4QPX A;  1Y5N B;  2CJA A;  4G1P A;  4IFV A;  2ZNZ A;  4J90 A;  3M9N B;  2DCU B;  5IV3 A;  4I2P B;  4KRW A;  4C9D A;  1CQN A;  4I69 A;  4EZ9 A;  3L3C A;  3A12 A;  4ZS6 A;  5KFW A;  4RPF A;  5U47 A;  1YZ6 A;  4K4V A;  1RT4 A;  1PC4 A;  3GSI A;  3I96 A;  3WBZ A;  1ROF A;  1IJF B;  1LQ9 A;  3CNQ P;  4F3Q A;  5C2C A;  3V4I B;  5H9F K;  4J9K A;  4Y65 A;  3SBM A;  5IZH A;  1N5T A;  2OPP A;  4WP3 A;  2V8D A;  1J5O A;  3HKW A;  3H5X A;  1X4D A;  4CIO A;  4YN3 B;  1SJ4 P;  4W92 B;  3J7A N;  1SC4 B;  5KT3 A;  2FTR A;  1CC7 A;  3HSZ A;  4IG0 A;  1X4H A;  4FPR A;  4UQG A;  3J7Z T;  2F8M A;  2WON B;  3DRP A;  3R2C J;  4NL5 A;  3W5X A;  3K5P A;  3T5K A;  3DKD A;  2XYG B;  5HQ8 A;  3ZZU A;  4OZL A;  1V3R A;  4PQU A;  4WP9 A;  3OXG A;  3EGV A;  4FN5 A;  5D15 A;  3NMA A;  4J91 A;  2ZZM A;  3TJA A;  2PMZ D;  2HAF A;  2ZEJ A;  1SH2 A;  3VTI A;  3M1V A;  1KVJ A;  2C2E A;  1N5V A;  4ES3 A;  2YPY A;  5I3Q A;  1GK8 A;  1T02 A;  4ZCK A;  3HJF A;  4ID5 B;  1WOP A;  2E7V A;  1SH0 A;  5K8M A;  2WCX A;  1LK5 A;  3LF0 A;  3O44 A;  5B0B A;  4FF3 A;  4F3M A;  1RAF B;  1PJ5 A;  5HQL A;  4B3R F;  2H9Z A;  3W60 A;  2UVR A;  1VQS A;  2OUG A;  2B8P A;  1RAO A;  2RD5 C;  4MT1 A;  4OX8 A;  3AY0 A;  1VRU A;  3BKF A;  4P9S A;  1CSJ A;  1X7V A;  5E3A A;  1WF0 A;  3AD7 C;  2FQQ B;  1HNI A;  1B0T A;  4UST A;  3BO2 A;  1KQG B;  4DCP B;  2IM3 A;  5A8R B;  4WKR A;  2BRK A;  1N5Q A;  2EC2 A;  2LP4 A;  3BYR A;  5HVG A;  3CCW A;  1UCN A;  3D67 A;  1DHM A;  3H0P A;  2WK4 A;  5D6G A;  4MKB A;  1ZS6 A;  4ZLP A;  1UVL A;  2HWH A;  4KGX B;  5KG7 A;  3KOA A;  4RUA A;  3NOC A;  2RKI A;  3M2U A;  2YKP A;  3A8J A;  4X64 F;  1KQS R;  1K73 T;  5AXM A;  2G1H A;  3OVS A;  3MDF A;  4Y6I A;  2V9K A;  4C2M A;  5K8O A;  3BDP A;  3KJV A;  2BRL A;  1T9V A;  2DHG A;  4IO1 A;  3EX7 B;  2I1R A;  1U0S A;  2L9N A;  1OJ4 A;  2IRU A;  3R9L A;  2HHT A;  1OQ3 A;  2B4U A;  2EFQ A;  4M63 A;  3VAL A;  4B3S J;  2GAG C;  4ZVU B;  2VV5 A;  2G1D A;  1N33 F;  4ATN A;  1TKZ B;  4WWS A;  3GYN A;  4JBC A;  2I2Y A;  1S0V A;  1HA1 A;  3N4W A;  4I2P A;  3GR1 A;  2NR0 A;  2B9Y A;  2D7S A;  1D8Z A;  3HHL A;  3SCI E;  3OTC A;  4F8R A;  3GU0 A;  2HQI A;  2L41 A;  4F50 A;  1FX4 A;  4H4M A;  1FTR A;  1HNW F;  3CO0 P;  4KPC A;  1JLF A;  4MKY A;  5IT9 U;  1FRJ A;  2VZ9 A;  2KT5 A;  2DYA A;  4OZJ A;  1WSR A;  1BUX A;  2J7K A;  1KD1 T;  4IO9 Q;  2DH7 A;  4CNZ A;  4ZHR B;  4O0I A;  1UVI A;  2AEM A;  5HN0 A;  4N41 A;  1F3F A;  1NEE A;  2AYE A;  1FJG J;  2MZR A;  3QIP A;  3ISZ A;  1XJW B;  3CDB A;  3JS9 A;  2E9T A;  2YNH B;  3AOC A;  1RTJ A;  5J2N A;  2F40 A;  3ETO A;  1IKY B;  3KUE A;  1QE1 B;  1YJW S;  2BYC A;  3CCV S;  2VKZ G;  2XS2 A;  2F4F A;  2GGP B;  2IVY A;  2ROE A;  2JNJ A;  3UWT A;  1L3K A;  5E2Q A;  1VMB A;  5HMX A;  2ZHB A;  1FD8 A;  3VV2 B;  2K2P A;  3N6L A;  4I64 A;  2AF6 A;  4QWC A;  2AJQ A;  3GJT B;  1RAD B;  1PCA A;  3NS7 B;  4FYD A;  1O0P A;  4DPY A;  2HMI A;  2LA4 A;  1B4S A;  4CLS A;  2VFR A;  1Y11 A;  2ZKT A;  5DG8 A;  1QAI A;  3J7A 1;  1S76 D;  2EW9 A;  2BM0 A;  1Q5V A;  3D3B J;  4HAC B;  3H90 A;  2XUL A;  4IH5 A;  4LT6 A;  3SCK E;  1HI1 A;  3VAF A;  2IJR A;  3FBF A;  1OPZ A;  4ZIT A;  2F1F A;  4P10 A;  3GIJ A;  3G6Y A;  3C2P A;  4YME A;  2OHD A;  1T9U A;  3NGD A;  4DR5 F;  3RYL A;  1T9Y A;  1J2V A;  2KDO A;  4LVO P;  3UNY A;  2CPF A;  5L1J A;  1S6U A;  3N9U C;  3RR7 A;  4ER8 A;  4CLY A;  2MTL A;  1HMV A;  5HK4 A;  2VG7 B;  5AXK A;  3J80 Y;  1T3N A;  2FVC A;  1RWO B;  4LF6 F;  3DU6 A;  4Q2M A;  5ETS A;  4CI0 B;  4YY3 J;  1HHS A;  3MWB A;  3PY8 A;  2RNE A;  2VD3 A;  4J9M A;  5LJ5 Y;  1U1R A;  2EFP A;  4EBD A;  3MI7 X;  3IS9 A;  4JV0 A;  4DQI A;  2IY5 B;  2HS3 A;  1RUS A;  4A8M P;  1YHQ S;  2BJ1 A;  1P27 B;  1VQ9 S;  3U1N A;  3K8V A;  2W9A A;  1U6F A;  2OEL A;  2JC0 A;  1QVG R;  4OYI A;  4H54 A;  2MST A;  1UTA A;  3OR1 B;  3KK2 B;  2GO8 A;  3CUL A;  4EBC A;  3T1H J;  2JLF A;  3CGI A;  3NXZ A;  4DSE A;  4UF4 A;  1KP6 A;  2EG1 A;  4IH7 A;  4URQ U;  4ED4 A;  4LFB J;  2OPR B;  5E5N A;  2PO4 A;  1KTQ A;  5A8K B;  4DX8 H;  4DUZ F;  5J2M A;  1UZH A;  2J0S D;  2PFF B;  2DPI A;  3OFH A;  3DMJ B;  5KG3 A;  4M94 A;  3PVX A;  2DRB A;  2BV3 A;  1FWL A;  2ZM6 J;  1YJ9 S;  1XK8 A;  3SFU A;  1HW9 A;  3B4D A;  3CCS S;  3IM9 A;  1P1T A;  2YKO A;  1FX2 A;  3ENQ A;  3NY0 A;  5K8P A;  1CJU A;  4NXN J;  3FNN A;  3ITH A;  3SDE B;  4ZCM A;  4N76 A;  4OI0 A;  2HBZ B;  2FJV A;  4P6Q A;  4IDK B;  1C4C A;  5L46 A;  2QX0 A;  4A8Q A;  4B3O B;  4DL3 A;  4J9R A;  2W2Q P;  1HQU A;  3BYP A;  2D1C A;  1HBO A;  4I68 A;  3MCO A;  4M5I A;  4CTA B;  1HQE B;  3NS5 A;  2FGC A;  1FHT A;  5DO2 A;  5DDO C;  1VI7 A;  4LIW A;  2C3O A;  3L7O A;  5JMN A;  4LF7 J;  2ZHA A;  1RT3 A;  2HFS A;  4CT9 A;  1RHK B;  3DU5 A;  2OPS B;  3Q89 A;  1RLD A;  4OZ5 A;  4HEA 9;  2A6O A;  2CPX A;  2CQ0 A;  1URR A;  2CKW A;  4ZP6 A;  4RBT A;  3ZTO A;  4LRE A;  5L39 A;  2LEA A;  5IWA J;  2H3E B;  4JI1 F;  5DDR C;  4RW8 A;  4H4K C;  2OJ3 A;  1UVM A;  1IWA A;  1NBE B;  3DDI A;  3G2X A;  1T7P A;  4FBU A;  4OHY A;  2IFX A;  2Q43 A;  1OIA A;  3FSX A;  4A8W A;  1PYO B;  1FDB A;  3FEZ A;  4IRC A;  3L9Z A;  2XMV A;  3GIM A;  1O51 A;  4EO6 A;  1TK5 A;  4KTQ A;  1QE1 A;  1VDH A;  3DOK B;  2Z30 B;  4DUT A;  2QFI A;  4J5O A;  1UEK A;  4CYU B;  2VQE F;  1HFE L;  1LV5 A;  2XEX A;  1CBK A;  4ZVG A;  4DUY F;  1JJ2 R;  3HX9 A;  3NGU A;  4F04 B;  2XYP B;  4JYA J;  2V2K A;  1FRK A;  1SL2 A;  1RT7 B;  3D54 A;  4CLU A;  1FTC A;  3QSI A;  3T6J A;  3MXH P;  4DV3 J;  1KVI A;  2XMK A;  3OXF A;  4JV5 J;  1EET A;  4OLO A;  2J8S A;  5KFK A;  1KSP A;  1IBM F;  4F02 A;  2GJF A;  4WP8 A;  1AW0 A;  5ITH A;  2XWX A;  2VIC A;  2DIU A;  4ECU A;  2PII A;  1TAU A;  1PBA A;  1DRZ A;  3PDN A;  1YSJ A;  4ZVE A;  1JMT A;  5RUB A;  1FF2 A;  2EK6 A;  4WTY A;  1U2R A;  3BSC A;  3RRH A;  5CYM A;  2G4B A;  3VF0 B;  4YB6 A;  1VBZ A;  1SV5 A;  5LMN J;  1CJT A;  1IJE B;  1SB6 A;  1I6J A;  3QRP A;  1LWF A;  1CJK B;  3M2V B;  4UY8 5;  1XC9 A;  3Q2S C;  3NMR A;  1KQK A;  4I4B A;  3H2L A;  2LLZ A;  4XDC A;  1TZ0 A;  2MZJ A;  2CQB A;  1UWB B;  2DB1 A;  2H54 B;  2LEP A;  3E51 A;  4UUW A;  2HFO A;  3I0S A;  4Z2X A;  4RU2 A;  5AXL A;  2UUC F;  5KOW A;  2UVW A;  3VZH A;  1Q1K A;  1HQE A;  3QQC D;  1C0U A;  1VBK A;  3G6X A;  1UFL A;  1TL1 B;  4QR2 A;  5KFO A;  1GMU A;  5GAH U;  3MEE A;  1WC5 A;  1TUW A;  2DBB A;  1C4A A;  4CH0 S;  3EVO A;  3QZ8 A;  2BEF A;  1XNR J;  2E9R X;  4B17 A;  3WC0 A;  4I0W A;  3P6Y C;  1RBO B;  1VHF A;  4KKO B;  2DHS A;  4K59 A;  4NML A;  4CO3 A;  3R6G B;  2BE7 D;  3I31 A;  1JLB B;  2M5Y A;  2E7X A;  2VF3 A;  5CZX A;  2I5J B;  3OL8 A;  5DG7 A;  4Z7C A;  1TL4 A;  3OD2 A;  2BAC A;  6AT1 B;  5H9E J;  3MR6 A;  3MCM A;  4IUF A;  4OI6 A;  1EAR A;  1UET A;  4JI8 F;  2V8V A;  2R7O A;  2VQE J;  2FLL A;  4CO4 A;  4F4A A;  2YH0 A;  2J6T A;  1WC1 A;  2XG8 A;  3KK3 B;  4LBP A;  1WI8 A;  1CUL A;  2Z58 B;  5G4D A;  2VA2 A;  1YIT S;  2HG4 A;  3CCZ A;  3CT9 A;  3D7S B;  3LOU A;  4KYZ A;  4F36 A;  3FVY A;  1TEL A;  3NCR A;  4RNM A;  4DCJ B;  1DLO B;  1Q7Y T;  4GKJ J;  3P49 B;  3J81 U;  4LR7 A;  2DEJ A;  1CVJ A;  2F7V A;  2AWZ A;  3KJQ B;  2LEB A;  1S97 A;  4YB5 A;  4ZCL A;  3IWN C;  2LQ5 A;  1RTI A;  1RWP B;  3FZ2 A;  4HL9 A;  4BHQ A;  1RIS A;  3IR6 B;  3OTO J;  1YK9 A;  3G6V A;  1SUQ B;  1NJW A;  4PWD A;  2YKN B;  4IG3 B;  3N79 A;  3OR2 B;  4NCA A;  3RG6 A;  1WHX A;  3GCX P;  8RUC A;  3EPG A;  1VRT B;  4P75 A;  4ZVQ B;  2OEM A;  2DHH A;  4EUV A;  2K06 A;  2LA6 A;  5F8M A;  3POT B;  2HFU A;  5C2G A;  3PO4 A;  4ZVR B;  2G2Z A;  2DY9 A;  3OFG A;  1Q0N A;  1VBY A;  4K5S A;  5D0G A;  2LVW A;  2UUC J;  3I9Z A;  3MPD A;  2UVU A;  4YOE A;  4PG4 A;  2MQP A;  4DQR A;  2M7S A;  2W8L A;  4PWU A;  2FZG B;  2IVM A;  2MB0 B;  3MMC A;  3M6W A;  4GVB A;  4QIW D;  3OT9 A;  4LMZ A;  1VRT A;  2A0F B;  2J9C A;  3EVM A;  1IKV B;  5SUH A;  2DK2 A;  3EXY A;  4RLE A;  2CQ4 A;  2YKN A;  3WQP A;  2UU9 J;  1K9M T;  2YX4 A;  2CNO B;  3W2V A;  1F2G A;  3EIC A;  1R8C A;  5DM6 Q;  2FVS A;  1K0T A;  3PEH A;  4LF9 J;  2VBW A;  1U02 A;  2BVZ A;  5GAG I;  4P74 A;  2B9X A;  2DGU A;  1X4A A;  2HS4 A;  4EU0 A;  2N3O A;  1WOR A;  2Z56 B;  3L09 A;  2OPR A;  1GTE A;  2FJD B;  4MMO A;  1NDK A;  4OHZ A;  4AD6 A;  5HO4 A;  2GHW A;  5FLX U;  3KHL A;  2YKA A;  4WU3 A;  1Q82 T;  5CCL A;  5DQI A;  1QVF R;  5HJX A;  1VC5 A;  1HNZ F;  4UZB A;  2QLW A;  2CQG A;  1V3Z A;  3IAS 9;  1V9O A;  1X4F A;  3KK3 A;  3HJV A;  4PAB A;  4X62 J;  4NEZ A;  3MUM P;  3KLG A;  3HPO A;  4F2S A;  3M8W A;  4O3R A;  5IT9 Y;  2ASY A;  1RQ0 A;  3FKB A;  5HMW A;  4ZIW A;  1YIJ S;  1DLO A;  1SIW B;  3W63 A;  1WG1 A;  4MFB A;  1RE1 B;  4LQ9 A;  2OI2 A;  1JLE B;  4LF6 J;  2VON A;  1N36 J;  3CCJ S;  2CDR B;  4ETX A;  4UUX A;  3TYT A;  3BGU A;  2F4V F;  2E1R A;  1R6V A;  4B3M F;  1YBA A;  5C5J A;  1X4E A;  4F4Z A;  3UFC X;  5DGB A;  4R0J A;  4C8L A;  1Q4R A;  2FY8 A;  2ZHO A;  2CVE A;  5CH7 B;  1FVQ A;  2NSC A;  3W66 A;  2JH3 A;  3FZB A;  4CM2 A;  2W2M P;  2ZDO A;  3M30 B;  1M5H A;  4DPT A;  5FLX Y;  3MFH A;  3L7P A;  1EX8 A;  1WC3 A;  3N5F A;  2GS8 A;  4HH0 A;  3PM9 A;  5B0A A;  3CJ3 A;  2B5J A;  4PYA A;  5KFG A;  3TRG A;  1YZ7 A;  4DBQ A;  3OL6 A;  4DV2 J;  3O3L A;  4M5D A;  2YWE A;  3QJL A;  1JQG A;  1MG7 A;  1GEH A;  4PQA A;  3CCM S;  5I42 A;  2AGQ A;  2HBR B;  2DNH A;  3CC2 S;  1AFI A;  1DAR A;  5F8L A;  2FHO B;  2JLG A;  1LWE A;  2KHD A;  1LW0 B;  2CQC A;  2H5E A;  1RT1 A;  3IAM 9;  4USM A;  4MKV A;  2Z2Z A;  2WVD A;  3K57 A;  4JV2 A;  3MAA B;  4NRT A;  2NZ4 A;  2UUB F;  4OHW A;  2YNF B;  5B0C A;  1N5Y A;  2HHP A;  4K0K F;  4OJH A;  3FBC A;  3GV5 B;  2VPW B;  3PW7 A;  1LNQ A;  1D09 B;  3UN5 A;  4ZP9 A;  1MU2 A;  1SVD A;  2HBY B;  2QE5 A;  3IA0 A;  4NI2 A;  3T41 A;  3OUY B;  2FLN A;  1VFJ A;  4GC7 A;  5HP1 B;  1QTN B;  5KFB A;  3B78 A;  3ISN D;  2XI3 A;  3A4T A;  2OIH A;  3MEK A;  1FT8 A;  4WTO B;  4F4Y A;  1EIY B;  1UPP A;  2MHE A;  1IKY A;  4PRF A;  2PA8 D;  4Q43 A;  1S57 A;  3CVK A;  2YVS A;  3IGN A;  4CLK A;  2YNH A;  1FDA A;  2BE9 B;  2H4W B;  2FHK A;  1T03 B;  3KTQ A;  1ZET A;  3VQS A;  2B4O A;  3AA8 A;  3J81 Y;  1T8E A;  4DU8 A;  5KFN A;  3PIO Q;  1NZ8 A;  1RTZ A;  4KV8 B;  1U26 A;  1U2F A;  4W4M A;  4MYT A;  3AXM A;  4RX6 A;  3F41 A;  4RW7 B;  4O4G A;  5IM0 A;  1NHV A;  1IBK J;  4ZOS A;  2JZ5 A;  4RL1 A;  2R2U A;  2H5J B;  2K7K A;  2J0Q D;  3DOK A;  1FXR A;  2N4D A;  5L9N A;  4X4S A;  1N48 A;  1XMQ J;  3IWX A;  1HBU B;  1SCJ B;  2HS0 A;  1KEK A;  3KJV B;  2ALY B;  3DLG B;  2OPP B;  3KDN A;  4DMZ A;  1NND A;  3NLC A;  3PJ9 A;  1X4C A;  2Y8Y A;  1NDC A;  3OHA A;  1APS A;  1Z2L A;  2NYI A;  2C2Z B;  2CG8 A;  2YWW A;  3DLK A;  4NE9 C;  4N7T A;  2ZWP A;  1QJH A;  5I3U A;  5BYS A;  4Q7A A;  2VFU A;  2EXU A;  2O01 C;  4RW4 A;  2R8I A;  3G4S S;  2MZT A;  3NBP B;  4OX9 F;  3SDE A;  1U49 A;  2E44 A;  1N0V C;  5F8H A;  2L9W A;  5KG5 A;  3UI3 A;  4DS5 A;  3QGP A;  4LIR A;  2EVZ A;  4CTA A;  3P96 A;  2UV8 G;  2J9D A;  3M05 A;  4O44 A;  3WDO A;  5AE1 A;  2BQU A;  1OYD A;  1Y7P A;  1ARO P;  1EZZ B;  3CSK A;  1T05 B;  4U7U D;  3EJM A;  2VFV A;  2NRE A;  4NLP A;  3QT6 A;  1B0P A;  1ZBT A;  2GIQ A;  2QLX A;  2VFS A;  5ETP A;  1NSQ A;  3CTR A;  3BJY A;  4MAK A;  3U27 A;  2LQ9 A;  2PT0 A;  3C19 A;  2GW8 A;  1K1Q A;  3E01 B;  5KFP A;  3CCE S;  1AUS L;  2UUW A;  4KE5 A;  3AA9 A;  1UKU A;  4TKT A;  4JV1 A;  4Q0B B;  2R7T A;  2J76 E;  1FVS A;  3VAJ A;  1FJG F;  5A8K A;  1TK0 A;  4NI2 B;  3CJT A;  2HQ3 A;  1NJZ A;  1RYS A;  3D1O A;  1X31 C;  1RAE B;  1OY6 A;  4RWW A;  3JAM U;  2IYG A;  1WHV A;  2YNG A;  3S6E A;  3I5A A;  3KWM A;  5A8W A;  2GQC A;  3NWG A;  4CO1 A;  1TKT B;  2WOM B;  4DV1 J;  2QIF A;  2DNN A;  3EGW B;  4NLX A;  2KHC A;  2VA3 A;  1TL7 A;  4LFC F;  4YR3 A;  1MWY A;  1N5S A;  3MM6 A;  3LGM A;  3O6Q A;  4OMF G;  2F9J A;  2OO4 A;  4BS2 A;  2RF2 A;  4G3I A;  2DR6 A;  2MKK A;  2MZQ A;  1GX6 A;  5DLF A;  3QFH A;  1KBR A;  2YKM A;  4B3S F;  2RQ4 A;  4QIE A;  2AHO B;  3H42 A;  4KO0 B;  5DS7 A;  2R2S A;  1ELO A;  1N54 B;  4IFV B;  2UXC J;  1KR4 A;  5KFH A;  3KK1 A;  1R0C B;  4LF9 F;  3TJ9 A;  1NHU A;  3KLF A;  2KJV A;  2ASJ A;  1EQM A;  1RAI B;  1RT4 B;  1BQM A;  3MCN A;  3UR0 A;  1RCO B;  1XR7 A;  2R7R A;  2NXC A;  1H2U X;  2AX0 A;  1Q78 A;  2DY1 A;  4O3O A;  4HT5 A;  4LF4 J;  2KVI A;  4OYP A;  4DV7 F;  2N82 B;  1X5P A;  3RAM A;  4I7F A;  4HYK A;  4ECY A;  1VC6 A;  1SKR A;  3V6J A;  3FCW A;  4NYP A;  2K1R A;  1NSP A;  1FKP B;  3ONQ A;  2DR9 A;  3TNV A;  4J37 A;  4CH7 A;  3VGV A;  3S01 A;  1SPB P;  1WG4 A;  3DFE A;  1KN6 A;  1F6T A;  4WFX A;  1P6T A;  2GAH C;  4KH1 B;  1UFK A;  3NGS A;  3CPW R;  1U1M A;  1TKD A;  4KR0 B;  2MSS A;  1ZPW X;  3G8T A;  2XSJ A;  3T9Z A;  1JLG B;  4DL7 A;  4LSN A;  4OZ0 A;  2B3T B;  4HHU A;  2E5J A;  2W2O P;  3JTN A;  3TA2 A;  3OTE A;  4ZPA A;  3DHW C;  4QWD A;  1U45 A;  4MK7 A;  4U96 A;  9RUB A;  2DNG A;  2QC3 A;  5M2R A;  2COL A;  3HFZ B;  2GMH A;  4ZLL A;  1DJ0 A;  4YR2 A;  3AD8 C;  1MSW D;  4B9S A;  2MKY A;  1TQL A;  5L9X A;  2VBX A;  5JJB A;  1QSS A;  2ABY A;  3M2R A;  4DQP A;  1VQ7 S;  3WIU A;  2VG6 B;  2E5L F;  1UW9 A;  4DR4 J;  3W2V B;  2NXN A;  5LMN F;  2I5J A;  3H8Y A;  4X4T A;  5IC4 B;  4E0D A;  1F5A A;  1DAX A;  2RHS B;  3CW2 C;  1RYR A;  2VC1 A;  6FDR A;  3BQ2 A;  3LO3 A;  1ZOT A;  2HK3 A;  1GX5 A;  1VGY A;  4NAS A;  4TN2 A;  2C2O B;  3M8P A;  2PI4 A;  4DR6 J;  1XEZ A;  3TJ8 A;  2UUA F;  1B7F A;  5KT5 A;  1KHW A;  2RS8 A;  2CYY A;  3TVY A;  5LMU J;  2GVD B;  1X5T A;  4W90 B;  2RUG A;  3U02 A;  3SIP B;  2AEF A;  1JB0 C;  4OIX A;  1BHN A;  1X8D A;  2W9C B;  2FLP A;  2CJQ A;  3LQV A;  1N6Q A;  2MQN A;  3DGV A;  2R8H A;  4OLP A;  1RSC A;  2M8H A;  1DBD A;  2V69 A;  4NLS A;  4DQS A;  3OL9 A;  4K2J A;  4ERD A;  4AUK A;  2AYM A;  3DHX A;  1H3D A;  3FCV A;  3I0R B;  2WB1 D;  1P9Q C;  4OJ3 A;  5D4N A;  5F3T A;  3UR3 C;  1FO1 A;  3D3C J;  4YY3 F;  4OZ1 A;  1PC5 A;  1VLO A;  2BDP A;  4KJI A;  3SI8 A;  4X4N A;  1SQE A;  2VBZ A;  1W7W A;  2MYF A;  1S12 A;  5FDL A;  3N01 A;  3T6B A;  4UOG A;  1XQI A;  3VR1 A;  2EWH A;  2RDI A;  4JI4 J;  2NQP A;  3D5M A;  4RW7 A;  5FJ4 A;  4KC5 A;  2HRU A;  4CLT A;  3BO3 A;  2UXD F;  3M8P B;  2WVF A;  2HVI A;  2A3J A;  4V19 J;  3CJ5 A;  2ZE2 B;  3BQ0 A;  3MFI A;  1RGV A;  1T03 A;  4ED8 A;  2ZUA A;  1E6Y A;  4G1I A;  4ES1 A;  4L6V 3;  1HNI B;  1N8R T;  1VQP S;  3R5J B;  3FFI B;  1YTY A;  1KFD A;  2DH8 A;  1WEX A;  2IBO A;  2APO A;  3PR5 B;  1S10 A;  2DGW A;  2AJ4 A;  1R7I A;  4ELT A;  1BMQ B;  4CT8 A;  1EB0 A;  1OWX A;  1TL5 A;  2KT3 A;  4GMK A;  2Z8Q A;  4G6V B;  2CAJ A;  2R7V A;  3W5Z A;  2MDA A;  3PYF A;  2EC0 A;  3O1L A;  4I6A A;  4ZDN A;  2LQJ A;  2FZK B;  2ZOM A;  1TMM A;  3OPK A;  2JFK A;  3PJX A;  2DR5 A;  1S6O A;  4LSN B;  2FJX A;  5F8G A;  3KNG A;  4DUY J;  5KFQ A;  4JI7 J;  1CPZ A;  3VAG A;  3RBX A;  5D0E A;  5EX3 A;  2PGC A;  4R5P B;  2BJE A;  2CPY A;  2HVZ A;  1KNZ A;  1GXT A;  4YR0 A;  2Y9H A;  3PX0 A;  2BAN B;  1RT6 B;  2CPJ A;  2WON A;  1I3O B;  3HDS A;  4DPX A;  1PJ7 A;  1VK8 A;  5E3P A;  1UJ5 A;  4CRJ A;  3GP9 A;  3M8R A;  3MR5 A;  3NNH A;  2O3D A;  4H4K A;  2D3Z A;  1Y10 A;  2W1B A;  1OSC A;  3CDA A;  2C22 A;  3PNI A;  5B0E A;  4AYB D;  3NRB A;  2W9C A;  3K58 A;  3DDK A;  1KC8 T;  5I4M A;  3MEG A;  4DI6 A;  3D9B A;  2O66 A;  1HNX J;  3DRR A;  2VU5 A;  4RBU A;  5HI7 A;  5C24 B;  1NU4 A;  1WOO A;  2QZ8 A;  2CUY A;  3MR3 A;  3DXB A;  3KLF B;  2JFD A;  4DV5 J;  3BN4 A;  1IR0 A;  5DJB A;  5DQH A;  2E5I A;  4X4R A;  5KG2 A;  1GFW B;  2DGX A;  3HFV A;  3M30 A;  4ZPW R;  3OLA A;  3B8H A;  3I55 S;  2H65 B;  2EKY A;  2C1E B;  2VL1 A;  1CG2 A;  3DI6 B;  1GXU A;  1ZAX A;  3MMB B;  3VGS A;  3Q8S B;  2CZV C;  1S48 A;  2ATC B;  3BF4 A;  3JSB A;  4LF2 A;  4U9R A;  4ECX A;  4FS2 A;  2M88 A;  1OYE A;  1W25 A;  2DGT A;  4DV0 F;  1JLG A;  3ICL A;  2R7S A;  4P2F A;  5EWE A;  3R6L B;  4MH8 A;  3EM1 A;  3ZO7 A;  4ZLN A;  3HHL C;  4R8U B;  3RRG A;  4F2R A;  4RR5 A;  1N52 B;  3OSN A;  1Q95 G;  1N32 J;  3LGN A;  2GML A;  3K5O A;  3AAW B;  3KK2 A;  2X3G A;  1HL6 A;  4KFB A;  4QPT A;  3LPY A;  1KTV A;  2DNO A;  2P9E A;  1AB8 A;  1URN A;  3LP2 B;  5KAK A;  3KLE B;  3V6K A;  2MKI A;  2FVQ A;  2HNY B;  3QRR A;  2BJD A;  2XB2 D;  4J9O A;  3RBD A;  1U2C A;  4RW6 A;  3VGT A;  4GO7 X;  2YY3 A;  3VVU A;  1D9D A;  4OFZ A;  3HK2 A;  4F0K A;  2ZBQ A;  4J9L A;  3PG9 A;  3Q86 A;  1ZM2 A;  3ZNU A;  5IT4 A;  4M5N A;  3TX0 A;  5H9E K;  4PXC A;  1IKV A;  2C28 A;  1Y3K A;  1BQN B;  1KLM A;  1WC0 A;  4LVN P;  2NPI A;  2XMA A;  4DG1 B;  4DFJ A;  2DVI A;  3J7Y U;  1NPK A;  4YHH J;  3HHN B;  3VVT A;  1JLA B;  4TYA A;  3OTD A;  4FPI A;  4A8S A;  3W2W B;  4HI2 A;  4DL5 A;  3IRX A;  1OY9 A;  1NLK L;  5T7L B;  3TUI C;  4MKA A;  5CAA A;  4XTT A;  2CG4 A;  3KKF A;  2GCF A;  4OYO A;  5D0H A;  2UUT A;  4TQR A;  1XMQ F;  4DZ6 A;  4JI5 F;  3LAK A;  2KM8 C;  2WW8 A;  3DCA A;  3GV8 B;  3MM5 A;  1WHY A;  3U1L A;  1YJR A;  2XY6 A;  2WSF C;  5FII A;  1Y5I B;  3GJR B;  4L74 A;  5KFI A;  3OW2 R;  5KFE A;  4UOH A;  5CHC B;  4I56 A;  2YWH A;  4JI0 J;  3UD5 A;  2HZA A;  3UCG A;  2CQD A;  2KL8 A;  2YNG B;  3KLI B;  3OFF A;  4HHH A;  4QIV A;  1S72 S;  4A8K A;  2XHW A;  4C3M A;  3TAR A;  2FY1 A;  2QRR A;  4X65 J;  1WKK A;  1TVR B;  4NZ0 A;  3LP1 B;  2GGP A;  2A2C A;  3M6U A;  5F41 A;  2ZDP A;  1VS3 A;  3CD6 S;  3MOJ B;  1DFD A;  2ILZ A;  1LWC A;  1Y0H A;  3D6H B;  4FVM A;  3SXL A;  2HHH J;  4ECS A;  4OZN A;  5LXY A;  3K0J A;  4NZ6 A;  2MPU A;  4H4O B;  3TAM B;  3ZTR A;  3BO4 A;  4ZJQ A;  1K1S A;  1RCX B;  5KT6 A;  3R7B B;  2KU7 A;  4B02 A;  2IMW P;  4LUB A;  3CJ2 A;  3FQK A;  3I32 A;  2UZA A;  2KB2 A;  3MMA A;  2QSW A;  2IM0 A;  4DJB A;  3CDU A;  2C3U A;  4URG A;  4QW9 A;  1OQ6 A;  3SCJ E;  3VAM A;  3HLU A;  2FB0 A;  1T9T A;  4F3O A;  1DTQ B;  1FK9 B;  3KXD A;  3A3N B;  4RNF A;  2OEJ A;  1F3V A;  2NYH A;  1OY8 A;  3ILI A;  4RUH A;  4ES2 A;  2GMJ A;  2EFV A;  2B0G A;  3EYZ A;  1S99 A;  2QYG A;  4WXO A;  1SQF A;  2LDI A;  2W01 A;  4LFA J;  2V63 A;  2X3D A;  3Q8Q B;  1U6B A;  4ED6 A;  1R31 A;  3M7V A;  1A9N B;  5I3U B;  2XCA A;  1R8H A;  4YDD B;  2RSQ A;  4D3G A;  2ZIT A;  4K8R A;  4RNO A;  3W62 A;  7FDR A;  3GR0 A;  4OYM A;  2GIR A;  1J27 A;  1F2H A;  4O0N A;  4QQB A;  2CZ9 A;  2HQG A;  1RHJ B;  4QBU A;  2QLB B;  1S1T A;  4NLO A;  2GHP A;  2Y0B B;  4PXE A;  1N33 J;  3CD5 A;  3BSA A;  4IOB A;  1JLC B;  2QMU B;  1ZM9 A;  5ETO A;  3NKY A;  5ETM A;  2YNI A;  2F8E X;  1RTI B;  2F65 A;  1CJT B;  4OZ2 A;  4WE1 B;  4DDF A;  1UWB A;  1QLN A;  2J6U A;  3CDE A;  2D3O R;  3R2D J;  4TXS A;  1FI4 A;  2RT3 A;  4PG6 A;  2DGS A;  2CPE A;  4PG7 A;  3CO9 A;  4QWB A;  1PO6 A;  3R1H A;  4A47 A;  3N0V A;  4KV8 A;  3PW5 A;  2F63 A;  4ZVF A;  3EDR B;  1WEY A;  2YBV A;  2R4F A;  5MAO A;  2E1C A;  1KRP A;  1U1P A;  4M1K A;  3T5J A;  3TO8 A;  2G9O A;  4RNN A;  4JI8 J;  2QMX A;  4N8O A;  3R7N B;  4Q8F A;  2X7I A;  2ACM A;  2MQ8 A;  1BWE A;  2VG5 B;  4OX7 A;  2ILY A;  2IJF A;  2L9D A;  2HNZ A;  3FBB A;  2Z2M A;  1EET B;  2QSF A;  4YUD A;  4FKX A;  1UVK A;  2E7W A;  2B56 A;  1D3W A;  3VAH A;  1SIZ A;  2HBQ B;  4ELV A;  4K4U A;  2OGU A;  4XIU A;  1NJI T;  1RT7 A;  1X4B A;  3K2Y A;  5JUM A;  2MQM A;  4F4X A;  2ZD1 A;  3M9M B;  4USJ C;  4M5M A;  2JX2 A;  4FF1 A;  1VQL S;  1XMB A;  2CJB A;  2LQ8 A;  3HVA A;  1DTT A;  2X1B A;  4QOT A;  4PCQ A;  3SCL E;  5BR8 F;  2VIH A;  1HIY A;  4WK1 A;  2BJ3 A;  3JXO A;  5G0R B;  4NCG B;  4DQQ A;  1YJN S;  2BQR A;  1RT1 B;  1U1L A;  2FGO A;  1QY7 A;  2RRN A;  2B9W A;  5A2Q U;  2CPH A;  3PKY A;  3KHR A;  3EZ5 A;  4WK3 A;  3GFY A;  4C48 A;  4L75 A;  5KFM A;  3UN2 A;  2HND B;  2XBP A;  4DR7 F;  3MPW A;  2W25 A;  2AJF E;  4WXW A;  3MED B;  1LWF B;  3M2V A;  3CCT A;  1QM9 A;  3RB0 A;  1ACM B;  1GMV A;  4KH0 B;  4OX6 A;  1FCA A;  2Z2L A;  4IG0 B;  5ADZ A;  5AT1 B;  5IS2 A;  3BS9 A;  1DQA A;  3QAE A;  3TZZ A;  5KT7 A;  4EEY A;  1G4C A;  2WSE C;  3G96 A;  2EI5 A;  3KNA A;  1BQM B;  2BQ3 A;  1WUU A;  1IKX A;  3IM8 A;  4ZVH A;  3G9C A;  1DQ8 A;  4K4X A;  5IFM A;  3MZI A;  5K14 B;  1C0T A;  1UZD A;  2AGO A;  4GKK J;  4C4W A;  5L8R C;  3T5L A;  3Q22 A;  4IQX A;  1DZ5 A;  5KFR A;  2C2D A;  2CA9 A;  2HHX A;  2VB6 A;  1CJU B;  3AXK A;  2MY8 A;  4NX9 A;  2HVH A;  3GON A;  4M5J A;  1YRT A;  1NXI A;  3HSD A;  1S4E A;  1UEU A;  4IDK A;  4B3O A;  2BKO A;  4OI2 A;  1LOU A;  1WOS A;  2MY7 A;  2R3V A;  4JI0 F;  3WX8 A;  1S6P A;  4A8X A;  3HXM A;  2VOO A;  2RVJ A;  2AW0 A;  1K0V A;  2AZ3 A;  3MAH A;  3W5Y A;  2RDJ A;  3QAT A;  4EZ6 A;  3T19 A;  3GG1 A;  2ZH7 A;  2Z57 B;  5A0Y B;  2WAQ D;  2E5G A;  1D9A A;  2PSZ A;  4B9U A;  3HCX A;  1S7H A;  4IFY B;  1XBW A;  4IRD A;  1HHT P;  4QZV B;  2DPJ A;  2DO0 A;  2PEH A;  4GC6 A;  3FDS A;  2BOP A;  4ITS A;  5JVG Q;  1UVJ A;  4Y28 C;  3DGP B;  3CCU S;  4HT7 A;  1MRO A;  4ID8 A;  2IRY A;  4ZPT R;  3CMA S;  3QT8 A;  1IQZ A;  1JJC B;  4EMD A;  3CXC R;  2ERR A;  2C2K B;  1KFS A;  3QRQ A;  2WHO A;  2Q3P A;  3DI6 A;  3MMB A;  2CQI A;  4CLZ A;  4DFK A;  4NXM J;  2R42 A;  4LF8 J;  2GVZ B;  1XNQ J;  3G8S A;  2HKE A;  2PE8 A;  2Z2Y B;  3R7S B;  1TK8 A;  4USW A;  1REV A;  3FQL A;  3SSR A;  4WFN Q;  4XPC A;  1AXQ A;  2JJ4 D;  4GVB B;  1Y00 A;  1UP1 A;  2DNY A;  4F26 A;  4KPY A;  4B3R J;  1B70 B;  4QYZ J;  3ZZZ A;  2C3Y A;  2JHE A;  3A8E A;  3UCZ P;  5CYQ B;  1NKE A;  1NM2 A;  2B9E A;  4O3P A;  4FBT A;  1XR6 A;  3W9H A;  3ITH B;  1MMD A;  1G3O A;  4Q44 A;  1Q53 A;  2KRB A;  2QL9 B;  2ZM6 F;  3HVT B;  1PBU A;  2DNZ A;  3JQJ A;  4HAC A;  2E29 A;  1IKX B;  1V6H A;  3JSR A;  1SC3 B;  2BUN A;  4C0O C;  1Q8B A;  4FXD A;  5KFY A;  3TZW A;  5JVH Q;  2VJU A;  1TFY A;  2BW2 A;  1RA7 A;  2BAN A;  1PKU A;  4WZQ A;  4FYY B;  2KXF A;  3MM8 A;  1BE4 A;  2W7P A;  2RB7 A;  4ECT A;  4PUO A;  4C8Z A;  3JAM Y;  2HHH F;  1WTF A;  2X1G A;  3CIZ A;  2UXC F;  3DYA B;  1R8A A;  3EZU A;  3CF5 Q;  4BDP A;  2JEJ A;  1CJK A;  3CMQ A;  3QID A;  2AMC B;  3R8Y A;  4USK A;  5MLC V;  3HT3 A;  3V81 A;  4KHP F;  4LF1 A;  2CFX A;  2ADB A;  5FD1 A;  1H73 A;  1K8A T;  3KYL A;  4X66 F;  2MKJ A;  5A2Q Y;  1U24 A;  3FMB A;  1JK9 B;  2C3P A;  3C16 B;  4U8Y A;  3PW0 A;  1Q86 T;  2DGQ A;  4ELU A;  4DX5 A;  4DPU A;  1EKR A;  4ECR A;  1H6K X;  1Y5L B;  3R97 A;  1VQK S;  4P52 A;  1HPZ B;  1H7W A;  1ZM3 A;  2ZH8 A;  1KWM A;  3LAL A;  1ZA2 B;  4HTJ A;  1REG X;  2XMM A;  3H5S A;  5ETR A;  1EAY C;  1AZS B;  2D3U A;  5F3Z A;  3PX6 A;  3RZA A;  5GMD A;  4H4M B;  5T14 A;  4IR9 A;  1MNE A;  1WHW A;  4DR5 J;  1Z1Z A;  2HSE B;  4YHH F;  4TU9 A;  5E33 A;  2DD8 S;  4Q5V A;  1IKW B;  3A8K A;  4DR1 J;  4JI1 J;  1JLC A;  4ZVT B;  4B08 A;  4LQ3 A;  1KVK A;  1YJT A;  3W3S A;  3IG1 B;  2MLZ A;  4NLD A;  2AIR B;  4F0H A;  4GVL A;  3RTV A;  4ECW A;  1N34 F;  3FUY A;  1FJC A;  1A7G E;  4DCO B;  2KI2 A;  3UQS A;  2CRL A;  5KFJ A;  3AHP A;  3QBC A;  3AJ1 A;  4X4Q A;  2OMO A;  3DLK B;  5HBM A;  4QWE A;  1LW0 A;  2R9L A;  3DOM B;  4DL2 A;  4XDD A;  3UD3 P;  3UVJ B;  2FC9 A;  3DXS X;  2M8D B;  3QO9 B;  3PV8 A;  5IT0 A;  2EEY A;  1SJQ A;  2KG0 A;  4OX9 J;  3BV8 A;  4IH6 A;  5AE3 A;  4F4K A;  1BXN A;  3HKZ D;  4NLW A;  1Q8L A;  2MMY A;  4DHV A;  1RT3 B;  3RUB L;  4CLW A;  1S1V B;  2IHR 1;  2QA4 S;  1LWX A;  2ATL A;  1FXL A;  2YQ1 A;  2MQO A;  3S8S A;  1DTQ A;  1FK9 A;  1LK7 A;  3D0H E;  5CYM B;  4DU7 A;  5HBM B;  3OV7 A;  4X4U A;  1QDU B;  3L7U A;  3US5 A;  4Z37 A;  1PIL A;  3HO1 A;  2GX8 A;  4A48 A;  3TEG A;  3T1H F;  1RT2 A;  3ZZ0 A;  1T95 A;  4F67 A;  4Y2M A;  3IR5 B;  4DXL A;  1NKC A;  2WB4 A;  1VQ5 S;  3V5R A;  5DQG A;  1ZTT A;  2P6T A;  3K8W A;  2W4D A;  4QIG A;  1CJV B;  3OFE A;  4FVC A;  3RBZ A;  2NXU A;  3THT A;  1K47 A;  1TUV A;  1KKH A;  2DNM A;  1UPM B;  1SC1 B;  3FCH A;  3H7H B;  4TLR A;  5GAE I;  3PFO A;  5J1E B;  2AEJ A;  4MIW A;  4O4G B;  5IM0 B;  1RT5 B;  1TUG B;  2AKW B;  3C8Y A;  7AT1 B;  1B64 A;  1UL3 A;  2RQM A;  1TVR A;  2BW7 A;  3MHY A;  2E5H A;  4C8M A;  5A76 A;  4WJB A;  3K89 A;  3TX8 A;  2RHQ B;  3OTO F;  2ZOF A;  3M6V A;  1GXL A;  1B7Y B;  3CCQ S;  4JYA F;  1V5V A;  3Q0A A;  1KON A;  2IJN A;  2FC8 A;  1NK9 A;  1FA0 A;  2UUA J;  4KHP J;  1XER A;  1G1X A;  3LP0 B;  3NP5 A;  2G0J A;  3DLJ A;  2J9D E;  3IC1 A;  3N6M A;  4PXD A;  5E0O A;  1X5O A;  4DWI A;  1FNX H;  3ZZP A;  4C98 A;  1H2V Z;  1VYA A;  5F8N A;  5KG6 A;  4O3N A;  2FJW A;  1LW2 A;  4XK8 C;  5EUH A;  1O5J A;  3GFX A;  1SJ1 A;  3Q8V A;  2XTJ P;  3D0G E;  2OFG X;  3IS9 B;  3V6H A;  3DDN A;  3FGV A;  2MJN A;  4NYZ A;  4X64 J;  4RW9 A;  3CC7 S;  3I4P A;  4KAI A;  4ECV A;  1ZPV A;  5KFZ A;  1LEO A;  1MML A;  1QAJ A;  2PC6 A;  1W2B R;  2BR0 A;  2J7W A;  1H98 A;  4DOZ A;  1UJ4 A;  4QYR A;  5CYQ A;  3M32 A;  3BEG B;  3MTJ A;  2LEC A;  2ZJQ Q;  1WKJ A;  2HHQ A;  5B09 A;  4O3S A;  1D0E A;  2V2Z A;  4WFZ A;  2RU9 A;  2MLX A;  4M8L A;  4C3L A;  3M8Y A;  3NWR A;  3GV7 B;  2PI5 A;  4J9V A;  5I3P A;  4P2X A;  1B0V A;  3NNC A;  4O4R A;  1WEL A;  1XTZ A;  4TY8 A;  4LSL B;  3W8G A;  5EHH A;  5KFF A;  4ICL B;  2HHS A;  3AOB A;  2I38 A;  3F73 A;  2AV5 A;  2WVB A;  4USH A;  3C16 A;  4C6A A;  1QAX A;  3DGP A;  3G71 S;  4CDI A;  3IFE A;  4WCE Q;  3TUP A;  4S0M A;  3K7R A;  1VQN S;  5DZ6 A;  2GNK A;  2QL5 B;  5LM7 E;  2KG1 A;  1AT1 B;  2ZNY A;  4KGV B;  2BE2 A;  4DSL A;  2FHM A;  4WII A;  3O5T B;  4OYB A;  4LSL A;  5HAO A;  3ULH A;  3FMW A;  4YB7 A;  3ZFV A;  3KLG B;  2HWT A;  5AXN A;  4LRB A;  2HHU A;  1QUV A;  1IN0 A;  3GMG A;  2VG7 A;  2DXD A;  1M5O C;  1S0N A;  2JEF A;  4JI6 J;  5CZV A;  1WWH A;  2XNQ A;  4RWX A;  2ZH4 A;  3PCO B;  4GO5 X;  2XO7 A;  2M3D A;  4LJM A;  5DZ7 A;  3DLH A;  1HNX F;  3DLL Q;  3I56 S;  4J7C A;  2DKO B;  2E9Z A;  3KHH A;  4DR6 F;  1XR5 A;  3OTB A;  2VDI A;  4HDH A;  1RWU A;  1B99 A;  3ADA C;  1JWW A;  1WDT A;  1YWX A;  4K50 A;  3HD1 A;  2KN4 A;  3DLB A;  4RW4 B;  1TKZ A;  1VQO S;  2L3M A;  3LW5 C;  1PSD A;  2K3K A;  3GIR A;  3QNW B;  5IOL A;  3W1Y C;  2OPQ B;  4J9P A;  3D2W A;  1HAR A;  2MZS A;  2RQK A;  3POT A;  3BB5 A;  5KG1 A;  1IVZ A;  1FFW B;  4DSI A;  3JTP A;  2CJX B;  1X9M A;  1JJ4 A;  3A8I A;  3AOA A;  5KFS A;  1YGY A;  1C1C B;  2HLT A;  4MIB A;  1G2E A;  2LCW A;  1U7L A;  4MIA A;  4RW9 B;  1RHR B;  4I1T A;  4KGZ B;  4MK9 A;  4KGK A;  1NH7 A;  4TVA B;  1RK8 A;  1UJ6 A;  2UVV A;  1IBL J;  2AZ1 A;  4LR8 A;  3TVZ A;  1S1W A;  1MWQ A;  1RT6 A;  3H20 A;  2NZC A;  3MED A;  3HFK A;  4DV4 J;  4J9S A;  2ASL A;  3LP2 A;  2GJ2 A;  1S6Q B;  5C42 A;  4ZVS B;  1BQX A;  3GG0 A;  5BYR A;  3VCD A;  3W9J A;  4ZLJ A;  1YI2 S;  9ATC B;  4LF5 F;  3QIP B;  4WYW A;  3GCW P;  4UTG A;  5D4O A;  3GIK A;  2PN6 A;  5E41 A;  1T94 A;  2DNL A;  5E3R A;  3LGH A;  3THV A;  4C7Q A;  3CCR S;  5GAD I;  2P8I A;  1RZM A;  1S1U A;  3MPY A;  1AFJ A;  2R7X A;  4ANE A;  3R5B A;  1WTB A;  3TQ1 A;  3FEX B;  1RT5 A;  1UVN A;  1YVF A;  2XWY A;  2JVO A;  5KFT A;  1WC4 A;  2KJW A;  3Q8U A;  2GJI A;  1E6V A;  1HKA A;  2DNQ A;  2WSC C;  2ZC3 A;  2DR8 A;  2FHJ A;  2HGN A;  5J1N A;  3FSI A;  1T05 A;  2OKQ A;  4IOA Q;  1LXN A;  5BJR A;  1UMJ A;  2FDN A;  3KLV A;  1RWN B;  1S1V A;  2P9G A;  3EWG A;  1U8W A;  1U25 A;  2ALZ A;  1RKJ A;  4Q2L A;  3U1M A;  3OLB A;  1S6Q A;  1ZAW A;  3IXQ A;  3KG1 A;  1GMW A;  4KIA A;  3TA1 A;  5KFD A;  3T1Y F;  2Y8W A;  1C0U B;  2FJB B;  3SMZ A;  4ENO A;  1NRK A;  1U1K A;  3DRP B;  4AQY F;  2AGP A;  5LSL A;  3V81 B;  4UZC A;  1L3V A;  3E2E A;  1PAE X;  3MEE B;  2XLI A;  4DV1 F;  2DR7 A;  2MJU A;  4I2Q B;  1OS5 A;  4M5D B;  4JP8 A;  4DSK A;  2HFV A;  1FEH A;  1S1T B;  4LBH A;  5LT5 A;  3AT1 B;  4A8Y A;  1GQE A;  3H2U B;  2BXJ A;  2ZBI A;  3PZP A;  1SV5 B;  1PGZ A;  2RKI B;  3M2U B;  3UN3 A;  4B9L A;  1E6V B;  2D41 A;  1VJW A;  2HIY A;  3I5B A;  2Y1J A;  2HPU A;  2I8E A;  4RNH A;  3KLH A;  1XNQ F;  2MEW A;  1R3N A;  2QJ3 A;  1U09 A;  4X2B A;  2UUB J;  4JI7 F;  1OPI A;  2BJ7 A;  3LH2 S;  1ZH5 A;  2YTC A;  3K5N A;  3NG8 A;  1FD2 A;  5LSR A;  5J2Q A;  5B0D A;  2A1B A;  1EKS A;  3JYT B;  3ZTS A;  1EJ7 L;  2VOP A;  2G2Y A;  1NSA A;  2VG6 A;  1YKW A;  4IQM A;  4U67 Q;  2J8A A;  2ZH3 A;  2HZV A;  3FRZ A;  3IGV A;  2XGP A;  2AT1 B;  3M8Q A;  3FFI A;  1FJE B;  2D3O 1;  1RP5 A;  2ZC4 A;  2QA2 A;  4ECQ A;  4JV5 F;  2GC8 A;  2CVI A;  3C15 A;  4NXM F;  1U8S A;  1IBL F;  3HHK A;  3HF5 A;  3GQC A;  3CJK A;  2HGL A;  1U1N A;  5HMZ A;  4DR1 F;  1CS4 B;  1HNV B;  3RGI A;  2W9B A;  2VQF F;  3LA0 A;  4QR0 A;  1YJ7 A;  2CJ9 A;  1X0P A;  3SQG B;  4AND A;  1LWC B;  4CYU A;  4TU8 A;  2VJV A;  4PQU B;  1JXV A;  4DN9 A;  5HLF B;  2XLK A;  4WE1 A;  1JNZ B;  2V4J A;  3LP1 A;  3VWS A;  4LF4 F;  1RU1 A;  1HWK A;  3TUJ C;  2VHG A;  3IP0 A;  4KGM A;  1M1K T;  5LOQ A;  1TR0 A;  3KLI A;  1FFG B;  1RJJ A;  1C1C A;  2BA9 A;  3MF5 A;  8ATC B;  3M8Z A;  2V9W A;  3MAQ A;  1QUP A;  3A3P B;  2ROG A;  4ZIV A;  5B0G A;  3CCL S;  1N6Q B;  1M5V C;  3PFE A;  2JDJ A;  2CQ1 A;  4U6P A;  2DXF A;  2H48 B;  2N7C A;  1H38 A;  2CNL B;  1HNW J;  3DOL B;  5D4P A;  1KS2 A;  2V8G A;  5KFL A;  4CP5 A;  2V68 A;  2OPS A;  2RRB A;  2FD2 A;  2ZVI A;  3AFG A;  4DN0 A;  3MM9 B;  3IBW A;  3T3F A;  1S4F A;  4QIF A;  1C0T B;  2ZH9 A;  2JSX A;  1F1B B;  1S59 A;  2GHV C;  2OML A;  5KFU A;  1YDL A;  1WKL A;  4C11 A;  3GII A;  1O6X A;  1FER A;  3OR2 A;  2HHV A;  1MWZ A;  1MN7 A;  3F44 A;  4R25 A;  3UCU P;  3ILJ A;  2CQP A;  1EP4 B;  4E98 A;  3LTO A;  5CCM A;  1R27 B;  4PWD B;  4YS2 A;  3M2R B;  2BE2 B;  4LFA F;  1VRQ C;  4EBE A;  3NNA A;  2KT2 A;  4KB7 A;  1DUR A;  2GVZ A;  2LFV A;  4NA2 A;  1X9W A;  2LMI A;  3ZTQ A;  1L5U A;  5HJY A;  1QSL A;  1FNM A;  1HWL A;  3THP A;  2XO6 A;  3EVW A;  3ZZY A;  1JXL A;  3W9I A;  2HQF A;  4FYX B;  2ZVS A;  3HHL D;  1MRO B;  3PEJ A;  4ILR A;  3B4M A;  3AB2 B;  5THW A;  5C25 B;  3CJQ A;  5EDW A;  1N56 A;  4TNO A;  4USI A;  3H5Y A;  3TA0 A;  3D28 A;  4NYO A;  1W2I A;  1UEV A;  2I9S A;  3HSG A;  2EFN A;  2HWI A;  2W7A A;  1HWJ A;  3ENA A;  5KFV A;  2HHW A;  1HWU A;  4DF8 A;  4P2S A;  4Y34 A;  1CQM A;  3WIV A;  4E2F B;  2LXI A;  1RA6 A;  4XPE A;  3JSM A;  2C3M A;  1CJV A;  2M70 A;  1M5P C;  2BM1 A;  1OSD A;  1S6P B;  3OL7 A;  2VG5 A;  3F0N A;  5T7L A;  4ZN1 A;  2M52 A;  1JJH A;  2E1A A;  1O8B A;  1S1X A;  1TU0 B;  3KUG A;  4O44 B;  2EBG A;  1Z2Z A;  5SZT A;  3R1L A;  2M2B A;  1IXK A;  2K8G A;  2CWX A;  3TP2 A;  5GAH I;  2IA0 A;  4BC7 A;  2KH9 A;  4QYZ K;  4WFY A;  4BC9 A;  1N36 F;  3P45 B;  1CEZ A;  2AU0 A;  2OH2 A;  4FKY A;  5A6P A;  2CIM A;  2P9C A;  1TV6 B;  3FJ2 A;  4ZKA A;  3CC4 S;  2HND A;  1ULR A;  1R8B A;  3PRV A;  2NCK L;  5ETQ A;  1NAQ A;  4QWA A;  2QA4 G;  2KO1 A;  2M9K A;  3NAH A;  4LRA A;  2IA6 A;  4AL7 A;  4C8Y A;  2NUH A;  4KT0 C;  2JOQ A;  1NJX A;  1Q8K A;  4BWJ A;  3WX4 A;  3X1L B;  3IMQ J;  3MOZ A;  3BH6 B;  3ZZT A;  2AJ0 A;  3C6T A;  4KFB B;  2XY7 A;  4U7C A;  1Q79 A;  3IBF B;  4LRC A;  3TR5 A;  1RBL A;  3ETM A;  5KTQ A;  1AUD A;  3C15 B;  2IDE A;  3AD9 C;  2DTJ A;  2BJ9 A;  5DET A;  2DNK A;  3QT5 A;  2M0G B;  3UW1 A;  1VIO A;  3NS6 A;  1FRH A;  2HVD A;  3SQG A;  2OEK A;  2R2R A;  4F25 A;  3C46 A;  2HNZ B;  3R5C A;  4AE5 A;  2ZBR A;  5L38 A;  3TAN A;  1I94 J;  2V5H G;  4M5G A;  8AT1 B;  5D78 A;  2R8K A;  2LXU A;  5J2Q B;  4YDX A;  4L3K A;  2FVP A;  1SXL A;  2H4Y B;  4C0H A;  5J1E A;  4TU7 A;  3MD1 A;  1E6Y B;  2YWF A;  3OUY A;  1G6B A;  1S77 D;  4DR7 J;  4HTI A;  3MMA B;  3M8Q B;  3ENV A;  3K5M A;  3O8W A;  4OHV A;  1Q16 B;  5C42 B;  4RZR A;  3NGT A;  1H7X A;  1BD6 A;  2BKN A;  3K17 A;  4NZ7 A;  5C24 A;  5K8N A;  3VAK A;  1NK6 A;  4ZPC A;  2HQD A;  1T0T V;  3RAQ A;  2SXL A;  3QO9 A;  7FD1 A;  3CWJ A;  3CJ8 A;  4USV A;  3C14 A;  2R7W A;  4J9U E;  1GNK A;  3MPV A;  1P8G A;  3OVA A;  3NBP A;  3CDW A;  1IBM J;  4ZCI A;  1JX4 A;  2FPH X;  3JSY A;  4JB8 B;  4OJG A;  3UD4 P;  2RIL A;  1N34 J;  1X60 A;  2BAB A;  4DV5 F;  4X4V A;  4JI6 F;  4ALZ A;  3H4D A;  4DL4 A;  3DOM A;  3EGZ A;  2FZC B;  3P4U B;  2J0X A;  4UOF A;  3HSJ A;  4FP9 A;  3TUZ C;  1HBO B;  4R5P A;  3MM5 B;  4CWB A;  2VBY A;  3Q83 A;  1TV6 A;  1Z4U A;  2G0C A;  4CQ1 A;  6FD1 A;  3PW2 A;  3DM2 B;  1FKO A;  1S9F A;  5HAN A;  3H98 A;  1HR0 F;  5LXR A;  3A1Y G;  4LBI A;  2V0N A;  2XHC A;  2A18 A;  1WNE A;  2A2D A;  5A8R A;  4ED1 A;  1NME B;  1AZS A;  1UFW A;  5L1L A;  2VPY B;  2BJ8 A;  4DSF A;  1XWL A;  3ELH A;  3N5B A;  1HPZ A;  1UA1 A;  2IAJ A;  3R5G A;  1W26 A;  2ACY A;  1FWK A;  3R5A A;  4M5K A;  1WF1 A;  4NLU A;  4PAA A;  3DRY A;  4AT1 B;  1T3O A;  2FJA B;  3ENW A;  3Q8P B;  1NK8 A;  1SQG A;  4CO0 A;  3CE8 A;  2V8H A;  1ZM4 A;  4H4O A;  4IKA A;  4DR2 F;  3KJN B;  1XNR F;  3TEH B;  1J5E J;  3BPS P;  3FRY A;  5C25 A;  3KJF B;  2EPI A;  2UP1 A;  4LF7 F;  2IDL A;  4MFB B;  1VLY A;  3R5D A;  1MW7 A;  3M1V B;  5E3C A;  5CAB A;  3LWM A;  3TAP A;  4JUZ A;  2OTL S;  1PYT A;  2JVR A;  2JRS A;  4DZD A;  2DXE A;  3DYA A;  2CPI A;  4MTP A;  3SEO A;  4JOU A;  4ZP7 A;  4X4P A;  1PAU B;  3L95 X;  3CED A;  3AOD A;  1IBC B;  5AJ3 J;  2XCP A;  2LQB A;  1HBM B;  1NKB A;  4FNI A;  1VQM S;  2DJW A;  2DNR A;  2YX1 A;  4NXN F;  2KTQ A;  1FWP A;  2KZZ A;  3S1T A;  2XSF A;  2BBE A;  1WD6 A;  3F56 A;  2Q79 A;  3BZQ A;  3I5C A;  3T5H A;  3G87 A;  1PG5 B;  3E3X A;  1IQT A;  3CIM A;  4M5L A;  2OPQ A;  1YBT A;  2U1A A;  3GPA A;  1RU2 A;  5KG4 A;  4DV0 J;  2P2C B;  2VDH A;  1MN9 A;  3GZ7 A;  5M2U A;  5I42 B;  4DF4 A;  1SJF A;  3D4J A;  3M32 B;  1U0H A;  2WVC A;  1HLW A;  3BH7 B;  2GZO A;  2G2O A;  1F9H A;  4NA3 A;  2YX7 A;  3SYZ A;  3EZO A;  1S9G B;  4QW8 A;  4KSE B;  4X65 F;  1B3T A;  1KQF B;  3V4I A;  2DGV A;  2RUS A;  3UDV A;  4DV3 F;  1JLA A;  1U1Q A;  4G1Q A;  2YKM B;  3D66 A;  3GJS B;  4V1A k;  5GME A;  3EPI A;  4DG1 A;  2QL7 B;  2QTW A;  3MEG B;  2V4R A;  2J7U A;  3Q8Y A;  2QMW A;  3AH6 A;  4JI3 J;  2NS1 B;  3A13 A;  1OMS A;  4DR3 J;  2CJY B;  4OZ3 A;  4G65 A;  4PYD A;  1TL7 B;  1LW2 B;  2Y1L B;  2GA7 A;  1CS4 A;  2MQQ A;  1RAB B;  3JB9 k;  1XIQ A;  4PWW A;  4JI2 J;  4PZV A;  3SSS A;  4IOC Q;  2MGZ B;  2P5V A;  2N7Y A;  2XS7 A;  3FBE A;  4ZA1 A;  5HVF A;  3MUV P;  4R8U A;  2V4J B;  1VC0 A;  2Y1R I;  2DO4 A;  4O23 A;  4YQW A;  1YJV A;  2XLJ A;  4RUB A;  1U1O A;  1EHW A;  1LFW A;  2ZZT A;  3MGJ A;  3GFZ A;  4C3K A;  3DLE B;  2LDY A;  2IYI A;  2YH1 A;  1RWX B;  2OP5 A;  3HT0 A;  4ZHR A;  3TZY A;  3E01 A;  5AJ3 F;  1VK3 A;  1JLB A;  3M8S A;  2C2N A;  2ZH2 A;  4J9N A;  1F0X A;  2WVE A;  1T11 A;  4Q0B A;  3KMQ A;  1ITP A;  3BSN A;  1YRX A;  1S9E B;  4N8N A;  4Q8E A;  2ADC A;  5K14 A;  1H74 A;  1D1U A;  4LF8 F;  2DRD A;  4QU7 A;  1PJ6 A;  3NCQ A;  2HFN A;  4DV4 F;  3KFW X;  1EQ0 A;  5H1S V;  1RTH B;  2JL9 A;  2ZWO A;  3DRR B;  2ZBC A;  2ZZN A;  2VAS A;  1VQ8 S;  3QGI A;  1RWM B;  1UWA A;  3SQO P;  1IWG A;  3L4B C;  3Q2T C;  3D68 A;  2CPZ A;  3BBB A;  4O3Q A;  4HDG A;  3H40 A;  4JI4 F;  2LYV A;  4ILL A;  2FJE B;  1WI6 A;  5F8I A;  1ZYQ A;  1M1H A;  3LAM A;  4NWB A;  2N4C A;  2YXL A;  2ZJP Q;  5D4L A;  4LFC J;  3ISN C;  1HR0 J;  5G0R A;  1FKO B;  2GQQ A;  3C6U A;  5BR8 J;  3WZ0 A;  3NGK A;  4EYH B;  2C2R A;  1HD0 A;  4MK8 A;  5D0R A;  2YWG A;  1ZZN A;  2HMI B;  2HEK A;  4BCA A;  4Y2C A;  1M90 T;  2F5G A;  2FIU A;  3K5L A;  2WBR A;  4CH1 A;  2X51 A;  1NPR A;  2AQ4 A;  3A3O B;  4YP3 A;  3QT7 A;  1FE4 A;  1N4L A;  2I0X A;  1X9S A;  2J0W A;  1XN9 A;  2CDQ A;  2PD1 A;  2QLJ B;  1X5S A;  1YLX A;  1S1U B;  2BX6 A;  2W2N P;  3EDQ B;  3ILL A;  4CO2 A;  4RU9 A;  2A6M A;  3LWL A;  5LJ3 Y;  4DV6 F;  1U47 A;  1I1G A;  3BBF A;  2N3L A;  1H72 C;  1CUL B;  3BGL A;  2XC9 A;  3GYG A;  4B9V A;  4ID5 A;  4A8O A;  1ZTW A;  4ETZ A;  2KYZ A;  2QLF B;  4A4J A;  4CLL A;  1HBN B;  2AD9 A;  3CUN A;  3NL0 A;  1JKH A;  3TWZ A;  1JNR B;  1Y3J A;  2MQL A;  2GV1 A;  3QLH A;  1Q81 T;  1H0H B;  3S7R A;  4K0K J;  3MD3 A;  4CNY A;  3GLJ A;  4HVZ A;  3PRB A;  5B7W A;  2Z4P A;  5IWA F;  1YBU A;  2R8J A;  1RWK B;  4MJK A;  1S79 A;  2XZT B;  3RU0 A;  1FE0 A;  2POK A;  2CXE A;  4PPD A;  4L76 A;  3SSQ A;  3GWC A;  3AJD A;  1TL1 A;  1TTH B;  1VJQ A;  3IRW P;  3M4X A;  2WRM A;  3I87 A;  3RRK A;  3ZTP A;  4PKD B;  5IQ6 A;  3UDE A;  3P5T L;  3H59 A;  2P6S A;  4DR2 J;  3IBC B;  3LPE A;  2QO3 A;  3BKT A;  4Y00 A;  3OJU A;  2XMW A;  2W4P A;  3D6F B;  2B5J B;  1WAC A;  2W2P P;  4KQZ A;  1BY9 A;  2CWK A;  1RDR A;  2XY5 A;  3PTW A;  1NPP A;  2FUG 9;  1JIH A;  3VAI A;  3TVK A;  4DV7 J;  1UAW A;  1SKW A;  1FNO A;  4OI3 A;  1LKZ A;  1HQU B;  4UQT A;  1WDD A;  3IN5 A;  2QN6 B;  2F4V J;  1PIE A;  3LAN A;  2ROP A;  4FXW A;  2JEI A;  4HHJ A;  1BQN A;  1KLM B;  1VHI A;  4HLB A;  1U6Z A;  5J1P A;  3BBC A;  2XMT A;  3GFH A;  4NLT A;  2G13 A;  2OD4 A;  2RE1 A;  4BWM A;  3HM9 A;  5GAD U;  4ECZ A;  2RF2 B;  3NOG A;  3UO0 A;  1VQY A;  4DX6 A;  1ZZF A;  2RML A;  3H4B A;  3V6D A;  3MUR P;  1RHM B;  1IBK F;  1GTH A;  2Q66 A;  4DL0 C;  5EN1 A;  4K4Y A;  1ZA1 B;  2B43 A;  4OHX A;  1VIS A;  1Q7L B;  2GO9 A;  1L3U A;  1TKT A;  2WOM A;  2KYX A;  5LMU F;  3R27 A;  1M0S A;  1BGX T;  3OHB A;  3T1Y J;  3N28 A;  3PJW A;  2YQ0 A;  4OQJ A;  2RAQ A;  4CCH A;  5KFC A;  4NA1 A;  1KDN A;  4WFB Q;  1JLQ A;  3EE3 A;  4ED3 A;  1M5K C;  2CZ4 A;  4K4Z A;  1WC6 A;  5DLG A;  2K7J A;  1HI8 A;  4L3N A;  2L48 A;  4DPO A;  4JI5 J;  1HYS B;  3Q23 A;  2K1R B;  1NH8 A;  3BGO P;  2KRR A;  3UDL A;  2KFZ A;  1WSV A;  5CYJ A;  4AL5 A;  2HZC A;  2F8H A;  2GIF A;  4MYU A;  5ETK A;  3V6D B;  2KZM A;  5A6W A;  2UV8 A;  1RB0 A;  2HUR A;  1FKP A;  1GAO A;  4NLR A;  5IV4 A;  5HQM A;  3BN7 A;  2DH9 A;  3TOQ A;  1SBR A;  2DHA A;  2WBM A;  1C2P A;  3ZZR A;  4I7F B;  2HW3 A;  1HMV B;  4R0E A;  2MZ1 A;  3MM9 A;  4C8N A;  2UXB J;  1UA0 A;  1M1G A;  4G1Q B;  1XMO F;  3BM7 A;  2QEX S;  1S5Z A;  2CQ2 A;  4C11 B;  3Q8R B;  1A0O B;  3M6X A;  2OD6 A;  2VKR A;  4U95 A;  5C7P A;  5CA5 A;  1CLF A;  1IUJ A;  5ETN A;  4DEZ A;  3PO5 A;  3QPI A;  4OJ1 A;  2DGO A;  4KO0 A;  3D0I E;  4OYZ A;  2B7B B; 
#chains in the Genus database with same CATH homology
 2C2K B;  1I51 B;  2H54 B;  3KJN B;  2QLJ B;  3EDQ B;  3KJF B;  3R7S B;  1I3O B;  1SC4 B;  2HBR B;  4ZVO B;  1RWO B;  2QLF B;  2XYG B;  1PAU B;  1RWN B;  1IBC B;  1RHJ B;  2QLB B;  2Y0B B;  3RJM B;  3R6G B;  2QL9 B;  2C2M B;  2HBY B;  1RWK B;  1SC3 B;  2XZT B;  1GFW B;  1RWV B;  1QTN B;  2H65 B;  4LSZ B;  2P2C B;  2C1E B;  1RWW B;  3EDR B;  3P45 B;  5K20 B;  4ZVP B;  2FQQ B;  4DCJ B;  4DCP B;  2H51 B;  2H4W B;  3IBC B;  3R7N B;  3R6L B;  3KJQ B;  3D6F B;  5IC6 B;  3GJS B;  2XYH B;  2QL7 B;  1RWP B;  3IBF B;  2CJY B;  2HBQ B;  2HBZ B;  2XZD B;  2H5J B;  2Y1L B;  4ZVQ B;  5IC4 B;  2QL5 B;  2C2O B;  4ZVR B;  1RHU B;  1RHK B;  1RHM B;  2C2Z B;  4ZVU B;  2H4Y B;  2CNN B;  3SIP B;  1RWX B;  3GJQ B;  4ZVT B;  2DKO B;  2CNO B;  4DCO B;  1PYO B;  1F9E B;  1ICE B;  3QNW B;  3GJR B;  2H48 B;  4JB8 B;  2CNK B;  2CNL B;  2CJX B;  2XYP B;  1RWM B;  3D6M B;  3P4U B;  1QDU B;  1RHR B;  3R5J B;  1RE1 B;  1BMQ B;  3D6H B;  3GJT B;  2CDR B;  1RHQ B;  3NS7 B;  1NME B;  4ZVS B;  1SC1 B;  2H5I B;  3R7B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...