2C1EB

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2c1eB00
2C2OB 3P4UB 3R7NB 1SC1B 2XYGB 1RHJB 3RJMB 1RHUB 2CDRB 2H4YB 2QLFB 3GJQB 4ZVRB 3NS7B 4ZVSB 1RWKB 5IC6B 1RHQB 3R7SB 2H54B 1I51B 4ZVQB 3QNWB 3R6LB 4LSZB 2H5JB 5K20B 1PAUB 2HBRB 1RWVB 2H48B 2H5IB 2XZTB 3GJTB 1QDUB 1RHKB 2CNNB 1PYOB 3D6HB 4JB8B 1QTNB 1RWPB 2HBYB 4ZVPB 2XYHB 3R6GB 4DCOB 2C2KB 2XYPB 4DCJB 2C2ZB 1I3OB 2FQQB 4DCPB 1RWWB 3GJSB 2QL5B 2QL9B 1RWOB 3D6FB 4ZVUB 2C1EB 2P2CB 3KJNB 1F9EB 2Y0BB 3EDQB 1NMEB 1SC3B 3IBFB 1RHMB 1IBCB 2H4WB 1ICEB 1RWXB 2C2MB 1RHRB 2CJXB 1BMQB 2DKOB 3KJFB 2CNKB 3D6MB 2QLJB 1RWNB 2H65B 2XZDB 3EDRB 1RWMB 2HBZB 2CNLB 3IBCB 4ZVTB 3P45B 2Y1LB 2CNOB 3SIPB 2HBQB 1RE1B 2QLBB 2CJYB 1SC4B 1GFWB 3R7BB 4ZVOB 2QL7B 5IC4B 3GJRB 3KJQB 2H51B 3R5JB
chains in the Genus database with same CATH superfamily
3ZZTA 4FF1A 3Q8SB 4NLGA 4NX9A 2DGSA 4WXWA 3NNHA 2BM1A 1L3VA 4KKOB 2QJ3A 2MQLA 4YR0A 2MKSA 2PFFB 1SKSA 2J5AA 2XM3A 4CP5A 4NLRA 4NLWA 2VIHA 2N4CA 1HHTP 2EI5A 5L1KA 4EBEA 5K8NA 3KG1A 4OJGA 5DGAA 2M8DB 4ZPAA 1DARA 1RADB 4OX6A 2BYCA 3UVJA 2IC3B 3TAMB 4DSJA 3DLGB 4NLXA 2V4RA 3R2DJ 3H40A 2FDNA 4N8NA 5ETQA 4PR6A 1F9FA 4OYPA 4N56A 2FD2A 2ZJRQ 4UF4A 3CJTA 4JUZA 5C25A 1S1VB 2ZH6A 3C3LA 1WG4A 4F67A 2XMMA 5KG4A 3NS5A 1U26A 2J7UA 2OJ3A 3GYNA 1R7IA 2ZWOA 4CM2A 2DXEA 4OI1A 1QY7A 1RU2A 1U6BA 1KLNA 2E1AA 3HI9A 3WX4A 1JXLA 1PIEA 3TP2A 5KT5A 1P27B 1SH0A 2FJAB 1GXTA 3M30B 5DZ6A 3VAGA 1NDKA 3J81j 1H0HB 3W7BA 1CEZA 2AJFE 1U49A 1WC1A 2MSSA 4M8LA 3KLFB 4LFAF 1NJIT 3HT0A 2HRUA 2M5YA 1MMNA 2XYHB 4IG3B 4W92B 2OSRA 2RDIA 1N56A 5A8RB 4N76A 2C2KB 5IWAJ 4M1KA 1QAJA 1Y11A 1WTFA 5E3AA 2P9GA 3K8VA 5K14A 3V4IA 3GIKA 2UUWA 4O0NA 4P2SA 3SI8A 4YB1P 1XMQJ 1WELA 3EPIA 3TJ8A 2DR8A 2QV6A 3GJSB 4B3MJ 4DFMA 3LA0A 4YOEA 1Y4ZB 1I6JA 5H9FJ 1EB0A 1UVKA 4OZ5A 2ATLA 3D6FB 1WEXA 1YBAA 2KL8A 3BSAA 4PXEA 1H98A 3DC2A 4PKDB 2OPRB 4DUTA 1BWVA 1YTYA 4ECRA 4DZDA 2OP5A 4I1TA 5HAOA 4XAKA 2DNNA 2VG6B 4YY3J 1LKZA 2FJEB 2K1RB 3RW7A 4OJ3A 1X9MA 1YBTA 1X9SA 1QAYA 1FEEA 3CGIA 3ETMA 1EQ0A 3S6EA 1W25A 3DYAA 4KBIA 2P5VA 3A12A 3THPA 4C97A 3EXCX 1ZZNA 1WHVA 4NWBA 4CYUB 1JKHB 4IG0B 2ZM6J 1VLOA 4RW9B 7FDRA 3OFHA 3J7ZT 2CJAA 3O5TB 1S97A 1RABB 1IBCB 2IVMA 3PIPQ 3MEEB 1NK9A 1TKXA 2DIUA 2I9SA 3DU5A 3O3LA 2OPPB 3DN9A 2C2MB 2XSFA 4ZPVR 4M5DB 1GAOA 2OPSA 3CCTA 4U7CA 3H0PA 2KJWA 3LPEA 4BC9A 1RXOB 1X5TA 4FXVA 1WSRA 4LFAJ 2XO6A 2MKJA 2YNGB 3QPIA 1B0PA 4IFYA 1RA6A 2R7TA 2LP4A 4HH0A 1U8SA 3K57A 1TUGB 1NZAA 3HSGA 1SL1A 1PSDA 1XEZA 3KXDA 3PNIA 3AA8A 3A8KA 4ZP8A 1L3KA 1K8AT 3E2EA 4LF5J 1ELOA 1XMQF 4B3MF 2PE8A 3ZZPA 4R25A 1F9HA 1YRXA 4OJHA 5C25B 3TZZA 1XN9A 1X4GA 3C16A 4BC7A 5IFMA 4MTPA 1SL2A 3NEKA 1TL3B 2XEXA 2WOMA 4GO7X 5LJ5Y 1VRTA 4DV5J 5F3TA 1DLOB 4MIAA 3X3UA 2KXHA 4YY3F 1S79A 4HDGA 3R7BB 5FDLB 4B9LA 4PWDB 3N0VA 2EW9A 2C2NA 5D4NA 2B9WA 2EK1A 3R5GA 2K7JA 2HWTA 3W9IA 2K3KA 1H7XA 2GIRA 3A8JA 3ENWA 4IFVB 1UW9A 4OHWA 2OPSB 4ECVA 2IA6A 1HWLA 2LMIA 1TR0A 1F1BB 2MDAA 2B9EA 4ELTA 4RR5A 4J9LA 2XWXA 2XCAA 5LM7E 5D3GA 1WDTA 2B8QA 2RNEA 3GJQB 3ZO7A 4A8FA 1HWUA 2IAJB 2VDHA 3TUPA 2HGNA 2ZBQA 1FRIA 2K8GA 1JJ4A 2W01A 2VG5B 1LWFA 4OX9F 4D3HA 1Q86T 1H2UX 1NPRA 5FIIA 4XIUA 2UXBF 1V5IB 3OVBA 1AFJA 4UQTA 1ZPVA 3R8YA 3ZTPA 3Q8QB 3TUIC 1IBKJ 2R8JA 1EETB 2VG6A 1N88A 1H7WA 3KTQA 2B9XA 2H3EB 4WYWA 2YWEA 3MR7A 4RUBA 5KFXA 2WW8A 3I4PA 4K4SA 1E6VA 2OUGA 3RR8A 1BWEA 3M32B 4OYAA 5HROB 2YKMB 5HMXA 3AH6A 3MM7A 2DY1A 2FHKA 3MEGA 5KFQA 3PFOA 2KG1A 3CNQP 2MEWA 3PRBA 4Z37A 1AZSA 3DRPA 3GJTB 4Z7YA 5KT6A 1Q8BA 3GG0A 2IM3A 2CIMA 4ED5A 2I6WA 1RYSA 4LMZA 4RNOA 3I4HX 3T5JA 2GO8A 1U0SA 2UUBJ 2XHCA 1HNVA 2IJFA 1RTIB 3HHLB 2XZWA 4ED4A 2LEAA 1D0EA 3N6LA 3CCLS 2QEXS 1G1XA 4FVMA 3BGUA 1T9VA 2XTJP 4DCOB 4O4GB 2BANA 4O3NA 1VJQA 3CVKA 4WK1A 2DH7A 1UVLA 3UE2A 3IM8A 1F5BA 3L09A 2LEBA 1S0OA 4DMZA 1S5ZA 2W2OP 1PBAA 3FNNA 5A8KB 4CI0B 2W7OA 3FBEA 4I2QB 2HMIA 2O01C 1FDAA 3G6VA 1RT1A 4DL6A 1FNOA 2DNOA 3M9OB 4ZJLA 1HKAA 2HWHA 1BQNB 1U1KA 1IBLJ 4KHPF 2Y3YA 1IBKF 1GTEA 1HHQA 1FXDA 2DXFA 3M30A 2YNIA 3J81U 5F8GA 3IWXA 3THTA 3OL6A 2HVHA 2XB2D 2ATCB 2HNYA 2DEIA 1CJTA 2OAUA 5A8RA 1JLQA 3UN5A 3OV7A 2UXDF 3D1QA 1RHMB 1Q4RA 3H8YA 4LBHA 3BS9A 2R2UA 3K7RA 3EZ5A 4A8QA 4NMLA 2RVJA 5KT4A 2V94A 2PDAA 1UWBB 3LW5C 2XLJA 3K89A 4TYAA 3Q8RB 1UVIA 1WC4A 2DKOB 1HMVB 1RQ0A 2YX1A 4OZNA 4LFCF 2W2PP 3W2WB 4WBFA 5ADZA 3BYRA 4LR7A 2UV8G 4HI1A 1NK7A 1RDRA 2HS4A 2D7SA 1IM4A 4X84A 4IDKB 1CJUB 2DPJA 1RU1A 2HMIB 2C28A 3PW2A 2ZH3A 2APOA 2MLZA 4A4JA 1VLYA 1D8YA 4HACA 4NA2A 4ATNA 2D3OR 3BM7A 2CVEA 1P6TA 1O51A 3BGLA 3FC9A 3M8QA 5L1JA 1VIXA 1S76D 1KVIA 1R8CA 2YNIB 4RW9A 5J1NA 3MTJA 5E3CA 4O3PA 3SV4A 2AJ0A 3L7OA 3W3SA 2O3DA 4FDFA 1RE1B 1A0OB 2LQBA 1N6QB 5B0CA 1IKWA 3ZNJ1 3GV7B 2RHQB 2B4PA 2C2DA 3R1HA 4EZ6A 1XTZA 4NEZA 5D15A 4IYQA 2UXDJ 2J9DE 1GXUA 2X3DA 5KFBA 4RUAA 3I55S 5CZVA 2Z56B 2PI4A 4PUOB 5C42B 4FPIA 4TXSA 2HQ3A 3T6BA 2DGQA 3GSIA 3HXMA 1RT2A 5ETPA 3DU6A 3KDOA 1SL0A 3NBPA 1X31C 3M8YA 4BBYA 3VAJA 1RSCA 1C0TB 3NS7B 3K5LA 1CJUA 1RBLA 3ZNUA 4LF4F 2RRNA 1PJ6A 2XMVA 2BBEA 4ZVGA 5KOXA 3KK3A 2B6AA 3G8TA 4F8RA 4JI8F 4LFCJ 1KQFB 3M8ZA 2W4PA 4DLGA 4N7TA 5ETNA 2CJBA 3UFCX 4MYTA 5A0YA 4DXLA 2VPWB 4JI3J 3R7SB 1FD2A 1XWLA 4I64A 2J9EA 3CXCR 3DNCA 4CWBA 1F5AA 1SB6A 4HR2A 4KFBB 5J2PB 3QNWB 4Y2IA 2BEFA 4LSZB 2HHPA 3DLEA 3T1AA 3LPYA 5KG0A 4OYBA 4KB7A 2MQMA 3HD2A 3D67A 2YNFA 2ASJA 3H4DA 2DGUA 3QIDA 2HEKA 1AUDA 2C3MA 3MWBA 2V8GA 3VCDA 3M6UA 6AT1B 2I8EA 1OY9A 2IC3A 1VBKA 2CYYA 1MMLA 3NY0A 3O44A 3WIVA 1H6KX 5HJYA 3FSIA 3KHLA 1HD1A 2XG8A 2YNHA 4GVBB 1W2IA 3LF0A 1TAQA 4YB5A 2X7IA 3W9HA 1NEEA 2EEYA 4ZJQA 4B08A 3MFHA 4HHHA 4MK7A 1EP4A 4RX6A 2D1CA 4F4XA 1WJ9A 2G2ZA 1QJHA 1PYOB 3KLIB 3JYTB 4J9MA 3R5AA 1LWCB 4OI6A 5ETMA 3MEKA 2Y8YA 2HHTA 3M8SA 1RUSA 5BYQA 1T03B 4P9SA 1IJEB 5DG9A 1HA1A 2PA8D 1M0SA 2HLUA 3HHKA 3VVTA 3KK3B 3BQ2A 2CUYA 3SCJE 3IS9A 3MM9B 2VFRA 3GCWP 3NAIA 1DTQA 4TLRA 3CF5Q 5CXTA 1IR2A 3PHEA 1FX4A 5CD4H 3TX8A 4M5NA 2RD5C 1T9UA 5BYRA 4ID8A 3H7HB 2B7CB 4QW9A 3UCZP 3G9CA 4KFBA 3CPWR 1VQ6S 4JI8J 5KFJA 3OT9A 2IM0A 1KWMA 3OLBA 3B8HA 4M5IA 4IR9A 4JI3F 3I96A 1IKWB 5K8OA 2J0QD 4KY3A 2KO1A 3W66A 2O5DA 1U1LA 3CC2S 4OZ0A 3I6PA 2R7QA 2E7XA 2YNHB 4GVBA 5CCMA 4F50A 4ITSA 3ICLA 2UV8A 3DMJA 1JLCB 1X4DA 2ZVSA 2JWNA 2G0JA 1WTBA 3M05A 4OI0A 1BE4A 4NCGA 1TV6A 3KLEA 1TTHB 2VDIA 4XPCA 5L1LA 3EUNA 1T8EA 1T03A 5KG3A 4UZBA 4HH1A 4YP3A 4PABA 4B9SA 1ICEB 2CZVC 3UPFA 4ELUA 4I2QA 4LF1A 1HYSA 3J7A1 2QA1A 2OEJA 2VFSA 3S01A 4CCHA 3CDAA 2QRRA 1BQNA 4DV4J 1N36F 1RK8A 4Y34A 1ITPA 1WHWA 3ZZRA 4HL9A 5GAEU 2FLLA 4JYAJ 3CJ4A 1URRA 3UNYA 1WSVA 5AE3A 3VF0B 4EBCA 1IR1A 2HBZB 1VHIA 1TKXB 3C15B 3EM1A 4LR8A 2CADA 5KT3A 3P3DA 7AT1B 2V4QA 1EKRA 1CJTB 1QD1A 3DRYA 2W24A 3BSNA 1NM2A 2LDIA 1M5PC 1YVFA 2I1RA 3N5BA 2BV3A 2MZJA 3SSSA 1U1PA 5T41A 4ZP7A 2CWXA 2YH0A 3DM2A 4ICLA 1NDLA 2GQ2A 2ZE2B 2OPQB 3FRYA 3TI0A 3KNAA 1DQ9A 1FXRA 2UUAJ 3MMCB 2B43A 1OQ3A 3V4MA 4JV0A 5DQGA 4PEOA 1GFWB 4ZVOB 5AE2A 2NXCA 2GV1A 4U6PA 1A6LA 3D5MA 4HTIA 2N82B 1CQMA 2NXUA 3Q86A 3B6BA 2H51B 5KG5A 1VOMA 1RTJA 3HZEA 5DM7Q 4DF4A 4TYBA 2HZAA 2J0XA 3AOBA 4BS2A 4ECZA 2VOOA 2GIQA 1PGZA 1R31A 4OHZA 1RHUB 1FK9B 1G2EA 3BF4A 1SKWA 1WEYA 3KLVA 4H4OA 2XWYA 2HHHF 2ZDPA 3TO8A 3CMQA 4WFBQ 2XSJB 2E5LF 3FBBA 3DRXA 4ED0A 2E66A 2KH9A 4DSEA 3RAXA 2BZ2A 4IH5A 2P9EA 5F8MA 5BR8F 3ZTRA 1UEUA 2MPUA 4UT4A 1RAIB 4MK9A 4KRWA 3MEGB 5D8HB 2AEJA 2HZCA 2W8KA 3OTOF 2J76E 4ID5A 1PO6A 2UXBJ 1LQ9A 1JJHA 2DRBA 3DDNA 1GMWD 2K3IA 1YI2S 2H48B 4LF7J 3A3PB 1XNQF 3C14A 3MMJA 1RTDB 2LU1A 5IT9Y 1FNMA 2EKYA 2XZTB 5DQHA 3DI6A 2UUAF 1X5PA 4LJMA 4F4WA 4Q0BA 3R5CA 3FSYA 1JJCB 5KFUA 2LFVA 5IXUA 1S72S 4USKA 3FSXA 4RW7A 1VK3A 5E3RA 1FRMA 2RF2A 3R5BA 2ROEA 1U48A 6FDRA 4JB8B 3FDSA 2DGWA 3OTCA 3CCSS 1N32J 3KYLA 2LVWA 1R3NA 2QGFB 2ZD1A 4ZP9A 4CLYA 3JB9k 4DX7A 2ZBCA 4C6AA 3KK1A 4JI6J 2ZC4A 4OJ1A 5KFTA 5JJBA 4K4WA 4C8LA 2VBYA 2XHWA 2R2TA 3I0RB 5ETTA 3QLHA 2R3VA 3MURP 3HX9A 4O3QA 5CABA 4DF8A 5BR8J 3GYXB 4ZVHA 1UEVA 3DRRB 5AXLA 2YWHA 3QO9A 2YPYA 3N4WA 1IKVA 3U1NA 1S1UB 1VJWA 2WW4A 3VGVA 2IHR1 2V2ZA 3M7VA 3Q8YA 3OTOJ 1DURA 2DHAA 2G1HA 1RLCL 1N5VA 1TFWA 2AJ2A 4R5PB 3MM9A 4OZ2A 5B7WA 1L3UA 5H9EK 3H4BA 2BDPA 1S1VA 1NH8A 2HFZA 3D2WA 1IBMJ 2IDEA 5KFIA 4C3MA 5B09A 1YK9A 4E2FB 1BY9A 4PRFA 2EBEA 2W2NP 4URQU 4X4OA 4DWIA 1Y7PA 2DCUB 3HDSA 1D9AA 1KFDA 4RBVA 2B8PA 2N7YA 4LRCA 4Q8EA 2WTFA 3QAUA 1ZAXA 2WVFA 1BMQB 2ZUAA 2GMLA 2PI5A 4PWDA 1HHSA 1KOOA 4ZLJA 1UPPA 2I0XA 4B02A 2MGZB 4G1QB 2CVIA 3SCIE 3UN2A 3TAPA 1NSQA 1RWMB 1X4CA 4IG3A 2IDLA 2QZ8A 5IQ6A 4QWCA 2EG2A 3ZZYA 2UUTA 4KGMA 3SXLA 4FS2A 3J7Z5 3L7PA 4NCGB 4KGXB 1IWGA 2FC8A 3TAMA 1ZM2A 1WC5A 1ZBTA 2B4OA 2B0GA 4L74A 4HT7A 1VRUB 1LEOA 2QMWA 3HVWA 4RW6A 4S0MA 3Q23A 2CJKA 2IY5B 1IQTA 5F41A 2HYIB 4FVCA 4QR1A 2VUGA 3RGIA 3SEOA 4RWWA 3T19A 3UDEA 2HGMA 3KMSA 3CCMS 1B0VA 4DLEA 2AWZA 5ETSA 4C8MA 4OYXA 2E9TA 5HI7A 4YS2A 3ZTQA 1X5OA 1ROFA 5I3PA 4CRJA 4CYUA 4X65F 2AZ1A 1IBMF 2RQMA 1F6TA 2KFYA 5DLFA 1WI6A 5DJBA 4I67A 3OL8A 3QJLA 3QGPA 5KT2A 3HKZD 4CLZA 4C48A 2A0FB 4YUDA 4ZPBA 3K5MA 2VQFJ 3W64A 2D3UA 4X4RA 2CDQA 3CJ3A 1DTTB 1FERA 2KFZA 3QAEA 5JVHQ 4B3RJ 2FJVA 4U95A 1I51B 3J81Y 4OFZA 4Y2MA 3IG1A 4DL3A 1HBUA 2VASA 1ZPWX 3MM5B 3VZHA 1SVDA 4YR3A 2H5JB 1RTHB 3HP6A 2YWKA 3G4SS 3QWUA 3ZZ0A 4K59A 1KC8T 1TFYA 4EGLA 1U6ZA 5LXRA 3IAM9 2AJ1A 2BJDA 4FNHA 3MM8A 2GHVC 3MEDA 1WC0A 3OPKA 3D6TB 3DLHA 3PEHA 2FGOA 4I2PA 1SIWB 3IRWP 4K5SA 2A3JA 2RU3A 4DV3F 3RUBL 4J91A 2YKOA 4KT0C 3NCQA 4UOFA 5DS7A 1S6UA 4QWAA 4DL2A 2WSFC 2EVZA 1NJYA 3IWNC 4DR4F 1RWPB 1IN0A 2BKPA 4ENOA 4UZCA 1A9NB 2UXCJ 1T95A 1YWXA 2GHWA 3KFWX 4X65J 2A6MA 1R8AA 4LSLB 4C11B 4J9VA 4LF2A 5F9LA 4DV0F 5FJ4A 2ZHBA 1SV5A 2A10A 2XLIA 2GMJA 2EWHA 1S0VA 2F7VA 2KI2A 4CTAA 4DPWA 2FB0A 2VOPA 2KVQE 2MKYA 1XQIA 4J9RA 1HBUB 2QA4G 2V50A 3MPWA 2QLXA 2BE2A 2V63A 2QA2A 3FCWA 4QQBA 3K58A 3SV3A 4GC6A 1J5OA 1HIYA 2RILA 4CLKA 3FBFA 9ATCB 4DN0A 4QU6A 3M1VB 4P6QA 2HK3A 2VBZA 3EGVA 1PYTA 2DGTA 3MUMP 3K5NA 5KFVA 1Z2ZA 4M5KA 4PPZA 4YDDB 3GE9A 1UEKA 4CH7A 4K4YA 1W7WA 3CSKA 3KJNB 4KAIA 5HMWA 4FYYB 4GC7A 1XIQA 2MZTA 3GFYA 1LW2B 2V34A 1NZ8A 1OPZA 4DU7A 4F25A 3KK1B 3UNGC 4CLWA 2YKMA 5AXKA 3Q8VA 2DHGA 3NXZA 4KKOA 3PR4A 2NXNA 3G71S 2DR6A 2JHEA 4WU2A 3GU0A 1Q8LA 3NGRA 2F3JA 2BOAA 3NGSA 4MYUA 2H1YA 3GV8B 3P6YC 4ZIWA 1WI8A 3HZGA 1FRJA 2IA0A 3V6KA 4DV3J 3AXMA 5C7PA 5LSRA 4C0HA 4U9RA 5L9XA 1UZDA 1VC6A 4K50A 4YR2A 2M9KA 4X64J 1TV6B 2YQ1A 3BKTA 3DM2B 4ICLB 3RU0A 1M5OC 2UXCF 4OI3A 3JAMY 1VQMS 2DNMA 1A7GE 1WHYA 2FUG9 1U45A 4FBTA 4N41A 3VAFA 3CO9A 5L38A 1GXLA 3PZPA 2DRDA 2LQ5A 4ZK7M 4K2XA 3K59A 3D66A 2CNOB 3T5HA 1VYAA 1LW0A 2OI2A 3VAKA 5IM0A 4ECUA 3BJYA 5HL7Q 1QAXA 4AD6A 2KM8C 4DR3F 3SSQA 3MUVP 1T3NA 4CDIA 4ZOSA 1GH8A 5KFZA 3QGGA 2HQFA 1SC4B 3CJQA 4X66F 1XBWA 2LXFA 1KHWA 2FVPA 2DY9A 1FXLA 1RAOA 3DOMA 1IWAA 3OQ2A 2B4VA 3SCLE 3KJQB 1M5KC 3HHLD 2LU2A 4DBQA 4ZMMA 2C2OB 2GAHC 1KOHA 1HL6A 2Z8QA 2GVDA 3PJWA 4PG5A 5I3QA 2LXUA 1RCOB 3CDEA 4U8YA 5D78A 4ZDNA 5LSLA 2HVIA 1R0AB 3MTKA 5KFNA 2ZC3A 3FJ2A 1N8RT 4JI5F 3GV5B 2IVFB 3I5CA 2CPHA 4ANEA 4MAKA 2FJXA 2WVDA 1G6BA 1Q7LB 2DGXA 2HLTA 2DGVA 1VRUA 4DQSA 5CYMA 2J6SA 3KOAA 3U02A 4ELVA 3FQLA 1C4CA 3QATA 1WUUA 2AKWB 4NLUA 3IN5A 1S59A 3BZQA 3AJ1A 3MCNA 3DGPA 1ZOTA 2PMZD 4EBDA 4TU9A 2GQQA 2VZ9A 1S4EA 3MR2A 3H2VE 4DR3J 4NYPA 3IR6B 4NA1A 4OI4A 3CCVS 2BW2A 3A8EA 1JQGA 4J7CA 4BCAA 2RRBA 1QDUB 2JLEA 2ZOGA 3W60A 1E6YA 4X66J 3GILA 3CW2C 4K0KJ 1R0CB 4DV2J 1KVJA 1TL4A 1GMUA 4X62J 3UVJB 3TANA 2GW8A 2WBMA 3MAAA 4USTA 3EYZA 3UDLA 8RUCA 1FNXH 2R7WA 5HSPA 2VD3A 4QU7A 2AGOA 2LA6A 2XMWA 1QVGR 1PC4A 5EDWA 1IXKA 2M70A 5B0AA 1JLCA 1D9FA 2M0GB 1FTCA 2QE5A 3AD9C 4DI6A 2ROGA 4NEYA 2JDJA 3B4DA 4B9MA 2XO7A 4R0JA 1U25A 2G4BA 2BKOA 2DNZA 1VC0A 1N0VC 4WWSA 3M8PB 1SCJB 2QLWA 1JJ2R 4ZVUB 1U7LA 4NLDA 1KHVA 1Q0NA 5A0YB 2GO9A 1CQNA 4DX8H 1HQEB 4DSLA 5H9FK 2FLOA 5J2QB 4M5JA 5FD1A 1NPKA 3VGSA 1RGVA 2KT3A 3PACA 4O4RA 2JEFA 2VJUA 4LBIA 4ED8A 2GHPA 3PX0A 4B3OA 2KHCA 3EWGA 2OTJS 2MTLA 3FMBA 2DBBA 4CH1A 2DR7A 1R0AA 1YDLA 2YWFA 3FFIA 4P52A 4Y65A 4CT8A 4CTAB 1UKUA 3MAAB 2CA9A 4NE9C 1NDPA 3D4JA 3CCJS 4FF2A 1HNIB 4USMA 4UOHA 8ATCB 3SSRA 5J2NA 4O4GA 4DV2F 5J2MB 1NB2A 1RHRB 3FZBA 1NJZA 4X62F 4KJIA 4IRKA 3D1OA 4EU0A 2DB1A 1K44A 2CNKB 2F8EX 2MZQA 2QLJB 2V4JA 3DCAA 3AB4B 4R0EA 4CO2A 6FD1A 5L46A 3GIIA 3I9V9 3QRQA 3NMAA 2OD4A 4CLLA 2LEPA 3CJ8A 1BQMB 4OQJA 3GLJA 3VHQA 1W2BR 4HTJA 2GJFA 4O3RA 2OH2A 4FF4A 2HPUA 1JKHA 4IG0A 1K73T 3C6UB 3ILJA 3M2UA 3D0HE 1U2FA 3MEEA 3O8WA 1CSJA 2RUGA 3H42A 4LRAA 1AZSB 2RT3A 4WE1B 3TVZA 2JL9A 3G6XA 4LQ3A 1H38A 2HNDB 1JLFB 3A8IA 3EVOA 1MROB 1YZ6A 3PX6A 4P75A 4Q45A 2QIFA 1Q82T 4W4MA 3GJRB 1S1TA 4W98A 3TEGA 1HNIA 2CQ2A 2AP6A 2CQDA 2B5JA 4FP9A 2W7PA 3CMAS 4JV5F 2YKNA 4P7VA 3LGMA 3LALA 2G0CA 4OMFG 3H5SA 2RQKA 1BGXT 2H4YB 2V4JB 4DR2F 2LECA 2RAQA 4JP8A 2WSEC 1C1BB 2WRMA 5GAHU 5CYJA 4QIWD 1PAEX 3W2VB 3RRHA 3C6TA 2KTQA 2MQOA 2DO4A 3QIPA 4CLTA 2QYGA 4DUZF 2DYAA 4OLPA 3OVAA 2R7RA 1B0TA 4XTTA 2RUSA 3ADAC 2RF2B 3LP0B 1MW7A 3UDVA 2KFNA 2AT1B 3KLGB 4JI2J 2C22A 4RU9A 4YFUA 4ZVQB 1N33F 1J27A 1FWLA 1C1CB 3TA1A 4JI4J 4B3OB 3IWLA 4B3SJ 5D6GA 2JZ5A 2PN6A 5HO4A 3A13A 4KE5A 3OR1B 1JLQB 1M5SA 4NYOA 5CZXA 3TRGA 1YITS 1UA1A 5KG2A 3RYLA 1F3VA 1UJ6A 5B0EA 1FKAF 2DHXA 1OYEA 4L72B 4AE5A 4N47A 2A2DA 2WVBA 3QMQA 3QO9B 3IA0A 3R27A 4WP3A 5SZTA 1QSLA 4CO1A 4UQGA 1RAGB 4EUVA 2V9WA 4C8KA 5GMDA 3MEDB 4ZVPB 2AX1A 3SQGA 4RO0A 4DPOA 3NGTA 2M3DA 1KQGB 3T3FA 3M32A 3I5AA 1HBMA 2RHSB 5CHCB 3CJSA 3JTOA 3FVYA 3W63A 3RG6A 1N0UA 4RNFA 4ZN3A 4DV6F 4DS5A 3QRPA 4DR1F 1RWOB 1SQGA 4NLPA 4TQRA 2KT5A 4JI2F 1Q5VA 3QSIA 3PW7A 1JLBB 1U1RA 2XMJA 3BPDA 2ZOMA 4KYZA 2QG9B 4O44A 2VA2A 3PR5B 3OL9A 3DDKA 3MM6B 2VG7B 4ID5B 4FKYA 1F9EB 5IV3A 1VQ7S 1F3FA 2JEJA 3POTB 3P49B 5E5NA 4DV1F 1NMEB 3I87A 4OX7A 5EWGA 3D1HA 3HFZB 3PTWA 3QT6A 3M1VA 1S6QA 4F0HA 4ECSA 1CC7A 3T1YF 4V19J 3T5LA 3SCKE 3UI3A 1WWHA 1M90T 4DV7J 1RAHB 3UWTA 1HW8A 1SJ1A 2H4WB 3B4MA 4RLEA 1NKCA 1LV5A 2E1PA 2J9DA 3MECB 3W2VA 3DOLB 4KHRA 1XR5A 3BGRB 2MZ1A 3LGHA 1EHWA 1VQ9S 4LSNB 4ZVFA 1VQNS 5HJXA 3K8WA 1UP1A 3DGVA 2E7WA 1U02A 2XULA 4ZITA 1FFGB 2BW7A 2CNLB 3GCXP 3IBCB 2BM0A 2EFOA 3DLEB 5K5MA 3GFXA 5B0GA 4ZPWR 5K8MA 3BH7B 5GADI 2W2MP 5T7LB 2YKAA 2B7BB 4A8OA 4IO9Q 4WFZA 5L1IA 1HQUA 1N5YB 2E29A 2YNGA 1B3TA 1GTHA 3U1LA 4DQPA 5LJ3Y 3HO1A 2QLBB 1BC6A 2MLXA 3AD8C 4IH6A 1TP7A 2A18A 1HMVA 4W90B 4RNHA 3JYTA 2X1GA 4HDHA 4I68A 4PG6A 3RB0A 4A46A 1AB8A 1G3OA 4MJKA 1SKRA 4B3TF 3R5JB 2BUNA 4WTOB 4NXMF 3DI6B 2G2OA 1KLMA 4LRFA 4P2MA 3C16B 1RT7A 3T1YJ 4NXNJ 1FJGJ 2DNPA 1L3SA 1RI7A 3E01A 2HVZA 5CYQB 3NRBA 1VQ8S 3RR7A 2VKRA 3H2UB 5J1EA 4DV7F 4AQYJ 3V6HA 2IBKA 5CAAA 4DG1B 2QYCA 1R8PA 5IQQA 2AF6A 1U1NA 1TQLA 3MR5A 4TNOA 5M2RA 2CPIA 4P10A 2CXEA 4B17A 3FEZA 2OEMA 1Q78A 4FXWA 1WD6A 1S57A 1ZAVA 4PZVA 4OZ3A 3AY0A 1HWIA 3DRSB 4H4MA 4WKYA 4TQSA 5IT9U 1YZ7A 4DR5J 2Q66A 3ISNC 2R42A 1K47A 3TR5A 4ZHRB 1RWUA 1WKLA 1DY3A 3MMCA 1G4CA 3E3XA 2UVRA 5K20B 1PJ5A 1PAUB 2EC0A 2ZOFA 4FN5A 4Y2AA 2AEMA 4ZPDA 4USJC 4AFFA 3QJJA 1M1KT 4G3IA 1NK0A 2NZCA 4CZCA 2Y8WA 5EHHA 2GX8A 1RTZA 1HWJA 3V81B 3NCPA 3KG4A 3KNGA 3QIPB 2CJ9A 3W8PA 2OPRA 3FCVA 4I56A 3G82A 4LSNA 4LT6A 1AFIA 5C42A 1FJCA 2YY3A 2W4DA 3N5FA 2VODA 4AXIA 3CJ2A 3D3BJ 2Z2ZA 3G87A 2VPYB 3NG8A 2A6OA 2DIVA 5IT0A 4OL8A 3UCUP 1GNKA 3DKDA 2C2ZB 3ITHA 2ZZNA 5ETKA 3MGJA 1H72C 3PW4A 2Q43A 3KKFA 1X7VA 2FQQB 2XMUA 3K17A 5I42B 1RWWB 3FCHA 3GR1A 1RAJA 2N4DA 2NR0A 1TKZA 2V69A 3Q83A 1F60B 4P7TA 3VGTA 4EWTA 5D0EA 1MWYA 1VR6A 2MZSA 5A2QU 1H3DA 2DPIA 4DR5F 4ANCA 1N48A 2WK4A 3DOKA 3M2VB 4KO0B 1WOSA 1ZM4A 3VV2B 2HFOA 2DNLA 3T6JA 4PQUB 2NREA 5E0OA 1KBRA 4O3OA 4YHHJ 1IUJA 4AL7A 2KYXA 3D28A 1S1WB 5GAEI 2J6TA 3QYYA 1Y0HA 4WJBA 3RBXA 1HQEA 2Z4PA 1X4BA 4UTGA 2VF3A 2XMKA 3AAWB 5KFYA 3M2RA 2KG0A 2YTCA 3KMQA 4RKUC 3ILOA 1U2CA 1PILA 4M5GA 3TWZA 1FEHA 5M2UA 3LWMA 1S9EB 1VRQC 2M52A 4NLTA 1YKWA 5B0DA 1UTAA 5THWA 5C24A 4F04B 1RZMA 1S10A 5LT5A 2XY5A 1WG1A 2HK2A 3EGNA 4CLUA 3H25A 4QIEA 4EI2A 2R4FA 1HARA 1R8BA 4TY8B 1KQSR 1RKIA 4IFVA 3LANA 5CH7B 4JI7J 1HFEL 1Y3KA 2Z30B 3M6VA 1C4AA 2RDDA 3AHPA 2WAQD 2XBPA 5IS2A 3PCOB 4LF8F 2DNGA 1RTDA 3D54A 1QSYA 1EKSA 5A8WB 1IVZA 4MKVA 5DO2A 4EMDA 1DRZA 3SBMA 2E44A 2Z0GA 4I6WA 1K9MT 3PYFA 1QSSA 2R7OA 1YJWS 1HBNB 2ZBIA 3O2IA 4HLBA 1JMTA 5CA5A 1WEZA 4KR0B 1Z4UA 1REVA 2AZ3A 3I56S 2YWGA 2PEBA 4P2FA 1SIZA 3M2RB 3M6XA 3MM8B 3P96A 4YHHF 3OHBA 3EPGA 3BQ0A 3NNAA 2U1AA 2ZBRA 4DJBA 4ECWA 1FFWB 3P4UB 2FZCB 3GYGA 1SC1B 3IGNA 4WU3A 3RJMB 3PDNA 1H73A 4MMOA 3A3OB 5T7LA 5C24B 5IWAF 2MGZA 2AQ4A 2DR9A 1H2TZ 3CCWA 5HVFA 1XC9A 1VK8A 1SC6A 2DITA 2EBGA 3BR8A 3PRDA 1FRXA 5J2PA 3BBFA 4KPYA 2CWKA 1T7PA 2OPPA 1VISA 1X0FA 1RWKB 3TA0A 2YKNB 1TAUA 3GTYX 3AXKA 4NLQA 1EJ7L 2V8VA 3ULHA 3MCOA 3O1LA 4RW8A 4IQMA 1WC6A 2YQ0A 4UOGA 4B9UA 1REGX 1GK8A 1RHQB 1RTIA 3HHLA 1FHTA 1CC8A 1O5JA 4RNMA 2XS7A 3NAHA 3QRRA 4A8MP 5A8WA 2DISA 1VFJA 4JI7F 1T11A 4M5HA 1YRUA 1GMWA 2DHHA 2ILYA 3PJ9A 4QIVA 4C8YA 1NHKL 1Q79A 2FVRA 2GQCA 2HRTA 3MMAA 2GC8A 4QPTA 2JOQA 2Q3PA 2ZKTA 3IBWA 5IM0B 4A8SA 1PC5A 4PG8A 2ZM6F 4DS4A 1TVRA 1Q7YT 1FRHA 2VC0A 2XQCA 4OHVA 3LH2S 5H1SV 1Y5NB 1ZZFA 3J80Y 2JVRA 4YB6A 4J9NA 1S9EA 3QZ7A 2HGLA 2OKQA 3Q22A 1V3ZA 2IMWP 4J9QA 5DG8A 2DTJA 5J2QA 3Q2TC 4HHJA 3HFVA 1X5SA 3NOCA 3MUTP 3R2CJ 4X4SA 1D09B 1MLAA 3CWJA 3H90A 2M4MA 1TKTB 1FFSB 3LAKA 3N9UC 3BBCA 2WONB 3B82A 5LMNJ 5ETLA 2CPJA 1S6PA 1FDBA 5D3GB 1RT4B 4OI2A 4V19X 5IZHA 5F8HA 4LF5F 4ETXA 5HN0A 2UUCF 4DR6J 1TL1B 1GX6A 5KG7A 2L3MA 3CC7S 3GFZA 3RAQA 2AIRB 4RW6B 2AU0A 3KLEB 1YX2A 3MOZA 4HKQA 5EUHA 3JQKA 1LW0B 3C46A 1NSPA 4OV6A 2ZNZA 1IQZA 2D3O1 5DDQC 2WB4A 2AHOB 1TZ0A 5HLFA 2RB7A 3RRKA 3M4XA 1NK4A 3Q24A 3D9BA 2CPDA 3RBEA 4OHYA 3AB2B 1ULRA 4UOCA 1RBOB 3IR7B 4USWA 4ZCKA 2HS0A 2V68A 4CLPA 4EK2A 3PV8A 2AV5A 1K1QA 2E1CA 1U09A 3OR2B 1T9WA 4F4ZA 2XS5A 4LSLA 3UO0A 2NXJA 4ZLPA 3IP0A 2GJIA 2HNDA 3JAMU 1X9WA 4WFYA 4MIBA 4C4WA 1U2RA 1DAXA 3KJFB 1EARA 1NCLA 4Y6IA 3BN4A 3F73A 4J9PA 1ZTTA 2FLNA 4CH0S 4OX9J 3DFEA 1YBUA 3OTEA 3T41A 2ZE2A 2XZDB 5LMNF 5HP1B 4NRTA 3IGVA 4DQIA 3QFHA 5D0RA 4OZLA 1GEHA 2CQPA 2P6SA 4KV8A 3B54A 3K2YA 1ZAWA 1WHXA 4KQZA 3S7RA 3WQPA 2AGQA 1NXIA 4EFAC 2UUCJ 2L9DA 1FO1A 4DL5A 4DR6F 4H54A 2NPFA 5JXSA 1MN7A 1F5CA 4MKBA 3HJFA 1EETA 1HLWA 1KLMB 3E51A 2HBQB 4OYOA 4J9OA 4N8OA 3QGIA 2A1BA 1U6FA 1AUSL 2J0SD 1HI0P 5HK4A 4DQRA 3CJKA 1F2HA 1KONA 2VBWA 3PO5A 3BKFA 5IC4B 1HWKA 3HLUA 3WC2A 2F1FA 5A2QY 2JH3A 1CPZA 3PYGA 2Y9HA 1GX5A 2GIFA 2FVSA 1B4SA 2RS2A 1O8BA 2XYGB 1X4FA 2W25A 2YNFB 1YQHA 4QR0A 5ITHA 1BXNA 4WFNQ 3KHGA 3SFUA 5DLGA 1UMJA 3G8QA 4F4YA 2ERRA 1FKPA 2RKIA 3JSBA 1HW9A 1NNDA 3ZC4A 4I7FB 4F3MA 3IMQJ 2Z2YB 1MWQA 2XNRA 1RJJA 2VBXA 2CPEA 5DGBA 3IAS9 3J7YU 5J2NB 1SQFA 3KWMA 4M95A 2VB6A 4BWJA 3BDPA 4LRBA 1FE0A 4DL0C 1J5OB 1QUPA 4F4KA 4Y3CA 2NQPA 4A47A 2CRLA 3PKMA 4KHPJ 1NDCA 3RTVA 2E9RX 1R89A 4QWDA 4H4OB 2CPFA 3DLBA 1N5SA 3RZAA 2AEFA 1GMVA 1UETA 2XSJA 4ZJOA 4XPEA 3CTRA 4H4KC 1RT3A 1SH3A 2CQCA 5KFSA 5HQ8A 2QSWA 3M8WA 4QZVB 5LSOA 1KVKA 1MWZA 3UN3A 1FESA 1WKJA 1FI4A 3KDNA 1FWPA 4FPRA 5HVHA 2B4UA 2LCWA 4DV5F 1TL7A 1CS4B 2I5JA 3J7YI 4X4VA 2A2CA 4DPXA 4EO6A 5DG7A 4LUBA 4JV1A 3D0IE 4M5DA 3W62A 4OYIA 1SKUB 2ASYA 3GIRA 3T9NA 3CCRS 1WKKA 5J1PA 5T14A 2IMOA 2GNKA 4MH8A 1FRLA 2PEHA 2R8KA 5KFOA 2FC9A 3MPDA 3QZ8A 4DL7A 1TUWA 2K2PA 2MQQA 1OJ4A 2EFNA 3I32A 5MAOA 1SJFA 4QYZJ 1YJTA 3QJPA 1VIOA 2JLFA 1AW0A 3MZIA 1I3OB 4GKKJ 3HSZA 2UVWA 2XGQA 1V6HA 2V5HG 4Q43A 4PQUA 1SXLA 1PCAA 2PC6A 5AJ3J 2QX0A 4ZCIA 1NRKA 4Z7CA 2V9KA 4DSKA 2VFUA 1T3OA 3BEGB 3G6ES 1UVJA 2DXDA 2W7AA 4FNIA 4UUWA 2KHDA 4C2MA 1JB0C 4HVZA 3Q8UA 2HIYA 3CCZA 2P2CB 3EZUA 3AFGA 4MFBA 4DX5A 1N6QA 5KFPA 3FUYA 2PSZA 3AQPA 2UU9F 2D9PA 1O6XA 2JFDA 1FKOA 3ENVA 1IKVB 2R2SA 5GMEA 5FLXU 2IYGA 4G65A 3GONA 1OO0B 1Q1KA 1YG0A 2O66A 5GVQA 1P8GA 1UZHA 1L5UA 5KFGA 2HHQA 2BE7D 4F7VA 2CQ1A 4LF4J 3JS9A 5EWEA 4WFAQ 2UUBF 5F8JA 2Y0SD 3DLKA 1QM9A 3B78A 2GS8A 5E33A 3VQSA 8AT1B 5DQIA 2F8MA 1Z2LA 2ZHAA 4NLSA 1BHNA 2ROPA 2KVIA 3US5A 1JLEA 1DQ8A 2PGCA 3CD6S 4Q5VA 3PYDA 4CT9A 1SJ3P 4K2JA 4KC5A 3N01A 2DVIA 3TJAA 1NK6A 1RT3B 4Q2LA 1E6VB 2ASLA 3ZZOA 2KKHA 3BREA 1HBMB 4LREA 3PM9A 3GG1A 3QWPA 1HQ2A 3M6WA 1REVB 5J1EB 5CQGA 3KJVA 4WKRA 4ZPTR 2K7KA 2V0NA 3CJ5A 2MXYA 5AJ3F 3UD4P 3SIPB 5LMUF 2J9CA 2E9ZA 2CG8A 2OD6A 3BSCA 3DXSX 5IV4A 2ADBA 1JIHA 2G1DA 1V9OA 5D0HA 1IBLF 1URNA 5HMZA 4M5LA 3K0JA 4RUCA 4I6YA 4CNYA 4F26A 4QWEA 1KD1T 2YKQA 1Y5IB 1NJXA 4H4MB 3ZFVA 1ZYQA 1AYEA 1U47A 4C98A 1RP5A 4DPYA 5BJRA 3NMRA 2RIJA 3MM6A 1M5HA 4ILMA 4Y28C 4RZRA 2VPXB 2UU9J 2R7XA 2O67A 1U1MA 3CDUA 1DHMA 5HQMA 3CCQS 2BANB 2BQUA 2BRKA 5F8LA 3OSNA 1UFLA 2QLFB 3EMTA 5EX3A 4FYVB 2GGPB 3L95X 4ZKAA 5F9NA 4FF3A 1XMBA 3PJXA 3LUYA 5D4OA 3HJVA 2V2KA 2BKNA 2XNQA 1RT5A 3MM5A 3OXLA 3HPOA 3FZ2A 3P5TL 2KB2A 4QOTA 2W9BA 5KAKA 2EFGA 3GB0A 4ZIVA 1FVSA 3KHHA 3GIMA 3NNCA 1KNZA 2CQ0A 1ZS6A 4A8KA 2F9DA 2B51A 3HK2A 4NYZA 2RDJA 2BXJA 4TN2A 3HHLC 5DZ7A 4F36A 1TMJA 2ZKUA 2JRSA 3KLHA 2PMHA 2W2QP 3OD2A 4UY85 1R8HA 1NSKL 3OXGA 4K4TA 1JX4A 4RU2A 4C8NA 5HANA 2YBVA 5DETA 3HULA 3W5XA 1X4AA 2HHSA 1VQ4S 1S6OA 4BWMA 5LMUJ 4RL1A 1JLBA 4YEAA 1WG5A 2HFVA 2PIIA 2FJBB 1U4BA 3HMJG 1G7CB 1QE1B 1RT6A 2MKIA 3AOCA 2BR0A 1QLNA 3TOQA 1TKZB 3A4TA 3Q89A 3TA2A 2W9CA 3EX7B 1D9DA 3I0SA 2JJ4D 3N6NA 5AXNA 4WFXA 3CB4A 2L48A 3QT8A 4DV4F 1N36J 2K06A 2OFHX 2R2RA 4ZA1A 1P9QC 4URGA 2RQCA 3L9ZA 2PO4A 5EWFA 4DFKA 1RT7B 2CJQA 1U0HB 3ET6B 3FRZA 3MECA 1IKYB 4K7QA 1S1WA 1CJKB 4I2PB 2HZVA 4HACB 2Z57B 1LNQA 5KFHA 1RAEB 1RCXB 3M8QB 4JYAF 1JXEA 4ZLLA 2WSCC 1T02A 5GMKa 1ZTWA 2R8HA 5HBMA 2G0IA 1XERA 3KLHB 2MQNA 1KN6A 5KOWA 3DYAB 3ONQA 2BJEA 1PKUA 5RUBA 5KFKA 1YJVA 4WE1A 3N79A 3VAIA 1D1UA 1S7HA 3MAHA 1JK9B 1FWKA 4JV2A 1J2VA 3GFHA 4DUYF 3HCXA 2CQ4A 2W1BA 2QSFA 3JXOA 1NKEA 1MG7A 2NSCA 2ZH9A 2EKNA 1JXVA 3K5OA 2KZMA 2VV5A 1HNZF 1J5EF 1UVMA 1APSA 3V5RA 4B9NA 4NCAA 3W8GA 1GQEA 4DN9A 1SPBP 2LKZA 1S48A 1JNRB 4U8VA 2K1RA 2M7SA 3OBIA 4IQXA 3KUEA 4HYKA 4CLFA 5F0UA 3G2XA 4TLQA 2CJXB 2RS8A 3TYTA 3F41A 4G1IA 3TEHB 4ECXA 1HI1A 4QIGA 3V6JA 3HHNB 3LP0A 1TK0A 1NBEB 4U7UD 2J8AA 2LLZA 2MHNA 2MSTA 3BBBA 3NCRA 5HBMB 3WBZA 5K9FA 2JC0A 3AJ2A 4OYZA 4ZVTB 5GADU 2XY6A 4J90A 1DLOA 3ITHB 1UVNA 3RB3A 2EFVA 4EZ9A 1FKOB 3BGFA 3HVAA 1RISA 4HI2A 2VPZB 3QGHA 2UVUA 3W65A 3JTNA 1VDHA 4AT1B 4TKTA 4YN3B 4X4PA 1PYSB 2E5GA 2UP1A 2XS2A 2EFPA 3U27A 2AJQA 4BDPA 4RW8B 5C2GA 3DHWC 2IRUA 4DUYJ 2PD1A 3ILIA 3TJ9A 4KO0A 5I3UA 2IYIA 1EZZB 2BJ1A 3CD5A 3EGWB 3EVMA 2KM8B 4F2SA 3JTPA 4ILLA 1HNZJ 1J5EJ 4MKYA 2AW0A 4WK3A 5CYMB 4F2RA 3IS9B 1IJFB 3DOLA 1IKYA 2ABYA 3EVWA 4XDDA 1Y00A 1KQKA 5KFAA 4D3GA 3L3CA 3V6DA 4M5MA 4JI6F 3KJVB 4ERDA 2CDRB 2KZZA 1XR7A 2NSBA 2MZRA 1Q8KA 2HFSA 3ETOA 4LVOP 1LXJA 1YRTA 2C42A 3TQ1A 4PWWA 4AL6A 1R6YA 2P8IA 3F44A 3IFEA 4WCEQ 2GVDB 3G6YA 3AA9A 2ZH2A 5F8IA 5IC6B 2ZITA 2MJUA 2POKA 2X3GA 4U7UK 4DDFA 2MB0B 2NCKL 1AXQA 2R8GA 1LOUA 3RB6A 2GA7A 3N28A 3MM7B 4NMXA 3CO0P 4Z2XA 2EXUA 1S0NA 3ENQA 1Q81T 1FDDA 2J8SA 3NGDA 4I7FA 3TVKA 1TL7B 2CQHA 2I5JB 3R6LB 4L6V3 3TW0A 4DSIA 4P72A 3AD7C 2MJNA 3IRXB 3ZTOA 2ZH7A 2X51A 1RT2B 2OSQA 1KKHA 5E3QA 1N5TA 3MPYA 1S1UA 1D3WA 2AJ4A 2GAGC 2HURA 2RE1A 3I5BA 7FD1A 2HHUA 1VI7A 1RTJB 4U96A 4ILRA 3A3NB 5F8NA 2DR5A 4USIA 2B6AB 4K4UA 4ZLNA 2FYXA 2QFJA 2CNNB 2BQ3A 3MCSA 3H2LA 2M8HA 3ISZA 3KUHA 2GVZA 5SUHA 4F02A 5CD4A 1UCNA 1VBXA 4NCBA 9RUBA 2ALZA 2Y1RI 1JLGB 4GMKA 1MN9A 4RWXA 2OIHA 1I5OB 5C5JA 3CIZA 3TUJC 2MKCA 1OMSA 1MU2A 2N7CA 1CBKA 1BQXA 1KSPA 3LO3A 1FD8A 4Y2KA 4I6AA 4JI0F 4P74A 2HHHJ 4OZJA 1NLKL 4OLOA 2E5LJ 3PYEA 1FX2A 1CG2A 2VU5A 2BJ9A 4E98A 1T9XA 2FY8A 1SUQA 4G6VB 1FTRA 3QQCD 2HNYB 2HW3A 2MQPA 3OJUA 4RBTA 3R3TA 4LBPA 2YQ3A 2AYEA 2VFTA 4DFJA 2AYGA 1EQMA 1SH2A 3KK2B 2X1FA 1FRKA 4DFPA 4P2XA 1N54B 5JVGQ 4Q0BB 1RTHA 3TUZC 2XY7A 4NOHA 3Q0AA 3NOGA 1RT1B 3EDQB 2J0WA 4LF7F 1XNQJ 1SC3B 3I9ZA 1HBNA 2EG1A 2JLGA 3RW6A 3VGUA 3IC1A 2IFXA 3C8YA 1JLEB 2VHGA 2JSXA 4PYDA 2OELA 5D0GA 3ILLA 1Y5LB 3AOAA 1B7YB 3FKBA 3HF5A 3LQVA 1S9GB 2FVQA 3JSRA 4ZP6A 2VQFF 4O0IA 4MT1A 1T05A 2F4VF 4AYBD 4WIQA 4XDCA 2G9OA 2BMBA 5LL6d 5BXIA 3KHRA 2QA4S 3W61A 3BO3A 4DR7J 4B3RF 2DH8A 4C9DA 4IKAA 5D77A 4PXCA 2ACMA 4ZCLA 3GQCA 3PW5A 3MD1A 1S9FA 2RJZA 3MPVA 5E7OB 4JI0J 3UDCA 2G13A 3M9NB 1S6PB 3OFFA 4Q44A 3V4IB 2JEGA 1S1XB 3WDOA 5EGYA 5LXYA 2F65A 3RBDA 2Y1JA 4X4NA 2FLPA 1Z1ZA 2VC1A 1T94A 3IG1B 3UD3P 3OSPA 4FS1A 3OVSA 4IDKA 1HNWF 1WF1A 4KGKA 1UW4A 5KFCA 4HEA9 2CJYB 2BA9A 4RW4B 1BD6A 1HPZB 1DQAA 3EJMA 2YWWA 2MKHA 4ER8A 2BJ8A 1ZA2B 1C1BA 2B9YA 3GWCA 3CEDA 5ETVA 4B9TA 1RT5B 2VKZG 4RJVA 3ISND 1TVRB 3JSMB 5U47A 5H9EJ 4C7QA 2JC1A 5B0FA 2XCPA 3C15A 1GT8A 2AX0A 3C66A 3QSYB 2HQIA 1TK5A 1Q5YA 3NGKA 4QIFA 4ECTA 1B99A 3CCUS 5HROA 2HIQA 4HHUA 4CQ1A 5ETRA 1C2PA 2GZOA 3E8OA 3MHYA 3D3CJ 1S1TB 1SJRA 1VGYA 4DPUA 2DHSA 4XK8C 2C2RA 5DRKA 1C1CA 1W26A 4I69A 5AE1A 2AYMA 4USHA 1KDNA 1E6YB 3VAHA 2ZZTA 3JQJA 2RRAA 4PUOA 2F4VJ 3A1YG 2RMLA 1SV5B 1L3TA 1HNVB 4DR7F 4WP8A 1UFKA 3P8BB 1P1LA 4IOBA 4K4VA 4R8UA 1NK5A 4DOZA 1CULB 2V6AA 2W9CB 5F0WA 1I94F 1QTMA 1JLAA 4KV8B 2Y1IA 3ENAA 2AGPA 1EX8A 1RWVB 3E01B 1HPZA 5CYQA 1VS3A 2JFKA 4ED3A 3LGNA 4KSEB 1OSDA 2DD8S 2CQ3A 3MD3A 4C0BA 2BOPA 4ALZA 1HNWJ 4QYZK 2ALYB 2H5IB 3KLGA 1XMOJ 3AODA 4G1PA 4WTYA 1TL3A 1KTQA 2D41A 3R9LA 3CCES 3M8PA 3PFEA 2V8DA 4LF6F 3SYZA 1RHKB 2DO0A 2E1MC 5L9NA 5FDLA 3H5UA 3R1LA 1HBOA 1LXNA 4NZ7A 5AT1B 4B9VA 1YJUA 2QT7A 3D6HB 2DRAA 4NI2B 1D8ZA 3FK4A 1WOPA 3TZXA 2CPZA 4X64F 1XJWB 2ZDOA 2HBYB 2ZH4A 3DLLQ 4IR1A 3C19A 2G2YA 4TY8A 1N34F 5EN1A 3R6GB 1YJRA 3HFKA 2CAJA 3KG0A 3CDBA 3IRXA 4PQAA 5AXMA 4DCJB 3J7AN 2HNZA 1DTTA 5E3PA 5C2CA 1FDNA 4IOAQ 1HD0A 4E0DA 3HVTA 1FKPB 1NO8A 1KP6A 2OHDA 1LWCA 4KGVB 2HRYA 4RPFA 5HMYA 1VQYA 3DLGA 4PYAA 4DCPB 4J9UE 1UWBA 2FVCA 4EEYA 4RNNA 2AYBA 2KXNB 2E7VA 1LWFB 2BX6A 2FJDB 5IOLA 1WNEA 4OYMA 1KFSA 2GVZB 2VJVA 4KTQA 3GSDA 1WF0A 4X4TA 1DJ0A 1XNRF 2YX4A 1I94J 2Z58B 3ZXWA 2FY1A 3NL0A 2D69A 2Q1LA 1V5VA 1R0BG 2Y0BB 2C3PA 1MU2B 2YVSA 4QW8A 1U1QA 1X4EA 4NLVA 2HS3A 3QFWA 3C6UA 4USUA 3IBFB 4K4XA 1XMOF 3I0RA 2HWIA 3H98A 4OHXA 4WZQA 1XR6A 3OW2R 3SDEA 4LF6J 3ZZZA 4JI5J 1V3RA 3UR0A 2YXLA 2LYVA 4TY9A 3OXFA 1VQ5S 5IT4A 1LFWA 3MMBA 3OLAA 4CO4A 4F4AA 4DR4J 2VONA 3N6MA 3W1YC 4LF9F 1BUXA 2EPIA 3D6MB 3BQ1A 1VBYA 1TL1A 1CJVB 2R9LA 1N34J 1UJ4A 3GP9A 1ZM9A 4NL5A 3EDRB 4OX8A 3V2UC 4P71A 2XC9A 4DV0J 3Q2SC 2IPOB 1X60A 4M63A 1VQOS 4R5PA 4USVA 3P45B 2DNQA 4FBUA 2KYZA 1VCTA 4NA3A 3DDIA 3THVA 2PMWA 1OPIA 3S8SA 2L41A 4X4QA 2KRBA 3TAQA 1C0UB 5A6WA 1S0MA 3NGUA 3CULA 4ZN1A 1S4FA 3G96A 5HLFB 1WF2A 2C3OA 3D68A 2RU9A 1H2VZ 3QT7A 5KFFA 2BABA 4IUFA 2F63A 3CJ0A 1EAYC 3G86A 5F3ZA 2ASDA 2C2EA 1SJ4P 1HBOB 4K0KF 2DNHA 1N5QA 3DXBA 2IJNA 1NJWA 3OHAA 2JVOA 4NPOA 1NHUA 2ZFHA 3FMWA 3H20A 2ADCA 1HNXF 2C3YA 4A48A 2NZ4A 3AQOA 3WX8A 4Y0FA 2I38A 4ECQA 4ES1A 1K0TA 2J7WA 5KTQA 3BR9A 1QUVA 4C0OC 2BE9B 4N5SA 1VQKS 1RHJB 4M94A 1Y10A 2J7KA 3BO4A 2VA3A 3DRSA 2N3OA 4GRSA 1VQPS 3LTOA 4TU7A 2HHWA 2MY8A 4A8YA 1RT4A 1UWAA 2RQ4A 3CIMA 3TZWA 4ZVSB 4LR9A 5HP1A 1K0VA 4JOUA 4UUXA 3HHEA 5HQLA 2AMCB 5GAGI 3GPAA 2W9AA 3LP1A 1T0TV 4P73A 4LF9J 4RW4A 1RA7A 2LXIA 3UD5A 3W2WA 5K8PA 2ZJQQ 3V6DB 2DK2A 1OQ6A 5A6PA 2H54B 2ZVIA 1SBRA 5KT7A 3TZYA 4EO8A 2HQCA 1S7IA 2JNJA 2H9ZA 3CT9A 4DG1A 3V81A 1N4LA 2WOMB 1TMMA 1IKXA 1M1GA 1WDDA 2HSEB 2NPIA 4ED7A 2DNKA 2HBRB 4RW7B 3S1TA 1FT8A 5KG6A 3TNVA 1LFPA 1DBDA 4IOCQ 2E5IA 2HG4A 4QYRA 4ZCMA 3IO1A 1UJ5A 1XK8A 2FHJD 2HFUA 2ZWPA 2DGOA 1YJNS 3FBCA 4FZVA 4ZHRA 4MFBB 4RBUA 3LP2A 5D4LA 3TX0A 3OUYB 3MMBB 3P5BP 4NRUA 3U7JA 4PCQA 3W5ZA 3HT3A 4A8WA 3VWSA 1HNXJ 2Q6CA 2RKIB 3H59A 3WC0A 5JUMA 2FIUA 4PG4A 2IAJA 2QTWA 3I31A 2CZ9A 1LWEB 3NWGA 1SUQB 1OS5A 2DJWA 3GR0A 3LAMA 2BJ3A 3LOUA 5KFWA 3EGZA 2XYPB 1OIAA 1TK8A 1NKBA 4QPXA 2GMHA 1WOOA 2KRRA 2YPZA 2HHVA 2SXLA 1UL3A 1R6VA 1FJEB 1HI8A 4WPAA 3MXHP 1XNRJ 3BH6B 2ZD1B 2FPHX 1VMBA 2IRYA 4CNZA 1VRTB 3BGRA 4OYWA 3MAQA 2FZKB 5KFRA 4DHVA 5MLCV 4ED2A 2MYFA 2ZH5A 1TKDA 4FYDA 4LVNP 1OWXA 1SJQA 1NSAA 2C1EB 3DOMB 3JQMA 3M2UB 3PXGa 3RAMA 3QLHB 3TVYA 4ES2A 5I42A 1YSJA 5I4MA 2V2VA 3DRPB 2BJ7A 1CS4A 5GAHI 3G8SA 4NZ6A 2R8IA 1TKTA 2NUUG 4FKXA 4LRDA 4V1Ak 4C11A 5FLXY 4JV5J 2HHXA 3RRGA 1JLFA 4RUHA 1U8WA 2COLA 3HKWA 4G1QA 4ES3A 4MKAA 4KGZB 4I4BA 1EIYB 4DR2J 2E1RA 1X8DA 2OPQA 3NWRA 4L3KA 2MHEA 5KFDA 1NHVA 5A76A 4GKKF 3D7SB 1NB7A 3PKYA 3OJSA 3I0SB 3D0GE 1ZH5A 4CO0A 5DM6Q 2NS1B 3NBPB 2OMLA 4DZ6A 3T1HF 2GGPA 2IBOA 1RWNB 2M2BA 5HVGA 3EXYA 3PW0A 1Q53A 2BACA 1M1HA 3SQGB 4F0KA 2FGCA 2DEJA 3C6TB 3CDWA 2LA4A 2GCFA 4PPDA 5GAGU 3DGPB 1LW2A 1YJ9S 1IKXB 1TUVA 2CPYA 1K1SA 1R43A 2LDYA 3HM9A 4JI4F 2YKPA 1CLFA 1NU4A 1NPPA 4B3SF 1FK9A 2NYHA 2X1BA 4WF9Q 2D3ZA 2RSQA 4Y2CA 1Q8IA 2U2FA 1ZETA 1OYDA 1VQSA 2F4FA 3OR2A 4J5OA 4PXDA 1RB0A 4J9SA 1Y9OA 4CO3A 3PRVA 1OY6A 2R7UA 1N32F 2XI2A 3SQOP 1IM6A 3OFEA 1F2GA 1DZ5A 1NAQA 2QL7B 1S1XA 3OR1A 4TVAB 2FJWA 2MMYA 4YMEA 1KEKA 4ZS6A 2ILZA 2KT2A 4K5RA 2N3LA 3CMES 3MDFA 4L3NA 2BVZA 4C8ZA 2KU7A 3FEXB 3R7NB 2X1AA 5ETOA 4GVLA 1TL5A 1P9YA 1TELA 3QBCA 2KJVA 1PBUA 4DPTA 2CQGA 2DT9A 4ZVRB 1YHQS 4UY8T 4I0WA 4CLSA 1RYRA 1BQMA 1S49A 3VTIA 2XI3A 2P9CA 1U0HA 3ET6A 1SQEA 4JI1F 4O23A 3RBZA 3T5KA 3T1HJ 2WVCA 5KFLA 4YB7A 5HATA 2EK6A 2NUHA 1MSWD 4ANDA 1JLGA 3VR1A 2EFQA 2WVEA 2L9NA 5EX0A 2VICA 4X2BA 2GFFA 2OTLS 1S12A 1UFWA 4L76A 3M8RA 2F9JA 3BN7A 4Q7AA 3FGVA 4J37A 2V8PA 4ZVEA 2LQJA 3KLFA 2DCLA 2V67A 3IR5B 3RB4A 4MK8A 3HSDA 1MNEA 5KFMA 1KRPA 2VG7A 4QCLA 1CULA 4WIIA 2ZBPA 2VG5A 1WC3A 2YH1A 3L7UA 3LP1B 5J2MA 4C8OA 1PG5B 2ZEJA 1Y3JA 2VQEF 3O6QA 2WZ1A 4F3OA 4CIOA 1QAIA 2BE2B 1YGYA 2E5HA 3FQKA 3IXQA 2QMXA 1FA0A 1T9YA 4IO1A 4NZ0A 4WP9A 3CD0A 1HYSB 4PWUA 2IM2A 2MY7A 2CPXA 5B0BA 1IR0A 4WXOA 4QWBA 1FCAA 3OTDA 1WORA 2BRLA 4QR2A 3BDEA 4BLGA 4NI2A 3BSOA 1U1OA 4QJVA 2UZAA 1I1GA 2QL5B 3DHXA 3PVXA 3SMZA 2ZJPQ 1S9GA 2FZGB 2QL9B 2V8HA 3DLJA 5B08A 4DUZJ 4JI1J 3K5PA 1U24A 2ZZMA 2F8HA 2WHOA 3PO4A 1FVQA 3NP5A 1T05B 1DFDA 2HQGA 5E2QA 1MROA 2L9WA 1N52B 3EZOA 2B56A 2W4CA 1N33J 2VL1A 1N5YA 5DDRC 3SDEB 1QE1A 1RT6B 2HQDA 4AUKA 4B3TJ 1RLDA 1NUEA 2OFGX 4NXMJ 3VZIA 3L4BC 4NXNF 4OZ1A 4J9KA 3CD7A 4U67Q 4C3LA 1FJGF 2PA3A 4IFYB 2HFNA 5CCLA 2P6TA 3F0NA 4NASA 2FHOB 3ZTSA 2ZH8A 2W9BB 4IRCA 2CKWA 2GJ2A 1VBZA 3PIOQ 2VQEJ 3HHDA 3EE3A 4KIAA 3MF5A 2XMAA 2LQ8A 3CC4S 2HAFA 1C0UA 2F40A 2H65B 3VAMA 4DSFA 1BLUA 3AT1B 4N77A 1T9TA 4DX6A 2Y1LB 4DQQA 1JNZB 2CFXA 2WBRA 4TU8A 1P1TA 4O44B 4DV6J 3R97A 3W5YA 3OFGA 2XMTA 4UW2A 2D9OA 1CJVA 4L75A 2NLWA 4FYXB 3EICA 4ETZA 4DR1J 2NXEA 2OO4A 3POTA 4LIWA 3DRRA 4F0MA 3OL7A 4CM0A 2IJRA 3PEJA 3DLKB 4HT5A 1EP4B 4DEZA 4JBCA 5D4PA 3GMGA 2CG4A 3DOKB 3M2VA 3KK2A 1VC5A 1CVJA 2YX7A 3X1LB 1F0XA 2VFVA 1RAFB 3MI7X 4LQ9A 1NH7A 5L39A 4FXDA 1AA1B 4LIRA 4DV1J 2OGUA 4YDXA 5M2PA 2FHJA 3NKYA 1ACMB 3IM9A 2HVEA 1LK5A 1DTQB 4K8RA 1FE4A 1YLXA 1WACA 4PG7A 3CUNA 1ZA1B 3G82B 2WCXA 2M88A 2I2YA 2JEIA 4KH0B 2W8LA 4Q8FA 2PFDA 3U1MA 3OTBA 3VQTA 2Z2MA 4ED6A 2QC3A 1RKJA 1JWWA 4EYHB 1YIJS 1HR0J 2HVDA 3BV8A 3UW1A 2ACYA 2HAIA 1HQUB 3MR6A 4A8XA 3W9JA 2B3TB 2ZUGA 4AXJA 2MKKA 2B5JB 3LP2B 3OUYA 1KS2A 4ZPCA 1OSCA 2QMUB 5DDOC 2WONA 2KDOA 2HNZB 1LWXA 4AL5A 1KTVA 2HKEA 3WHIA 3T9ZA 3UQSA 5I3UB 2O1PA 2QO3A 2R7VA 1V3SA 1S77D 1LWEA 2BQRA 2E5JA 3I82A 4GKJJ 2KN4A 1R27B 1X0PA 1RACB 3HSJA 3KUGA 2NYIA 4QBUA 3GZ7A 2DH9A 2WB1D 2ZNYA 3PG9A 4DU8A 2H5EA 2KXFA 3TARA 2IM1A 2AD9A 4KPCA 4KHMA 4WZMA 1H74A 2V2QA 2OLWA 3JSYA 2FTRA 3FEYB 1QTNB 4GKJF 2FHMA 4C3KA 2CQIA 5A8KA 2UVVA 2IIHA 2IRXA 4PXBA 3M9MB 2Q6BA 4H4KA 4O3SA 3R5DA 3QT5A 4AQYF 1ZM3A 1X4HA 2CZ4A 4NLYA 1UA0A 5DDPC 2C3UA 4YQWA 4LFBF 1B7FA 4WYLA 3LWLA 1S99A 5G0RB 4LF8J 4ECYA 5L8RC 3PHTA 4Y00A 1AROP 3F56A 1RAAB 2OMOA 3NS6A 1HR0F 1Q16B 1LK7A 4IH7A 2Z2LA 3ZZUA 3FFIB 2IVYA 2F5GA 3KLIA 3C14B 3C2PA 1MMDA 1FF2A 2OEKA 2JX2A 3CE8A 4R8UB 3MFIA 3J80U 2Q79A 3H5YA 1QVFR 1JLAB 1RBAA 1TU0B 1M5VC 1VQLS 3MOJB 1CJKA 2LQ9A 3WIUA 4IRDA 4XO0A 3UCGA 3MMAB 4FYWB 2MQ8A 2QN6B 3SZ2A 4OIXA 4X4UA 5KG1A 3JSMA 4DL4A 1FJ7A 3BGOP 1B64A 1RWXB 4Q2MA 3AJDA 5E41A 3CJKB 4KH1B 1YJ7A 4L73A 3GIJA 3WZ0A 2VH7A 1B70B 2PT0A 2CQBA 3BYPA 4MIWA 3HD1A 4E8UA 1AT1B 2RH3A 3MPUB 3NLCA 4F3QA 3MCMA 5G0RA 2R7SA 4PAAA 1Q95G 2XLKA 3VALA 2DNYA 4NLOA 3BB5A 2DNRA 1UAWA 2XGPA 3DMJB 5JMNA 3TQEA 5K14B 1OY8A 3SFGA 3HVTB 5G4DA 4LFBJ 3CJRA 4BHQA 1S6QB 3BKUA 4URSA 5KFEA 3UR3C 3PX4A 2D74B 2QFIA 3MR3A 1SI9A 2EC2A 4GO5X 3H5XA 3BO2A 5BYSA 5LOQA 4ED1A 2J6UA 4EYIB 1KR4A 2MLYA 3VVUA 1VHFA 1O0PA 2L08A 3ELHA 2ZHOA 4OV1A 3PY8A 3BPSP 3Q8PB 2ZH1A 1C0TA 4CO5A 1UPMB 1NK8A 3HVRA 4K4ZA 1PJ7A
chains in the Genus database with same CATH topology
2C2OB 3P4UB 3R7NB 1SC1B 2XYGB 1RHJB 3RJMB 1RHUB 2CDRB 2H4YB 2QLFB 3GJQB 4ZVRB 3NS7B 4ZVSB 1RWKB 5IC6B 1RHQB 3R7SB 2H54B 1I51B 4ZVQB 3QNWB 3R6LB 4LSZB 2H5JB 5K20B 1PAUB 2HBRB 1RWVB 2H48B 2H5IB 2XZTB 3GJTB 1QDUB 1RHKB 2CNNB 1PYOB 3D6HB 4JB8B 1QTNB 1RWPB 2HBYB 4ZVPB 2XYHB 3R6GB 4DCOB 2C2KB 2XYPB 4DCJB 2C2ZB 1I3OB 2FQQB 4DCPB 1RWWB 3GJSB 2QL5B 2QL9B 1RWOB 3D6FB 4ZVUB 2C1EB 2P2CB 3KJNB 1F9EB 2Y0BB 3EDQB 1NMEB 1SC3B 3IBFB 1RHMB 1IBCB 2H4WB 1ICEB 1RWXB 2C2MB 1RHRB 2CJXB 1BMQB 2DKOB 3KJFB 2CNKB 3D6MB 2QLJB 1RWNB 2H65B 2XZDB 3EDRB 1RWMB 2HBZB 2CNLB 3IBCB 4ZVTB 3P45B 2Y1LB 2CNOB 3SIPB 2HBQB 1RE1B 2QLBB 2CJYB 1SC4B 1GFWB 3R7BB 4ZVOB 2QL7B 5IC4B 3GJRB 3KJQB 2H51B 3R5JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2O B;  3P4U B;  3R7N B;  1SC1 B;  2XYG B;  1RHJ B;  3RJM B;  1RHU B;  2CDR B;  2H4Y B;  2QLF B;  3GJQ B;  4ZVR B;  3NS7 B;  4ZVS B;  1RWK B;  5IC6 B;  1RHQ B;  3R7S B;  2H54 B;  1I51 B;  4ZVQ B;  3QNW B;  3R6L B;  4LSZ B;  2H5J B;  5K20 B;  1PAU B;  2HBR B;  1RWV B;  2H48 B;  2H5I B;  2XZT B;  3GJT B;  1QDU B;  1RHK B;  2CNN B;  1PYO B;  3D6H B;  4JB8 B;  1QTN B;  1RWP B;  2HBY B;  4ZVP B;  2XYH B;  3R6G B;  4DCO B;  2C2K B;  2XYP B;  4DCJ B;  2C2Z B;  1I3O B;  2FQQ B;  4DCP B;  1RWW B;  3GJS B;  2QL5 B;  2QL9 B;  1RWO B;  3D6F B;  4ZVU B;  2C1E B;  2P2C B;  3KJN B;  1F9E B;  2Y0B B;  3EDQ B;  1NME B;  1SC3 B;  3IBF B;  1RHM B;  1IBC B;  2H4W B;  1ICE B;  1RWX B;  2C2M B;  1RHR B;  2CJX B;  1BMQ B;  2DKO B;  3KJF B;  2CNK B;  3D6M B;  2QLJ B;  1RWN B;  2H65 B;  2XZD B;  3EDR B;  1RWM B;  2HBZ B;  2CNL B;  3IBC B;  4ZVT B;  3P45 B;  2Y1L B;  2CNO B;  3SIP B;  2HBQ B;  1RE1 B;  2QLB B;  2CJY B;  1SC4 B;  1GFW B;  3R7B B;  4ZVO B;  2QL7 B;  5IC4 B;  3GJR B;  3KJQ B;  2H51 B;  3R5J B; 
#chains in the Genus database with same CATH topology
 3ZZT A;  4FF1 A;  3Q8S B;  4NLG A;  4NX9 A;  2DGS A;  4WXW A;  3NNH A;  2BM1 A;  1L3V A;  4KKO B;  2QJ3 A;  2MQL A;  4YR0 A;  2MKS A;  2PFF B;  1SKS A;  2J5A A;  2XM3 A;  4CP5 A;  4NLR A;  4NLW A;  2VIH A;  2N4C A;  1HHT P;  2EI5 A;  5L1K A;  4EBE A;  5K8N A;  3KG1 A;  4OJG A;  5DGA A;  2M8D B;  4ZPA A;  1DAR A;  1RAD B;  4OX6 A;  2BYC A;  3UVJ A;  2IC3 B;  3TAM B;  4DSJ A;  3DLG B;  4NLX A;  2V4R A;  3R2D J;  3H40 A;  2FDN A;  4N8N A;  5ETQ A;  4PR6 A;  1F9F A;  4OYP A;  4N56 A;  2FD2 A;  2ZJR Q;  4UF4 A;  3CJT A;  4JUZ A;  5C25 A;  1S1V B;  2ZH6 A;  3C3L A;  1WG4 A;  4F67 A;  2XMM A;  5KG4 A;  3NS5 A;  1U26 A;  2J7U A;  2OJ3 A;  3GYN A;  1R7I A;  2ZWO A;  4CM2 A;  2DXE A;  4OI1 A;  1QY7 A;  1RU2 A;  1U6B A;  1KLN A;  2E1A A;  3HI9 A;  3WX4 A;  1JXL A;  1PIE A;  3TP2 A;  5KT5 A;  1P27 B;  1SH0 A;  2FJA B;  1GXT A;  3M30 B;  5DZ6 A;  3VAG A;  1NDK A;  3J81 j;  1H0H B;  3W7B A;  1CEZ A;  2AJF E;  1U49 A;  1WC1 A;  2MSS A;  4M8L A;  3KLF B;  4LFA F;  1NJI T;  3HT0 A;  2HRU A;  2M5Y A;  1MMN A;  2XYH B;  4IG3 B;  4W92 B;  2OSR A;  2RDI A;  1N56 A;  5A8R B;  4N76 A;  2C2K B;  5IWA J;  4M1K A;  1QAJ A;  1Y11 A;  1WTF A;  5E3A A;  2P9G A;  3K8V A;  5K14 A;  3V4I A;  3GIK A;  2UUW A;  4O0N A;  4P2S A;  3SI8 A;  4YB1 P;  1XMQ J;  1WEL A;  3EPI A;  3TJ8 A;  2DR8 A;  2QV6 A;  3GJS B;  4B3M J;  4DFM A;  3LA0 A;  4YOE A;  1Y4Z B;  1I6J A;  5H9F J;  1EB0 A;  1UVK A;  4OZ5 A;  2ATL A;  3D6F B;  1WEX A;  1YBA A;  2KL8 A;  3BSA A;  4PXE A;  1H98 A;  3DC2 A;  4PKD B;  2OPR B;  4DUT A;  1BWV A;  1YTY A;  4ECR A;  4DZD A;  2OP5 A;  4I1T A;  5HAO A;  4XAK A;  2DNN A;  2VG6 B;  4YY3 J;  1LKZ A;  2FJE B;  2K1R B;  3RW7 A;  4OJ3 A;  1X9M A;  1YBT A;  1X9S A;  1QAY A;  1FEE A;  3CGI A;  3ETM A;  1EQ0 A;  3S6E A;  1W25 A;  3DYA A;  4KBI A;  2P5V A;  3A12 A;  3THP A;  4C97 A;  3EXC X;  1ZZN A;  1WHV A;  4NWB A;  4CYU B;  1JKH B;  4IG0 B;  2ZM6 J;  1VLO A;  4RW9 B;  7FDR A;  3OFH A;  3J7Z T;  2CJA A;  3O5T B;  1S97 A;  1RAB B;  1IBC B;  2IVM A;  3PIP Q;  3MEE B;  1NK9 A;  1TKX A;  2DIU A;  2I9S A;  3DU5 A;  3O3L A;  2OPP B;  3DN9 A;  2C2M B;  2XSF A;  4ZPV R;  4M5D B;  1GAO A;  2OPS A;  3CCT A;  4U7C A;  3H0P A;  2KJW A;  3LPE A;  4BC9 A;  1RXO B;  1X5T A;  4FXV A;  1WSR A;  4LFA J;  2XO6 A;  2MKJ A;  2YNG B;  3QPI A;  1B0P A;  4IFY A;  1RA6 A;  2R7T A;  2LP4 A;  4HH0 A;  1U8S A;  3K57 A;  1TUG B;  1NZA A;  3HSG A;  1SL1 A;  1PSD A;  1XEZ A;  3KXD A;  3PNI A;  3AA8 A;  3A8K A;  4ZP8 A;  1L3K A;  1K8A T;  3E2E A;  4LF5 J;  1ELO A;  1XMQ F;  4B3M F;  2PE8 A;  3ZZP A;  4R25 A;  1F9H A;  1YRX A;  4OJH A;  5C25 B;  3TZZ A;  1XN9 A;  1X4G A;  3C16 A;  4BC7 A;  5IFM A;  4MTP A;  1SL2 A;  3NEK A;  1TL3 B;  2XEX A;  2WOM A;  4GO7 X;  5LJ5 Y;  1VRT A;  4DV5 J;  5F3T A;  1DLO B;  4MIA A;  3X3U A;  2KXH A;  4YY3 F;  1S79 A;  4HDG A;  3R7B B;  5FDL B;  4B9L A;  4PWD B;  3N0V A;  2EW9 A;  2C2N A;  5D4N A;  2B9W A;  2EK1 A;  3R5G A;  2K7J A;  2HWT A;  3W9I A;  2K3K A;  1H7X A;  2GIR A;  3A8J A;  3ENW A;  4IFV B;  1UW9 A;  4OHW A;  2OPS B;  4ECV A;  2IA6 A;  1HWL A;  2LMI A;  1TR0 A;  1F1B B;  2MDA A;  2B9E A;  4ELT A;  4RR5 A;  4J9L A;  2XWX A;  2XCA A;  5LM7 E;  5D3G A;  1WDT A;  2B8Q A;  2RNE A;  3GJQ B;  3ZO7 A;  4A8F A;  1HWU A;  2IAJ B;  2VDH A;  3TUP A;  2HGN A;  2ZBQ A;  1FRI A;  2K8G A;  1JJ4 A;  2W01 A;  2VG5 B;  1LWF A;  4OX9 F;  4D3H A;  1Q86 T;  1H2U X;  1NPR A;  5FII A;  4XIU A;  2UXB F;  1V5I B;  3OVB A;  1AFJ A;  4UQT A;  1ZPV A;  3R8Y A;  3ZTP A;  3Q8Q B;  3TUI C;  1IBK J;  2R8J A;  1EET B;  2VG6 A;  1N88 A;  1H7W A;  3KTQ A;  2B9X A;  2H3E B;  4WYW A;  2YWE A;  3MR7 A;  4RUB A;  5KFX A;  2WW8 A;  3I4P A;  4K4S A;  1E6V A;  2OUG A;  3RR8 A;  1BWE A;  3M32 B;  4OYA A;  5HRO B;  2YKM B;  5HMX A;  3AH6 A;  3MM7 A;  2DY1 A;  2FHK A;  3MEG A;  5KFQ A;  3PFO A;  2KG1 A;  3CNQ P;  2MEW A;  3PRB A;  4Z37 A;  1AZS A;  3DRP A;  3GJT B;  4Z7Y A;  5KT6 A;  1Q8B A;  3GG0 A;  2IM3 A;  2CIM A;  4ED5 A;  2I6W A;  1RYS A;  4LMZ A;  4RNO A;  3I4H X;  3T5J A;  2GO8 A;  1U0S A;  2UUB J;  2XHC A;  1HNV A;  2IJF A;  1RTI B;  3HHL B;  2XZW A;  4ED4 A;  2LEA A;  1D0E A;  3N6L A;  3CCL S;  2QEX S;  1G1X A;  4FVM A;  3BGU A;  1T9V A;  2XTJ P;  4DCO B;  4O4G B;  2BAN A;  4O3N A;  1VJQ A;  3CVK A;  4WK1 A;  2DH7 A;  1UVL A;  3UE2 A;  3IM8 A;  1F5B A;  3L09 A;  2LEB A;  1S0O A;  4DMZ A;  1S5Z A;  2W2O P;  1PBA A;  3FNN A;  5A8K B;  4CI0 B;  2W7O A;  3FBE A;  4I2Q B;  2HMI A;  2O01 C;  1FDA A;  3G6V A;  1RT1 A;  4DL6 A;  1FNO A;  2DNO A;  3M9O B;  4ZJL A;  1HKA A;  2HWH A;  1BQN B;  1U1K A;  1IBL J;  4KHP F;  2Y3Y A;  1IBK F;  1GTE A;  1HHQ A;  1FXD A;  2DXF A;  3M30 A;  2YNI A;  3J81 U;  5F8G A;  3IWX A;  3THT A;  3OL6 A;  2HVH A;  2XB2 D;  2ATC B;  2HNY A;  2DEI A;  1CJT A;  2OAU A;  5A8R A;  1JLQ A;  3UN5 A;  3OV7 A;  2UXD F;  3D1Q A;  1RHM B;  1Q4R A;  3H8Y A;  4LBH A;  3BS9 A;  2R2U A;  3K7R A;  3EZ5 A;  4A8Q A;  4NML A;  2RVJ A;  5KT4 A;  2V94 A;  2PDA A;  1UWB B;  3LW5 C;  2XLJ A;  3K89 A;  4TYA A;  3Q8R B;  1UVI A;  1WC4 A;  2DKO B;  1HMV B;  1RQ0 A;  2YX1 A;  4OZN A;  4LFC F;  2W2P P;  3W2W B;  4WBF A;  5ADZ A;  3BYR A;  4LR7 A;  2UV8 G;  4HI1 A;  1NK7 A;  1RDR A;  2HS4 A;  2D7S A;  1IM4 A;  4X84 A;  4IDK B;  1CJU B;  2DPJ A;  1RU1 A;  2HMI B;  2C28 A;  3PW2 A;  2ZH3 A;  2APO A;  2MLZ A;  4A4J A;  1VLY A;  1D8Y A;  4HAC A;  4NA2 A;  4ATN A;  2D3O R;  3BM7 A;  2CVE A;  1P6T A;  1O51 A;  3BGL A;  3FC9 A;  3M8Q A;  5L1J A;  1VIX A;  1S76 D;  1KVI A;  1R8C A;  2YNI B;  4RW9 A;  5J1N A;  3MTJ A;  5E3C A;  4O3P A;  3SV4 A;  2AJ0 A;  3L7O A;  3W3S A;  2O3D A;  4FDF A;  1RE1 B;  1A0O B;  2LQB A;  1N6Q B;  5B0C A;  1IKW A;  3ZNJ 1;  3GV7 B;  2RHQ B;  2B4P A;  2C2D A;  3R1H A;  4EZ6 A;  1XTZ A;  4NEZ A;  5D15 A;  4IYQ A;  2UXD J;  2J9D E;  1GXU A;  2X3D A;  5KFB A;  4RUA A;  3I55 S;  5CZV A;  2Z56 B;  2PI4 A;  4PUO B;  5C42 B;  4FPI A;  4TXS A;  2HQ3 A;  3T6B A;  2DGQ A;  3GSI A;  3HXM A;  1RT2 A;  5ETP A;  3DU6 A;  3KDO A;  1SL0 A;  3NBP A;  1X31 C;  3M8Y A;  4BBY A;  3VAJ A;  1RSC A;  1C0T B;  3NS7 B;  3K5L A;  1CJU A;  1RBL A;  3ZNU A;  4LF4 F;  2RRN A;  1PJ6 A;  2XMV A;  2BBE A;  4ZVG A;  5KOX A;  3KK3 A;  2B6A A;  3G8T A;  4F8R A;  4JI8 F;  4LFC J;  1KQF B;  3M8Z A;  2W4P A;  4DLG A;  4N7T A;  5ETN A;  2CJB A;  3UFC X;  4MYT A;  5A0Y A;  4DXL A;  2VPW B;  4JI3 J;  3R7S B;  1FD2 A;  1XWL A;  4I64 A;  2J9E A;  3CXC R;  3DNC A;  4CWB A;  1F5A A;  1SB6 A;  4HR2 A;  4KFB B;  5J2P B;  3QNW B;  4Y2I A;  2BEF A;  4LSZ B;  2HHP A;  3DLE A;  3T1A A;  3LPY A;  5KG0 A;  4OYB A;  4KB7 A;  2MQM A;  3HD2 A;  3D67 A;  2YNF A;  2ASJ A;  3H4D A;  2DGU A;  3QID A;  2HEK A;  1AUD A;  2C3M A;  3MWB A;  2V8G A;  3VCD A;  3M6U A;  6AT1 B;  2I8E A;  1OY9 A;  2IC3 A;  1VBK A;  2CYY A;  1MML A;  3NY0 A;  3O44 A;  3WIV A;  1H6K X;  5HJY A;  3FSI A;  3KHL A;  1HD1 A;  2XG8 A;  2YNH A;  4GVB B;  1W2I A;  3LF0 A;  1TAQ A;  4YB5 A;  2X7I A;  3W9H A;  1NEE A;  2EEY A;  4ZJQ A;  4B08 A;  3MFH A;  4HHH A;  4MK7 A;  1EP4 A;  4RX6 A;  2D1C A;  4F4X A;  1WJ9 A;  2G2Z A;  1QJH A;  1PYO B;  3KLI B;  3JYT B;  4J9M A;  3R5A A;  1LWC B;  4OI6 A;  5ETM A;  3MEK A;  2Y8Y A;  2HHT A;  3M8S A;  1RUS A;  5BYQ A;  1T03 B;  4P9S A;  1IJE B;  5DG9 A;  1HA1 A;  2PA8 D;  1M0S A;  2HLU A;  3HHK A;  3VVT A;  3KK3 B;  3BQ2 A;  2CUY A;  3SCJ E;  3IS9 A;  3MM9 B;  2VFR A;  3GCW P;  3NAI A;  1DTQ A;  4TLR A;  3CF5 Q;  5CXT A;  1IR2 A;  3PHE A;  1FX4 A;  5CD4 H;  3TX8 A;  4M5N A;  2RD5 C;  1T9U A;  5BYR A;  4ID8 A;  3H7H B;  2B7C B;  4QW9 A;  3UCZ P;  3G9C A;  4KFB A;  3CPW R;  1VQ6 S;  4JI8 J;  5KFJ A;  3OT9 A;  2IM0 A;  1KWM A;  3OLB A;  3B8H A;  4M5I A;  4IR9 A;  4JI3 F;  3I96 A;  1IKW B;  5K8O A;  2J0Q D;  4KY3 A;  2KO1 A;  3W66 A;  2O5D A;  1U1L A;  3CC2 S;  4OZ0 A;  3I6P A;  2R7Q A;  2E7X A;  2YNH B;  4GVB A;  5CCM A;  4F50 A;  4ITS A;  3ICL A;  2UV8 A;  3DMJ A;  1JLC B;  1X4D A;  2ZVS A;  2JWN A;  2G0J A;  1WTB A;  3M05 A;  4OI0 A;  1BE4 A;  4NCG A;  1TV6 A;  3KLE A;  1TTH B;  2VDI A;  4XPC A;  5L1L A;  3EUN A;  1T8E A;  1T03 A;  5KG3 A;  4UZB A;  4HH1 A;  4YP3 A;  4PAB A;  4B9S A;  1ICE B;  2CZV C;  3UPF A;  4ELU A;  4I2Q A;  4LF1 A;  1HYS A;  3J7A 1;  2QA1 A;  2OEJ A;  2VFS A;  3S01 A;  4CCH A;  3CDA A;  2QRR A;  1BQN A;  4DV4 J;  1N36 F;  1RK8 A;  4Y34 A;  1ITP A;  1WHW A;  3ZZR A;  4HL9 A;  5GAE U;  2FLL A;  4JYA J;  3CJ4 A;  1URR A;  3UNY A;  1WSV A;  5AE3 A;  3VF0 B;  4EBC A;  1IR1 A;  2HBZ B;  1VHI A;  1TKX B;  3C15 B;  3EM1 A;  4LR8 A;  2CAD A;  5KT3 A;  3P3D A;  7AT1 B;  2V4Q A;  1EKR A;  1CJT B;  1QD1 A;  3DRY A;  2W24 A;  3BSN A;  1NM2 A;  2LDI A;  1M5P C;  1YVF A;  2I1R A;  3N5B A;  2BV3 A;  2MZJ A;  3SSS A;  1U1P A;  5T41 A;  4ZP7 A;  2CWX A;  2YH0 A;  3DM2 A;  4ICL A;  1NDL A;  2GQ2 A;  2ZE2 B;  2OPQ B;  3FRY A;  3TI0 A;  3KNA A;  1DQ9 A;  1FXR A;  2UUA J;  3MMC B;  2B43 A;  1OQ3 A;  3V4M A;  4JV0 A;  5DQG A;  4PEO A;  1GFW B;  4ZVO B;  5AE2 A;  2NXC A;  2GV1 A;  4U6P A;  1A6L A;  3D5M A;  4HTI A;  2N82 B;  1CQM A;  2NXU A;  3Q86 A;  3B6B A;  2H51 B;  5KG5 A;  1VOM A;  1RTJ A;  3HZE A;  5DM7 Q;  4DF4 A;  4TYB A;  2HZA A;  2J0X A;  3AOB A;  4BS2 A;  4ECZ A;  2VOO A;  2GIQ A;  1PGZ A;  1R31 A;  4OHZ A;  1RHU B;  1FK9 B;  1G2E A;  3BF4 A;  1SKW A;  1WEY A;  3KLV A;  4H4O A;  2XWY A;  2HHH F;  2ZDP A;  3TO8 A;  3CMQ A;  4WFB Q;  2XSJ B;  2E5L F;  3FBB A;  3DRX A;  4ED0 A;  2E66 A;  2KH9 A;  4DSE A;  3RAX A;  2BZ2 A;  4IH5 A;  2P9E A;  5F8M A;  5BR8 F;  3ZTR A;  1UEU A;  2MPU A;  4UT4 A;  1RAI B;  4MK9 A;  4KRW A;  3MEG B;  5D8H B;  2AEJ A;  2HZC A;  2W8K A;  3OTO F;  2J76 E;  4ID5 A;  1PO6 A;  2UXB J;  1LQ9 A;  1JJH A;  2DRB A;  3DDN A;  1GMW D;  2K3I A;  1YI2 S;  2H48 B;  4LF7 J;  3A3P B;  1XNQ F;  3C14 A;  3MMJ A;  1RTD B;  2LU1 A;  5IT9 Y;  1FNM A;  2EKY A;  2XZT B;  5DQH A;  3DI6 A;  2UUA F;  1X5P A;  4LJM A;  4F4W A;  4Q0B A;  3R5C A;  3FSY A;  1JJC B;  5KFU A;  2LFV A;  5IXU A;  1S72 S;  4USK A;  3FSX A;  4RW7 A;  1VK3 A;  5E3R A;  1FRM A;  2RF2 A;  3R5B A;  2ROE A;  1U48 A;  6FDR A;  4JB8 B;  3FDS A;  2DGW A;  3OTC A;  3CCS S;  1N32 J;  3KYL A;  2LVW A;  1R3N A;  2QGF B;  2ZD1 A;  4ZP9 A;  4CLY A;  3JB9 k;  4DX7 A;  2ZBC A;  4C6A A;  3KK1 A;  4JI6 J;  2ZC4 A;  4OJ1 A;  5KFT A;  5JJB A;  4K4W A;  4C8L A;  2VBY A;  2XHW A;  2R2T A;  3I0R B;  5ETT A;  3QLH A;  2R3V A;  3MUR P;  3HX9 A;  4O3Q A;  5CAB A;  4DF8 A;  5BR8 J;  3GYX B;  4ZVH A;  1UEV A;  3DRR B;  5AXL A;  2YWH A;  3QO9 A;  2YPY A;  3N4W A;  1IKV A;  3U1N A;  1S1U B;  1VJW A;  2WW4 A;  3VGV A;  2IHR 1;  2V2Z A;  3M7V A;  3Q8Y A;  3OTO J;  1DUR A;  2DHA A;  2G1H A;  1RLC L;  1N5V A;  1TFW A;  2AJ2 A;  4R5P B;  3MM9 A;  4OZ2 A;  5B7W A;  1L3U A;  5H9E K;  3H4B A;  2BDP A;  1S1V A;  1NH8 A;  2HFZ A;  3D2W A;  1IBM J;  2IDE A;  5KFI A;  4C3M A;  5B09 A;  1YK9 A;  4E2F B;  1BY9 A;  4PRF A;  2EBE A;  2W2N P;  4URQ U;  4X4O A;  4DWI A;  1Y7P A;  2DCU B;  3HDS A;  1D9A A;  1KFD A;  4RBV A;  2B8P A;  2N7Y A;  4LRC A;  4Q8E A;  2WTF A;  3QAU A;  1ZAX A;  2WVF A;  1BMQ B;  2ZUA A;  2GML A;  2PI5 A;  4PWD A;  1HHS A;  1KOO A;  4ZLJ A;  1UPP A;  2I0X A;  4B02 A;  2MGZ B;  4G1Q B;  2CVI A;  3SCI E;  3UN2 A;  3TAP A;  1NSQ A;  1RWM B;  1X4C A;  4IG3 A;  2IDL A;  2QZ8 A;  5IQ6 A;  4QWC A;  2EG2 A;  3ZZY A;  2UUT A;  4KGM A;  3SXL A;  4FS2 A;  3J7Z 5;  3L7P A;  4NCG B;  4KGX B;  1IWG A;  2FC8 A;  3TAM A;  1ZM2 A;  1WC5 A;  1ZBT A;  2B4O A;  2B0G A;  4L74 A;  4HT7 A;  1VRU B;  1LEO A;  2QMW A;  3HVW A;  4RW6 A;  4S0M A;  3Q23 A;  2CJK A;  2IY5 B;  1IQT A;  5F41 A;  2HYI B;  4FVC A;  4QR1 A;  2VUG A;  3RGI A;  3SEO A;  4RWW A;  3T19 A;  3UDE A;  2HGM A;  3KMS A;  3CCM S;  1B0V A;  4DLE A;  2AWZ A;  5ETS A;  4C8M A;  4OYX A;  2E9T A;  5HI7 A;  4YS2 A;  3ZTQ A;  1X5O A;  1ROF A;  5I3P A;  4CRJ A;  4CYU A;  4X65 F;  2AZ1 A;  1IBM F;  2RQM A;  1F6T A;  2KFY A;  5DLF A;  1WI6 A;  5DJB A;  4I67 A;  3OL8 A;  3QJL A;  3QGP A;  5KT2 A;  3HKZ D;  4CLZ A;  4C48 A;  2A0F B;  4YUD A;  4ZPB A;  3K5M A;  2VQF J;  3W64 A;  2D3U A;  4X4R A;  2CDQ A;  3CJ3 A;  1DTT B;  1FER A;  2KFZ A;  3QAE A;  5JVH Q;  4B3R J;  2FJV A;  4U95 A;  1I51 B;  3J81 Y;  4OFZ A;  4Y2M A;  3IG1 A;  4DL3 A;  1HBU A;  2VAS A;  1ZPW X;  3MM5 B;  3VZH A;  1SVD A;  4YR3 A;  2H5J B;  1RTH B;  3HP6 A;  2YWK A;  3G4S S;  3QWU A;  3ZZ0 A;  4K59 A;  1KC8 T;  1TFY A;  4EGL A;  1U6Z A;  5LXR A;  3IAM 9;  2AJ1 A;  2BJD A;  4FNH A;  3MM8 A;  2GHV C;  3MED A;  1WC0 A;  3OPK A;  3D6T B;  3DLH A;  3PEH A;  2FGO A;  4I2P A;  1SIW B;  3IRW P;  4K5S A;  2A3J A;  2RU3 A;  4DV3 F;  3RUB L;  4J91 A;  2YKO A;  4KT0 C;  3NCQ A;  4UOF A;  5DS7 A;  1S6U A;  4QWA A;  4DL2 A;  2WSF C;  2EVZ A;  1NJY A;  3IWN C;  4DR4 F;  1RWP B;  1IN0 A;  2BKP A;  4ENO A;  4UZC A;  1A9N B;  2UXC J;  1T95 A;  1YWX A;  2GHW A;  3KFW X;  4X65 J;  2A6M A;  1R8A A;  4LSL B;  4C11 B;  4J9V A;  4LF2 A;  5F9L A;  4DV0 F;  5FJ4 A;  2ZHB A;  1SV5 A;  2A10 A;  2XLI A;  2GMJ A;  2EWH A;  1S0V A;  2F7V A;  2KI2 A;  4CTA A;  4DPW A;  2FB0 A;  2VOP A;  2KVQ E;  2MKY A;  1XQI A;  4J9R A;  1HBU B;  2QA4 G;  2V50 A;  3MPW A;  2QLX A;  2BE2 A;  2V63 A;  2QA2 A;  3FCW A;  4QQB A;  3K58 A;  3SV3 A;  4GC6 A;  1J5O A;  1HIY A;  2RIL A;  4CLK A;  3FBF A;  9ATC B;  4DN0 A;  4QU6 A;  3M1V B;  4P6Q A;  2HK3 A;  2VBZ A;  3EGV A;  1PYT A;  2DGT A;  3MUM P;  3K5N A;  5KFV A;  1Z2Z A;  4M5K A;  4PPZ A;  4YDD B;  3GE9 A;  1UEK A;  4CH7 A;  4K4Y A;  1W7W A;  3CSK A;  3KJN B;  4KAI A;  5HMW A;  4FYY B;  4GC7 A;  1XIQ A;  2MZT A;  3GFY A;  1LW2 B;  2V34 A;  1NZ8 A;  1OPZ A;  4DU7 A;  4F25 A;  3KK1 B;  3UNG C;  4CLW A;  2YKM A;  5AXK A;  3Q8V A;  2DHG A;  3NXZ A;  4KKO A;  3PR4 A;  2NXN A;  3G71 S;  2DR6 A;  2JHE A;  4WU2 A;  3GU0 A;  1Q8L A;  3NGR A;  2F3J A;  2BOA A;  3NGS A;  4MYU A;  2H1Y A;  3GV8 B;  3P6Y C;  4ZIW A;  1WI8 A;  3HZG A;  1FRJ A;  2IA0 A;  3V6K A;  4DV3 J;  3AXM A;  5C7P A;  5LSR A;  4C0H A;  4U9R A;  5L9X A;  1UZD A;  1VC6 A;  4K50 A;  4YR2 A;  2M9K A;  4X64 J;  1TV6 B;  2YQ1 A;  3BKT A;  3DM2 B;  4ICL B;  3RU0 A;  1M5O C;  2UXC F;  4OI3 A;  3JAM Y;  1VQM S;  2DNM A;  1A7G E;  1WHY A;  2FUG 9;  1U45 A;  4FBT A;  4N41 A;  3VAF A;  3CO9 A;  5L38 A;  1GXL A;  3PZP A;  2DRD A;  2LQ5 A;  4ZK7 M;  4K2X A;  3K59 A;  3D66 A;  2CNO B;  3T5H A;  1VYA A;  1LW0 A;  2OI2 A;  3VAK A;  5IM0 A;  4ECU A;  3BJY A;  5HL7 Q;  1QAX A;  4AD6 A;  2KM8 C;  4DR3 F;  3SSQ A;  3MUV P;  1T3N A;  4CDI A;  4ZOS A;  1GH8 A;  5KFZ A;  3QGG A;  2HQF A;  1SC4 B;  3CJQ A;  4X66 F;  1XBW A;  2LXF A;  1KHW A;  2FVP A;  2DY9 A;  1FXL A;  1RAO A;  3DOM A;  1IWA A;  3OQ2 A;  2B4V A;  3SCL E;  3KJQ B;  1M5K C;  3HHL D;  2LU2 A;  4DBQ A;  4ZMM A;  2C2O B;  2GAH C;  1KOH A;  1HL6 A;  2Z8Q A;  2GVD A;  3PJW A;  4PG5 A;  5I3Q A;  2LXU A;  1RCO B;  3CDE A;  4U8Y A;  5D78 A;  4ZDN A;  5LSL A;  2HVI A;  1R0A B;  3MTK A;  5KFN A;  2ZC3 A;  3FJ2 A;  1N8R T;  4JI5 F;  3GV5 B;  2IVF B;  3I5C A;  2CPH A;  4ANE A;  4MAK A;  2FJX A;  2WVD A;  1G6B A;  1Q7L B;  2DGX A;  2HLT A;  2DGV A;  1VRU A;  4DQS A;  5CYM A;  2J6S A;  3KOA A;  3U02 A;  4ELV A;  3FQL A;  1C4C A;  3QAT A;  1WUU A;  2AKW B;  4NLU A;  3IN5 A;  1S59 A;  3BZQ A;  3AJ1 A;  3MCN A;  3DGP A;  1ZOT A;  2PMZ D;  4EBD A;  4TU9 A;  2GQQ A;  2VZ9 A;  1S4E A;  3MR2 A;  3H2V E;  4DR3 J;  4NYP A;  3IR6 B;  4NA1 A;  4OI4 A;  3CCV S;  2BW2 A;  3A8E A;  1JQG A;  4J7C A;  4BCA A;  2RRB A;  1QDU B;  2JLE A;  2ZOG A;  3W60 A;  1E6Y A;  4X66 J;  3GIL A;  3CW2 C;  4K0K J;  1R0C B;  4DV2 J;  1KVJ A;  1TL4 A;  1GMU A;  4X62 J;  3UVJ B;  3TAN A;  2GW8 A;  2WBM A;  3MAA A;  4UST A;  3EYZ A;  3UDL A;  8RUC A;  1FNX H;  2R7W A;  5HSP A;  2VD3 A;  4QU7 A;  2AGO A;  2LA6 A;  2XMW A;  1QVG R;  1PC4 A;  5EDW A;  1IXK A;  2M70 A;  5B0A A;  1JLC A;  1D9F A;  2M0G B;  1FTC A;  2QE5 A;  3AD9 C;  4DI6 A;  2ROG A;  4NEY A;  2JDJ A;  3B4D A;  4B9M A;  2XO7 A;  4R0J A;  1U25 A;  2G4B A;  2BKO A;  2DNZ A;  1VC0 A;  1N0V C;  4WWS A;  3M8P B;  1SCJ B;  2QLW A;  1JJ2 R;  4ZVU B;  1U7L A;  4NLD A;  1KHV A;  1Q0N A;  5A0Y B;  2GO9 A;  1CQN A;  4DX8 H;  1HQE B;  4DSL A;  5H9F K;  2FLO A;  5J2Q B;  4M5J A;  5FD1 A;  1NPK A;  3VGS A;  1RGV A;  2KT3 A;  3PAC A;  4O4R A;  2JEF A;  2VJU A;  4LBI A;  4ED8 A;  2GHP A;  3PX0 A;  4B3O A;  2KHC A;  3EWG A;  2OTJ S;  2MTL A;  3FMB A;  2DBB A;  4CH1 A;  2DR7 A;  1R0A A;  1YDL A;  2YWF A;  3FFI A;  4P52 A;  4Y65 A;  4CT8 A;  4CTA B;  1UKU A;  3MAA B;  2CA9 A;  4NE9 C;  1NDP A;  3D4J A;  3CCJ S;  4FF2 A;  1HNI B;  4USM A;  4UOH A;  8ATC B;  3SSR A;  5J2N A;  4O4G A;  4DV2 F;  5J2M B;  1NB2 A;  1RHR B;  3FZB A;  1NJZ A;  4X62 F;  4KJI A;  4IRK A;  3D1O A;  4EU0 A;  2DB1 A;  1K44 A;  2CNK B;  2F8E X;  2MZQ A;  2QLJ B;  2V4J A;  3DCA A;  3AB4 B;  4R0E A;  4CO2 A;  6FD1 A;  5L46 A;  3GII A;  3I9V 9;  3QRQ A;  3NMA A;  2OD4 A;  4CLL A;  2LEP A;  3CJ8 A;  1BQM B;  4OQJ A;  3GLJ A;  3VHQ A;  1W2B R;  4HTJ A;  2GJF A;  4O3R A;  2OH2 A;  4FF4 A;  2HPU A;  1JKH A;  4IG0 A;  1K73 T;  3C6U B;  3ILJ A;  3M2U A;  3D0H E;  1U2F A;  3MEE A;  3O8W A;  1CSJ A;  2RUG A;  3H42 A;  4LRA A;  1AZS B;  2RT3 A;  4WE1 B;  3TVZ A;  2JL9 A;  3G6X A;  4LQ3 A;  1H38 A;  2HND B;  1JLF B;  3A8I A;  3EVO A;  1MRO B;  1YZ6 A;  3PX6 A;  4P75 A;  4Q45 A;  2QIF A;  1Q82 T;  4W4M A;  3GJR B;  1S1T A;  4W98 A;  3TEG A;  1HNI A;  2CQ2 A;  2AP6 A;  2CQD A;  2B5J A;  4FP9 A;  2W7P A;  3CMA S;  4JV5 F;  2YKN A;  4P7V A;  3LGM A;  3LAL A;  2G0C A;  4OMF G;  3H5S A;  2RQK A;  1BGX T;  2H4Y B;  2V4J B;  4DR2 F;  2LEC A;  2RAQ A;  4JP8 A;  2WSE C;  1C1B B;  2WRM A;  5GAH U;  5CYJ A;  4QIW D;  1PAE X;  3W2V B;  3RRH A;  3C6T A;  2KTQ A;  2MQO A;  2DO4 A;  3QIP A;  4CLT A;  2QYG A;  4DUZ F;  2DYA A;  4OLP A;  3OVA A;  2R7R A;  1B0T A;  4XTT A;  2RUS A;  3ADA C;  2RF2 B;  3LP0 B;  1MW7 A;  3UDV A;  2KFN A;  2AT1 B;  3KLG B;  4JI2 J;  2C22 A;  4RU9 A;  4YFU A;  4ZVQ B;  1N33 F;  1J27 A;  1FWL A;  1C1C B;  3TA1 A;  4JI4 J;  4B3O B;  3IWL A;  4B3S J;  5D6G A;  2JZ5 A;  2PN6 A;  5HO4 A;  3A13 A;  4KE5 A;  3OR1 B;  1JLQ B;  1M5S A;  4NYO A;  5CZX A;  3TRG A;  1YIT S;  1UA1 A;  5KG2 A;  3RYL A;  1F3V A;  1UJ6 A;  5B0E A;  1FKA F;  2DHX A;  1OYE A;  4L72 B;  4AE5 A;  4N47 A;  2A2D A;  2WVB A;  3QMQ A;  3QO9 B;  3IA0 A;  3R27 A;  4WP3 A;  5SZT A;  1QSL A;  4CO1 A;  4UQG A;  1RAG B;  4EUV A;  2V9W A;  4C8K A;  5GMD A;  3MED B;  4ZVP B;  2AX1 A;  3SQG A;  4RO0 A;  4DPO A;  3NGT A;  2M3D A;  1KQG B;  3T3F A;  3M32 A;  3I5A A;  1HBM A;  2RHS B;  5CHC B;  3CJS A;  3JTO A;  3FVY A;  3W63 A;  3RG6 A;  1N0U A;  4RNF A;  4ZN3 A;  4DV6 F;  4DS5 A;  3QRP A;  4DR1 F;  1RWO B;  1SQG A;  4NLP A;  4TQR A;  2KT5 A;  4JI2 F;  1Q5V A;  3QSI A;  3PW7 A;  1JLB B;  1U1R A;  2XMJ A;  3BPD A;  2ZOM A;  4KYZ A;  2QG9 B;  4O44 A;  2VA2 A;  3PR5 B;  3OL9 A;  3DDK A;  3MM6 B;  2VG7 B;  4ID5 B;  4FKY A;  1F9E B;  5IV3 A;  1VQ7 S;  1F3F A;  2JEJ A;  3POT B;  3P49 B;  5E5N A;  4DV1 F;  1NME B;  3I87 A;  4OX7 A;  5EWG A;  3D1H A;  3HFZ B;  3PTW A;  3QT6 A;  3M1V A;  1S6Q A;  4F0H A;  4ECS A;  1CC7 A;  3T1Y F;  4V19 J;  3T5L A;  3SCK E;  3UI3 A;  1WWH A;  1M90 T;  4DV7 J;  1RAH B;  3UWT A;  1HW8 A;  1SJ1 A;  2H4W B;  3B4M A;  4RLE A;  1NKC A;  1LV5 A;  2E1P A;  2J9D A;  3MEC B;  3W2V A;  3DOL B;  4KHR A;  1XR5 A;  3BGR B;  2MZ1 A;  3LGH A;  1EHW A;  1VQ9 S;  4LSN B;  4ZVF A;  1VQN S;  5HJX A;  3K8W A;  1UP1 A;  3DGV A;  2E7W A;  1U02 A;  2XUL A;  4ZIT A;  1FFG B;  2BW7 A;  2CNL B;  3GCX P;  3IBC B;  2BM0 A;  2EFO A;  3DLE B;  5K5M A;  3GFX A;  5B0G A;  4ZPW R;  5K8M A;  3BH7 B;  5GAD I;  2W2M P;  5T7L B;  2YKA A;  2B7B B;  4A8O A;  4IO9 Q;  4WFZ A;  5L1I A;  1HQU A;  1N5Y B;  2E29 A;  2YNG A;  1B3T A;  1GTH A;  3U1L A;  4DQP A;  5LJ3 Y;  3HO1 A;  2QLB B;  1BC6 A;  2MLX A;  3AD8 C;  4IH6 A;  1TP7 A;  2A18 A;  1HMV A;  4W90 B;  4RNH A;  3JYT A;  2X1G A;  4HDH A;  4I68 A;  4PG6 A;  3RB0 A;  4A46 A;  1AB8 A;  1G3O A;  4MJK A;  1SKR A;  4B3T F;  3R5J B;  2BUN A;  4WTO B;  4NXM F;  3DI6 B;  2G2O A;  1KLM A;  4LRF A;  4P2M A;  3C16 B;  1RT7 A;  3T1Y J;  4NXN J;  1FJG J;  2DNP A;  1L3S A;  1RI7 A;  3E01 A;  2HVZ A;  5CYQ B;  3NRB A;  1VQ8 S;  3RR7 A;  2VKR A;  3H2U B;  5J1E A;  4DV7 F;  4AQY J;  3V6H A;  2IBK A;  5CAA A;  4DG1 B;  2QYC A;  1R8P A;  5IQQ A;  2AF6 A;  1U1N A;  1TQL A;  3MR5 A;  4TNO A;  5M2R A;  2CPI A;  4P10 A;  2CXE A;  4B17 A;  3FEZ A;  2OEM A;  1Q78 A;  4FXW A;  1WD6 A;  1S57 A;  1ZAV A;  4PZV A;  4OZ3 A;  3AY0 A;  1HWI A;  3DRS B;  4H4M A;  4WKY A;  4TQS A;  5IT9 U;  1YZ7 A;  4DR5 J;  2Q66 A;  3ISN C;  2R42 A;  1K47 A;  3TR5 A;  4ZHR B;  1RWU A;  1WKL A;  1DY3 A;  3MMC A;  1G4C A;  3E3X A;  2UVR A;  5K20 B;  1PJ5 A;  1PAU B;  2EC0 A;  2ZOF A;  4FN5 A;  4Y2A A;  2AEM A;  4ZPD A;  4USJ C;  4AFF A;  3QJJ A;  1M1K T;  4G3I A;  1NK0 A;  2NZC A;  4CZC A;  2Y8W A;  5EHH A;  2GX8 A;  1RTZ A;  1HWJ A;  3V81 B;  3NCP A;  3KG4 A;  3KNG A;  3QIP B;  2CJ9 A;  3W8P A;  2OPR A;  3FCV A;  4I56 A;  3G82 A;  4LSN A;  4LT6 A;  1AFI A;  5C42 A;  1FJC A;  2YY3 A;  2W4D A;  3N5F A;  2VOD A;  4AXI A;  3CJ2 A;  3D3B J;  2Z2Z A;  3G87 A;  2VPY B;  3NG8 A;  2A6O A;  2DIV A;  5IT0 A;  4OL8 A;  3UCU P;  1GNK A;  3DKD A;  2C2Z B;  3ITH A;  2ZZN A;  5ETK A;  3MGJ A;  1H72 C;  3PW4 A;  2Q43 A;  3KKF A;  1X7V A;  2FQQ B;  2XMU A;  3K17 A;  5I42 B;  1RWW B;  3FCH A;  3GR1 A;  1RAJ A;  2N4D A;  2NR0 A;  1TKZ A;  2V69 A;  3Q83 A;  1F60 B;  4P7T A;  3VGT A;  4EWT A;  5D0E A;  1MWY A;  1VR6 A;  2MZS A;  5A2Q U;  1H3D A;  2DPI A;  4DR5 F;  4ANC A;  1N48 A;  2WK4 A;  3DOK A;  3M2V B;  4KO0 B;  1WOS A;  1ZM4 A;  3VV2 B;  2HFO A;  2DNL A;  3T6J A;  4PQU B;  2NRE A;  5E0O A;  1KBR A;  4O3O A;  4YHH J;  1IUJ A;  4AL7 A;  2KYX A;  3D28 A;  1S1W B;  5GAE I;  2J6T A;  3QYY A;  1Y0H A;  4WJB A;  3RBX A;  1HQE A;  2Z4P A;  1X4B A;  4UTG A;  2VF3 A;  2XMK A;  3AAW B;  5KFY A;  3M2R A;  2KG0 A;  2YTC A;  3KMQ A;  4RKU C;  3ILO A;  1U2C A;  1PIL A;  4M5G A;  3TWZ A;  1FEH A;  5M2U A;  3LWM A;  1S9E B;  1VRQ C;  2M52 A;  4NLT A;  1YKW A;  5B0D A;  1UTA A;  5THW A;  5C24 A;  4F04 B;  1RZM A;  1S10 A;  5LT5 A;  2XY5 A;  1WG1 A;  2HK2 A;  3EGN A;  4CLU A;  3H25 A;  4QIE A;  4EI2 A;  2R4F A;  1HAR A;  1R8B A;  4TY8 B;  1KQS R;  1RKI A;  4IFV A;  3LAN A;  5CH7 B;  4JI7 J;  1HFE L;  1Y3K A;  2Z30 B;  3M6V A;  1C4A A;  2RDD A;  3AHP A;  2WAQ D;  2XBP A;  5IS2 A;  3PCO B;  4LF8 F;  2DNG A;  1RTD A;  3D54 A;  1QSY A;  1EKS A;  5A8W B;  1IVZ A;  4MKV A;  5DO2 A;  4EMD A;  1DRZ A;  3SBM A;  2E44 A;  2Z0G A;  4I6W A;  1K9M T;  3PYF A;  1QSS A;  2R7O A;  1YJW S;  1HBN B;  2ZBI A;  3O2I A;  4HLB A;  1JMT A;  5CA5 A;  1WEZ A;  4KR0 B;  1Z4U A;  1REV A;  2AZ3 A;  3I56 S;  2YWG A;  2PEB A;  4P2F A;  1SIZ A;  3M2R B;  3M6X A;  3MM8 B;  3P96 A;  4YHH F;  3OHB A;  3EPG A;  3BQ0 A;  3NNA A;  2U1A A;  2ZBR A;  4DJB A;  4ECW A;  1FFW B;  3P4U B;  2FZC B;  3GYG A;  1SC1 B;  3IGN A;  4WU3 A;  3RJM B;  3PDN A;  1H73 A;  4MMO A;  3A3O B;  5T7L A;  5C24 B;  5IWA F;  2MGZ A;  2AQ4 A;  2DR9 A;  1H2T Z;  3CCW A;  5HVF A;  1XC9 A;  1VK8 A;  1SC6 A;  2DIT A;  2EBG A;  3BR8 A;  3PRD A;  1FRX A;  5J2P A;  3BBF A;  4KPY A;  2CWK A;  1T7P A;  2OPP A;  1VIS A;  1X0F A;  1RWK B;  3TA0 A;  2YKN B;  1TAU A;  3GTY X;  3AXK A;  4NLQ A;  1EJ7 L;  2V8V A;  3ULH A;  3MCO A;  3O1L A;  4RW8 A;  4IQM A;  1WC6 A;  2YQ0 A;  4UOG A;  4B9U A;  1REG X;  1GK8 A;  1RHQ B;  1RTI A;  3HHL A;  1FHT A;  1CC8 A;  1O5J A;  4RNM A;  2XS7 A;  3NAH A;  3QRR A;  4A8M P;  5A8W A;  2DIS A;  1VFJ A;  4JI7 F;  1T11 A;  4M5H A;  1YRU A;  1GMW A;  2DHH A;  2ILY A;  3PJ9 A;  4QIV A;  4C8Y A;  1NHK L;  1Q79 A;  2FVR A;  2GQC A;  2HRT A;  3MMA A;  2GC8 A;  4QPT A;  2JOQ A;  2Q3P A;  2ZKT A;  3IBW A;  5IM0 B;  4A8S A;  1PC5 A;  4PG8 A;  2ZM6 F;  4DS4 A;  1TVR A;  1Q7Y T;  1FRH A;  2VC0 A;  2XQC A;  4OHV A;  3LH2 S;  5H1S V;  1Y5N B;  1ZZF A;  3J80 Y;  2JVR A;  4YB6 A;  4J9N A;  1S9E A;  3QZ7 A;  2HGL A;  2OKQ A;  3Q22 A;  1V3Z A;  2IMW P;  4J9Q A;  5DG8 A;  2DTJ A;  5J2Q A;  3Q2T C;  4HHJ A;  3HFV A;  1X5S A;  3NOC A;  3MUT P;  3R2C J;  4X4S A;  1D09 B;  1MLA A;  3CWJ A;  3H90 A;  2M4M A;  1TKT B;  1FFS B;  3LAK A;  3N9U C;  3BBC A;  2WON B;  3B82 A;  5LMN J;  5ETL A;  2CPJ A;  1S6P A;  1FDB A;  5D3G B;  1RT4 B;  4OI2 A;  4V19 X;  5IZH A;  5F8H A;  4LF5 F;  4ETX A;  5HN0 A;  2UUC F;  4DR6 J;  1TL1 B;  1GX6 A;  5KG7 A;  2L3M A;  3CC7 S;  3GFZ A;  3RAQ A;  2AIR B;  4RW6 B;  2AU0 A;  3KLE B;  1YX2 A;  3MOZ A;  4HKQ A;  5EUH A;  3JQK A;  1LW0 B;  3C46 A;  1NSP A;  4OV6 A;  2ZNZ A;  1IQZ A;  2D3O 1;  5DDQ C;  2WB4 A;  2AHO B;  1TZ0 A;  5HLF A;  2RB7 A;  3RRK A;  3M4X A;  1NK4 A;  3Q24 A;  3D9B A;  2CPD A;  3RBE A;  4OHY A;  3AB2 B;  1ULR A;  4UOC A;  1RBO B;  3IR7 B;  4USW A;  4ZCK A;  2HS0 A;  2V68 A;  4CLP A;  4EK2 A;  3PV8 A;  2AV5 A;  1K1Q A;  2E1C A;  1U09 A;  3OR2 B;  1T9W A;  4F4Z A;  2XS5 A;  4LSL A;  3UO0 A;  2NXJ A;  4ZLP A;  3IP0 A;  2GJI A;  2HND A;  3JAM U;  1X9W A;  4WFY A;  4MIB A;  4C4W A;  1U2R A;  1DAX A;  3KJF B;  1EAR A;  1NCL A;  4Y6I A;  3BN4 A;  3F73 A;  4J9P A;  1ZTT A;  2FLN A;  4CH0 S;  4OX9 J;  3DFE A;  1YBU A;  3OTE A;  3T41 A;  2ZE2 A;  2XZD B;  5LMN F;  5HP1 B;  4NRT A;  3IGV A;  4DQI A;  3QFH A;  5D0R A;  4OZL A;  1GEH A;  2CQP A;  2P6S A;  4KV8 A;  3B54 A;  3K2Y A;  1ZAW A;  1WHX A;  4KQZ A;  3S7R A;  3WQP A;  2AGQ A;  1NXI A;  4EFA C;  2UUC J;  2L9D A;  1FO1 A;  4DL5 A;  4DR6 F;  4H54 A;  2NPF A;  5JXS A;  1MN7 A;  1F5C A;  4MKB A;  3HJF A;  1EET A;  1HLW A;  1KLM B;  3E51 A;  2HBQ B;  4OYO A;  4J9O A;  4N8O A;  3QGI A;  2A1B A;  1U6F A;  1AUS L;  2J0S D;  1HI0 P;  5HK4 A;  4DQR A;  3CJK A;  1F2H A;  1KON A;  2VBW A;  3PO5 A;  3BKF A;  5IC4 B;  1HWK A;  3HLU A;  3WC2 A;  2F1F A;  5A2Q Y;  2JH3 A;  1CPZ A;  3PYG A;  2Y9H A;  1GX5 A;  2GIF A;  2FVS A;  1B4S A;  2RS2 A;  1O8B A;  2XYG B;  1X4F A;  2W25 A;  2YNF B;  1YQH A;  4QR0 A;  5ITH A;  1BXN A;  4WFN Q;  3KHG A;  3SFU A;  5DLG A;  1UMJ A;  3G8Q A;  4F4Y A;  2ERR A;  1FKP A;  2RKI A;  3JSB A;  1HW9 A;  1NND A;  3ZC4 A;  4I7F B;  4F3M A;  3IMQ J;  2Z2Y B;  1MWQ A;  2XNR A;  1RJJ A;  2VBX A;  2CPE A;  5DGB A;  3IAS 9;  3J7Y U;  5J2N B;  1SQF A;  3KWM A;  4M95 A;  2VB6 A;  4BWJ A;  3BDP A;  4LRB A;  1FE0 A;  4DL0 C;  1J5O B;  1QUP A;  4F4K A;  4Y3C A;  2NQP A;  4A47 A;  2CRL A;  3PKM A;  4KHP J;  1NDC A;  3RTV A;  2E9R X;  1R89 A;  4QWD A;  4H4O B;  2CPF A;  3DLB A;  1N5S A;  3RZA A;  2AEF A;  1GMV A;  1UET A;  2XSJ A;  4ZJO A;  4XPE A;  3CTR A;  4H4K C;  1RT3 A;  1SH3 A;  2CQC A;  5KFS A;  5HQ8 A;  2QSW A;  3M8W A;  4QZV B;  5LSO A;  1KVK A;  1MWZ A;  3UN3 A;  1FES A;  1WKJ A;  1FI4 A;  3KDN A;  1FWP A;  4FPR A;  5HVH A;  2B4U A;  2LCW A;  4DV5 F;  1TL7 A;  1CS4 B;  2I5J A;  3J7Y I;  4X4V A;  2A2C A;  4DPX A;  4EO6 A;  5DG7 A;  4LUB A;  4JV1 A;  3D0I E;  4M5D A;  3W62 A;  4OYI A;  1SKU B;  2ASY A;  3GIR A;  3T9N A;  3CCR S;  1WKK A;  5J1P A;  5T14 A;  2IMO A;  2GNK A;  4MH8 A;  1FRL A;  2PEH A;  2R8K A;  5KFO A;  2FC9 A;  3MPD A;  3QZ8 A;  4DL7 A;  1TUW A;  2K2P A;  2MQQ A;  1OJ4 A;  2EFN A;  3I32 A;  5MAO A;  1SJF A;  4QYZ J;  1YJT A;  3QJP A;  1VIO A;  2JLF A;  1AW0 A;  3MZI A;  1I3O B;  4GKK J;  3HSZ A;  2UVW A;  2XGQ A;  1V6H A;  2V5H G;  4Q43 A;  4PQU A;  1SXL A;  1PCA A;  2PC6 A;  5AJ3 J;  2QX0 A;  4ZCI A;  1NRK A;  4Z7C A;  2V9K A;  4DSK A;  2VFU A;  1T3O A;  3BEG B;  3G6E S;  1UVJ A;  2DXD A;  2W7A A;  4FNI A;  4UUW A;  2KHD A;  4C2M A;  1JB0 C;  4HVZ A;  3Q8U A;  2HIY A;  3CCZ A;  2P2C B;  3EZU A;  3AFG A;  4MFB A;  4DX5 A;  1N6Q A;  5KFP A;  3FUY A;  2PSZ A;  3AQP A;  2UU9 F;  2D9P A;  1O6X A;  2JFD A;  1FKO A;  3ENV A;  1IKV B;  2R2S A;  5GME A;  5FLX U;  2IYG A;  4G65 A;  3GON A;  1OO0 B;  1Q1K A;  1YG0 A;  2O66 A;  5GVQ A;  1P8G A;  1UZH A;  1L5U A;  5KFG A;  2HHQ A;  2BE7 D;  4F7V A;  2CQ1 A;  4LF4 J;  3JS9 A;  5EWE A;  4WFA Q;  2UUB F;  5F8J A;  2Y0S D;  3DLK A;  1QM9 A;  3B78 A;  2GS8 A;  5E33 A;  3VQS A;  8AT1 B;  5DQI A;  2F8M A;  1Z2L A;  2ZHA A;  4NLS A;  1BHN A;  2ROP A;  2KVI A;  3US5 A;  1JLE A;  1DQ8 A;  2PGC A;  3CD6 S;  4Q5V A;  3PYD A;  4CT9 A;  1SJ3 P;  4K2J A;  4KC5 A;  3N01 A;  2DVI A;  3TJA A;  1NK6 A;  1RT3 B;  4Q2L A;  1E6V B;  2ASL A;  3ZZO A;  2KKH A;  3BRE A;  1HBM B;  4LRE A;  3PM9 A;  3GG1 A;  3QWP A;  1HQ2 A;  3M6W A;  1REV B;  5J1E B;  5CQG A;  3KJV A;  4WKR A;  4ZPT R;  2K7K A;  2V0N A;  3CJ5 A;  2MXY A;  5AJ3 F;  3UD4 P;  3SIP B;  5LMU F;  2J9C A;  2E9Z A;  2CG8 A;  2OD6 A;  3BSC A;  3DXS X;  5IV4 A;  2ADB A;  1JIH A;  2G1D A;  1V9O A;  5D0H A;  1IBL F;  1URN A;  5HMZ A;  4M5L A;  3K0J A;  4RUC A;  4I6Y A;  4CNY A;  4F26 A;  4QWE A;  1KD1 T;  2YKQ A;  1Y5I B;  1NJX A;  4H4M B;  3ZFV A;  1ZYQ A;  1AYE A;  1U47 A;  4C98 A;  1RP5 A;  4DPY A;  5BJR A;  3NMR A;  2RIJ A;  3MM6 A;  1M5H A;  4ILM A;  4Y28 C;  4RZR A;  2VPX B;  2UU9 J;  2R7X A;  2O67 A;  1U1M A;  3CDU A;  1DHM A;  5HQM A;  3CCQ S;  2BAN B;  2BQU A;  2BRK A;  5F8L A;  3OSN A;  1UFL A;  2QLF B;  3EMT A;  5EX3 A;  4FYV B;  2GGP B;  3L95 X;  4ZKA A;  5F9N A;  4FF3 A;  1XMB A;  3PJX A;  3LUY A;  5D4O A;  3HJV A;  2V2K A;  2BKN A;  2XNQ A;  1RT5 A;  3MM5 A;  3OXL A;  3HPO A;  3FZ2 A;  3P5T L;  2KB2 A;  4QOT A;  2W9B A;  5KAK A;  2EFG A;  3GB0 A;  4ZIV A;  1FVS A;  3KHH A;  3GIM A;  3NNC A;  1KNZ A;  2CQ0 A;  1ZS6 A;  4A8K A;  2F9D A;  2B51 A;  3HK2 A;  4NYZ A;  2RDJ A;  2BXJ A;  4TN2 A;  3HHL C;  5DZ7 A;  4F36 A;  1TMJ A;  2ZKU A;  2JRS A;  3KLH A;  2PMH A;  2W2Q P;  3OD2 A;  4UY8 5;  1R8H A;  1NSK L;  3OXG A;  4K4T A;  1JX4 A;  4RU2 A;  4C8N A;  5HAN A;  2YBV A;  5DET A;  3HUL A;  3W5X A;  1X4A A;  2HHS A;  1VQ4 S;  1S6O A;  4BWM A;  5LMU J;  4RL1 A;  1JLB A;  4YEA A;  1WG5 A;  2HFV A;  2PII A;  2FJB B;  1U4B A;  3HMJ G;  1G7C B;  1QE1 B;  1RT6 A;  2MKI A;  3AOC A;  2BR0 A;  1QLN A;  3TOQ A;  1TKZ B;  3A4T A;  3Q89 A;  3TA2 A;  2W9C A;  3EX7 B;  1D9D A;  3I0S A;  2JJ4 D;  3N6N A;  5AXN A;  4WFX A;  3CB4 A;  2L48 A;  3QT8 A;  4DV4 F;  1N36 J;  2K06 A;  2OFH X;  2R2R A;  4ZA1 A;  1P9Q C;  4URG A;  2RQC A;  3L9Z A;  2PO4 A;  5EWF A;  4DFK A;  1RT7 B;  2CJQ A;  1U0H B;  3ET6 B;  3FRZ A;  3MEC A;  1IKY B;  4K7Q A;  1S1W A;  1CJK B;  4I2P B;  2HZV A;  4HAC B;  2Z57 B;  1LNQ A;  5KFH A;  1RAE B;  1RCX B;  3M8Q B;  4JYA F;  1JXE A;  4ZLL A;  2WSC C;  1T02 A;  5GMK a;  1ZTW A;  2R8H A;  5HBM A;  2G0I A;  1XER A;  3KLH B;  2MQN A;  1KN6 A;  5KOW A;  3DYA B;  3ONQ A;  2BJE A;  1PKU A;  5RUB A;  5KFK A;  1YJV A;  4WE1 A;  3N79 A;  3VAI A;  1D1U A;  1S7H A;  3MAH A;  1JK9 B;  1FWK A;  4JV2 A;  1J2V A;  3GFH A;  4DUY F;  3HCX A;  2CQ4 A;  2W1B A;  2QSF A;  3JXO A;  1NKE A;  1MG7 A;  2NSC A;  2ZH9 A;  2EKN A;  1JXV A;  3K5O A;  2KZM A;  2VV5 A;  1HNZ F;  1J5E F;  1UVM A;  1APS A;  3V5R A;  4B9N A;  4NCA A;  3W8G A;  1GQE A;  4DN9 A;  1SPB P;  2LKZ A;  1S48 A;  1JNR B;  4U8V A;  2K1R A;  2M7S A;  3OBI A;  4IQX A;  3KUE A;  4HYK A;  4CLF A;  5F0U A;  3G2X A;  4TLQ A;  2CJX B;  2RS8 A;  3TYT A;  3F41 A;  4G1I A;  3TEH B;  4ECX A;  1HI1 A;  4QIG A;  3V6J A;  3HHN B;  3LP0 A;  1TK0 A;  1NBE B;  4U7U D;  2J8A A;  2LLZ A;  2MHN A;  2MST A;  3BBB A;  3NCR A;  5HBM B;  3WBZ A;  5K9F A;  2JC0 A;  3AJ2 A;  4OYZ A;  4ZVT B;  5GAD U;  2XY6 A;  4J90 A;  1DLO A;  3ITH B;  1UVN A;  3RB3 A;  2EFV A;  4EZ9 A;  1FKO B;  3BGF A;  3HVA A;  1RIS A;  4HI2 A;  2VPZ B;  3QGH A;  2UVU A;  3W65 A;  3JTN A;  1VDH A;  4AT1 B;  4TKT A;  4YN3 B;  4X4P A;  1PYS B;  2E5G A;  2UP1 A;  2XS2 A;  2EFP A;  3U27 A;  2AJQ A;  4BDP A;  4RW8 B;  5C2G A;  3DHW C;  2IRU A;  4DUY J;  2PD1 A;  3ILI A;  3TJ9 A;  4KO0 A;  5I3U A;  2IYI A;  1EZZ B;  2BJ1 A;  3CD5 A;  3EGW B;  3EVM A;  2KM8 B;  4F2S A;  3JTP A;  4ILL A;  1HNZ J;  1J5E J;  4MKY A;  2AW0 A;  4WK3 A;  5CYM B;  4F2R A;  3IS9 B;  1IJF B;  3DOL A;  1IKY A;  2ABY A;  3EVW A;  4XDD A;  1Y00 A;  1KQK A;  5KFA A;  4D3G A;  3L3C A;  3V6D A;  4M5M A;  4JI6 F;  3KJV B;  4ERD A;  2CDR B;  2KZZ A;  1XR7 A;  2NSB A;  2MZR A;  1Q8K A;  2HFS A;  3ETO A;  4LVO P;  1LXJ A;  1YRT A;  2C42 A;  3TQ1 A;  4PWW A;  4AL6 A;  1R6Y A;  2P8I A;  3F44 A;  3IFE A;  4WCE Q;  2GVD B;  3G6Y A;  3AA9 A;  2ZH2 A;  5F8I A;  5IC6 B;  2ZIT A;  2MJU A;  2POK A;  2X3G A;  4U7U K;  4DDF A;  2MB0 B;  2NCK L;  1AXQ A;  2R8G A;  1LOU A;  3RB6 A;  2GA7 A;  3N28 A;  3MM7 B;  4NMX A;  3CO0 P;  4Z2X A;  2EXU A;  1S0N A;  3ENQ A;  1Q81 T;  1FDD A;  2J8S A;  3NGD A;  4I7F A;  3TVK A;  1TL7 B;  2CQH A;  2I5J B;  3R6L B;  4L6V 3;  3TW0 A;  4DSI A;  4P72 A;  3AD7 C;  2MJN A;  3IRX B;  3ZTO A;  2ZH7 A;  2X51 A;  1RT2 B;  2OSQ A;  1KKH A;  5E3Q A;  1N5T A;  3MPY A;  1S1U A;  1D3W A;  2AJ4 A;  2GAG C;  2HUR A;  2RE1 A;  3I5B A;  7FD1 A;  2HHU A;  1VI7 A;  1RTJ B;  4U96 A;  4ILR A;  3A3N B;  5F8N A;  2DR5 A;  4USI A;  2B6A B;  4K4U A;  4ZLN A;  2FYX A;  2QFJ A;  2CNN B;  2BQ3 A;  3MCS A;  3H2L A;  2M8H A;  3ISZ A;  3KUH A;  2GVZ A;  5SUH A;  4F02 A;  5CD4 A;  1UCN A;  1VBX A;  4NCB A;  9RUB A;  2ALZ A;  2Y1R I;  1JLG B;  4GMK A;  1MN9 A;  4RWX A;  2OIH A;  1I5O B;  5C5J A;  3CIZ A;  3TUJ C;  2MKC A;  1OMS A;  1MU2 A;  2N7C A;  1CBK A;  1BQX A;  1KSP A;  3LO3 A;  1FD8 A;  4Y2K A;  4I6A A;  4JI0 F;  4P74 A;  2HHH J;  4OZJ A;  1NLK L;  4OLO A;  2E5L J;  3PYE A;  1FX2 A;  1CG2 A;  2VU5 A;  2BJ9 A;  4E98 A;  1T9X A;  2FY8 A;  1SUQ A;  4G6V B;  1FTR A;  3QQC D;  2HNY B;  2HW3 A;  2MQP A;  3OJU A;  4RBT A;  3R3T A;  4LBP A;  2YQ3 A;  2AYE A;  2VFT A;  4DFJ A;  2AYG A;  1EQM A;  1SH2 A;  3KK2 B;  2X1F A;  1FRK A;  4DFP A;  4P2X A;  1N54 B;  5JVG Q;  4Q0B B;  1RTH A;  3TUZ C;  2XY7 A;  4NOH A;  3Q0A A;  3NOG A;  1RT1 B;  3EDQ B;  2J0W A;  4LF7 F;  1XNQ J;  1SC3 B;  3I9Z A;  1HBN A;  2EG1 A;  2JLG A;  3RW6 A;  3VGU A;  3IC1 A;  2IFX A;  3C8Y A;  1JLE B;  2VHG A;  2JSX A;  4PYD A;  2OEL A;  5D0G A;  3ILL A;  1Y5L B;  3AOA A;  1B7Y B;  3FKB A;  3HF5 A;  3LQV A;  1S9G B;  2FVQ A;  3JSR A;  4ZP6 A;  2VQF F;  4O0I A;  4MT1 A;  1T05 A;  2F4V F;  4AYB D;  4WIQ A;  4XDC A;  2G9O A;  2BMB A;  5LL6 d;  5BXI A;  3KHR A;  2QA4 S;  3W61 A;  3BO3 A;  4DR7 J;  4B3R F;  2DH8 A;  4C9D A;  4IKA A;  5D77 A;  4PXC A;  2ACM A;  4ZCL A;  3GQC A;  3PW5 A;  3MD1 A;  1S9F A;  2RJZ A;  3MPV A;  5E7O B;  4JI0 J;  3UDC A;  2G13 A;  3M9N B;  1S6P B;  3OFF A;  4Q44 A;  3V4I B;  2JEG A;  1S1X B;  3WDO A;  5EGY A;  5LXY A;  2F65 A;  3RBD A;  2Y1J A;  4X4N A;  2FLP A;  1Z1Z A;  2VC1 A;  1T94 A;  3IG1 B;  3UD3 P;  3OSP A;  4FS1 A;  3OVS A;  4IDK A;  1HNW F;  1WF1 A;  4KGK A;  1UW4 A;  5KFC A;  4HEA 9;  2CJY B;  2BA9 A;  4RW4 B;  1BD6 A;  1HPZ B;  1DQA A;  3EJM A;  2YWW A;  2MKH A;  4ER8 A;  2BJ8 A;  1ZA2 B;  1C1B A;  2B9Y A;  3GWC A;  3CED A;  5ETV A;  4B9T A;  1RT5 B;  2VKZ G;  4RJV A;  3ISN D;  1TVR B;  3JSM B;  5U47 A;  5H9E J;  4C7Q A;  2JC1 A;  5B0F A;  2XCP A;  3C15 A;  1GT8 A;  2AX0 A;  3C66 A;  3QSY B;  2HQI A;  1TK5 A;  1Q5Y A;  3NGK A;  4QIF A;  4ECT A;  1B99 A;  3CCU S;  5HRO A;  2HIQ A;  4HHU A;  4CQ1 A;  5ETR A;  1C2P A;  2GZO A;  3E8O A;  3MHY A;  3D3C J;  1S1T B;  1SJR A;  1VGY A;  4DPU A;  2DHS A;  4XK8 C;  2C2R A;  5DRK A;  1C1C A;  1W26 A;  4I69 A;  5AE1 A;  2AYM A;  4USH A;  1KDN A;  1E6Y B;  3VAH A;  2ZZT A;  3JQJ A;  2RRA A;  4PUO A;  2F4V J;  3A1Y G;  2RML A;  1SV5 B;  1L3T A;  1HNV B;  4DR7 F;  4WP8 A;  1UFK A;  3P8B B;  1P1L A;  4IOB A;  4K4V A;  4R8U A;  1NK5 A;  4DOZ A;  1CUL B;  2V6A A;  2W9C B;  5F0W A;  1I94 F;  1QTM A;  1JLA A;  4KV8 B;  2Y1I A;  3ENA A;  2AGP A;  1EX8 A;  1RWV B;  3E01 B;  1HPZ A;  5CYQ A;  1VS3 A;  2JFK A;  4ED3 A;  3LGN A;  4KSE B;  1OSD A;  2DD8 S;  2CQ3 A;  3MD3 A;  4C0B A;  2BOP A;  4ALZ A;  1HNW J;  4QYZ K;  2ALY B;  2H5I B;  3KLG A;  1XMO J;  3AOD A;  4G1P A;  4WTY A;  1TL3 A;  1KTQ A;  2D41 A;  3R9L A;  3CCE S;  3M8P A;  3PFE A;  2V8D A;  4LF6 F;  3SYZ A;  1RHK B;  2DO0 A;  2E1M C;  5L9N A;  5FDL A;  3H5U A;  3R1L A;  1HBO A;  1LXN A;  4NZ7 A;  5AT1 B;  4B9V A;  1YJU A;  2QT7 A;  3D6H B;  2DRA A;  4NI2 B;  1D8Z A;  3FK4 A;  1WOP A;  3TZX A;  2CPZ A;  4X64 F;  1XJW B;  2ZDO A;  2HBY B;  2ZH4 A;  3DLL Q;  4IR1 A;  3C19 A;  2G2Y A;  4TY8 A;  1N34 F;  5EN1 A;  3R6G B;  1YJR A;  3HFK A;  2CAJ A;  3KG0 A;  3CDB A;  3IRX A;  4PQA A;  5AXM A;  4DCJ B;  3J7A N;  2HNZ A;  1DTT A;  5E3P A;  5C2C A;  1FDN A;  4IOA Q;  1HD0 A;  4E0D A;  3HVT A;  1FKP B;  1NO8 A;  1KP6 A;  2OHD A;  1LWC A;  4KGV B;  2HRY A;  4RPF A;  5HMY A;  1VQY A;  3DLG A;  4PYA A;  4DCP B;  4J9U E;  1UWB A;  2FVC A;  4EEY A;  4RNN A;  2AYB A;  2KXN B;  2E7V A;  1LWF B;  2BX6 A;  2FJD B;  5IOL A;  1WNE A;  4OYM A;  1KFS A;  2GVZ B;  2VJV A;  4KTQ A;  3GSD A;  1WF0 A;  4X4T A;  1DJ0 A;  1XNR F;  2YX4 A;  1I94 J;  2Z58 B;  3ZXW A;  2FY1 A;  3NL0 A;  2D69 A;  2Q1L A;  1V5V A;  1R0B G;  2Y0B B;  2C3P A;  1MU2 B;  2YVS A;  4QW8 A;  1U1Q A;  1X4E A;  4NLV A;  2HS3 A;  3QFW A;  3C6U A;  4USU A;  3IBF B;  4K4X A;  1XMO F;  3I0R A;  2HWI A;  3H98 A;  4OHX A;  4WZQ A;  1XR6 A;  3OW2 R;  3SDE A;  4LF6 J;  3ZZZ A;  4JI5 J;  1V3R A;  3UR0 A;  2YXL A;  2LYV A;  4TY9 A;  3OXF A;  1VQ5 S;  5IT4 A;  1LFW A;  3MMB A;  3OLA A;  4CO4 A;  4F4A A;  4DR4 J;  2VON A;  3N6M A;  3W1Y C;  4LF9 F;  1BUX A;  2EPI A;  3D6M B;  3BQ1 A;  1VBY A;  1TL1 A;  1CJV B;  2R9L A;  1N34 J;  1UJ4 A;  3GP9 A;  1ZM9 A;  4NL5 A;  3EDR B;  4OX8 A;  3V2U C;  4P71 A;  2XC9 A;  4DV0 J;  3Q2S C;  2IPO B;  1X60 A;  4M63 A;  1VQO S;  4R5P A;  4USV A;  3P45 B;  2DNQ A;  4FBU A;  2KYZ A;  1VCT A;  4NA3 A;  3DDI A;  3THV A;  2PMW A;  1OPI A;  3S8S A;  2L41 A;  4X4Q A;  2KRB A;  3TAQ A;  1C0U B;  5A6W A;  1S0M A;  3NGU A;  3CUL A;  4ZN1 A;  1S4F A;  3G96 A;  5HLF B;  1WF2 A;  2C3O A;  3D68 A;  2RU9 A;  1H2V Z;  3QT7 A;  5KFF A;  2BAB A;  4IUF A;  2F63 A;  3CJ0 A;  1EAY C;  3G86 A;  5F3Z A;  2ASD A;  2C2E A;  1SJ4 P;  1HBO B;  4K0K F;  2DNH A;  1N5Q A;  3DXB A;  2IJN A;  1NJW A;  3OHA A;  2JVO A;  4NPO A;  1NHU A;  2ZFH A;  3FMW A;  3H20 A;  2ADC A;  1HNX F;  2C3Y A;  4A48 A;  2NZ4 A;  3AQO A;  3WX8 A;  4Y0F A;  2I38 A;  4ECQ A;  4ES1 A;  1K0T A;  2J7W A;  5KTQ A;  3BR9 A;  1QUV A;  4C0O C;  2BE9 B;  4N5S A;  1VQK S;  1RHJ B;  4M94 A;  1Y10 A;  2J7K A;  3BO4 A;  2VA3 A;  3DRS A;  2N3O A;  4GRS A;  1VQP S;  3LTO A;  4TU7 A;  2HHW A;  2MY8 A;  4A8Y A;  1RT4 A;  1UWA A;  2RQ4 A;  3CIM A;  3TZW A;  4ZVS B;  4LR9 A;  5HP1 A;  1K0V A;  4JOU A;  4UUX A;  3HHE A;  5HQL A;  2AMC B;  5GAG I;  3GPA A;  2W9A A;  3LP1 A;  1T0T V;  4P73 A;  4LF9 J;  4RW4 A;  1RA7 A;  2LXI A;  3UD5 A;  3W2W A;  5K8P A;  2ZJQ Q;  3V6D B;  2DK2 A;  1OQ6 A;  5A6P A;  2H54 B;  2ZVI A;  1SBR A;  5KT7 A;  3TZY A;  4EO8 A;  2HQC A;  1S7I A;  2JNJ A;  2H9Z A;  3CT9 A;  4DG1 A;  3V81 A;  1N4L A;  2WOM B;  1TMM A;  1IKX A;  1M1G A;  1WDD A;  2HSE B;  2NPI A;  4ED7 A;  2DNK A;  2HBR B;  4RW7 B;  3S1T A;  1FT8 A;  5KG6 A;  3TNV A;  1LFP A;  1DBD A;  4IOC Q;  2E5I A;  2HG4 A;  4QYR A;  4ZCM A;  3IO1 A;  1UJ5 A;  1XK8 A;  2FHJ D;  2HFU A;  2ZWP A;  2DGO A;  1YJN S;  3FBC A;  4FZV A;  4ZHR A;  4MFB B;  4RBU A;  3LP2 A;  5D4L A;  3TX0 A;  3OUY B;  3MMB B;  3P5B P;  4NRU A;  3U7J A;  4PCQ A;  3W5Z A;  3HT3 A;  4A8W A;  3VWS A;  1HNX J;  2Q6C A;  2RKI B;  3H59 A;  3WC0 A;  5JUM A;  2FIU A;  4PG4 A;  2IAJ A;  2QTW A;  3I31 A;  2CZ9 A;  1LWE B;  3NWG A;  1SUQ B;  1OS5 A;  2DJW A;  3GR0 A;  3LAM A;  2BJ3 A;  3LOU A;  5KFW A;  3EGZ A;  2XYP B;  1OIA A;  1TK8 A;  1NKB A;  4QPX A;  2GMH A;  1WOO A;  2KRR A;  2YPZ A;  2HHV A;  2SXL A;  1UL3 A;  1R6V A;  1FJE B;  1HI8 A;  4WPA A;  3MXH P;  1XNR J;  3BH6 B;  2ZD1 B;  2FPH X;  1VMB A;  2IRY A;  4CNZ A;  1VRT B;  3BGR A;  4OYW A;  3MAQ A;  2FZK B;  5KFR A;  4DHV A;  5MLC V;  4ED2 A;  2MYF A;  2ZH5 A;  1TKD A;  4FYD A;  4LVN P;  1OWX A;  1SJQ A;  1NSA A;  2C1E B;  3DOM B;  3JQM A;  3M2U B;  3PXG a;  3RAM A;  3QLH B;  3TVY A;  4ES2 A;  5I42 A;  1YSJ A;  5I4M A;  2V2V A;  3DRP B;  2BJ7 A;  1CS4 A;  5GAH I;  3G8S A;  4NZ6 A;  2R8I A;  1TKT A;  2NUU G;  4FKX A;  4LRD A;  4V1A k;  4C11 A;  5FLX Y;  4JV5 J;  2HHX A;  3RRG A;  1JLF A;  4RUH A;  1U8W A;  2COL A;  3HKW A;  4G1Q A;  4ES3 A;  4MKA A;  4KGZ B;  4I4B A;  1EIY B;  4DR2 J;  2E1R A;  1X8D A;  2OPQ A;  3NWR A;  4L3K A;  2MHE A;  5KFD A;  1NHV A;  5A76 A;  4GKK F;  3D7S B;  1NB7 A;  3PKY A;  3OJS A;  3I0S B;  3D0G E;  1ZH5 A;  4CO0 A;  5DM6 Q;  2NS1 B;  3NBP B;  2OML A;  4DZ6 A;  3T1H F;  2GGP A;  2IBO A;  1RWN B;  2M2B A;  5HVG A;  3EXY A;  3PW0 A;  1Q53 A;  2BAC A;  1M1H A;  3SQG B;  4F0K A;  2FGC A;  2DEJ A;  3C6T B;  3CDW A;  2LA4 A;  2GCF A;  4PPD A;  5GAG U;  3DGP B;  1LW2 A;  1YJ9 S;  1IKX B;  1TUV A;  2CPY A;  1K1S A;  1R43 A;  2LDY A;  3HM9 A;  4JI4 F;  2YKP A;  1CLF A;  1NU4 A;  1NPP A;  4B3S F;  1FK9 A;  2NYH A;  2X1B A;  4WF9 Q;  2D3Z A;  2RSQ A;  4Y2C A;  1Q8I A;  2U2F A;  1ZET A;  1OYD A;  1VQS A;  2F4F A;  3OR2 A;  4J5O A;  4PXD A;  1RB0 A;  4J9S A;  1Y9O A;  4CO3 A;  3PRV A;  1OY6 A;  2R7U A;  1N32 F;  2XI2 A;  3SQO P;  1IM6 A;  3OFE A;  1F2G A;  1DZ5 A;  1NAQ A;  2QL7 B;  1S1X A;  3OR1 A;  4TVA B;  2FJW A;  2MMY A;  4YME A;  1KEK A;  4ZS6 A;  2ILZ A;  2KT2 A;  4K5R A;  2N3L A;  3CME S;  3MDF A;  4L3N A;  2BVZ A;  4C8Z A;  2KU7 A;  3FEX B;  3R7N B;  2X1A A;  5ETO A;  4GVL A;  1TL5 A;  1P9Y A;  1TEL A;  3QBC A;  2KJV A;  1PBU A;  4DPT A;  2CQG A;  2DT9 A;  4ZVR B;  1YHQ S;  4UY8 T;  4I0W A;  4CLS A;  1RYR A;  1BQM A;  1S49 A;  3VTI A;  2XI3 A;  2P9C A;  1U0H A;  3ET6 A;  1SQE A;  4JI1 F;  4O23 A;  3RBZ A;  3T5K A;  3T1H J;  2WVC A;  5KFL A;  4YB7 A;  5HAT A;  2EK6 A;  2NUH A;  1MSW D;  4AND A;  1JLG A;  3VR1 A;  2EFQ A;  2WVE A;  2L9N A;  5EX0 A;  2VIC A;  4X2B A;  2GFF A;  2OTL S;  1S12 A;  1UFW A;  4L76 A;  3M8R A;  2F9J A;  3BN7 A;  4Q7A A;  3FGV A;  4J37 A;  2V8P A;  4ZVE A;  2LQJ A;  3KLF A;  2DCL A;  2V67 A;  3IR5 B;  3RB4 A;  4MK8 A;  3HSD A;  1MNE A;  5KFM A;  1KRP A;  2VG7 A;  4QCL A;  1CUL A;  4WII A;  2ZBP A;  2VG5 A;  1WC3 A;  2YH1 A;  3L7U A;  3LP1 B;  5J2M A;  4C8O A;  1PG5 B;  2ZEJ A;  1Y3J A;  2VQE F;  3O6Q A;  2WZ1 A;  4F3O A;  4CIO A;  1QAI A;  2BE2 B;  1YGY A;  2E5H A;  3FQK A;  3IXQ A;  2QMX A;  1FA0 A;  1T9Y A;  4IO1 A;  4NZ0 A;  4WP9 A;  3CD0 A;  1HYS B;  4PWU A;  2IM2 A;  2MY7 A;  2CPX A;  5B0B A;  1IR0 A;  4WXO A;  4QWB A;  1FCA A;  3OTD A;  1WOR A;  2BRL A;  4QR2 A;  3BDE A;  4BLG A;  4NI2 A;  3BSO A;  1U1O A;  4QJV A;  2UZA A;  1I1G A;  2QL5 B;  3DHX A;  3PVX A;  3SMZ A;  2ZJP Q;  1S9G A;  2FZG B;  2QL9 B;  2V8H A;  3DLJ A;  5B08 A;  4DUZ J;  4JI1 J;  3K5P A;  1U24 A;  2ZZM A;  2F8H A;  2WHO A;  3PO4 A;  1FVQ A;  3NP5 A;  1T05 B;  1DFD A;  2HQG A;  5E2Q A;  1MRO A;  2L9W A;  1N52 B;  3EZO A;  2B56 A;  2W4C A;  1N33 J;  2VL1 A;  1N5Y A;  5DDR C;  3SDE B;  1QE1 A;  1RT6 B;  2HQD A;  4AUK A;  4B3T J;  1RLD A;  1NUE A;  2OFG X;  4NXM J;  3VZI A;  3L4B C;  4NXN F;  4OZ1 A;  4J9K A;  3CD7 A;  4U67 Q;  4C3L A;  1FJG F;  2PA3 A;  4IFY B;  2HFN A;  5CCL A;  2P6T A;  3F0N A;  4NAS A;  2FHO B;  3ZTS A;  2ZH8 A;  2W9B B;  4IRC A;  2CKW A;  2GJ2 A;  1VBZ A;  3PIO Q;  2VQE J;  3HHD A;  3EE3 A;  4KIA A;  3MF5 A;  2XMA A;  2LQ8 A;  3CC4 S;  2HAF A;  1C0U A;  2F40 A;  2H65 B;  3VAM A;  4DSF A;  1BLU A;  3AT1 B;  4N77 A;  1T9T A;  4DX6 A;  2Y1L B;  4DQQ A;  1JNZ B;  2CFX A;  2WBR A;  4TU8 A;  1P1T A;  4O44 B;  4DV6 J;  3R97 A;  3W5Y A;  3OFG A;  2XMT A;  4UW2 A;  2D9O A;  1CJV A;  4L75 A;  2NLW A;  4FYX B;  3EIC A;  4ETZ A;  4DR1 J;  2NXE A;  2OO4 A;  3POT A;  4LIW A;  3DRR A;  4F0M A;  3OL7 A;  4CM0 A;  2IJR A;  3PEJ A;  3DLK B;  4HT5 A;  1EP4 B;  4DEZ A;  4JBC A;  5D4P A;  3GMG A;  2CG4 A;  3DOK B;  3M2V A;  3KK2 A;  1VC5 A;  1CVJ A;  2YX7 A;  3X1L B;  1F0X A;  2VFV A;  1RAF B;  3MI7 X;  4LQ9 A;  1NH7 A;  5L39 A;  4FXD A;  1AA1 B;  4LIR A;  4DV1 J;  2OGU A;  4YDX A;  5M2P A;  2FHJ A;  3NKY A;  1ACM B;  3IM9 A;  2HVE A;  1LK5 A;  1DTQ B;  4K8R A;  1FE4 A;  1YLX A;  1WAC A;  4PG7 A;  3CUN A;  1ZA1 B;  3G82 B;  2WCX A;  2M88 A;  2I2Y A;  2JEI A;  4KH0 B;  2W8L A;  4Q8F A;  2PFD A;  3U1M A;  3OTB A;  3VQT A;  2Z2M A;  4ED6 A;  2QC3 A;  1RKJ A;  1JWW A;  4EYH B;  1YIJ S;  1HR0 J;  2HVD A;  3BV8 A;  3UW1 A;  2ACY A;  2HAI A;  1HQU B;  3MR6 A;  4A8X A;  3W9J A;  2B3T B;  2ZUG A;  4AXJ A;  2MKK A;  2B5J B;  3LP2 B;  3OUY A;  1KS2 A;  4ZPC A;  1OSC A;  2QMU B;  5DDO C;  2WON A;  2KDO A;  2HNZ B;  1LWX A;  4AL5 A;  1KTV A;  2HKE A;  3WHI A;  3T9Z A;  3UQS A;  5I3U B;  2O1P A;  2QO3 A;  2R7V A;  1V3S A;  1S77 D;  1LWE A;  2BQR A;  2E5J A;  3I82 A;  4GKJ J;  2KN4 A;  1R27 B;  1X0P A;  1RAC B;  3HSJ A;  3KUG A;  2NYI A;  4QBU A;  3GZ7 A;  2DH9 A;  2WB1 D;  2ZNY A;  3PG9 A;  4DU8 A;  2H5E A;  2KXF A;  3TAR A;  2IM1 A;  2AD9 A;  4KPC A;  4KHM A;  4WZM A;  1H74 A;  2V2Q A;  2OLW A;  3JSY A;  2FTR A;  3FEY B;  1QTN B;  4GKJ F;  2FHM A;  4C3K A;  2CQI A;  5A8K A;  2UVV A;  2IIH A;  2IRX A;  4PXB A;  3M9M B;  2Q6B A;  4H4K A;  4O3S A;  3R5D A;  3QT5 A;  4AQY F;  1ZM3 A;  1X4H A;  2CZ4 A;  4NLY A;  1UA0 A;  5DDP C;  2C3U A;  4YQW A;  4LFB F;  1B7F A;  4WYL A;  3LWL A;  1S99 A;  5G0R B;  4LF8 J;  4ECY A;  5L8R C;  3PHT A;  4Y00 A;  1ARO P;  3F56 A;  1RAA B;  2OMO A;  3NS6 A;  1HR0 F;  1Q16 B;  1LK7 A;  4IH7 A;  2Z2L A;  3ZZU A;  3FFI B;  2IVY A;  2F5G A;  3KLI A;  3C14 B;  3C2P A;  1MMD A;  1FF2 A;  2OEK A;  2JX2 A;  3CE8 A;  4R8U B;  3MFI A;  3J80 U;  2Q79 A;  3H5Y A;  1QVF R;  1JLA B;  1RBA A;  1TU0 B;  1M5V C;  1VQL S;  3MOJ B;  1CJK A;  2LQ9 A;  3WIU A;  4IRD A;  4XO0 A;  3UCG A;  3MMA B;  4FYW B;  2MQ8 A;  2QN6 B;  3SZ2 A;  4OIX A;  4X4U A;  5KG1 A;  3JSM A;  4DL4 A;  1FJ7 A;  3BGO P;  1B64 A;  1RWX B;  4Q2M A;  3AJD A;  5E41 A;  3CJK B;  4KH1 B;  1YJ7 A;  4L73 A;  3GIJ A;  3WZ0 A;  2VH7 A;  1B70 B;  2PT0 A;  2CQB A;  3BYP A;  4MIW A;  3HD1 A;  4E8U A;  1AT1 B;  2RH3 A;  3MPU B;  3NLC A;  4F3Q A;  3MCM A;  5G0R A;  2R7S A;  4PAA A;  1Q95 G;  2XLK A;  3VAL A;  2DNY A;  4NLO A;  3BB5 A;  2DNR A;  1UAW A;  2XGP A;  3DMJ B;  5JMN A;  3TQE A;  5K14 B;  1OY8 A;  3SFG A;  3HVT B;  5G4D A;  4LFB J;  3CJR A;  4BHQ A;  1S6Q B;  3BKU A;  4URS A;  5KFE A;  3UR3 C;  3PX4 A;  2D74 B;  2QFI A;  3MR3 A;  1SI9 A;  2EC2 A;  4GO5 X;  3H5X A;  3BO2 A;  5BYS A;  5LOQ A;  4ED1 A;  2J6U A;  4EYI B;  1KR4 A;  2MLY A;  3VVU A;  1VHF A;  1O0P A;  2L08 A;  3ELH A;  2ZHO A;  4OV1 A;  3PY8 A;  3BPS P;  3Q8P B;  2ZH1 A;  1C0T A;  4CO5 A;  1UPM B;  1NK8 A;  3HVR A;  4K4Z A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 2C2O B;  3P4U B;  3R7N B;  1SC1 B;  2XYG B;  1RHJ B;  3RJM B;  1RHU B;  2CDR B;  2H4Y B;  2QLF B;  3GJQ B;  4ZVR B;  3NS7 B;  4ZVS B;  1RWK B;  5IC6 B;  1RHQ B;  3R7S B;  2H54 B;  1I51 B;  4ZVQ B;  3QNW B;  3R6L B;  4LSZ B;  2H5J B;  5K20 B;  1PAU B;  2HBR B;  1RWV B;  2H48 B;  2H5I B;  2XZT B;  3GJT B;  1QDU B;  1RHK B;  2CNN B;  1PYO B;  3D6H B;  4JB8 B;  1QTN B;  1RWP B;  2HBY B;  4ZVP B;  2XYH B;  3R6G B;  4DCO B;  2C2K B;  2XYP B;  4DCJ B;  2C2Z B;  1I3O B;  2FQQ B;  4DCP B;  1RWW B;  3GJS B;  2QL5 B;  2QL9 B;  1RWO B;  3D6F B;  4ZVU B;  2C1E B;  2P2C B;  3KJN B;  1F9E B;  2Y0B B;  3EDQ B;  1NME B;  1SC3 B;  3IBF B;  1RHM B;  1IBC B;  2H4W B;  1ICE B;  1RWX B;  2C2M B;  1RHR B;  2CJX B;  1BMQ B;  2DKO B;  3KJF B;  2CNK B;  3D6M B;  2QLJ B;  1RWN B;  2H65 B;  2XZD B;  3EDR B;  1RWM B;  2HBZ B;  2CNL B;  3IBC B;  4ZVT B;  3P45 B;  2Y1L B;  2CNO B;  3SIP B;  2HBQ B;  1RE1 B;  2QLB B;  2CJY B;  1SC4 B;  1GFW B;  3R7B B;  4ZVO B;  2QL7 B;  5IC4 B;  3GJR B;  3KJQ B;  2H51 B;  3R5J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...