2C1OA

Enaiihis fab fragment in the free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
ELVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IGK-C PROTEIN
total genus 50
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA01
4LSDA 1T3FA 1ZV5A 5AG8A 5FCUH 3QUMH 3UPRB 1I9JL 2COQA 3HNTH 2BCKB 2P8LB 3BSZH 4W6WB 1YEHH 4ZFGL 2Q1EA 4AEIL 1VACB 4PS4H 4YE4L 1MQKH 4N0UA 1R24A 4Y16C 1CTOA 1SEBB 1Z3GL 2V9QA 1JWUA 3O3EA 5EFIA 2GT9A 3FQUA 1MI5E 4K07A 4QRUA 3DBXB 3FT2B 3F6IA 1TXKA 2W60B 5EC2B 3CLEH 1XH3B 4PJCA 3D9AH 1KENL 2Y06H 1YJDL 4K23L 2ZCLL 4OQTA 3T0XA 1ADQL 1CFVL 4AMKH 5J13B 1G7QA 3HC3H 4H1LH 4PY7B 1FRGL 7FABH 1A4JB 3BO8B 4YK4B 2R8SH 4XC3H 1PQZA 4KU1A 5IMLA 3ROOB 1XF3B 4GRLD 5DMGD 3FB5B 5FKPA 2VQUA 5ID1B 4XH2B 3REVB 3DROA 4P2RD 4DGIL 1S5IH 1V8HA 3GDBA 2BY1A 4N0FB 3TZVB 2AV7A 2OI9C 4ELMB 3TFKD 4KTEH 3HE6A 2EDKA 1TQCC 3TBTA 1JZ7A 1AH1A 4NO2B 3VFOA 4GXUN 3TGXA 3OGCB 4HWEL 2NY0C 5FHAL 2X1PA 4RCAA 2SEBB 4PGEB 5D7LE 4Z5RB 1YPZA 4RAHA 1S7TA 1R3IL 2FECL 5ICYB 3TLRA 4NRYA 4G6KL 3ARBA 4KDVA 1IGYA 5IWLC 4U1SA 1LDPH 1XGUA 1YNLL 2HRPL 4JFEE 4NZRH 4KPHL 4NCDA 2BVUA 5FDWA 25C8L 4HCRH 3PP4H 2I27N 2IBZX 3HUJB 4Z8FL 5C0FA 2AQ1A 4MNQB 5IVXF 2R1WB 4JRYD 4C56D 3P0VH 4ZODA 1JTOA 2GAZA 3IVKA 1W0VB 4HWBA 1AGCA 3U82B 3RDTB 4KQ4H 4OLZH 4AM0A 1QLRA 4L9LB 5CILL 3V6ZB 4TSCH 4BM7A 4U1HA 3KPRE 2ENYA 2AJ3B 3ZKQD 3K1KC 5FA3A 4JFED 2DI7A 4XXCC 2MQCA 1HH9A 3WHXA 4OF8A 1ZEAL 1MH5A 3EYVA 1BZ7A 3QIBC 4XNQB 1TVBA 1JGLH 4PJFB 2P49B 3VD5A 3H3PL 3T2NL 1E4JA 5D72H 3MRGB 1FCGA 1PX3A 5CSZB 1AD0B 2VZVA 4XMKH 43C9B 4HZLA 1J18A 2VE6B 1OAYH 1TZGH 4NQVB 1K8IA 4YX2L 4XPTL 4I1NB 3LKNA 4ONFH 1I3VA 2FO4B 1W72L 3B9DA 3HAEA 4PJCE 3DXAA 1BWMA 2UWEB 3L1OH 3BYYA 3WS3A 1MJ8H 3QUMA 5HYSB 4GW1B 5IP4A 2BNRD 2VB5A 3OL2A 3RZCA 5C0EB 2CKBB 4Y4HA 3ZE0E 1QO3B 3AC0A 4WHYH 5I75C 4NQSA 4DEPB 2B5IC 1FZKB 4JFHE 4Y4KC 4G3YL 4KJQD 5IHBA 5MERA 2VITA 1ZGLB 5D6CA 1R5IA 4HGKC 1AC6A 1GHFH 4JFXA 3BD3A 3LKRB 2NY1B 3U0TA 2EDJA 2FH8A 5IB5B 2ARJA 5ID0B 5JDSB 5F1IA 1T1ZA 1YYLL 1XGPA 4KUCD 2ILLA 4UDTB 2CUMA 4WW2C 2B4CC 2X42A 4RGNB 4DUVA 1AE6L 3EBAA 2APVA 4GUPA 3SDAA 2ZSWB 2EH7L 1E4WH 1YN7A 3H6JA 4OFKA 2D0GA 4LSUL 4BELD 1YECL 4FQLL 4X9GA 4GT7A 1BFTA 4K7PX 1FE8H 3ALPA 3O11A 4YQXH 2JCCE 4OSUL 3U9UB 1HSAB 3MOAH 3MLTB 1NAKH 3GKWH 2QHRL 2HLFD 5E6IA 2OCFD 4IMLB 2IADB 1KJ2B 4DOHE 2XN9E 3MLSH 1FDLH 1JNNH 3KS0H 5GS1B 3ZTJH 3V5HB 1D3CA 1CFBA 3VXTB 2D7PA 2B2XH 3E3QC 2XV6B 3LHPL 4OCRL 5CEZH 1MJJB 3BOVA 3O6FA 5A2KH 2DLEA 4X7TA 4XNUL 1FG9C 3RQ3A 1JF5A 5LGJB 4D0CA 5A3ID 1X5XA 4X4ME 5J11B 2QL1A 3RY4A 5DLML 1LEIA 5D1ZA 3CFDB 4QRSA 4N8CL 5KZCB 4Z95L 2JLLA 1KT2A 8FABB 3FO1A 1C5DB 1U8MB 3BHBB 3QULA 3VGHA 1BD2E 5FYLH 2IPTH 4D8PA 4V2BA 1MFEL 1Q0YL 2ZJSH 1L0YA 1CFTA 1KCKA 1JHLH 4JFPB 4I18C 4KQ3H 4NRXB 1MEXH 4JDTH 5IR1B 1U3HB 1ZLWK 2B0SL 2J5LB 4KAQL 4DGVH 4NN5B 2GAZB 3IVKB 1AGCB 2CXGA 4E0RA 1A7NH 3HC4L 5L88H 2NTFB 3ESVF 2X4UA 5GGTH 4MA8L 4KMTH 4H20H 5F1SA 2IANA 2H32H 2A2QT 5DVLA 3FO0H 1OARL 1B88A 3D48R 3CVHA 1L7TL 1YMMD 5F7HA 4M6NH 3UTQB 4NZTL 1EHAA 2Z35A 4LKCB 3MRPB 4JRYA 4C56A 4HFUL 1PG7L 4NNYA 3IRPX 1Q72L 3S36X 3QRGH 3H9HA 4EKXA 3GSOB 4F3FB 4AIOA 4J8RA 5FECA 4X6CE 1TPXC 1RUPH 3IS1X 1JK8A 2Y6SD 3QPXH 1RHHA 4OI7A 1K5NB 5HHPB 5I8KH 4PGBA 2O5ZH 4DKFL 5D6DA 4EI6A 3HKFA 4YHLL 1NSNH 2G60H 4M8QB 4WU7B 1KNOA 1NPUA 4HD9A 3CZJA 1I1AB 3P0YL 1CF8L 3ARFB 5GSRB 4P23C 2Q7YB 4CU7A 1ZANH 5E2VL 1NH6A 1BQHG 1NL0L 3MYZA 4MB3A 4I3RH 2VLRD 2ARJB 4F7MA 4U6YB 5HD8C 4GQPH 1CD9B 1FIGH 3FQNA 3T3PF 3TO4B 5LWYH 4LARH 1CFQA 3A0OA 2HKFL 3L7EA 1HHKB 3OR6B 1MCOH 1WUNT 3KPQB 4I13B 2AEWA 4JFHD 4TNWK 2OL3A 5BRZD 1KIRB 5INDB 3QDAA 4YUEL 4RGNE 3PDDA 5T3XE 4ELKB 4KK5C 5JPMB 3RUGB 1I9IL 3Q5OA 1GAFH 3G6JF 4PLJC 1WAAA 1JMXA 3W2DL 1MWAB 1KPRB 4NQXA 4BFBD 5GHWL 3RPKA 4NN6B 2DWDB 4IIQB 3LN5B 2V17L 3HG1B 4LVNB 4P2OA 5AZ2L 4PD4J 5CGYD 4HH9B 5DO2D 1NCAL 5F8RC 2GITB 3P77B 2ESVD 4NYLB 1FJ1B 4R26L 1INQA 1OAXL 3VFWA 3VFSB 1AXSB 5D1QB 3KJ4C 1WEJH 4M1CD 3IFNH 4LFHD 3ZMRA 4OLXH 3MRNB 3PL6D 5IOPA 2EECA 1TJGH 2X4RB 5M95B 4MJID 4O2CA 4C55A 4MZ2A 3HE6D 4HXBH 4WO4A 5JOFA 3MBEB 5I1LB 4P57B 3NABH 1QHOA 1J0ZA 3PWUB 3KNBB 1QFWH 4J1UB 5D1ZD 4LNRB 4H1LG 5F3BB 1UB6B 4D9LH 4KVCL 2FL5B 5C8JA 3G6JE 1BGXL 1G7JA 4MDJB 2XFXA 4XP6L 1AIFA 1G7MB 4NM8L 3VJ6A 3K3QA 1L9NA 5MEQB 3D0LB 1OP5K 4GSDL 3VCLA 3TYGH 1NGXA 2Y07H 3PWPB 5HGDA 2A9NL 4L8DA 5J8OA 2CUIA 1MF2L 1MCWM 5BMFH 1JHKH 3EDDA 3NCBB 1D9KA 4J23A 2N7AA 1S7XA 1FAIL 2Q86A 3AB0C 4WV1A 3KHQA 1RV6X 3HG1D 4XMPH 4Y2OA 5CJOH 1KACB 3S5LB 5I30H 3TFKC 5DZNA 5JA8B 2HT4C 4WUUE 2FHBA 1HXMB 3M17B 1MI5B 3FO9B 5H37G 3WV0A 3T3PE 1SHMA 5C09D 1DUYA 1HINH 3C9NA 4EOWH 1NDGB 4HLZG 4ALAL 1BZ9B 1RPQA 1CWVA 4F3FA 4FFYH 4GO6B 4J8RB 3IJSA 5FYKL 3C2AL 4M1CC 5JA9A 3D9AL 5E6IC 1CLCA 2PF6A 4FA8A 5D6CB 5D1XC 4Z7OF 1CK0L 4PGBB 1JWMB 1XGYL 1IQDB 3MROB 1JUFA 1WAAE 3B9KC 1XR8A 5HY9B 4APQD 2RBLA 5E8PB 3WIIL 2E7LA 5KSAC 3QIUA 1KXQE 1LK2A 2WNGA 1F4XH 3AREB 4BZ2L 1D6EB 4YR6A 4RMTA 3RVVC 4P9ML 4KI5E 1FFNA 5F71A 5E8DL 4LGSB 4NQED 5FGBA 3DGCR 4FNLH 5D4QA 4OLYH 4O5LL 4UTBH 2WINB 1NCBL 2W65A 1X6NA 4RBPK 1UWGL 4PRID 2VDOH 3HE7A 2ZCHL 2LVEA 4S0SD 1S7SB 4PRIB 2Y7QA 4NZRL 3UJIL 5TE4H 4ELKA 4OV6F 4S1DC 4TUJA 3MGOA 1DBAL 4OT1L 4PJBE 1EK3A 2GFBB 4NZDA 4NQEB 5MP6L 3VFVA 2DS4A 4YDKL 1CBVL 4JY4B 2QBWA 2X89A 5IB3B 3MJ6A 4WO4D 2LQRA 3WO4B 3ZHLA 2HTKD 4O2FB 1DQML 4L5FL 4M7LH 5T1MB 3KYMA 5C09E 2F9BT 3IFPB 3IAQA 1KEML 2NXZB 2YS4A 5CGTA 5IROC 1S5IL 3C8HA 1U8NA 1GZPA 4ESKA 1YN6B 4AEHL 3BP7A 5TQ0L 3HG1E 5IF0A 4MXWH 4HMCA 5J06A 1SJXA 3GB7B 2YUZA 3TJEH 3ARDB 1BF2A 5GGUB 2XNAA 2YK1L 2HFFA 2MTPA 1WC7A 2A6IB 1JTPA 1EGJL 4OD1L 3NFSH 1FLTX 4JHAH 2W0LA 3OAYK 1OTTD 3OJMB 5KVGH 4RMSA 2ADFL 2PO6D 3JBG7 1J1XL 4EDXB 2OTPA 3AMLA 4RA3A 4L4TB 2XRAH 1VHPA 3N9GH 4HUUB 1J8HB 2J8UA 4XBGB 4J3UA 2RAMA 3DV4A 2P47B 3GNMH 3UTZA 2CR6A 5KVEH 2Z8RA 4UV7L 3O3EB 3VJ6B 4DGYL 5JW4Q 5SWZA 1RK1B 3IXAA 1MFBL 4MVBC 3DV6A 4WVRA 5CJXA 1EFXA 2KQNA 4DKAA 1QRNE 2ZUUA 1MFCH 2ERJB 2P8PA 5KSUB 4EI5B 1Q9OB 5DEZA 4P9HH 5LGHL 1LEGB 1S7WB 3M8OH 2J7LA 3LMJL 3O41B 5K93A 5TDOB 4OM1L 1SJEB 5EBMB 1DE4A 1F5WA 2R9HC 2AK4D 4UINH 4PUBH 5DQ9B 5F97E 1PLGH 5HHMD 1G6RL 1JPST 1IKFH 4L1HA 1R0AL 1EEZA 1OAYL 1MRCL 3PWVB 1PKQB 5FYLE 3U46A 1KIQB 3OAYH 3EIFA 1IM3B 3HE6B 5BRZB 2YA0A 3GSNA 3F7VB 3DVNB 3W0WD 3O4LD 4NO2A 3VFOB 4UDUA 1MJ8L 3R06A 2X4PB 1JFQL 3ARFA 5GSRA 3CU7A 2Q6WB 1EVTC 3QUZD 3EFFB 1FNEA 1IGYB 1HIML 1IGMH 4JEGB 2VXSH 2A38A 5FGSA 1BF8A 5JOPE 2QQLH 4OTXL 3AM8C 3MRKB 1CFQB 4Q6YA 1IGFL 3EGSA 2G2RB 2ICWB 4APQA 4XCFL 4P9HC 3QAZB 4NCC2 3RDTA 2FECI 1RZJC 4L9LA 1HZHL 1LO4H 2BVOA 2A1WL 3VD7A 3WSQH 2PW1B 3OAZK 4YXLL 1A6UH 1N59A 3IDXH 1IZJA 2BNRB 4XGZA 1IFHL 1BLNA 4AIXA 5IHZB 2YRZA 2E7HA 5I76B 1CTNA 2FATL 5CLWA 3K1DA 3LEXB 5D2LF 4N1HB 3VMOA 4ODHH 1FL3A 3NGBC 3MGOB 3GK8L 3VGDA 1BIIA 4R7NA 5HJ3A 1IM9B 3EOAA 4Z0BH 4POZC 2B0SH 1AD0A 4JY4A 3MLUL 2GITA 1R3HB 2B1HL 4MZ3A 3TH4T 4XAKD 5ICZA 5A1AA 5CZKA 1F2QA 3O4OC 2DQUH 4BK5A 4AENB 1AXSA 5D1QA 3B8SA 4LLQB 3GRWA 4RNRB 2J6EA 1TPXB 3PXHA 5E2WL 1IILE 1QRNA 4GJTB 2YC1B 3E3QE 2QQNL 4XBEL 5B22A 3B5TA 5DEFA 4X4MA 1D5BA 3I9GL 1OP3H 3V4VH 5IT2L 2A83B 3TIEB 3F7YB 3NZ8B 1UA6L 4OD2A 1R5IB 4WNQB 5F7UA 1PG7H 2HVJB 2GUOB 1AGDB 4Z95H 1MCKA 4BFEA 1J1OL 1ZWIA 4YE4H 3TNMA 1Q9LB 1YUHB 3QFDB 1E27B 2I5YH 4EN3D 4HS6B 5DXWA 5DJYB 4XVSL 4LLYB 3ULUD 3V95A 4XAWH 3BP6B 3EYSL 1TNNA 2IBZY 3LSOB 1TVHA 4AJ0A 2FO1A 4MAYC 2YPLD 3C08H 3QIBB 4GAGL 4GRWE 1N3NA 1MIEH 2JE8A 4LQ1A 1IAOA 2K3TA 3SE8H 2VISA 3JWOL 1WBZA 5J6HB 5I2IB 2CLRA 4PJEE 2AK1H 2R8SL 4AT6B 4PYGA 2J2ZA 1UQSA 1RFDL 4XVJH 1NL0H 4JM4H 4TTDC 5F1KC 1ACZA 4N0RA 4NO0D 1DUYB 4MD4A 4OZGF 4L29B 5TDOA 4UT9H 5B8CA 3DRQA 1CL7I 4GXVL 5F9AC 1JCKA 1MRDL 2B5IB 4BJLA 3RBSA 4NN6C 5KG9A 3C8KB 4TUKH 1GZQB 5KAQG 3MCKB 5DJ0A 1DVFA 5JQ6L 4QOKE 4R3SB 4BSWA 3OGCA 3TBYB 2BFVH 3RUGE 1OAQH 4R8WH 5JMOC 4BSVA 4G8GB 4TVPE 4FQCH 3I3EA 3JTTB 3KLDA 4TTGA 1EUUA 3CSBA 3BGFB 5FYJU 2EO1A 2WWKO 5DFTA 3EOTL 2J8UF 4EN3B 3NIFE 3W2DH 5BRZE 5JDJA 4NUGL 2IH1A 2UYLB 3MLVH 4KRNA 3K2UL 2XWBB 3V8CA 2BMKA 4G6AD 2OZ4L 5DD0H 2J6EL 4ZQKB 5E56A 5CEYB 2APTA 2VAAA 4NJ9L 4JB9L 1A6ZA 3BAEH 1U58A 2K7QA 5I74C 2VNCA 1TJGL 4P2QE 5ALBH 4XXCA 4L3EB 5EU6E 3CXHJ 4MMZC 2FIRT 3H3PH 4BSJA 4YLQT 4LCWB 4PJFA 3LS4L 2VLJE 3GSRB 2BVQB 5DRNA 1BJ1J 2BOCA 2I07A 5JR1H 3AB0B 5CEZD 2HMID 2HAZA 3PGFL 1WISA 3UTQA 4LCYB 1VFOA 3WXWL 2ZWLT 5DYOA 3NCJH 3GMMB 3MRIA 3OJDB 2HYMA 1QLFA 1F3JA 1MCIA 4OZHA 4JRXB 4MNHA 3ZKND 3MNWB 4AENA 2IMMA 4NQSB 3PWJA 4S10A 3MUGA 5C0AD 1WTLA 2MKLC 4RISL 2E6PA 3SDXF 5E08L 5AZEH 3RWGB 1XF5A 4ZO8A 5GGUA 4LVHB 2AJUL 3CH1B 1TCRA 4PRPD 1Q94B 4TPRL 2CLZB 2VDNH 4S0TD 5J89A 3LKPA 5I30L 1NGWB 5C7XL 1MAKA 3L95B 3RVWD 3WHE1 4JPVH 1BWWA 3CPLB 5D1QD 5D6DC 2QR0B 4PGDA 5IB5A 5ID0A 1J5OL 2UUDH 5C0DA 1GGCH 1AO7B 3BX7C 1KB5L 4WHTA 5DTFA 5ICXB 4YJZL 4U1NB 1I4FA 5B39A 3RGVA 4F7EA 4Y8AA 1KTDB 1JPSH 4QOKA 4U1IA 4IOFC 5E99H 4F7MB 4U6YA 1CL7H 4OFYD 4N5UA 3J7HA 2AEQL 4P46B 5EBWA 3BZFA 4HS6A 5DJ8A 1CIDA 5DA0B 3OXRA 2WK2A 3GBNH 4HK3N 3N06B 3VXMB 4R4FL 3ZKMD 2AGJH 4OFPA 3PXJA 5D71L 3W82A 4JANA 3G6JA 4PRDA 3SGJA 5BW7A 1I3RA 4LU5L 1EH9A 4AL8H 5I2IA 2I25N 2HMIC 3AY4A 5I0ZA 3MNVA 3QIWD 4TNWF 5ISZA 3TCLA 4RAUA 3KPNA 1DLHB 2CPCA 4JREC 4CADA 1A4JA 3BO8A 3FQRA 4DTGL 1N5YL 4NGHL 5KW9L 3DRQB 1E28B 1JPFA 3HZKB 4JO2L 4YC2B 2JTDA 3G5VA 1ZS8A 3UP1A 5BQ7B 1LP9B 4KTDH 1Q9KB 3Q3GA 1JNHB 4HFWA 2VDOL 5ID1A 1I9RH 3MLWL 3CXHK 4KXZI 3WO3B 3GMOB 5CIPB 4ZOBA 3FO1B 5AWNL 5DGQA 4YZFF 2PTTA 3X3GL 2YRPA 2H8PB 2X4TB 3AS0A 3MA7B 1RURH 3QDJB 4ACPA 3OZ9L 4JPKL 1BQHB 4YHNA 4Y5XB 1MAJA 1I85C 5JPNB 3D2UA 3GMNB 4QXTB 3U2SB 3JZ7A 4NRYB 5IR1A 5L6YL 1U3HA 3WMSA 1T7YA 1DBKH 1T04A 1H5BA 1XGUB 3RWJA 1DR9A 1MFDH 3NIDE 2IG2L 5EG6C 2YSSA 5F1OB 2VDRL 2W0KA 1WT5C 1KCUL 2F53B 1D7FA 4PJ7A 5F7LB 5BS0A 1T7ZA 3QH3A 1OT2A 2F19L 3GHBH 3V8OA 3ULVC 2D7OA 4NZTH 2Z93A 1A2YB 2Z35B 1UH3A 1P7QB 3CK0L 4WWKA 3JV6B 2XPGB 3EOAB 2YEZB 3AAZA 2V2WA 3N85H 4G9FA 5BZWB 4LPWA 2R0LL 2CMRL 4L3EE 4MAYA 1R3HA 3MOQA 5E8EB 3EO1A 3U1SH 4X6BB 3QPXL 1QYGH 1JN6A 4ODTL 43C9A 1ZT1B 4MNHB 4P5MA 4G42B 4GKZB 1A9EA 5TF1H 1DSFH 3BKJH 4RFNB 1S3KH 4YGVA 5JOEA 3HLAA 3VGGA 1J0IA 3DPBA 1CF8H 1IC7L 3FO2B 2WMPA 3QG6A 1JWMA 1FO0A 2DYPD 3L3GB 3UEZA 2R0WH 3MROA 3OTTA 2H9GA 4H0GA 3LKPB 1E6OH 1Q0XL 1E4XI 1TENA 3R4DA 5TQ0H 3GGWB 1P1ZA 5DRXB 1GCFA 2NR6D 5KSBF 1MCRA 3UYRL 4PRHA 1D6EA 2UVEA 1KEGL 3C6LB 1I3GL 3QEGL 3ULVH 4XP1H 4OFDA 1XFPA 4UUJB 3L7EB 4P46A 3BZFB 4Z7NF 3VW3H 2DKSA 1JWUB 5EFIB 3FQUB 4QRUB 1CDUA 1R5WB 4RFEA 1H3UA 4G7YL 1XZ0A 4WW1B 4P5KB 5DC0A 4KI5C 1EHLL 2XTJC 4FN0A 3S4SA 5HSFA 4F37K 5IMKB 2GSIB 5D7LD 5SWZE 5CBEB 1WJ3A 4QHLB 4YPGB 2BRQA 4ZFOL 4DW2L 1MFCL 3A6OA 3NGBB 4BH8A 1KPUB 2H26B 5LGHH 1MUJA 1CQYA 4PJ7E 3MO1A 2Z91A 3BDBA 1OAXH 1I7RA 3VWKA 4PJGB 3JTTA 5EPMA 1NKRA 5I1HL 1CICA 4PJHB 3T1FB 1VFAA 3UX9B 1CFSB 3O2DA 3Q6FB 1DBMH 3EHBD 5CEZE 2I9TB 1JE6A 1AP2B 3MTRA 3GFUA 4HLJA 4R9HA 5TH2B 3QI9B 5F6HI 1CT8B 4C4KT 3S88H 2VXTH 1FORL 4HS3A 4HKJB 5GGRY 1C5DA 5LXGH 1U8MA 2ICES 3WJJA 2OK0L 4ZS6C 4ZXBC 1HSBA 1JV5B 2YBRB 1C5BH 4J3WA 5C0FB 4MNQA 1CD8A 2OM5A 4EUPG 3QA3A 4XP6H 2AXHA 1W0WB 4YFLI 5MEND 4KHXL 1HDMB 2EXYD 5DMKB 5E24E 1JGDA 1FZOA 3TT3L 1AE6H 2EE9A 4PJXA 3KHOA 3PHQA 4GH7B 5MEQA 3WFHB 3ZYZA 2QQNH 1A9BB 2HH0L 1RUAL 1OF2A 2AJYL 5LJYH 1Q38A 4XCCL 4OZIF 4H5SA 2BSRB 4OV5A 2C7UB 1UACH 1NAML 3NBNA 4HZAA 3DIFB 2E27H 2X1WL 2YPKA 5CJOL 1AKJB 4JPWH 2FDBP 4NSKB 4XP5H 1OAUL 1IAIH 4NQDB 3NACH 1VEOA 3BT2H 3C5SB 5GGSB 5A16A 2V7HB 5IBLD 4PIRF 3V52H 1XGTB 4JFZH 1R3LA 3C9NB 5FYKE 4POYA 2VDQL 1F3JB 1DEEB 3SKMB 4M6OL 4P23D 4UBDC 5FCSH 4NO3B 2ERJC 5DD6A 5JW3H 3LRHA 3IYLW 1FC2D 3L5JA 1T21A 2NW2B 2ZUQC 5SX4I 1UFUA 3UTSB 5ENWB 3ZTNL 1DLFH 1Y6MR 1SYVA 3H9HB 3R8BB 3DYOA 1AR1C 4UNVA 3U4EA 2DDQH 2BP3A 4ZUVB 5CGMA 4NWTL 1XR8B 3F8UB 1PBYA 4PGDB 2FX9H 4DKEH 1J1PH 2Q8BH 4JFXB 4MQSB 4QHKI 3WUWA 3RL2A 3LB6D 3QUXB 4CVXA 1BECA 3P73B 1I1AA 4KY1L 4R90L 1AHWA 1LO5B 4D0DA 1HKFA 1RZJL 4PJ8D 1VDGA 3LN4B 3WL9B 5M94B 3ZE0F 1AY1H 1J9CT 4M6MH 4AQ1B 2DRUA 3ULUE 5C0ND 3FQNB 1JYNA 4ZTPL 4LSRH 1U8JB 3MFFB 2UZYB 4WHYG 4F7TB 2PXYC 1SEQL 6FABL 2KZ1B 5TE4L 1JPGA 2NNAB 1XZ0B 4BQ9A 5C08A 3HFMH 2Y5TB 2GFBA 3QCTL 5F6HJ 1YY8B 4GRWF 5I76A 4OIAA 3WE6A 4DKDC 4R4BB 2ZUXA 3HZYA 3HE6C 3VXTA 2D2OA 4L5FH 4P2QB 5C09A 4UIKH 1NCDH 2CO7B 1A7BA 3STLB 1WTGT 5C71A 3SGDI 4QTIH 1HXYB 4PJIE 4A6YH 5JTWA 5ITBL 1J8KA 1ZHBB 3CCHA 3RWHA 1HOCB 1DBBL 4HKZB 1WBXA 4HWNA 3MRCA 4HPOL 1DQLL 1VFAB 3RAJH 1Z9MA 2DKMA 4ZG1A 1C1EL 1IGIL 2DQTL 3B2VH 2GTZB 1NGPH 4NQTA 3PGFH 1N6QH 5IQ9B 3O4OB 5E2TL 1KXTB 4FQCL 5T33L 3DURA 1Q9WA 2WLYA 3HS0B 2P5WD 3QUYB 1IL1A 1RZ7H 1VFUA 4WO4B 3EOTH 1KN2H 4E5XA 3V0VA 1HHJA 5J1TC 3QJFA 3ZKMC 3O2VH 2H41A 5DEGB 1W0WA 1YYMH 1P9MA 2Z8WC 2DI8A 3ULSB 2OR9L 3LN9A 4Y88A 3KS0J 5D8JH 4GW4B 5I71B 1PY4A 32C2A 2GEEA 3BEVA 1X4YA 2BSRA 4LCIL 5IW6A 3QJHA 4PP1D 1P4LA 3CX2A 1LEGA 1S7WA 3VXUA 4PYHA 1U8HB 4HSQA 4AT6A 1OAKL 1Y6KR 1OHQA 3UZEA 5JMRA 1MIML 1F90H 4AQOA 2HG5A 4H0HB 1Y0LA 3T2OA 4XRCB 5DHVH 3R0NA 4JRYB 4C56B 1N0LA 4K9EH 3P30H 4X7CC 4M62L 1YDPA 2CR3A 3BW9A 1N7MH 4OLWL 4LSSH 4O02H 5ADPL 1MREL 2XYCA 3LKOB 5HHOE 2Q76B 4GKSA 3NA9H 3OX8B 3F7VA 5L2KA 2AK4E 4U2ZA 1FPTH 2DM4A 4PJ9D 4NHCH 1FFRA 3A6CH 1J12A 5C9JB 4OKVB 3VFRB 4P4KA 1H3WM 1S7UB 4LSTL 2VQTA 1L4IA 1LEKB 3VFGL 5E4EB 3S4SG 1KN4L 5TDPA 1DQQA 5DJ2B 3GRWH 1QACA 2VDMH 2Y25A 1DFBL 1YMME 4Q74A 4JQXA 1QVOB 5E6YA 4DZBA 2Q7NA 1LMKA 1CGUA 3IFLH 4IM8A 5D2NC 3WKMH 2MCPL 5C70A 5J12C 1YEEH 1OSZA 1RZ8A 4QWWC 2QADC 2EDBA 4Q6IA 2RCSH 3CFCH 1JPSL 1SYSB 4X0KA 3L3HB 1IFHH 1CL7L 4HS8L 4KJWC 4PP1C 1ZVHA 3W5MA 12E8H 2DQCH 3H0TB 3ME0A 1GGBL 2OL3B 1V3JA 4K94H 2HLAB 1OTSD 3S5LG 4PJDF 1BIIB 4R7NB 1NMAH 3QFJB 2NY4B 1TJHH 4NJAL 5D96B 3FN0H 2GKIA 5L2JB 5HDBE 3VFVB 3ARBC 3STBA 4HUVA 4PB9L 3AXLA 2FH6A 1HQRA 3HPLB 1A1OB 4MNGE 4F9LA 3P77A 2NTSP 5J1SC 1B2WL 1MWAL 1TTUA 2JJTC 3VXQB 5BVJB 1C8PA 5IMMB 4OCYL 1KPVB 3IDMB 5D7IA 2CH8A 5T1MA 3MRNA 2XWJB 1R5VB 3MV9D 5KSVB 2DTML 5F9JA 3T3MF 2FEDD 5E2UH 2NW3A 2E7CA 4G8EB 1DQJA 3GJFB 2IAND 3QB7C 1UB5B 2WBJA 3JV5A 5IGXH 4TOYL 2JF1A 1UXSB 4LCCC 2XN9D 1TZIB 2V2XB 2YD7A 3B9AA 4ODUA 2QSTA 3KPRA 1WFTA 1ZK9A 5JXAH 4IRJA 2W0FA 5ICXA 1FP5A 2CDEA 2W07A 3WIFA 1K85A 2HFFB 2QADD 5D5ME 1HHJB 1S5HB 3C6LC 1VACA 3LIZL 4J6RL 3G08B 3QNYA 4HWUA 3BGMB 3AU1A 4M7JL 3FT3A 5HHXL 4KJWD 3KPMB 4ODWA 4GQ9H 4EDXA 3BE1L 1PAMA 3QDMA 3BPNC 4KI5D 5DD1H 3U4BL 3ARWA 4HCRA 3FT2A 4G6FB 5DHYB 5A2FA 4L4VB 4DVBB 4J7RA 2DN7A 4FFZL 1F4YH 1RUKH 1E6OL 4P46C 1NMCB 1A6PA 2QQKL 3HMXA 3RTQD 2FSEB 3GMLA 1S7XB 4L8BB 2PN5A 5A2LH 3EDEA 3WHE0 3RZCC 4JGMA 5GZNC 2BDNL 4EUPB 3QXDB 5MP6H 5LCVL 3P3YA 1MCDA 4ZFGH 1VADA 2OTWB 4IMLA 2JIXB 3SQOH 5IUSA 3LV3B 2F74A 3REWA 2CJUL 5CBAA 2EIZB 2AV7B 1E28A 1OAQL 2Z92B 3FTGA 4M7LL 4XNMB 5ESAA 5FO9A 1JI1A 3D1MC 5C0BE 4KJYA 3VDAA 2GJJA 1UENA 1QBLH 5TGBB 2NPLX 1ONQA 4NN7C 4OZHF 4RWYH 2EYRB 1IE5A 4MXWL 4YDVA 5JUEL 3FMGH 4FG6C 2GQHA 3P9WB 3G5XB 5EZJB 2FHCA 4OAWA 5K9JL 4FQXB 3IDUA 1FVDB 2HVKB 3BMVA 1INDL 4K3JH 2R1XA 3U2SA 4NFCA 4DZBB 4IMKA 3CVIH 5ABDE 1A6TA 1JNLH 5MI0C 1G7PA 2PYED 2Q8AH 2R39A 1RIUH 2ZG1A 1CDGA 4JDVB 3DETC 5DSCA 1KELL 4WRLA 1TVDA 1AQDB 4WJ5A 5J0BA 2O5XH 3UC0L 3I6KB 2YKLL 4L8SA 1NAKL 1IBGL 2A73A 5GRJH 3CSPA 1G7IA 4W68A 1CGYA 3N50A 2PO6B 5BV7C 3EKCA 2VLKE 4LLVB 4C4KO 4Z8FH 2CQVA 3GMMA 3ZDXE 3M1BA 1ZVSA 4X4XB 4YDLB 3L3JA 1MFAL 3FQXA 4PJDE 1K4CB 2JB5H 3B2UC 3D39A 5IM7A 3D0VB 2JCCF 5DJ6B 2OS7A 3HA0A 3UAJD 5ALCH 2A74A 4PLOB 1MHCB 2VZUA 5BJTA 2E7MA 4MDIA 3WLBB 1ZHNA 4NQDE 1ODAA 4UT7L 1FL6B 3EZJB 3CH1A 3PUCA 3DLQR 2I60H 2RFXB 3MRJA 2NXZD 2R2HA 3UMTA 2ESVB 2EZ0D 2JK5A 5IF0B 3MRMA 3MREA 4FG6D 5HHVH 1JP5A 4TSAL 3DURB 4LSQH 4C83A 4M5ZL 2DD8H 4E42B 5I15L 2YXMA 4JFZL 5I8OH 5E99L 2PNDA 4ISVB 1F3DJ 4OF3A 5F9OL 1IRAY 1WZ1H 1ACYL 3GGWA 1KOAA 5GGVH 3HZMB 3CDFA 3GBNL 5CZVH 3OXRB 4L4TA 2Y6SC 5FF6A 4HIHA 1EMTH 3FRPA 4Q0XH 1TETH 3FAXA 5FM5O 2AV1A 4LEOA 3DV4B 4KMTL 4NBYB 4HGMA 4I0PA 3TV3H 2H1PL 5JLZB 5E9DE 5I9QC 4PJCF 1UCBH 3WDIA 2F5AH 1J1PL 3ZLQC 4L8CA 3SGJC 4XPFL 1NUFA 1HHKA 4QRRB 5EU4A 3QCVH 2D03H 4CDGC 3VRLE 4M61B 1LO2L 1JGUH 4JFDE 3RJQB 3TO2B 4XVUD 3LKSA 2CLRB 5FOBA 1QG3A 3H7BB 4LMQE 3BW9B 4DVRH 5KVFH 4L4VE 2MQ3A 1PX4A 4NO5B 1NGZA 5K59F 4CBPA 1IAIL 3V6FA 4JG1L 3K4DA 4JY5L 4ZO6A 1IVLA 2AERT 5SWQA 3SCMC 1ZVYA 5CIPA 4YNYB 4G6AC 5LVEA 4ZDHA 2EZ0C 5HDOA 1J86A 1DVFC 3INUL 4OGYL 2BHUA 4PJFF 2ZCLH 2M8XA 2K7PA 5I17A 4BSWB 4DN3L 3Q6FA 1FNLA 4RMRA 4X4YA 2BXZA 5L2KD 1NCWL 3L6FA 1CFNA 4NZUL 1X44A 3CFBB 1H8NA 2FLRT 4Y4FA 4I3RL 2CRMA 3LHPH 4OCXH 4HUKB 3V0WH 4HEME 1G6RA 4WEBL 4D2NA 5DO2C 5GJSL 1OWWA 4K7PL 4ZFZA 5TPWL 3S35X 4HUXA 1WT5A 4ZXBA 4MHHG 1XGQA 5D9SB 3T4AB 2DQIL 5IVXB 1H3PH 3EYOA 4TNVK 4PJBB 1BM3H 3MV9B 4OZIA 2X4UB 3PL6C 3NH7H 4QHUA 4U6HB 4NFBA 4V1DB 3HI1B 1R3IH 3CC5A 1YEIH 3SE9H 5IW3A 1UWEH 1F58L 3QEUA 3R1GH 4XWGL 2VLLB 3CMOL 4GFTB 3MNZB 2H45A 1HKLL 1CVRA 4GLRH 4IRJD 4KQ3L 4X6DB 2H3NB 2V7HA 4G43B 1A6VH 1P84K 2BVQA 5DRNB 4Y2DA 5T3XH 1HQRB 1YC7A 3KXFA 4UQ2B 2L7UA 4GKZA 5GGTL 3FO9A 5EUOF 5E94A 4EJ1C 4G8GD 3RZWA 3QI9C 5H2BB 1OB1A 3CXDL 5ENWA 3BN9C 3B9EA 4YBQC 1RZIB 1BVKB 4M8VA 2BFVL 3P0GB 3FFDB 1INEH 1NDGA 2R0WL 1UB5A 4XAKE 1YQVL 4LOUC 4L4VD 1CZ8L 3BJLA 5A40E 1AJ7H 2A83A 3TIEA 4EQ2A 3K8KA 1FNSL 4EDWH 4Y8DC 5AYUL 3VA2C 3QEGH 1CLZH 2PCPB 4U1JB 1OWRM 1DCLA 2BHZA 5L8LB 1S5HA 3GKZA 4MJ5A 3LDBC 4DK3A 4P2RB 3K2UH 1FH5L 5C0DB 1PYWA 1T3FB 1KJMB 2V2TA 3NA9L 1RK0B 4NUJA 5HDLA 5B39B 1KN2L 4HIHB 1I7ZA 1VEMA 5B4MD 1OTSC 5HTSA 5TFSH 3VG0H 4LLUA 4JVPA 1CDJA 2FSEA 3PHOA 3WNPA 5IG7A 5INDA 4QHKJ 2W65B 5EIIB 3NPSB 3VFTA 4U31A 1HILA 2VH5H 4ODXA 1J0KA 1QFWM 5TDNA 1FZMA 5EZLB 4P3DA 5DFVC 1PKQE 2O61B 1KPUA 3N1PC 1PD6A 3MV8E 4GAJH 2A0LD 1EO5A 2MCPH 3QUZA 2NY4C 3A6BL 5J6GA 3P9LA 5DMJB 1FG2A 4NBXB 4RAUB 2BVYA 3ES6B 4KJYB 4MQ7B 2KH2B 3C2AH 1FJ1A 2FEDC 1F4HA 3TBYA 5FYJD 4MJIB 5DR5L 3PQYA 4LSSL 2EYRA 2XG5A 4LVOB 5DUMH 3HE7D 5T1DH 5FB8A 3RDTD 1V7MH 1OGAE 4HV8B 2EH8H 3SDCA 4DCQB 1XR9B 4NKOA 4S1RL 3AM8A 4JKPH 5DD3H 5F9DC 3PNWB 4XI5D 4A6YB 4XNYH 1J7VR 4Y1AB 1HHIB 4D0BB 1U8OA 4LCCB 1A6TB 1Q9WB 2WM0A 5IBUG 1MCNA 1BAFH 4R7DA 4LFHG 3NTCH 4Y5XA 3RVUD 2FD6H 4PB9H 4PBWD 5IFJB 1VENA 1UGNA 4ZUTB 1R3KA 1WC7B 2A6IA 3LVEA 5E8DH 2NZ9C 4RSVA 4U3CA 1IC5L 5BO1H 3LPWA 4AEEA 5INCA 1U58B 3I6KA 1HNGA 2ZSVB 1T0PB 3Q6GL 4N8CH 1PSKL 3MUZ1 1HNFA 5KS9A 1CXEA 2FYYA 2NLJB 4MNQE 4HXBL 4XHJC 4Y19B 5GZND 3CIQA 5DJCA 1L0XA 3QG7H 5C2UB 1EJ6A 1JRHL 1F6AB 2VDQH 1X5IA 1MAMH 3U83A 3QNZB 4U1LA 3BMWA 4O4YL 4CMMA 1WWAX 4WI6A 2A74B 3MRIB 3HR5A 1KFAH 4NQVA 3QWRA 2R29H 1BJMA 3OKYA 1HI6B 1DEDA 4MA8H 3J8F7 5D7JB 1E4XH 2YOCA 3V6OE 2C3GA 2RFXA 2XA3A 4KKCC 4E41A 3EYFB 1QNZL 3VFNA 4ENEC 3EJJX 2HFEA 2QQKH 1RJZA 5T1KA 3OJ2C 1PKQA 4OKVA 4WFGE 2BK8A 4G6FD 3LQAL 1AFVH 5LAXA 1L6ZA 4P4KB 2EC9U 4XMPL 4WTWA 2EYSA 1KB9K 9CGTA 2NY5H 3L5HA 5KSBE 3S3SA 3QG6B 1AXIB 1NUGA 1FRGH 3FQTA 4X6FB 1I1AC 4WHDA 2NZ9D 5C0BB 3FOMB 1DZBA 2VWEC 4ZSOA 4KXZH 4PJEB 5L7XH 1JPTH 3SKNA 3RBGA 5T3ZD 2H32B 4ODSL 5DQJA 3HMWL 4ZUUA 3DTXA 3VD9A 3DBXA 5I8KL 3TA3C 1NFDE 1I7ZB 1XCTB 5EORH 3ARQA 5T3ZL 4U49A 5JUEH 4NQEE 3F5WA 1URLA 2BZDA 3AS1A 2FNBA 4MNGA 4LASH 3NCEB 3O9WA 4P9HL 3Q5YA 3WDHA 3DUUB 1YEDB 3IDYB 4UB0H 3FB5A 1CDHA 2IADA 3MNVB 5C07E 1T22A 4G8GE 2V9RA 3VFMB 4UINL 3TZVA 4MB5A 4QHLA 4JFOB 3MV7D 1ZT4B 4FMFA 5E4EC 1HOCA 1QR4A 1FO0H 2NY5C 4WUKL 2P24B 3EFDH 5I1JH 3V5KA 5GRJL 4N68A 1I8LA 1RIHL 2O26U 5T1LB 4X4YB 4XXDB 3SEPA 1KPVA 3CFBA 1NLBL 4ORGA 2KPNA 3ARBB 1A02N 1IAMA 3T0EE 1UEYA 1NBZA 3ARED 2APXA 4PD4K 4XNZC 1GIGL 1OP5H 5IFHL 2X70B 5CWSB 2JB5L 4CMHB 1BFVL 5EO9A 4Z7VE 3VWJA 1OGAB 3QJFB 4OTXH 4XP9H 1G0XA 4IRJB 4U1GB 1KJVB 1LD9B 1I1FA 2DJ4A 5C0CE 5F8QC 1GSMA 1NUNB 2BNUB 5IBLC 4PLKD 3WNNA 5BVPL 3VI3F 3U6RB 1P69B 2F5BH 5CINH 3HTLX 1F4WH 2A1WH 3P9MA 5DI8A 2AI0L 1SY6A 4UBDD 3O0RH 3C5JB 3P4LA 1FAKT 2VUYA 1PZ5A 1MCHA 2X1QA 1U8PA 1KELH 3U48A 1CYGA 4PJ9B 3MACL 3MXVL 4KI1A 2FHFA 2R56H 4ZPTB 3S6CA 3IGAA 4FQ2L 3BKMH 4X98A 3KYKH 2C1PB 2AW2A 4U1LB 2DYPB 3VXRE 4CMMB 1ETZB 3SBWA 3U9PL 3VXUE 2AKRB 1OVZA 5CBAB 1BVKA 2ZOLA 3MLXH 1OTUD 1N64L 4PB0H 1TIUA 5KSBA 5I8EB 4YHZL 1MFBH 1E4WL 1SBSL 3S37X 3CGTA 5BMFL 3WLWC 1OOAA 4TTDD 4Z7WA 5JZ7D 1FAIH 3MGTA 4G7VH 3U4EB 4M03A 5D1XB 3DVGA 4YDIL 4G8GA 1SQ2N 2UUDK 3MOAL 5HYSG 4OM1H 5DHVA 3SE3A 3B9KB 4GRWH 2FJHA 1KNOB 4OLEA 1J1OH 1F4AA 1YEEL 4TSAH 4YEEA 3CJJA 4XP4L 5EDXA 2N7BA 5I15H 4Y1AD 3QUYD 1FNAA 3EGSB 2VSDA 4WW2F 5FV2A 2IH1B 3OB0H 4KRLB 3VH8A 3WN5A 1SYSA 5HHNA 2OP4H 4DAGH 2DQDH 2P44B 4OGYH 1YN7B 1MJ7L 5EOCH 1KJ2H 2X7LB 1JGEA 1PFCA 1MIEL 1RULL 3KYOA 3AGVA 2PKDA 2XZZA 4PJDA 1BFOB 3W5NA 1PG7W 1XGYH 4MCYB 1WCBB 3C5ZA 5EIVA 3GJEB 2XXMB 3GMPB 4JY6B 2Q3ZA 1RFDH 4L8SB 2N56A 3MFFA 1MLBB 3MRBA 2A73B 1EUTA 3LQZA 4TVPD 1PDKA 2EYTB 2VXSL 4HT1L 3FN0L 5HGBB 3NACL 3QCVL 1JF1A 5IHUH 5C6PB 4JGUA 1K2DB 5SV4A 3GSQB 3E0GA 2WWKT 3D39B 3WFZA 1MEXL 1K6QL 4YFDB 3SDDC 5IBTL 1D5XA 3JTSA 1KTLB 1G7HB 3STLA 1QPPA 3TESA 2XWJA 1E6JH 5KSVA 4LIQL 6CGTA 4FQXC 1VKXA 1CGXA 3RJDA 3ZL4L 4A2LA 3LZFH 3VXRD 4OFYA 3OKDA 1RU9L 3CCHB 3RWHB 4U1MB 5HGHA 5C0CA 3RY5A 1ED3B 1HKLH 3V2AR 5JXAL 3F7YA 3NZ8A 2F53E 4ONHB 3RWGA 2ADJA 5F70A 4MJ2A 1CIUA 1LO0H 5C3LD 4KVNL 1ERNA 3UTTA 1NFIB 1G6VK 5DJXB 5HYFA 3TN0A 1Q9LA 4I9WE 2Q3AA 5EU6A 5DQDL 3T0EB 2G5BA 5L8JB 1G1CA 1Q72H 1RZJH 2WQRA 3H9SB 3Q1SL 4QHNA 5FDYA 4AEIH 5JXEA 3RGVB 4F7EB 5T5NF 3HNVH 3BAEL 2HT2C 3Q5TA 4JAMA 4Z7VB 3VXSB 2D7TH 1R24B 1MRFH 5D7JD 4UQ3B 3LOWA 4MDJA 4PRHE 4KMLB 1AIFB 2C7UA 4Z7UA 1NANI 4TULL 3TVMB 5C0AA 3LS4H 3ARTA 3QT2A 5JHDA 1CLZL 2YD4A 5J4MA 1N2RB 4M9OA 4I48A 4OIIL 3TNNB 1ZTXH 1EDQA 4OD1H 5CD3A 3HC3L 4M61A 5GGQH 1RD6A 4ZAKD 3T0ED 2AVGA 4IOFD 4BZYA 2HJLA 1YQ2A 3H42L 4EQ3A 3MPCA 4NNXA 5GSVB 4KDWA 3SDDD 3VFUA 4LLMB 3IFOB 4BQ6A 2VERN 5EU5B 4M5YH 2APFA 2VUOA 3FFCB 3P40A 5HD8D 2XTJE 1H8SA 3KXFE 2QSVA 2X44D 1QD0A 5E1HB 2PTUA 4PV8B 4WI5A 2AJUH 4CKVX 2IWGA 4G6JH 2W91A 1WV7T 3EO9H 5E2JA 4UILH 1G9EA 4OAWB 4Z7WB 4RGMC 1C7TA 4K3JL 1NLDL 3O45B 1CQKA 5FYJH 1VPOL 3T1WA 1JNLL 1S8DB 3SDYL 5IV2B 3MXWL 3QIWA 4RRPA 2DQJH 5EUOE 4KK5D 3TM6A 1UJ3B 4JQXC 4JKKA 4IJ3C 5GGRB 1X9QA 4YR6B 5GJTH 2YUVA 1MRCH 2MPAH 1KB9J 1IGJB 1GVIA 3T4AA 4WU5A 5JORA 4FXKB 3DRTA 3IAPA 2C5DC 5IKCA 3F5WB 3MLZL 4MLIA 3CX5K 4MSWB 5KOVC 4M93C 2XWTA 4LMQI 4EI5D 3IT8D 2Z31C 3GMPA 5EU3A 4OCSL 1G7LB 3S96B 5E70A 3WHXB 3WD5L 1F90L 1MIMH 1BZ7B 4RAVA 3UJTL 3D0VA 2X4NA 4GS7C 5DJ6A 2Z4QB 4GRLA 4WFFD 2HKHH 4YH6A 5BO1L 1CE6B 5TE6L 4XPTH 1ZHNB 4J3OC 2YWZA 3WSQL 1VGKB 2FCBA 2GJ6E 1XF4A 3D69B 3ARYA 1L0QA 4XTRD 3X3GH 2L0DA 1VKXB 5EA0L 2BNQB 3O8XB 1U95A 3OF6D 3WNKA 3D39E 5SWZD 1XF2B 5JR1L 1QBAA 1ACYH 1SJVA 1CXLA 1ED3A 4OF7A 2YPLA 2APBA 1BJ8A 2NW3B 4P46D 1FO0B 1QR1A 2ED7A 1DBKL 4P59H 1QFOA 4HC1A 3MJ7A 3CDYA 5F3BA 1KTDA 4CAGA 1P1ZB 1FNGB 5DRXA 4HUWB 1T6VN 5K59E 4TRPL 3L3IA 1KF9B 1HINL 4HAFA 3X11A 1S7VB 2XQYK 2NY2C 4Z77A 5AD0B 3G08A 3QNYB 4KK8C 1KCVH 3QNXA 3LQAH 4WENB 4K3EH 4PRDB 3VRLF 2E7LC 1XIWC 1UZ6E 2ZCKL 3ZE1E 2V5YA 4JPVL 5KVFL 2FBJH 5FOBB 3DV6B 4EUPH 3BP4A 2HFGH 1BOYA 2HG5B 1RUQL 2CMRH 2ED8A 3GI8H 4CN6A 5FKPB 1JPTL 1KJ2A 3TCLB 4HCRL 4EXKA 5JIPA 4OM0L 3O41A 2EC8A 5SV3A 5DJAA 1BPVA 3IS0X 1T66D 2B2XL 1A7RH 3RY6A 3Q2CA 1A3RL 4K94C 1RJYB 3FAWA 2IAMA 1U8LA 1S9XA 4AH2A 4Z7UF 2Z91B 4ODVL 3MV7E 1ZLSH 3AREC 3U46B 2AXGB 5I6XB 2PTTB 4LU5H 3HNSH 4NWUL 1IC7H 1EZVX 5IW1A 3T4YB 3DETD 3V6OA 2IH3B 2VDPL 3GBLA 3WIHL 3THML 1HN1A 5HYJB 3VXPB 1CD1B 2DJSA 3O3BB 5D72L 1HHIA 3N1GC 1TMCB 4GXVH 3AUVA 1T04B 4ZD3H 3JV4A 1CI5A 1AR2A 4TUKL 1ADQA 2F58H 4KTDL 4RX4A 5FHBH 2ADIB 4U3XA 5IFJA 1U8QA 3RIFF 5CAYB 3MQIA 3MRKA 4IRSB 3LKQA 2WINA 2G2RA 2HWZH 2IMNA 1C5CL 3EO0B 4JLRB 1ZLWH 3UAJC 1FZJA 3DWTA 3OZ9H 3IJHB 4LVEA 1NMBH 5KANI 4K23H 1CICD 3WFHA 2VL5A 3IDJA 5AYQA 5IBUB 4F33A 1AI1L 1NC2B 4X80H 1AQKL 5FUOL 2NXZC 4XP9L 4O2EA 5CSZA 1FLRL 2HP4A 2P7TB 2NX5E 2CIKA 4HIJB 4MD5B 4YHOL 3U36A 4LVOC 2ZZUT 4U33A 4L3AA 2F5BL 4XWOC 1CVSC 3QQ9C 1HEZB 4F9LC 3HPLA 2AI0H 1CE1H 4Y19D 3WXVH 5L8KB 1RUPL 4G5ZH 4Y4HB 4OCWH 3BP7B 5HVWA 1NCCL 3OAUL 4JZJC 1U42A 2EKJA 4FQHB 5I1CH 1FO0L 2VITB 4YQXL 2O5ZL 3E6FA 1MHHA 1BREA 5DWUH 4KZDL 1F13A 3SDCD 2DI9A 3ET9F 4MYWB 3FMGL 2ESVA 4KPHH 3DI3B 3DMMB 1RK0A 1MOEA 4QHNB 3G04A 3WIFB 1RSFA 3EJZD 1ZWIB 1A6AA 2IQAA 4OCMC 4K71B 2IC2A 2DICA 2OL3H 3ROLA 5A2JH 1SBSH 3DX7B 1J10A 3MGAA 2ZPKL 1IKFL 1U3YA 4FRWA 3UTPE 5F3HA 3QBTB 4GRMA 3U9UA 1XCTA 4RWHA 3SCMD 4C54A 5TDNB 2VLME 1G9MH 5J9PA 3IKCB 1IBGH 4ONGH 3GMLB 4L8BA 4ZUSB 5K9KA 3QQNA 5KOMC 2FX8L 5HXMA 5IVZA 5GS1A 3STZB 3PABB 4LLMA 4NQUA 4XMKL 4PR5A 2R1YA 4FOMA 4HGWA 3TO2A 5EU5A 4PY7A 3O6FB 5SWSE 1P7QD 3T2QA 5F9WC 1NBYA 4KROD 4L29A 5GRWA 1MLCA 3BZ4B 5D5MF 3QHFH 1RJLA 4NPYB 1FC1A 2WUCH 1KIQA 5BRZA 3HG1A 4P2OB 5ITFB 1GZQA 1A7NL 3IU3A 4E41D 5EPMB 1U92B 5F21B 1FFOA 2WBJD 4BKLA 1L6XA 1XR9A 2GJ6D 3V5KB 4AL8L 1INQB 3VI3E 4BSVB 5KAQF 1F8TH 1AP2A 3KJ6H 5F7DB 1A5FH 4HKZA 4O51A 5IOPB 1U36A 2IAMD 4W4OC 1OSPL 2FJFB 4MA7L 1B0GB 2LTQC 3HRZB 1KJ3H 3W81A 1OGTB 3BIKB 3BGAA 4ZUTA 1WZ1L 3F12A 4WGVB 1I9JH 3ULUL 1K6QH 4P57A 5HYQA 5MEOB 2EDWA 1Z5LA 2XWBA 3HS0A 3CAFA 1BMGA 2VJXA 2APWA 1QA9A 2BVOB 4JKWA 3PHQB 5CEYA 3PHSA 1XGQB 1B3JA 1QLEL 5EU3B 3LQMA 1HYSD 1B6DA 4XGZB 4FFVC 4O58L 4XX1G 4K8RL 2QSCH 3PL6A 2Y06L 5F7YC 5IFAH 4W4NA 3HB3C 2UVFA 4OGZA 1E0OB 4LPXA 1NEZB 5AEAA 3VA6A 4CNIB 5JW5A 5FXCH 4L3CA 4L8DB 2LU3A 2R4RH 2OJEB 3FJTA 2HN7B 3BZEB 4JM2D 2AXJA 3IGAB 1U93A 3MX0A 3EYVB 2P7TA 4X4ZA 2JJTA 4URTB 5IM7B 5HHQB 1M6OB 4OZFG 4JG1H 4AG4L 4E41E 1JWSB 4QOKD 2KUTA 1UZ6F 4R2GD 1I1RA 1RUAH 1QRNB 4BFGA 4LPUA 4FFYL 1G9NH 4OB5L 2F19H 1NAMH 1P4BL 3LKNB 4ZUVA 1DBJL 1MCEA 3MRJB 4FQIL 5E7FA 2FZ3B 1A14H 4OD2B 2VLKD 3IXTB 5E2TH 1FCCA 2UZIH 3ZE2E 3BVNA 3LEVH 2EDRA 2BJML 3LZFL 3VFRA 5FAAA 3RL2B 3FOMA 3E8UH 4Q9RL 1E27A 4P23B 5CEXA 4FABH 2JJWA 4LBEA 4OUUA 3O3AB 4YBLC 4ODTH 3DTXB 3ZTNH 3UTPD 4Q7DA 4UT9L 1S7VA 4KDTC 5ISZD 1OQOA 4PJ9C 4HPYH 4S1QL 5ACMA 5AG9A 4Y16A 1OAZL 1WQVT 4Y5YB 4FNLL 4FFVD 3IJYB 3O3DB 3DX7A 4R26H 2DQGH 5GRVL 2VZ1A 3UJJH 3UTOA 4JFEA 1SM3L 2DMKA 4PGCA 4ZO7A 5J9PB 4OLVH 1UXWB 3HE7C 3BWAA 3ZYJA 2YUXA 2R0ZL 3LQZB 1MY5A 5L2KE 4H26B 1HSAA 1DL7L 1KPRA 3T77B 3HZYB 4HFUH 3BP5B 1UM6L 3O6KH 3A67H 3V6FB 4XI5C 4R2GC 1WBYB 3DROB 3ULVF 2E8YA 4K3DL 4ZTPH 2ITCB 1F00I 4Z76A 1MNUL 4HG4J 1IJ9A 1MJJA 1CR9H 5C0GB 4TQEL 1O0VA 1YEGL 2PR4H 5TF0A 4JG0L 5ACZB 1WSST 1A1OA 1YJDH 3L3DB 4QRTB 2XQBH 2BERA 4D0CB 2XI9A 1BBJB 3UZQA 1QZ1A 2GTZA 4QXUH 2P4AB 2X4TA 3IDMA 5D7IB 4MXQD 4RGOH 4WGWB 4HV8A 2W9EL 5EO9B 3SDDB 1FNSH 4EDWL 5D70L 5F1NB 4KK9C 3U7WH 4X5XA 2GJ6B 4I2XB 1EXUA 1IL1B 3IFLL 4LPCA 1G6RB 4HJGA 2ORBL 3LKQB 2NY2D 4D8PB 1ZOXA 1A6WL 3ZTJG 2BSTB 4UAOC 4JM2A 3RVTD 1IGTA 5DFWH 1H9VA 4G9FE 1R3KB 3GM0A 4IEFB 1EA9C 1T7VA 3RTQA 5DT1L 1YY9C 4HUUA 3MRHB 4M7ZC 3CC5B 1NC2A 4V2CB 5I8CB 4JFFE 3MBXL 3MRDA 5JIHA 1JJUA 3CFEA 3NPZB 1V05A 1YNLH 2HRPH 5HYIA 3FQWA 4OIBA 1T66C 3I50L 4G8IB 3TNNA 4W70A 4Z0XB 4U1KB 4WWKB 4BYHA 5KJRH 1M71B 2XZAL 3TZVD 4Y2DB 2HJLB 4HHAA 4PB0L 4LVHC 3GSNH 3TC9A 5HI5C 3QUXD 3EO1B 1NCAH 1C16B 3HAEB 1RY7B 1W0YT 3AS2A 2UWEA 3I6GB 4UTBL 4D9QD 1T1WB 4IDLA 1IQDA 1WWWX 5D1XA 3VXRA 1N0XH 2KQMA 1M7DA 5D71H 1S7UA 4DK6A 1JZ6A 1NQBA 2FJHB 4S1RH 4HKXA 4WY7H 4WHTB 4DQOH 5F7KC 2VR4A 4OI8A 4M7LT 4YHPA 3WJLC 2A9ML 1S8DA 2G9HB 3GJFH 3WN5B 5HHMB 3QEQD 4P23A 5CEXB 1TJIL 2BRRL 4HJ0C 5GS0D 3WFBL 1JGVL 3FQTB 1GC1C 2X7LA 4X6FA 1KBGL 1OSZB 1RZ8B 3AFLA 3PF2A 4KAQH 4DGVL 4MJ6B 5C0BA 3BYTA 5E6ID 4LLWB 4IOIA 1MFNA 4JN2A 2VO5A 4NNPH 1GRWA 4RFEB 1WFOA 5F89B 4IJ3B 4MA3B 3JVGC 4I4WA 2C1OA 3D85B 4PG9B 3SE4C 3MLTA 4Y16D 1QSFE 4H0IA 3QZWB 1UXWA 3BWAB 3SGEH 1LE9B 2ZKHL 4MNGB 4AMKL 1K2DA 4LHJB 4PJBF 4J3TA 3O2DH 2HTLC 1FYTD 3D39D 3PWLA 4JHAL 2BX5A 4YPGA 1ZT7A 3IF1B 5D7KE 4Z0BL 3P4MB 5D7LB 2CSPA 2NY7L 4WI7A 4ALAH 3IU3B 1KFAL 4QGYA 4JN1L 5I16A 2DBJA 2IG2H 4LSRL 5H94B 1BJ1H 3BPCA 1L7IL 4U6VL 4JFFA 3ZYOA 3TBSB 1V3MA 5C0GA 4HULB 1A3RH 2FWOB 4X99A 2VLJD 4DGYH 2BSED 1R5VA 2FEEL 1RZFL 1NGYA 3WLBA 5F7FA 2ZNWA 2ADJB 1U95B 3HRZA 5IVXE 1BBJA 5FM8A 5D5MB 3BHBA 3QULB 5EU6D 4PJXE 2IFFH 2Y36H 1X5HA 4H88H 5C0IB 2W9LA 4Y1AA 4D0BA 4N8VG 1F4XL 4O2CB 3RWJB 1AGDA 2W0FB 2VLRA 3PGDA 3EYUH 3ZKSD 1YUHA 3VWJB 1ZHLB 2HT3C 2P8MA 2WANA 1UKSA 5ITBH 4CVZA 3FT3B 3KPMA 4ONOA 3EOYG 1I1FB 4NQCE 3FZUD 5E0QA 1GGTA 3QIBA 5E2UL 2FL5A 5DRWB 2H2SC 1OTUC 4GS7B 1FIEA 2P5WE 3HI5L 3S35H 4D94A 3QISA 1N6QL 3RKPA 1G7MA 4HJJL 3BZEA 4G9FB 2V2WB 1XIWA 4JKLA 5J6HA 1AKJA 1BHGA 4MS8D 3MRQA 2X40A 1XH3A 4PJCB 4RMVA 1BQLL 1IGML 2MWCA 2VC2H 4NQDA 2IQ9H 4JDTL 3LD8B 3I75A 3IFOA 3QFJD 2D4DA 1T1YB 4X98B 1JZ4A 5B38G 2CKBL 5FGRA 5DJAB 4GQ9L 3OKOA 4XP1L 4XCFH 2OI9B 2NQCA 1Z0MA 4YX2H 2PETA 1EGJA 3C60A 1JK8B 1CLOL 4XH2A 3REVA 4XVTH 4FFZH 5T1KB 4OLXL 5EC1B 2Q6WA 4XVUC 3AS3A 1GXEA 2XA8H 3PGCA 2CLVB 2BDNH 3UTSE 2I9LA 5EBLA 3O3AA 4V1DD 3S36H 4Z7VF 2V5SA 4HIEA 3GIZH 4JDZA 2CK0H 4UIMB 1BFVH 4UTAL 3VWKC 3F6LA 3C09B 4KJQC 3QIUC 4JZOB 3LRGA 3ARXA 4KKAD 1TETL 3MLZH 4H1LA 1J05A 1BEYH 4S1SH 4ZUUB 5ESVB 4D0DB 2DQHH 4QNPE 3FCTA 3BIBX 5I66B 3QDJE 3HUJA 4IRSA 5AUMB 4NJ9H 4DOHB 5KVEL 1FFNB 3QR2A 1WCQA 2E9JA 3F58H 3QXWA 5E8OB 3NVQA 4LSTH 2Z31A 3W9EB 3KPLA 4RA0C 3WD5H 4F7TA 4MS8C 3QDGE 2BVEA 1YNTB 4MA3A 1KJ3L 4HK0A 4TYUA 4XPGH 3L5XH 1FL5B 3I02B 1YEDA 3BPOC 1H15B 1MCPL 3M8OL 3VG9C 3NOIA 4MJIE 3TBVB 4NC1C 4ZFFA 1DN0A 3SJVD 1ZVSB 4X4XA 2J4WH 2VLLA 5FUZH 3VFMA 1MWAA 4GXUM 1BIHA 3PIQA 1PEZA 4LHUG 1ZT7B 5I18L 4TUOA 5I73B 2ESVE 3D69A 5LKNA 1I3UA 4G43A 2HKFH 2X4OB 3ZDZF 3OJDA 3L3DA 4QRTA 2P5WA 3FOLB 1V3LA 3O3UN 4JKMA 5I75B 3RWDB 1UACL 2LABA 2WBWB 3D3VE 2E27L 1QR1B 5CS7A 2EDLA 1J87A 4X6DF 1HSBB 1T2XA 3MZGB 5DZLA 1IEHA 5T5FH 1ORSA 2VN4A 4ONHA 1RVFH 1IGTB 1P84J 3RNKA 1NANH 1T0NA 3WS6C 2BCKA 2P8LA 3K8MA 4PV9A 3NFPA 5F7EL 3TN0B 1TZGL 4Z78B 1B2WH 4MHHI 4K3EL 5JOPD 4JJ5B 1MJUL 3BQUC 2J88L 1SEBA 4Z7QF 3O8XD 4GBXA 2BNQD 1RQ5A 2DTMH 4X6CF 2EDOA 2W59A 4I0CC 2UZIL 3V7AE 3D18B 2DDQL 4N1EA 5EU4B 1RUQH 5BV7H 4PJ9A 1D9KC 4UQ3A 3IDNA 5I8OL 4U1KA 2ZUYA 5GGSA 5A16B 3W0WE 5GGVY 1XEDA 4S11A 2WV3A 1QSVA 3KLAB 5C0RL 4HC1H 4RBPH 5CCKL 3KYNB 1AGEB 4JZJB 5CP3A 3QUZB 1V7NL 2DQUL 4GMTH 4X6EA 2CDFB 3G5VB 4YNYA 3SE4A 2ADGA 5GISL 5I8EA 3UJJL 1RIVL 2GTWB 5IW1B 5J11C 3K0WA 4MXQC 2F54D 1U8KB 2A9NH 2YWYA 4WW2A 5GGTA 4KK9D 5HYJA 3MGTB 1JGUL 4MJIA 5DFVD 5F7NC 1CD1A 5IT2H 1WFUA 4YHPB 3PJSA 1KENH 3MC0A 2YN3A 2EC9T 4XCYB 3BGFC 3H3KA 5DHVB 3TIDA 2AK4B 1RZGA 5E1AB 2YUWA 2Z31D 2ZG2A 3NFSL 3P2TA 1NJ9B 1B0GA 4HIEB 1DANU 4F2MA 5KVGL 2LAAA 4I18B 2BOBB 5KTEL 4ZUWB 3TH2T 1TZHA 1KIUA 3KLSA 5CEZL 1M7XA 4UAOB 3OKLA 1C12A 3T2PA 2FIKB 2EO9A 4CN1A 3KYOB 1QSEB 4BFIA 2ICWJ 1NGQL 2ICWA 1D9KD 3K80A 3UDWA 4C59B 4V1DA 3GO1L 1T2QH 3C6SA 4LF3B 5ILTL 5DS8B 5ESQB 4YHYB 1EVUA 3UTSD 1MCOL 1X5LA 3O6FC 2DM3A 4HPOH 2MQ0A 3BKCH 4PRIA 5HDBF 3TZVC 1LILA 3GHEL 5JHLH 1HQ4B 4XNQA 5ELIA 4KRPD 1TQCB 4N5ED 3DI2B 4P2QA 5ETUA 3AAZB 5D2LA 1IEBB 1F6AA 1MFEH 3QDGB 3MMEB 4GKNB 3C87A 4HZLB 3F7PC 3KVQA 5KBNC 2AJSH 5GZOD 4WI8A 5HHQA 4JFFB 5L2JA 1A7PL 4O9HL 1WZLA 1D5XB 2WIIB 3O6KL 4XCNA 3IFPA 1JZ8A 3QFJE 2K1MA 3I2CL 3WS3B 3MRCB 4HF5H 1JVKA 4KQ4L 1V7ML 4OJFL 2ZCHH 5D8JL 3VFPB 4JHWH 3W0WA 3FN9A 5D5MA 4XWGH 4HUMB 5KVDL 2B7DT 1EEQA 1CR9L 4RNRA 1ZGLA 2IGFH 1RJZB 4YIQB 1P7KA 2BNQA 3O8XA 3QDME 2R69L 2VLRB 2NY0D 2WAHA 4YWGL 2D31B 5DJZA 4EI6B 4B41A 2A77H 1UXSA 3GSNL 1ZA6A 2W9DH 4HBCH 5DDHA 4YFLF 2EDFA 5EUKB 4JFDD 5JDSA 5JIIA 4LBEB 4OUUB 2D9QB 3VRIB 1EJOL 3ZKNC 4KKCD 5IEHA 2JJUA 2VR5A 4F57H 4DN4L 4YO0A 5FKAA 4CVWA 4D9LL 5E9DD 1U41A 5T3ZE 1NEZG 2EDQA 2XN9B 1I3RB 3A6CL 3ZSSA 4YBLB 1U8HA 5FFLA 5BS0D 4OCSH 4NM8H 3MFGB 1X5YA 5CKAA 3IRZA 1Z6JT 4OZFH 3TYFB 2X89D 1Q9OA 2VISB 1NBVL 1OW0C 1YMHA 4X9FA 2P46B 1NFDF 1KBGH 3T77A 1LP9A 5J1AB 1LHZA 1ZA3A 4LVNC 4YXHH 4YXKL 2AJVH 2VXUH 5CMAA 5IIEA 3RY6C 3OB8A 5H35A 1I7RB 4UV7H 2O5YH 4QRQA 4QXGH 5GRUL 1M05B 4F7PA 4RQQB 4XBEH 2IAMB 1IC4L 2D03L 3GHBL 1DVFB 2DLHA 3ARGB 4WW2B 3V4VL 1ONQB 4Q58C 2AXGA 5DC4B 3VFWB 3C60D 4RGNC 3TT1L 1VCAA 3HHRB 3PJSB 3D2UB 3EFFA 3QIWC 3LMJH 1D5IL 4PFEA 4PJAE 1NAMA 5FO7A 2E6QA 3X13B 4PJIB 1Z5LB 4MNQD 4JY5H 4JFPA 3MLSL 4ODSH 4LHUA 3GMQB 4APQC 4FQ1L 4PREA 4K7FB 1O7VA 1P5UA 1A7OL 3L3HA 1TZHB 4HQQH 3F7QA 3NAAL 5BS0B 5IFAL 4N1CA 4QHMA 4Y5VA 3QCUL 5T3ZH 2OMBA 5CSBA 7CGTA 3ARZA 1YNTA 2YD5A 3B5HA 3ECBA 5D2LE 2EDTA 4KC3B 3U6RA 5D96C 4H8WH 2VAAB 1A2YA 2ZOKB 3T8XA 1GGUA 4R2GB 5I8CA 4Y7MA 4KUZL 1DN0B 1U2CA 1EO7A 4HIXL 4UB0L 4NSKA 3UBXA 1G7IB 2FD6L 2NZIA 3FL7A 3GI9L 4GRLC 5FUCE 1X5ZA 1IAKB 3MRPA 5E8EA 4NQCB 1QSFA 2GCYA 5JQHC 3CZFB 3QWQB 1Q0YH 2ZJSL 3G5ZB 4HX1A 1IEBA 5JHDE 1LE5B 4GBXC 5CUSH 4LSPH 1IT9H 1J0YA 1FGVL 1FYHB 3QO1B 4HIJA 3U36B 1YEHL 4EZMA 2E6JA 2X1OA 4UU9A 4LDLB 1MQKL 1GJIA 3EFDL 5I1JL 2VABA 2WBKA 1NC2D 1Z3GH 2NY7H 1IAIM 1IGCH 4G7YH 1HHGB 3ARFD 3LEVL 4LHQB 2JKXA 4QCIA 4RFNC 1MHEA 4QRPE 2HTKC 4RGND 3KPTA 3W9DB 4HWBH 2FATH 4WEUD 4UV4H 5A3IC 3H9SE 1KIPA 1D5BB 3SDAD 3RL1A 1GC1L 1QQDB 1A1MB 2JJVA 5IVNA 2QR0A 1N26A 2B1HH 5F88B 5LCVH 1UG9A 3SKNB 2XY1A 4FTVA 4Y89A 4HUWA 1HH6A 3QIUB 5DVOA 3O3DA 1LK2B 3SQOL 1CD0A 1CGVA 2DIBA 2VLRE 2ADFH 4M6ML 2Y4SA 5E2WH 1KCSH 4PJ5B 5HDQH 3WLWD 4WW1A 5JZ7C 5FKAB 4P5KA 1DP0A 2OTUB 3BKYL 1PG7X 4E9LA 1UA6H 3QWOA 3KR3H 4JO1L 3S36L 1LNUB 5IB2B 3OG6B 1LWRA 2NR6C 3BKML 2XTJB 1N8ZB 1JTTA 4BA8A 1DUZB 4ZUSA 4BQCA 1UM5H 2F74B 2UV3A 5HGBA 4S2SA 5HPOA 3STZA 4NN7B 1DTUA 2CDFA 4Z7WE 4IIQA 4QGTA 2XACC 5ESAB 2A6DA 5H8DA 1I8IA 4G9DA 5I73C 1S9XB 5EORL 5KSAA 3GSQA 3ARFC 1GPOL 2AP2A 4N0FA 4ELMA 2YMXL 3UYOD 1JPFB 3NN8A 3TPUB 2FBOJ 2YPVL 4XCCH 2XTJD 3WN5C 4X8JA 2I26N 1CXIA 4XVJL 3MJ9H 1U92A 3SGKC 2OZ4A 3PV6A 4PGJA 1FFPA 3O6LL 1NGPL 3VXPA 3W39B 1CLYH 2EEAA 3A6BH 1SVCP 3WFEH 5I18H 4PJ5D 1MRDH 3OWEA 1HDMA 1OGTA 3BIKA 3OKLB 4JM2C 1I8KA 2FB4L 5DT1H 1YEFL 2BNUA 1WGOA 2EIDA 3ETBF 2YPLE 3QEQA 1JNJA 4FQXD 3MRHA 2GJZB 3RWEB 4FQJL 5HGAB 3C6SB 4LF3A 4XT1C 4R4FH 1CXFA 3L1OL 1OL0A 4YDLC 1A1NB 3DO3A 3LRSB 5L0QC 4YHKH 1TITA 4ZXBD 2Q86B 2DWEA 3SJVB 3QDGA 3MLRH 4GOSA 3OKEA 3PV7A 5F7EH 2HN7A 1CU4H 5FCUL 4J3VA 4M02A 4LQFH 4WEMB 2A6KA 3HPJB 2ZOLB 4TSBH 4JRXA 4M43H 3MSPA 2OQJB 3W0WB 1KG0A 5DMIH 35C8H 4MAUL 2ATPA 3ARGD 3UTTE 2M26A 4YAQA 1YECH 2CUHA 5HHOD 4OD3H 3CLEL 1EEZB 5E95B 3KPSA 3F7RA 3DVGB 2CKBA 4U4BA 4LIQE 1NGWA 4DFIA 1FORH 4JFYB 3UO1H 3QUXA 1EBAA 4D3CH 5I9QB 4JQVA 2ENSA 2VXVH 5KVMC 1AHWB 1LO5A 3U9PH 4DVRL 3GEWB 3E1F1 1TTGA 3LN4A 4NCC1 1F42A 5FGCE 1WFNA 1NC4B 3BEWB 3VH8B 2QEJA 3HNVL 4JN2B 4XNUH 1RVFL 2FGWH 1KGCE 3T08A 3JWDL 4NM4L 4NO0A 1BFOA 2AEPL 1SVZA 3CFKA 5AUMA 5EC2A 3DECA 4Y16B 4PG9A 2ZSWA 1ORQA 3KPOA 3MUHL 4HWEH 2D0HA 2YD2A 5IESL 2VSCA 1YMHB 1DVFD 5JIKA 4NP4L 3BT2L 3S96A 5E6IB 5DVNA 3BDXA 5IHZA 2XZCL 3O4LE 2DMCA 5I1GH 5SWQB 2DLIA 2QQLL 4RAVB 2VKWA 5FYLD 3TBSA 1ZS8B 4EXPX 3BPOB 1ZHBA 2YD9A 1T2JA 1AGFB 4ZAKB 5CCKH 1A4KB 5I1EH 4MB4A 2MKWA 4X7TB 1G9NL 1OCWH 4R4ND 1A7QL 3FOLA 3DSFL 2VLKB 4OCYH 5KN5B 2D4FA 4H88L 4UILL 1S7TB 1FNFA 3W11C 1LEIB 1RIVH 1MHPL 4KRMB 3IDXL 4B0MM 3CMGA 2VLMD 4M4RA 4Y4FB 3D87B 3PV6B 2YR3A 4L4TE 3FB8B 1JGLL 1ZE3C 5LG1A 4RDQG 3PWNA 3P11H 4QXTA 5EU6B 3GK8H 4R7DB 2Q87A 1UH4A 3RIAK 4IDJL 4YDKH 4X5LA 4IRJC 3I2CH 4O02L 5ADPH 3MV9A 4OZIB 2VLJB 4XTRC 4LSVH 5EU7C 3U79A 3SO3B 1BD2B 1J8HA 2AJ3A 4XBGA 1PJ9A 4U3HA 2PYEE 4WFHE 2ATKB 4XBPB 3P4NB 4JB9H 4P0DA 5DF0A 5ADOL 5EN2B 4YHMH 5AD0A 3D18A 4FZEL 2C9AA 3VD3A 1KC5H 1QSED 2IQ9L 2QKIB 5DJCB 1Y0LB 2H3NA 1MSPA 2IBBA 3MLPA 2XZQH 3MCLH 4M48H 3DVIA 1OLLA 5BZWA 1WBZB 4F58H 3KXFB 4UQ2A 4RIRB 1EJOH 3E6HB 3GBML 5TE6H 5TE7H 4Y19E 4UU9B 3VXNA 2FO4A 1T03L 5E8NA 3WKML 1AO7D 4L9DA 1VADB 2OTWA 5CGYC 2VABB 4CRPA 4M1DL 1OB1B 1JF6A 4LPTA 4QF1B 5HYSA 3ZO0A 1K3IA 4X6EB 1MHEB 1A9EB 3QXVA 2OQJA 3BI9X 1KG0B 4MJ4A 1PY9A 5DD6B 4O9HH 2EIBA 2GYSA 2DQCL 4U2YA 2M1KA 5D93B 3KLHC 5EUOB 1K5NA 5HHPA 5LGKA 4R3SA 5F44A 1SYVB 4K55A 2B8OT 2X4PA 5TDPB 3EZ8A 4NRZA 4QXUL 4YUEH 5D7IF 3SCMA 4AIZA 4UIMA 3O45A 4IIQC 5FYKD 1MI5D 5E7BA 5JW4M 4TPRH 5K9JH 5EZJA 2V2TB 2ITDB 1RMFL 2Q7YA 5D2NA 3IAGC 4Q2ZA 3QO0A 5I1IH 2R69H 1DQDL 3G9AB 3NPSC 4OCRH 4YHIB 1T7XA 1Z2KA 4QXGL 1QBBA 1EFQA 4GG6E 3IJYA 1S9WA 3KPPA 4LGRB 2PTVA 4FQPA 3AY4C 5IG7B 4U0RB 3O4LA 3CLFH 4JFEB 4MD0A 2G5RA 5IB2A 3QDMD 1ORQB 3I02A 4FP8L 4JPWL 3UDWC 1N8ZA 1ZHKA 1XF1A 5IB4A 5ECJE 4L8SC 3IJHA 1KIRA 4GBXD 2VL5B 5CBEA 3S8WA 3X17A 5FUCC 3NCMA 1K4DB 3MV9E 2Z4QA 4GRLB 1HIMH 2H26A 4MCZB 3U0PA 3LS5H 3WE6B 3MMEA 4GKNA 5GQBA 3HZVB 1W72H 1K4CA 4U6XA 4GMSH 4JFOA 5SX5K 2BHYA 1CDIA 4G80A 3S37H 2ITCA 4ODVH 5E5UB 3U4BH 1CICC 3ILPB 5J7CC 1B0RB 3SDCB 1EAPA 2P24A 2JB6A 3CUPB 3D3VA 3SKJL 4X6DE 2AJVL 2VXUL 4WDIA 1HZHH 5D7KD 1DQJB 4G8EA 3ULUF 3GJFA 4L1DA 2FLBT 1AD9A 3FZUC 3BUTA 3OG4B 4MXVE 2NX5A 2OSLB 3QI9A 4N9GB 3WFCH 1NGYB 4DFHA 3QAZC 5BCAA 1T83C 3O2WH 4XHJD 2ED9A 1N4XL 3QQ9D 1N5AA 5JOFB 3L95A 4X7SH 1A3QA 2F8XC 2J8UE 3ZDZE 4O4YH 3NZHH 3BGMA 4QRPB 5ANMB 1JGVH 2Z8SA 1T4KB 3OR7B 2HWZL 4U1NA 4E5XB 2ICWI 4Q0XL 1NUDA 4Z77B 1ITBB 2GSGA 2J5LC 5C8JB 3V7AG 2AXFB 3MYJB 4NNPL 5DJ8B 1IEAA 1QNZH 3TO4D 1RI8A 3QEHB 4K94L 2VTFA 5F3HB 3FHAA 1GC1H 4HC1L 5DRWA 3KLAA 4ERSL 1NMCC 2C3WA 2QKIA 4OZGE 2VDNL 3G6JB 2VN7A 3B3IB 2DAVA 1V7NH 1ZANL 5E2VH 5JXED 1XGTA 3UPCA 2B4CH 2EIZA 3RGHA 1P4IL 3S3PA 4NO5A 2DYPA 1XF3A 1X5GA 1HXMA 3M17A 1CE1L 2ADGB 1MI5A 1NDMA 4PJEF 5FO9B 2MHAA 1T21B 5DK0B 5LWYL 4ZO9A 2CIIB 4CW1B 1H3TA 1DBBH 2QJDA 2CDGA 1RJLB 4NPYA 1KB5A 5FYJE 3SDXA 3VXRB 1M05A 1MELA 2DB8A 3MV8B 5LAXB 3RAJL 3RWCA 3U7YH 3WBDA 3QUKB 5GGSY 3BKJL 5EO0B 1W8OA 1JBJA 1FFOB 5JNYA 3RZCD 1Z9SA 3GMOA 3QXTA 2C4FU 1YZZA 1FVDA 4AIZB 4RGMB 4IOSD 5IJVA 4L3ED 3JXAA 4ZUWA 3MA7A 5HY9A 1OTTC 4JM4L 2UYLA 5MENB 4CVXB 2DBLL 4KFZC 2C26A 3G9VA 2ITDA 3RU8L 1R3JA 2BMKB 1QBML 1BBDH 4NC2B 2FIKA 3GMNA 2QSQA 2YMXH 4XHQA 3CFKB 1N5YH 1DQMH 1ZLSL 1T89C 5ILTH 2ZPKH 3AVEA 3OQ3B 2YPVH 3UXFA 4JLRA 3TO4C 4Q6IC 1UVQB 3L5WB 1B0WA 4UT7H 5ESVA 4B7LA 3ULUC 2VDKL 4QHUB 3O6LH 4MCYA 1DJSA 3C5ZB 3D3VD 5F6IB 4PJ7B 2ZOKA 1UWEL 1ZHKB 3OMZA 1OAKH 3SO5A 2DTSA 3ILQC 2Y7QB 3AROA 4HK0B 4R90H 1EGJH 4K8RC 1SY6L 2R9HD 3ELAT 2E9IA 2WIIA 4FQJH 3ARGC 1VEPA 5E5RB 4OJFH 1T6WA 1HYSC 4U6XB 5E00A 4DZ8B 4G8FB 4I3SL 4TUOB 4O2FA 4OF6A 6FABH 3SJVE 3GNML 2XXCB 1AO7E 4MX7B 4QKXB 4KRPB 1IMHC 3FB8A 1CZ8H 3VXQA 1RUML 3O8XC 1LO3L 1FZKA 2V5MA 4PG2C 3IXTA 1X5AA 2CK0L 4F37F 4X6CB 2EE6A 3UTTB 4KKLD 1RIUL 2IALA 5DEGA 3MODH 1FDLL 1JNNL 4OQTL 4G5ZL 1C5BL 3T0EA 2XFXB 2BSSB 4EOWL 3RNKB 3DX8A 4OZGA 2EE2A 5K33A 1DQLH 4K8RH 4LCUA 4GRMB 4JAMB 4Z7VA 2F53D 5A2IH 4P4RA 3ZKXB 4HUNB 5IW6B 4ZPTA 1YNKL 2HH0H 4GBXB 3QEHA 3CFIC 4WV1B 2FJGA 2D9CA 4PLJD 1NMAL 2IFGA 3S5LA 3EUUA 1N2RA 1BP3B 1H3GA 1QFUH 4P59L 3ARUA 3VXSE 1LP9E 4PR5B 2OLDA 4NJAH 2DLTA 1NFDB 4FTVD 4WEBH 3PP3K 3H8NA 4QF1A 3FQRB 2VMFA 3T2NH 2IPTL 3UYPA 3ZZ1A 5GSVA 3LEYL 3V52L 1DE4B 4K3GA 5BQ7A 1FV1A 2DQEL 4F7PB 5EZIH 1KCVL 1CU4L 2J8OA 4GKSB 2JIXA 4PBXA 2JCCA 4M3JA 2CIIA 2PW2B 1KLUB 4R97B 4NC0B 1G9ML 1LO4L 1RULH 1A47A 1EIBA 1AGBA 5C9KA 1CFNB 1LDSA 1P6AB 1D6VH 1OP3K 4WI4A 3TP4A 4TOYH 3CFDA 3CD4A 2F8VA 4C58B 3CMOH 5KANG 4UDUB 4M1GL 4Y4FC 2FX9L 4DKEL 3O6FD 1A21A 5GIRA 4HT1H 2B1AH 3F12B 3GMQA 2YD8A 3SDDA 3RA7H 3QHFL 4K7FA 5TH2A 4HQQL 2CKNA 1F45A 3MRRB 4DW2H 1QFWL 5IVXA 3WUZA 1W0VA 3JWOC 1L9MA 3FCTB 5I66A 4LEXL 3QEQB 3BE1H 1JV5A 2YBRA 4U1HB 4P2QD 3ZDXF 4ETQB 5MENE 4FXKA 1INEL 3Q6GH 3TH3T 5DMKA 3MLWH 3KPLB 4GSDH 1A1NA 2FGWL 1HH9B 1OSPH 2VR9A 2HJKB 5JW5B 1FL5A 2G75B 1IAKA 1T7WA 3HFML 4OZIE 5CUSL 4ZNEE 1T0MB 2E8ZA 3LEXA 5FHBL 4MAYB 1U6AL 2PYEB 2RIKA 3VGFA 2P48B 4NP4H 1K3ZA 2A6JA 5HJ3B 2BNRE 4LAQH 1UEMA 1M71A 1YY9D 4HUVB 2VRAA 1BQUA 2KBGA 2XZCH 3FQXB 3VGAB 4GW1A 5I1DB 4ZFOB 3WO4C 5FYKH 1GYAA 5D1XD 1F6LL 3QHZL 3ZT6A 1FYTE 3HI6L 1C16A 5J3HD 2D7TL 3VGBA 2ATPB 3L3KB 4OFIA 1AI1H 4X80L 3VFNB 3SBWC 2HFTA 4NZUH 5KSAD 1FL6A 5D70H 1ROWA 3G5YA 1ZTXL 4FTVE 1OAUH 2VYRE 2P5EE 2R15A 4GG8A 3V0WL 3V5DA 3QUXC 4PTTB 4AG4H 1OLZA 3T0DA 1T4KA 4M6AA 4X6CA 2R0LH 3C6LA 2UZXB 1CDBA 3QSKB 3KPRD 3WXVL 4PJ5A 2VXQL 3ZDYE 1NC4A 2GSGB 5DDHB 2GK0B 4K9EC 2XKSA 4OCWL 3HZMA 3FRUB 3BKYH 3UTZB 3QXAA 3ZT7A 4LOUD 2Y72A 2OTUA 4JRYE 4C56E 3MV11 4PRAB 3KPSD 5I19L 3O11B 2B39A 4LSVL 5T5NG 1EFXB 3TA3A 1XCQA 3N0PB 4KZDH 1N3NB 2K9UA 2P8PB 2LU7A 5BXFA 5FGBC 4NOFA 4BH7A 5DK3A 3FRPG 3ZSTA 4FABL 3GIVB 3V4PL 4HJ0D 4S2SB 5GS0C 2AABL 4Z7QE 4EUPA 1KC5L 5AAWA 5DHXB 3C60C 5IMOB 3IDGA 2QQQA 1T22B 1FN4B 1LE9A 1X5JA 4PJHE 1NEUA 4NKMA 1G9NC 3REWB 4R4BA 3TF7C 1KEGH 5DD0L 1ZGLP 1EO8L 4JFQB 3UCRA 2DQGL 2WWMD 2ZUWA 3WCYA 4EIZC 1Y18B 3GSNB 5DK2B 2FRGP 4B53A 4P2OC 3MRLA 4Z6AT 4M1DH 4ONGL 4I2XE 4KVCH 1AHWC 1P53A 4OLVL 3W39A 2I9TA 1A64A