2C1OA

Enaiihis fab fragment in the free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
ELVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGK-C PROTEIN
publication title Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA01
3H6JA 3RX8A 3SDDA 3X3FH 1JHKL 3JWDH 1H8SA 4OT1L 4QRQA 3FT2B 5GS0H 3B9KD 3U1SL 2F8OA 5FKPB 2LU7A 4KAQH 3VXRD 4WWID 3WXWH 1UM4L 5DJXB 2COQA 4EUPG 1LWRA 4WUUE 2DBLL 4N8CH 4TNWK 5EIIA 1KELH 1LVEA 5IIEB 3VGGA 1ZGLP 4IM8A 1UJ3C 4PJGF 5FGRA 3BKYH 3PWPD 4PUBL 5HGHB 3PL6D 4ZODA 1XGRB 1H15B 1ZANL 4P5TC 3TN0D 3O11A 4AZ8A 5DO2C 5CJBA 1ZLVH 3RAJH 3OKKB 2EIZB 1CXEA 3KXFB 3OB0H 1X7QB 4F7TA 5DEFA 1UQSB 3W0WA 3L5HA 4J3UA 5DMKB 1T03L 5D7IE 2C3HA 5T3ZL 4J4PA 3HNTH 3DV6A 5C0BD 3S35L 2ZCKH 5BZDA 4G42B 3HS0A 1UKQA 4L29B 4KTYA 1KC5L 2VXSL 4PRPD 2CPCA 4OF5A 2CDFB 1N59B 2BSSB 3QG7L 2XWJB 1RUKH 4QF1A 3B3IB 4U05A 2MMXA 2HJKA 5JMOC 4YHYB 4XVUC 3ZTJH 3A6BH 1CF8H 1RK1A 4RSVA 5LGKA 2FH6A 3VH8A 5FGCE 2BRQA 2C1OA 2R2HA 5IF0B 4JLRB 2C3VB 5C08B 4ZS7L 3FT3B 4FQXD 1HYSD 1MFEH 3A6OA 4I77L 1RUMH 4LLMB 3UYRL 4CU6A 5HJ3B 2ZWLT 2DJSA 3T0ED 4M43L 1G84A 4DN4L 1AGEB 1KEGL 5DZLA 3EKCA 3KJ6L 1JZ3A 2AJUL 4PRAB 1QLFB 3FQRA 4JFFA 4FQLL 5DMGC 5DFVC 3UZEA 3V6FA 3NCJH 1ZAGA 1SEQL 3RVXD 4MJ4A 1R5IA 2BNQB 5CEYA 3RTQC 4NQDE 4Y19A 1CFNB 1F58H 1XF1A 2UUDH 4PG9A 2OI9B 2XZAH 3F6IA 3RZCC 4P9ML 4XVTH 2LV4A 1CICB 5F9AC 4MMXC 4BSVB 2LU4A 3THMH 3ULUL 2XOTA 2R0LL 3HZYB 2XRAH 4D9RD 2NXYB 3LIZL 4UU9A 3ULSB 4BELD 5JW4N 2DLFH 1NGYB 5GHWH 3W9DB 1NCCH 4MNGA 2J88L 1OTSD 1Q9KB 4OFVA 3PJSB 3QIBA 1A21A 3JBG7 1NBVL 4J1UA 4AT6A 2FH8A 5HDBF 4KHTH 4CDHA 1J18A 2KBGA 3ZTJG 2FATH 3BP5A 1CI5A 5IJKA 3QRGL 2JELL 2FR4B 2ADIB 4GO6B 3TBTB 2XXMB 2CMRH 2VLJA 2RFXA 1QFOA 4ONFH 2B1HH 2VABB 4PJXA 2DQCL 3RY6C 3I84A 1JTPA 3MA7A 5IKCB 4OLXH 3FMGH 3TO4A 3KPQB 1RHHA 1W8NA 2V9QA 4XVSH 1DQML 5GRUH 4P2RB 5AYQA 5MENA 4YXLL 1E4WL 5ECJE 4PGBA 4WFGD 2B0SH 2ESVA 4YFEA 4XMPH 2VN7A 3IGAB 5EB9A 5D1QC 3IETA 4NUGL 2P8MB 4WO4D 5E2TH 1JWSB 2IPTL 4UINH 2MPAL 1MHEB 3KLSA 4F8TA 5BVJA 3GEWB 1VACB 2ZCHH 1HZHH 1MCOL 3ZKXB 5T33L 3LRSA 2BVQA 3WMSA 2HJLA 1SQ2N 15C8H 4O4YL 2KH2B 3BHBB 1DE4A 1HXMB 1S9VA 2NY2B 1VKXA 3F7YA 4X8JB 4PRBB 4L5FH 2HFFB 2P5WE 4ZYKB 3EFFB 2IALB 1FYTE 3T2OA 3O8XD 1UWEL 4NT6A 4XNMB 4Y5VB 3BIAX 2ZUSA 2ILLA 4X7CC 5D1XD 3DVIA 2UVEA 3KPSE 4D3CH 1FZOB 4KK8C 4XNQA 3AS3A 3H9SA 1AO7E 2DLIA 5IB4B 1UWXK 1OB1B 4KTDL 4AEEA 4XP6H 3WFEL 3N1QC 3SDYL 1DBKH 3BDYH 3RUGB 4NRXA 3HFML 5D2LA 4DN3L 5BMFH 2GITB 5M7QA 2AQ2A 3STLA 2BNUA 2YOCA 3T04D 2GK0B 3GMRB 3QNYB 4YNYA 3EO9H 2HRLA 2EIEA 1N3NB 5I9QC 4X6EA 3LSOA 3M45A 2DI7A 4XZUB 5HI3C 3DX6B 2ZKHL 3MROA 1GL4B 1EBPA 3CLFH 3RVWD 4K71B 3E1F1 1YMMA 4U4BA 2QJDA 3WL9B 5DMIL 5KJRH 1FNGB 3CFCL 3FN0H 2ADFL 1UJ3A 5F3HB 4KMTL 3ULUC 4WFHE 3IXAA 4S10A 1YYML 4LSQL 1KCLA 1RIVH 4OGYL 1IEAA 3VXSB 2YD6A 2YEZA 2C7UB 5DS8B 1FPTL 2HP4A 2EYTB 1L4IA 4CVXB 3DXAD 4JANB 1FVEB 5EZOH 4RGOH 1YEIH 4NC1C 1RZ7L 2PUQT 3I9GH 2G75A 4C59B 5SWZD 4NM4L 4XPGL 1CBVL 1ROWA 2Z8VC 1WWBX 1X5JA 3C8DA 1UKSA 2DQIL 3ALPA 1HDMB 1VFUA 2F58L 1EEQA 1BFOB 1K8IB 2PNDA 4YUEL 5H8DA 1RJCA 4NSKB 3UTSD 4ONGH 1NC4B 2BCKA 1KPRB 5F7LB 2XZCH 5CILL 2QQNL 2BHUA 4QY8A 3GRWA 4F15B 3D25A 2NQCA 5IBLC 3ZE1E 3R06A 5C8JB 3IF1A 4QHKJ 2VLME 3LS4H 5HVHC 1HKLL 5D8JH 5DURB 2J12B 1TVBA 1OPGH 4LPTA 2R8SL 4PJFE 1CGSH 4L4VB 3QCVL 4XP5L 3EJYD 4JY5L 5DMYA 2XZZA 4MVBD 4NNXA 1MF2L 3FL7A 3P11L 1MOEA 4ZUSB 1A7PL 4PJ5E 4HT1L 4ZUWB 3S6CA 2F74B 1KTKE 3EFDL 4JO4H 1S8DA 2EDKA 5ID0B 2OTUA 4HK3N 2MKLC 4NKDB 3KPNB 5KVGH 5EO9A 1QR1B 2GJ6A 1GC1L 3QZWA 4N0CC 7FABH 3PWVA 4Q0XH 3REWA 2R2BA 1VFOA 3DROB 5FA3A 1G6RA 1TQCB 1T80A 4NZRH 5ANME 3RZCA 2XPGB 4G6ML 5DD5H 1PG7W 5E99H 3MO1B 1OP9A 1A0QL 1S3KH 4HPYH 3QDGE 5DRXB 1A9EB 1XF3B 1QRNA 2PCPA 3MRMB 1AH1A 3KYNB 1RJYB 3T8XA 2OK0L 1CLZH 4JFPA 4W81A 3IU3A 2FJHB 3OKLB 5EIVA 1K85A 5E95B 3LD8C 3MR9A 1HINH 1R3KB 1IEBB 1A4JB 5BVPL 3VWKD 5JUEH 2DICA 3GJFA 5D7LD 4JFDE 5C86A 5KVFL 1XIWC 5IB2A 2OZ4L 4KZDH 1IC1A 5DUML 2VL4A 4X9IA 1PAMA 3RY6A 4PJAE 2RB8A 4M62H 4FTVE 1A6AB 2VJXA 1S5IL 5DQJA 4OGXL 4O02L 1U92A 5JDJA 1IAIH 1P7QB 4Y5XB 2A6JB 1CFBA 5FUOH 3RL2A 3CUPB 4Q9RL 3VE0A 4LVHC 4M1GH 1ZWIB 1C12A 2YS4A 3QXDB 4I18B 3QFJA 1MLBA 3E6FB 4RAUB 4UQ2A 5ITBH 2H2PC 2IQAA 1MSPA 5FYJL 1XGQA 4U3XA 5J6GA 1RK0A 1CVRA 4F58L 1NANH 1A7NH 2X4UB 4NHCH 3DGGB 2UWEB 3ZE0E 5H94A 5GRWA 1BFVL 2H2SD 1IGCH 1OAXL 4LCCC 4O2CB 1UENA 1PKQA 1LO4L 3QDAA 4KKAC 4AQ1B 3ECBB 2OMNA 3QEQD 1IILE 4WW1A 1I1FB 3MRLA 3SDXB 1RI8A 5JZ7C 2F54A 3V0WL 4XP1L 3FO0H 3RWGA 4OZGE 4XP4H 1TQBB 2O61A 4OLWL 5DD0L 1I9IL 3LY6A 1F4YH 4NHUA 1AR1D 2BC4B 4JHAH 2J8HA 3T2NH 4WW2B 1LEKA 1WBXA 1SMOA 1KCVL 4KJQD 1T22A 4JQXC 3MXWL 3MV9E 5DZNA 2JJVA 3QIWD 1RSFA 5EZLB 4Z7QF 4PG2C 1A6WL 1T7WA 4RGND 1WQVT 3O3UN 4I3SH 3VGBA 3PDOB 3S34L 4GRLC 4NCDA 2ICEA 1GC1C 4HIEA 5F1NB 3NFPA 4BZYA 1J1XH 3IRZA 4LLWA 5BRZD 3CFEB 4V2BA 5FB8A 2EC8A 3MRGB 3SDAA 1REIA 5CUSL 4U6YB 3T65B 4XT1C 5F1IA 1N7ML 4TRPH 4ODHL 4XVJH 4EQ3A 3G5YB 4K8RL 4CGTA 5C7XH 1MH5A 1YEEH 5F7FA 4EVNA 2VZSA 5MEPB 2YRLA 3ROLB 1JPSH 1F97A 3O3BB 4JPIB 1T83A 2JJWA 3HRPA 2LTQC 1XR8A 3AVEA 1OAUL 5DD6B 1MFCL 1JN6B 4KK6D 4OLYH 4W68A 3B8SA 8FABA 3GMLA 2WBJC 4MYWB 1IM3B 4OZFA 3U46A 3D1MC 4TQEL 1MVFA 4XTRC 2FO1A 3BUTA 1I3RA 5HHQB 3BAEH 5FGBC 3TBYB 2YD8A 3N1PC 1ORQB 5AG8A 2K9UA 5HHXH 1J05A 3U4BH 2KKQA 2ZG2A 3FO9A 4N0FB 2ID5A 5KSUB 1HQRA 4J3XA 3LKNA 3BP6A 5BV7L 3OKMA 1L9NA 2D03L 2VAJA 3W2DH 2HMIC 3R8BB 3UZQA 4RRPG 3QHTC 4ZG1A 5KS9E 4N90E 5D71L 4LPUA 1RQ5A 3HR5B 1EEYA 4OZ4A 4UB0L 2F53B 3NFSH 4NBYB 5JHDA 4XCCH 4GXVH 5IFAH 3OX8B 4XCFL 2V7NA 4PRHD 4PRDA 1SVZA 1T04A 4NO3B 5DJ2B 3QT2A 3EZ8A 2HTLD 1FL5A 4GW5A 1WZMA 5I66B 4OSUH 1D6EA 5DJDA 1FDLH 4UOJA 2IQ9L 3SKOB 3LEYH 3BW9A 5I1GL 4XXCC 1NFIA 1X9QA 3DVGA 4QRRB 2E7CA 1YEJH 2IH1A 3HUJF 2A9MH 4U6VL 3C9NB 4M7ZC 2E9JA 2DQGL 4ZSOB 4PJIB 3VXRE 3ROOB 1FO0L 3DX8A 2P5EB 2ZSVA 1W0YT 2VERN 3BRGC 2XN9A 5C0FB 4OCRH 4K07A 2DQDH 2OSLB 3PWPE 3DMMD 5F1KC 3V6BR 5TDPB 4O58H 4H20L 4L8SC 1A14H 2NNAA 5L2KB 5CJOH 1A3RH 3U30B 3P4MA 1IZKA 1IAOB 1XIWA 3OF6A 3QDMA 3PWJA 4HIJA 3HG1D 1KB9K 4YQXL 4HG4J 1I4FA 3AMKA 3DV6B 5HD8D 1AC0A 3FONA 3RHWF 2AXFA 5F9JB 3O4LA 3F5WA 2VR5A 4XB7A 4YDIL 5C0BE 2FX7L 5E94A 1S7TA 2E7MA 2YC1A 3E3QE 4PRPE 4LLQA 3QXAA 4WWKC 4U3HA 2WWKT 1SY6A 5FDYA 5IM7A 3NN8A 4IOFC 1DBAL 2XNAB 5I1AB 4K7PH 2CKNA 2R0KH 2XTJC 2NZ9C 2C1OB 4ZD3L 3RBSA 3P0YL 3TWCL 3G5XA 3UTTD 4Z5RB 2BVPB 5J8OA 4ZUTB 5GGSB 1KSRA 3VXMA 2CJUL 1ES0A 1MRFL 1UACH 3ARGA 4JQVC 4GAYA 5BXFA 3TBWA 2J2ZA 2DMCA 3TNNB 4ETYA 3HE7C 2VQ1B 1DQQB 3D9AL 4FQCH 2NX5D 2GI7A 3T0EE 4P2CG 1NEUA 4IRSB 2YHGA 5T5NG 3TVMB 3N1MC 4R90L 5LVEA 5DUPL 3K7UA 2XWBA 4JY4B 4AMKH 4OCSL 3X11B 1J5OH 1K4CB 1QO3B 4M93C 3KPRB 5EFIA 4OCXH 1BJ1J 3SQOL 1YMHB 4JQXA 5GS1C 5IW1A 1HH9B 4XH2A 3HC4H 4X7SH 1KOAA 3CZFB 2CR6A 1H8NA 1LK3L 3BO8A 2P42B 4PG2A 2X09A 1M6OA 1H5BC 5ICXA 1UADC 3MV7A 3TT3L 5A2JH 3O9WB 4BZ1L 2ITDB 4GRLA 3NFNB 5INDA 4PJDF 4AL8H 4S1QH 5L2JB 3G5VB 2X10A 1W0WB 2YBRB 4XI5D 4YGVB 2GTWA 4D9RE 1W72H 4M9PA 3LH2L 4WI4A 3VFUA 2YPLA 5T1KA 5C2UB 5CGYD 4NWUH 2PTTB 2NW3B 1MCBA 4J6RL 1CLYH 1JMXA 2VXQL 3KDMA 5I1HH 1QYGH 4JZOA 3EYOB 5KTEL 3RI5F 4HG4K 1QSEA 4K3EH 1I7RB 1PY4A 1JNHA 1AD0B 3U7WH 1KXVC 4Z95H 4XHJC 3EO0B 1CE6A 1Y6KR 4H25B 2LABA 1IC5H 5DXWA 2EEBA 3AMLA 2APVA 3QEHA 1PFCA 4K9EC 2MCG1 3RL1B 3MA7B 5B4MC 4YHLH 2W65B 1KF9B 5IVXF 1RHHB 4JFEB 3TO4B 1QBML 3BXNA 5ADPL 4JFOA 4G3YH 1PG7H 1T0PB 1YDPB 3O41B 1MAMH 2SEBB 5TQ0H 4GQ9H 1RU9L 1X5ZA 1GYAA 1BEYH 4PGBB 1DVFC 4DW2H 1BP3B 1XCQA 4R4NC 1WCBA 2P47B 2VDKL 2VLKE 3MJ7B 4RMUA 1LO2L 4PGJA 3LV3B 4WFGE 3FQUB 5ABDE 5C0AA 4ZFOB 4MJ2A 1JYNA 1A6VL 5E4IA 3SDDD 2NY6C 1R0AH 1U95B 3TPKA 1JE6A 1IRAY 4HGWA 5BCAA 4N1CA 3O81A 2DI8A 4UI2A 3FOMB 4M7LT 1KT2B 1SJHA 3A67H 5IR1B 2JLLA 4LCUA 4QHLB 4WV1B 4NQUA 4XNUL 3LDBB 5CBAA 1SBBA 4G6FB 4ZXBA 5GGTL 3MFFB 2BSTA 3MJ6A 3K8LA 3WFHB 3CFIC 5GGSY 1U8IA 4A6YH 2A6DA 4BQ8A 1R3JA 4IJ3B 5GGQL 3MOAH 1QNZL 1WEJH 3QYCA 5I17B 1TZGL 2VZOA 4HC1H 2NY0D 4Z7UF 4X6EB 3H9HB 3QA3B 1KYOJ 1JUFB 2GFBA 5EBGA 3WUWB 2YN3A 4JKPH 4WHTA 2R9HD 4XXCA 5JLZA 3BT2L 2AV7B 5DWUH 4R0LC 3W39A 3MOBL 2DTML 3GSUB 5D2LF 4PB0H 3CXHJ 5FO8B 1UJ3B 4IDJH 4LCWB 4WI7A 3G6JB 1QFHA 3FCTB 4R4BB 1B88A 3WJJC 4M5YH 2CUMA 4P5TB 2QKIB 1JF6A 3BD4A 1CWVA 4Q6YA 4AM0B 5EOCH 4LQFL 1LE9B 4UT7L 1ZV5A 4L8SA 1ZS8A 3VD5A 4JM2C 1NMAL 1UXSA 2K3TA 1DN0A 1FG2A 4K3JL 3DXAE 4KK5D 4JO3H 2VH5H 4DVBA 5AEAA 3WN5C 5SWZE 2A2QT 3FAWA 3ZKNC 1G7HB 1RY7B 5ESVB 3S98A 1S9KC 3HMXH 1KJMA 1CYGA 1QRKA 3K81A 3X3FL 5IJVB 3RWCB 1RUAH 3HKFA 4GXUN 3S7GA 5GS0L 4OFYD 1OAYH 5K59F 1NGPH 3U0PB 3UTSE 3WXWL 3FQWA 4BKLB 2X4QA 3VGFA 4V2CB 2W0KA 3C6SA 4N8CL 1HIML 4XC1H 1KELL 3BKCH 1AXSA 2A83A 3VFSA 3BWUC 1MWAH 3V8CA 3L3IA 1NFDF 3IDGA 1X5LA 2X4OA 3BKYL 3MRHB 5HVGB 4QRTA 1WBZB 3EJZC 3C5ZD 3P3YA 4YHMH 4P46B 1LNUB 5HDBE 2ARWA 1Q8MA 4Z7VB 4JQVA 4P99A 4YZFF 4G7YH 3LEVH 3NCCB 3HE7A 3GMQB 1S8DB 4QRPA 5EDXA 3RAJL 1OF2A 4BUHA 1T21A 1K5NB 3KPLB 5GS3A 5EO9B 5FM5M 4M6AA 2JCCF 3RTQB 5LQBH 1KCKA 1ZGLB 4XGZA 2H32A 3HNTL 5C0CE 5GS1A 2ZCKL 1KXTB 1OD9A 1IARB 5EUOB 3RZCB 5IVNA 4S1DD 4EIZC 3VXPB 1XF2A 4ODVH 1NAKL 5D5MF 1JPFA 3DRTB 5CP7B 4TUJA 3D39B 3DETC 4OBSA 3OG6B 4KPHH 3D3VB 4X6FA 4RCAA 1M05B 3A6BL 2ESVD 3M1BB 4JFPB 1KB5H 4P3DB 3HTLX 2PO6C 3RWJB 5A40E 5JPNB 4XCYA 4IIQC 3H0TB 5EO1A 3FOLA 2K7QA 2P24A 2X44D 1MFEL 4HSQA 1RUML 1NUDA 1BQLL 1F3JB 1IGYB 1I3GH 1FGNH 3BJ91 4JAMB 4PIRF 4R3SB 5D7LE 3TM6A 2HLAA 4W4NA 4C56D 5DQJB 1C5BH 4I0PB 2QHLA 4QOKE 2FJFA 5I19H 3NCJL 1NDGB 2RGSA 2EKSB 4P4KC 1A3LH 4HX1B 1NGXA 4E41B 1CCZA 4TTDD 3VXNB 4N0UA 1DVFA 5KOVC 1F58L 1NUFA 4TTGA 4B7IA 1MLBB 2XZAL 4LLDB 3WHXB 3D0LB 3TZVD 4PTTB 5D1QB 4XVTL 1BIIB 3FQTA 3QULB 1HHIA 3THML 2IAND 1K6QH 3DO7B 1UWGH 4X9GA 4X6CE 2XRAL 2OJZH 1MHHA 1BVLB 3QUKB 5H94B 5GHWL 3JWDC 3OR7A 5A43C 4F3FA 5GS0C 3GSRA 4JCMA 1PZ5B 3QR2A 3ZDXF 2YSSB 4MD4A 5IB5A 3U36A 3VI3F 2ATPB 2X41A 4S1SH 4KKCD 3MV11 2F54B 4KHTL 4OLZH 4UDUA 5IEHA 2FATL 2F9BT 4G6AC 1I1CA 3QEQE 1RFDH 4GRWH 2GT9A 4TSBH 1ZA3A 1P4BH 2CMRL 5I74C 3U4AA 1C08B 5DK2A 4FN0A 3C6LA 4ONFL 2B1HL 3UPAA 1F42A 3NZ8A 5EU6E 3IJSB 4EKXA 5IHBA 4OLXL 3FMGL 2NY7H 4X9BA 4XVSL 5GRUL 5I9QB 3NAAH 4GKZB 2NY4C 3IRPX 3KHQA 4XCEA 4YBQD 4YDJB 5DVOA 5CP3A 2B0SL 3LKRB 2WM0A 4XMPL 1U8OB 4M61A 4HJ0C 4AYFA 2V9TA 5MEQA 4R0LA 5E2TL 4EQ2A 4DCQA 4EN3D 1QVOA 3GSNA 4HS3B 5FB8B 4GG6A 2ZCHL 5E56A 5ISZB 4P2OC 1HZHL 3E6HB 15C8L 1U8QA 1XCTA 2EIBA 4GKSB 3QUML 3TBVB 3DRQA 3TIEB 5CD3A 4HWUA 4L5FL 1KGCD 3HB3C 1G9EA 4PRIB 4KJWD 1U8KA 2EC9T 4G43A 4LIQH 2RJMA 4UDTA 4M9OA 4OCWL 3W5MA 4D3CL 3H7BB 5C0DB 3CDGB 3B2UD 2R0WH 3AU1B 4JM2A 2CO6B 4L9LC 3MUY1 2NLJB 2D4DA 4XP6L 4MNHB 1DBKL 4Y5YC 5IBUB 2F5AL 1P9MA 3WDJA 5BS0B 5BMFL 4NBXB 1U6AH 2PW2B 4OAWA 1S9YA 2APWA 2AEIT 2B2XH 1EIBA 4NQVA 3VRJB 1N6QH 3PIQA 3EO9L 1J05B 5C9JB 2ZUYA 4L8DA 4XAWH 3QPQD 3G9VA 2MQCA 2AJYH 4HS6A 2R4SH 2Q7YA 3LKNB 4APQA 4PFEA 1NAMH 2DMBA 3CLFL 5I15H 3OMZA 1S7XB 3OKEB 3OKDB 3MRQA 2QADD 2ZUQB 3HAEH 5E4EB 5L8LB 1FGVH 3T0VA 3V6OC 5EOTA 1WWCA 2Q7NA 2AEPH 5HVHB 5KJRL 3RIFF 3FN0L 1G9NC 1DSFH 3BH9B 3PGCB 3IDNB 5CMAA 4WEBH 4L4TA 5CIPB 1CR9H 2EZ0D 4OZ4B 1IL1A 2Y1VA 3RWIA 1AGCA 2VDNH 3QUZD 2FIRT 1YYLH 2V7NB 1OWWA 3UEZA 5EZOL 5DA0B 5IEKB 4RGOL 1YEIL 4X5WA 1JWMB 3DSNA 2XYCA 1D6EB 4J7RA 2YPVH 1U8HB 1ADQH 3KLAB 3ES6A 4P57A 1OTTD 1SMAA 4I0CC 2W60B 3VXUB 4ONGL 3K46A 2CDGA 2E8YA 4N1HB 1AP2A 5IUSA 2WIMA 4NQEA 1EBAA 3UP1A 3BPCA 2W92A 2W0FB 2HVJA 1J8HB 2J5LC 4CU7A 4WTXA 1ZT1B 2AQ3A 4HEME 5J7CC 4OI7A 3RU8H 4OZIF 3LS5H 2OL3A 2VQUA 3LD8B 4IIQA 3LS4L 4X9FA 5D8JL 3S4SA 1A1OB 1MI5D 1OPGL 5KSAA 1KEMH 3HI1B 4KZEH 1CGSL 2C4FT 4M6NH 2DQHH 3HAEG 2R1WA 4PY8I 3FRPG 3BP4A 1CXFA 2IPUG 4D2NA 5F93C 3RGVB 5F96L 2VDOH 4MQXC 1F8TL 4JO4L 1MJUH 2YWYA 3HG1E 4P4KA 3F12B 3IFOA 1YPZA 3WIHA 3H8NA 4L8CB 1RPQA 2H6PB 1FIGL 1KPVA 4LVHB 4ZO9A 3LPFA 4AEIH 4Q0XL 4Z7QE 3EYQD 4LLQB 2R1YA 5F7DB 2XWTB 3DVFA 5IM7B 3T77B 4MAYB 4NZRL 2WBKA 1HHGB 3NN8B 4JRXA 3S3SA 4L3AA 1T1ZA 4M1CC 2Q3ZA 4HCRA 1JGVH 4AENB 5GRXG 5E99L 5SWQA 4F8QA 4HUWB 4NN7C 1Y0LA 3VW3H 1S3KL 4HPYL 3OXSB 2X1XR 3K2MC 5C0IA 3QO1A 3EYFB 1CLOH 1YA5A 4RFEA 4RX4A 4LCCB 3TA3D 4MQTB 1CLZL 1JGEB 2HKFH 2OTWB 5GSRA 4ORZC 1GGIH 1NGWA 4C54A 3UTTE 2GJJA 2Z92B 3L3JA 4F33B 1HINL 3RWEA 3SDAD 2BVUA 4EI5C 3KVQA 3CSGA 3KG5A 3WNOA 4PRNA 1PQZB 3MYJB 1MCLA 2WV3A 3ARUA 2NX5E 4JDZB 4KZDL 4YGAB 1PEWA 3WFZA 2FIKB 4LCIH 4M62L 5FA4A 3OJDA 5J12C 4WI5A 2FGWH 4MD0B 1BQHG 3VWJC 1AD9A 1IAIL 3OL2A 4U0RC 3IDMB 5TE7H 1RVFH 4ETQB 3C09B 5FUOL 3CD4A 2Q8AH 1HSAA 3TNMA 1GSMA 1YEGH 2GSGB 3KJ4B 4M1GL 3TBSA 1S9XB 4AQOA 1SJEB 3LOWA 1KIRB 5ITBL 3HE6A 5SX5K 3KPOA 4Z6AT 1OSPH 2GTWB 4LVEA 5JW5B 3IVKA 3SY0A 5DMJB 2Z91A 3SCMA 4P2OA 4D8PA 4WNQB 3BQUC 5JQ6H 1A7NL 2FEEI 2FLRT 4ZO6A 2X4PA 4NHCL 2I9LA 5DRZA 3WKMH 1HI6A 2R2EB 3PP3K 3B2VH 4ZAKA 5E9DB 1PJ9A 3CC5B 1IGCL 3KXFD 4JPVH 4RMRA 4WI3A 1D9KA 4WTZG 3CNKA 1J0HA 3RNQB 4ELMA 5CBEB 5CCKH 3GM0A 1A2YA 3ZT6A 1A64A 5F88A 1FFOA 3RVTC 1A6ZB 1Z9OA 1ND0A 3CPLA 4F9PC 2G5BB 1CDBA 1CFSA 3BXNB 5I2IA 3FO0L 2OBGA 4XP4L 5T3XH 1JK8A 5KSVA 5MERB 1F4YL 5AUMA 4HWNA 4L9LA 2WBJB 4AIXA 3T2NL 4UT6H 1YY8A 4Y5YA 3QJFB 1HYRC 3TC9A 1MAJA 3VRIA 1FV1B 1XF5B 4PGDA 1WGOA 1WCBB 3GKZA 3IS0X 4MLIA 5CLWA 5DYOA 2G2RA 3MRPA 4YDVB 4G8EA 5I76B 1DLHB 3GBMH 3FO1B 5C08D 4I3SL 2GUOB 5DJ6A 3QI9C 3LB6D 4KKBC 4KGLA 4GW4B 1WLHA 4KDWA 1ZLVK 1KJ2H 4N0YH 1J1XL 5IMLB 1FZMA 1S7VB 4GJTB 3TYFA 5F7NC 5CSBA 3OB0K 2W9EH 2ENYA 1AFVH 1N4XH 5HDOA 3ARDC 3QQ3A 1RZ8B 4WUUA 4AY0A 2CRYA 5JW4R 3K4AA 4TRPL 2V5MA 4XVJL 1NQBA 3MRDA 5C7XL 2GAZA 1YEEL 3MLWH 4LDOB 2BNQD 5ID1A 1MHCB 1HWGB 4UTAH 1JPSL 4UOW0 1FORL 5D1ZA 2XN9D 4EIGB 1CICD 1U8JB 2PXYC 3SO3B 4BK4A 4OLYL 4U1LB 4BA8A 2D31B 2H1PH 4IHOA 5CJQH 3JV0A 4CW1A 3R0MA 4FNLH 4ZNEA 3SOBL 3BAEL 5D7IA 4X6DB 3RWFA 4P23C 3DYPA 1ITBB 1MJJA 5HHXL 3U4BL 4FQIH 3LQAC 2NY1D 4J3SA 1BREA 1I8MB 1NEZB 3NACL 4TUOB 1N5AB 1Q94B 3PP4H 1ACYH 3VCLB 3GMNA 4GUPA 5K9QG 3W2DL 1S78D 2DOCA 2AVGA 2MSPA 1TCRB 2Z35B 3K4DA 1RZIB 1WFUA 4X7DC 2FGZA 3ILPB 5IK3A 2UUDK 4HUNB 1ZLUH 2QBWA 3FO2A 4F7MB 2MKWA 1EX0A 1G7JB 5HYFA 4KKLC 3WYRA 3NCYP 3I6LD 3NFSL 4XCCL 4GXVL 5IFAL 2EO1A 4EXPX 1F4AA 4J8RB 3UJJL 1XF4B 2E3VA 4NFDA 1F6FB 1WITA 3NCYS 3RWDA 4OSUL 2I9TA 3V79C 2D0HA 2VWEE 1FDLL 1FFPA 2WWKO 3B5TA 4WWKB 5AZEH 3LEYL 1II4E 1ULVA 2BY0A 4PJDE 4XRCB 5L7XH 2XT1B 1BD2D 1JTOA 4NCC1 2HLFC 5JW4Q 1JYXA 4X9HA 3F7VA 2X89A 3IDGB 5IW6A 3OKNA 3L7EA 3MV7D 1F6AA 1HCVA 3MMEA 2XG4A 3ARXA 1M7DA 4GRMB 4OCRL 1P1ZA 5BV7B 2DQDL 4ZPVB 1NC2B 3NCEB 4JFZH 1ZOXA 1I75A 2BDNH 2PTVA 4BH8A 4O58L 4MXQD 2X4NA 4PP1C 5E8OA 4BFIB 1A14L 3MRRA 5SX4I 1IEHA 5CJOL 1A3RL 4DTGL 4LLYB 5IVXE 5DVLA 3B9AA 3QCTH 3WEXB 5C6PB 2VO5A 4M93B 1QSED 2V5YA 1I8KB 1ORSB 1R5WA 4RAHA 5GS1B 5ICYB 1RZJC 2BVEA 4JHBA 4PP2A 2BOBB 3K1KC 4ODWA 2EDYA 1NDMB 4YBLC 1H5BB 1C5DA 2B5IC 5T1LA 4Z78B 3AY4A 4TUJB 2Y5TA 3CFDA 1JGUH 1WCQA 2RIKA 5J1AA 3T4AB 1JV5B 3NTCH 2UWEF 3BH8A 4EBQH 3L3KB 4M03A 1TJGH 1WICA 3S5LG 2AJSH 2J8UB 5IFJA 4K7PL 3KYAA 4FFVC 2H3NA 3MRIA 2R0KL 1UVQA 3M17A 1MCIA 3L9RB 1T5WA 3BQUA 3T08A 3QXUA 1JCKA 3BRFA 3OG4B 5BW7C 3NPZB 3AREC 4PJEB 4ZUUB 1FO0B 3QUXC 1UACL 1A7BA 5HYSA 1T3FB 1F11B 1E28B 4KMLB 4WW2F 5HYJA 4FQCL 1AC6A 3LQMA 1A22B 1FYTA 4F9PA 1S5HA 4Z77A 4DKFH 4OV5A 5FEBA 5FECB 3T3PF 3E8UL 3KPSA 3EAKA 4AMKL 4B41A 4C56E 4N0UB 4UILH 1J5OL 2ZUTA 3O45A 4AH2B 4OCXL 1AO7A 4HKBB 1QBBA 4Z7UE 4YAQB 3V5KA 5EU4A 5FYLD 3B5GA 4JDTH 3GMMA 5D72H 1QFWI 3HC4L 4RISH 1CD9B 1U93B 4WU5A 4X7SL 3ZYZA 4IMKC 4FHBD 2DYPB 1UB5A 2MHAB 5DURD 4M8QB 4M3KB 4S1QL 3WE6B 2IANE 2NY6B 1UJTA 1CT8B 5E6ZA 3BZ4B 1W72L 1OCWH 3IDIA 3QWOA 4GLRH 4NWUL 3MCKB 3ARDA 1UG9A 1CLYL 2LFGA 1BECA 3ZHLA 5DJCB 5I1HL 1QYGL 1KG0A 2BJMH 4K3EL 4WU7A 1T2XA 4HUXA 1ZA3B 5CEZD 3U7WL 3LN9A 4Z95L 3KLHC 3ULVD 1IC5L 3W5NA 1FNSH 1JI2A 4Q7DA 3GJEB 4B0MM 1NLBH 4KUZH 2CLRA 4YHLL 3HN3A 1G7MB 1C7TA 2APXA 2EDOA 5FK9A 4G3YL 1PG7L 2M26A 4X99A 2X42A 4JPKH 1MQ8A 1MAML 3DV4A 5TQ0L 4GQ9L 5ENWA 1OY3B 1RZGB 5D6CA 1F4HA 1WTLA 1GGBH 2VZ1A 1I1AB 1TMCB 4U7KA 5D6DC 4R0LB 4MJIB 5K59E 2VZVA 2IAMB 2D7TH 5TDNB 5IB1B 1T4KB 3EDFA 4QTHA 5HPMB 3WLBA 1U8QB 5CJ5A 4A2MA 1H0DA 1NFDE 3ELAT 5CD3B 1R0AL 3D5OF 3WJLA 4UQ3B 4F7EB 1E4KA 4NRZA 2JB6B 4U1HA 3FZUC 4PJBE 5K9OA 4YO0A 4OZHF 4HK3J 4CL7A 1ZKAA 3C8KA 2GY7B 4UDTB 2DQFB 4MCZB 1N8ZA 1F3RB 1B3JA 1D5BA 1WV7T 3I02A 3NIFF 1AGFA 3KR3H 3CFJA 3VD7A 4PTUB 1ZA6A 4PJFA 3P9LA 2WUCH 1N2RB 5JO5B 1P2CB 4HXAH 4Y4FC 3HZMA 4OAWB 4A6YL 1L6XA 3WSQH 2I07B 3WN5B 4I13B 4QHNB 5HXMA 3MV8B 2P7TA 3MOAL 4PJ5A 1WEJL 1YECH 4QRUB 4H26B 3LEXB 2WAHA 4HC1L 4MX7B 1IQDA 1FJ1A 2YA0A 4PJIF 4S2SB 3Q5YA 5B38G 1WWWX 3OWEA 2YKLH 5D5ME 1CN4A 1EEUA 4JKPL 1QSFB 3BE1H 2R2CA 5DWUL 1P84J 2EXYD 3HI6H 1R3HA 3U4EB 5ANMA 3I6KA 1BBDH 4PB0L 2CKBA 1JP5A 3S96A 3QHFH 1TNMA 1URLA 3B9KC 1HHHA 3OHXA 1U3YA 3QDJE 3QDGA 5TPWH 1DBMH 4M5YL 1MRCH 2NY3D 4E0RA 1IGTA 2A77H 4YDKH 2CDEB 2KUTA 4YHZH 3EOBB 3VFRB 4R97C 2GTZB 3PHSA 2XY2A 5EOCL 1GPOH 3GSXA 3UBXI 2IPKA 4W70A 2X4TA 2WMPA 3HC0B 4CNIB 5IHLB 2Q3AA 3MNZA 4U6TA 3PL6C 4YHPA 1OP5H 1JZ6A 2X4RB 3U82B 3QUYC 2FBJH 3VI4F 1UM5H 3TN0C 5K9JH 4JO3L 2VH5L 4R7NB 5JORA 3FB5A 5CKAA 2VRAA 3R1GH 4HDIA 4K7FA 2BY2A 3L95B 4PJAA 1HH6B 2CLVB 1E27A 3QBTB 4D0BA 3HMXL 4FTVA 4RMSA 1B9ZA 2CDGB 1L0YA 1NBQA 4EUPB 1RUAL 4QO1A 1OAYL 1NGPL 4P2QB 2DDQH 5DRWB 5E8DH 1B4RA 5FO7B 1KN2H 4XC1L 5I8CA 2PO6B 3BKCL 5DI8A 1MWAL 2BNRB 3ZDXE 4G8IA 2VUOA 3VI3E 3AREA 4YHML 2E7BA 5BJTB 2HFTA 4RGMC 1BZ7B 1KNOB 2VZ3A 3MJGX 3VXOA 4QWWD 5DJZA 4G7YL 1MI5E 5SWSD 4QKXB 1CTNA 1Q72H 1IFHH 1KCRH 5FYJU 4FQXC 1HYSC 4DGYL 2XKNB 2DJUA 3BZFA 1B0GB 3MNVB 1NCAH 3T0EC 1EVTC 2MQ0A 4FZ8H 3RVUD 2FRGP 4DWHA 3RNKB 5LQBL 4FFYH 4U1NB 2H8PA 4OZGA 2E9WA 4LVNB 4O5LH 5EA0H 3OJVC 1ZHBB 4PBXA 1CL7I 1XGUB 1A7OH 5I8OH 4ODVL 4IMKA 4POYA 3MYZA 3MA9H 3MV9A 3PV6A 4OIAA 4LNRA 1A02N 5C0IB 5CSGA 3GBNH 1DQLH 4TVPD 2E9IA 4QYOA 3A6CH 5GJSH 4RFEB 3CMOH 2ATKA 5A2IH 4HUUB 4KPHL 1G6RH 3H2WA 1I85C 3L3DB 1KB5L 3ETBF 4DZBA 4PY7B 4JO2H 3UCRA 1NGZA 1Q9WA 4PJCB 4LFHD 4IEFB 4JFXB 4NKMA 5FKAB 3DX9B 3MNWB 2LU3A 1V5JA 5A2KH 3DO3A 1OTSC 4OF0A 2FL5A 5I74B 3LHPH 1JPGB 1FRGH 1I3GL 3EO1A 1FGNL 3MRJB 2DWDA 4TUKH 1FVCB 5F7KC 1GGCH 5C6TH 4QRRD 1WFOA 3SDCB 1C5BL 4OKVB 5I19L 1D3CA 1AD9B 5ESQB 3EW3B 1CIDA 4G9DA 3GJFH 1A3LL 1YQVH 4PGEB 2MCPL 1ED3A 3VFNB 2NY4B 3CX5J 1U3ZA 2P5ED 5DHYA 1BFSA 4LLVB 4RMQA 3ZDZE 4R9HA 4F2MA 5IVOA 1FN4B 5D6DA 3GSVB 5EBLA 3PXJA 1K6QL 3DUUA 2DKMA 1U8NA 3IXTA 1UWGL 3LAFA 4RQQB 3L5IA 2OJZL 3PXHA 2OCFD 4PJHB 1EAPB 2Z93B 5L2KD 4RZCB 2PETA 3GSOB 3TV3H 4APQD 4LEXH 1EXUB 1BLNA 2Q76B 4OV6F 3LN5B 4TOYL 4Y2OA 3HMWH 9CGTA 3KXFE 4S1SL 1OM3H 1ND0B 3SE9H 3K8KA 3CPLB 3LVEA 4MCYB 4ZFZA 4YHKH 4OLZL 4KJPD 4UNTA 5A16A 1CGVA 4QNPF 1LO0H 1RFDL 3CSYB 4TSBL 5J9PB 1I7TB 5KS9A 4Y5YB 2QQKH 4Y4FA 5HHNB 1I7UB 4OB5H 5I1JH 4YWGH 5IG7B 1LHZA 2NY7L 2VISB 5MI0B 3CDFA 3PABA 2VN4A 5HYIA 2RHEA 3T4YA 5KG9B 3KWWB 3G6JF 3P0GB 1UB6A 3JV6B 3V5HA 3MPCA 4FQQA 4L1DA 4UAOC 2XACC 5IHUL 1K8DA 2C9AA 5C08E 2HG5A 5DUBA 5C09B 1T1YB 4K7PX 5C0EA 4X5XA 1ZLWK 2OP4H 2XXCB 3DUSA 4ODXA 3B9KA 4CDGC 4GKOA 3PQYB 3TVMD 3VXRA 2GAZB 2L0DA 3RVWC 3KPRD 1CGTA 4F37K 2YUZA 4LIQL 4P5KB 2BNQE 1HN1A 4OCMC 5T1MA 3PWPA 4UIMB 5EUKA 1K3ZA 1BOGB 4ZQKB 3NPSC 3PL6A 4YR6A 1BPVA 5I1EH 4BSJA 4HFUL 3O9WD 3KPTA 3TN0A 1BJ8A 3FTGB 4HMCA 4IHOB 1JL8A 1U6AL 1JMZA 5CKGA 5J3HD 4FG6C 2B2XL 3S8WA 1KTDA 4MJ5B 2FNBA 4NJ9H 1SEBA 5LWYL 1G7LA 4L3EB 3PWLA 3AAZA 1N6QL 1AQDA 4U6HB 3RPIA 3JUYA 4XAWL 1T5XB 3TLRA 1MCKA 2AJYL 2X6MA 4XNXL 3MJ8A 4OZFH 1VFAA 5C0BA 3RY5A 1NAML 1DP0A 1P7KB 3AM8A 3X13A 3DYMA 5I15L 2J5LB 1V7MH 2X40A 4PRPA 1FGVL 4MS8D 4Z7VF 2V5SA 2AEPL 1SM3H 1CXIA 3I75B 2ZPKH 1DSFL 4JFED 5EPMA 4E5XA 5HI5D 5LGHH 3V52H 1CE1H 1HOCB 4GKNB 4WEBL 4Y88A 1KN4H 5E1HB 5EWIH 5BO1H 3FFCB 2X7LB 4JRWA 4NNYA 3DBXA 1CR9L 3QUMB 3MLRH 1BMGA 4GG8A 3MRBA 4KTEH 1X4XA 2VDNL 1BM3L 1YYLL 4LOUD 2EKJA 4NCC2 3V9FA 5AD0A 2ADJA 3BMVA 2HJFA 5EUOF 4NM8L 1YZZA 4FXGA 4YXKL 5E6IA 3I6LE 2W59A 4M02A 4PY8J 3FFDB 3T0EA 2I24N 3EOAB 3EJYC 1S7SB 1R3LA 4MVBC 2YPVL 1FLRH 1ZVSB 3JTTA 5BZWA 1ADQL 4OQ1A 3F6LA 4A6YA 3NCFB 2XQBH 4ISVA 4HWEH 4HKZB 4Z0XB 4NN7B 1ZEAH 5CWSA 5E24E 5MHSE 1GJIA 5LGJA 4HF5H 4ODBD 1VEOA 5IMMA 5B39A 1P53A 5DVMA 3W81A 4MDIA 2EE3A 3ZL4H 3SGJC 4LSSH 1DJSA 5HY9B 1BX2A 1TENA 3HE6D 4G6FD 3RU8L 4OZFG 1HK6A 2EDFA 5GGRA 2YUWA 5GRJH 2YD7A 4G8GB 2OQJA 3MJ9A 1KEML 3SGDH 4EI5B 2IF7A 2ITCA 3RUGE 4KKNA 4BM7A 4YHNA 2DQHL 4NO0D 4U7MA 3S97C 3FRUB 5GZOD 4ZAKD 1LDPH 4I9WD 3WS3A 2AXGA 3UBXB 2VDOL 2XI9A 5J12B 1K2DA 3VWJB 1MJUL 5D7KD 3VWKC 1T7YA 2PYEB 3OJMB 2I25N 4HKJA 4HZAA 4LRIC 3UC0H 4CADB 1FVDA 4OJFH 1Q9OB 4JFYB 5F3BA 1PDKA 3MACL 4AEIL 4OGZA 4K23L 5EU3A 1UH3A 4RFNC 4U3CA 1AGBB 3BH8B 2P8PA 3GI8H 5IMOB 2FJGA 4JB9H 4P5TD 4PD4J 4XAKD 5I1DB 5J6HA 1T66D 1JGVL 2EYRA 4OUUA 4U1KB 3M17B 3RWHB 3BQUB 3X12A 2HN7A 2VXTL 3C08H 5L8JB 4JR9H 5DFWH 2WP3T 5IMKA 1CLOL 5D2NC 3VXSE 4D0CB 3IJYA 3OV6A 4Y0GA 1SY6H 1UZ6F 5ERWB 4WO4A 2HKFL 3Q2CA 1CFQB 3VFWA 2HVKA 5DR5H 4PV9A 1RUQH 2E6PA 4MMZC 5HYJB 4ZOAA 1VFBB 1WBYB 2LAGB 1TZIB 3D2UB 4HFWA 2CLZA 5F44A 5HHPB 1KCUH 2H2SC 5CEXB 4IRZH 3QG6B 3BD3A 4XBGA 2IG2H 4X4YA 1DUYB 1P6FA 4JFQB 3FHQA 1M71A 1MFBL 5E8EA 3O8XA 4F57H 4LCIL 5EU4B 4ZDHA 2P8LA 5D1XA 2FGWL 3VD3A 4AG4H 4LARH 4RNRA 5TE7L 1RVFL 4P4RB 1Q1JH 1DL7H 2Q8AL 4RWHA 1AR1C 1YEGL 5IVZA 3QI9B 3ULUF 3MRNB 1FYHB 5KANG 4KJQC 4P46D 4PJ8D 4L4JA 3H3PH 3TPUA 1KFAL 2VE6B 1OSPL 3QIWC 3IDIB 4MA8H 2AV1B 3ARBB 3NIDF 4L4VE 4X98A 3ARDB 4RGNC 2FECL 2CIKA 4KXZH 2EXWD 2OTPA 1MIEH 3LKOA 5EU7E 3WKML 3B2VL 5I1CH 5IROC 4JPVL 2NR6D 1IQWH 5CCKL 1KLUB 3DIFA 1BJ1H 1MHPH 4R2GC 1HHJB 2WINB 4LKXB 4JKLA 3MFGB 2RBLA 3EUUA 2PXYB 3AFLA 2A6IA 3VFMA 3B6SA 3L3GA 3VGEA 3IU4H 3BRDA 5T3XL 3DV4B 3F62A 1UEYA 2DWEA 5KSBB 3KS0J 4UT6L 5D6CB 2JTDA 4MSWA 3D39D 4BYHA 3KYMA 1XGTA 3CVHA 2BSRB 2JJSC 1VGEH 3DXAA 5I30H 3B8YA 4P23B 4KK6C 3GBML 1L9MA 1T0NA 4LEOA 3G04A 5SWZA 1YUHA 4AJ0A 3WNPA 5E1AA 1KJ2L 1TTGA 4N0YL 1JTTA 2YR3A 3QNZB 3UTSA 1YEKH 2W9EL 4NQDD 1AFVL 1N4XL 1OARH 5DDHA 2X4SB 4I0PD 1N8ZB 1D5BB 3I02B 4MD5A 3BEWB 3MLWL 4Z7WB 3ZT5A 4NUJA 3WCYA 4UTAL 4XXDA 4HAFA 1OAKH 4QHMA 2LVCA 1U8PA 1INQB 2ZZUT 5D1QD 4RFOH 1KIQB 2IH3B 4PJ5B 1J12A 4FQ2H 2DD8L 4GMSH 4ORGA 1I9RL 4HQQH 4EDXB 1FHGA 3EOTL 3ZE1F 2H1PL 5FYLH 3LRGA 5CJQL 2YXMA 4BQ6A 1XGPA 1FFNB 4FNLL 2YUVA 5EO0A 4LHUB 1FL6A 2UWEE 4BSWA 1OGAB 2HTLC 5C0CA 4FQIL 5GGUA 2ZOLA 2Q86B 1FZKA 3G5ZB 1P4IH 1X5GA 4KK8D 2XFXB 1HHHB 2AK1H 4KVNH 5I6XB 4W4OC 3SGJA 2APFA 4FOMA 3PP4L 3B9VA 1ACYL 3SDXE 2NXZD 1IGTB 1QD0A 5C0JB 4UV7H 4Y16D 3T2PA 5C9KA 1NBYB 1KULA 5B8CA 3SJVD 4PR5B 4LU5H 5JOFB 5ETUA 5CEZH 3MNZB 2P49B 5D7JC 3ULVH 2ICWB 4N5ED 3DMMC 3T3PE 3FB5B 3QXWA 2A74B 3D85B 3PWUA 2H26A 3VA6A 43C9A 1D5ZB 3VWKA 2P5WD 5D7LA 4Y2DD 4YBLB 4D0BB 1SYSB 4UIKL 5ISZD 2E7LA 2ERJC 2R1XB 4NP4H 5TH2B 3ULUD 4HULB 1AHWA 2JIXB 5AZEL 3KPSD 5LAXB 4E42A 5HD8C 3N1FC 1AO7D 4YHOH 4Z76A 4PRID 5EN2A 3QEUB 5L7XL 3D18A 5C3TA 4OGAD 2BFVH 3WS6A 3PG2A 4L8BA 1JIBA 5KN5A 1JGDA 2R56H 3T3MF 4JZNB 3QUXB 4X6CA 4NOBA 1VPOH 2OJEA 4HIHA 4JFZL 1IT9L 1J0KA 4GSDH 2BDNL 1F13A 3I6GB 3GO1H 3T1FB 2W07A 1NBZA 1UZ8B 3IDJB 4HKXB 2B20A 4G8FB 5F8QC 3QCTL 4KROC 2QSTA 4D0DB 1C16B 1IKNC 4MHHG 1FSKC 3QEQA 3MUHL 3L3HB 4JCLA 4M5ZH 4DJMA 4RMVA 3HRZA 4X6BA 3FB6A 5EU6A 2R23B 1MJ7H 5I1LB 3CCHB 3KPMB 3PV7A 4LCYB 4DGIH 4QYOB 1JGUL 3BD5A 3NTCL 5GZND 2FSEB 2IC2A 1HQ4A 1HILA 1UFUA 4MNQB 2AJSL 3KNBA 3QIWA 4LF3A 1NL0H 5DGQA 3OAYH 1CXHA 5C0ND 3WHE1 3PGFH 3BPOB 4MDJB 2D7PA 4G80B 4E9LA 2XICA 2F53E 2VL5A 5IROA 1X5HA 2EDDA 4XI5C 1ERNA 5DHVH 4OD1H 4N0CD 1C7SA 3KYKH 5HHMB 3NIFE 1TLKA 5GPRA 1HEZA 1P5UA 4BFBD 3CX2A 1VFMA 4DKFL 3AS0A 3GI9H 1CDGA 3VXUD 1IBGH 1U3HC 3GGWB 3GSWB 3O3DB 4Z8FH 4JE4B 1EUTA 4JDVA 4PJ9C 4QRRE 1LEGA 4RWYH 4UILL 4YFLF 3Q6FA 4L3CB 3QAZC 5DGRA 1A4KB 2JJSA 4ZSOE 1S7RB 1EUUA 4JDTL 4PJIE 5BQ7A 1OL0A 4RISL 4ZTOH 3MGTB 1CD1A 4N8VB 2P5EE 3OR6B 4NQSB 4JPWH 5CZXC 2NW2A 1PD6A 3I50H 2O5XH 2AKRA 5FDWA 5C2BH 2EYSA 5B3JF 1OCWL 2ARJB 2XA8H 4HUKB 3RGVD 5L2KE 4FXLA 2R15A 4IRJB 1ZLSH 3UTPD 5JMRA 1ONQA 3VXTA 5IOPB 2O26U 4BQ9A 3SDDC 3S3JA 2YXFA 2BJML 1RZKH 2WWMD 4TYUA 4PREA 1MCCA 1FNSL 2EDBA 5FYKL 2VDRH 1BVKA 4MAYD 1NLBL 1MCHA 3VI4E 3MUGA 1U0QA 4YPGA 3F65A 3QIUB 3BP7A 4X6DF 2BP3A 2WIIA 4JPKL 3UTQA 3HZKA 3ARYA 1GGBL 3P2TA 4OM1H 4PRHA 3L3OA 4LBEB 3KPPA 2F15A 4JFDD 1DDHA 3L6FA 4X5XB 1G7PB 3ARFB 1MCDA 1CDJA 3AUVA 4TVPH 5F7YC 3MLPA 2Q6WA 4EI6A 4I48A 4KUCF 4I1NB 5DJ0B 2EEAA 4F7CB 5CP3H 1M1SA 4CKVX 2R9HC 3JXAA 3PGDA 5E5RB 3HPJA 1XR9B 5DVNA 1HHKB 2A6KA 2EDNA 4R97B 1W72B 5A2LH 3GSNH 1UM6H 2WQRA 1PSKH 4OQTA 5DQDH 3ZZ1A 3KPRE 5EUKB 5GIRA 3G6AB 3KR3L 3QUYB 4UNVA 2WUCL 1ACZA 3DMMA 1IM9D 4HXAL 5FOJA 1LP9B 2W91A 1AGDA 3WSQL 3EDEA 3EGSB 1U91A 4MQ7A 4WJ5B 5HGBB 1YECL 1A9BB 3LN4A 4DZ8A 1XZ0B 3HG1A 3FQXB 3KYOA 1HXYB 1VFAB 3GKWH 5E9DD 3X14B 3X13B 1MVUB 3BE1L 4NZTH 1FCCA 1W0VA 1AIFA 1AKJB 1DZBA 4M6OH 4XWOD 5HDLA 1FCGA 1PLGH 3HI6L 4XBPB 5F6HI 5DJYB 2FDBP 4BH7B 1A8JH 3OZ9H 1G6VK 3QHFL 3MV9D 1RULH 5MEOA 5TPWL 1DBML 4N9GB 3DBXB 2A77L 4YDKL 4YHZL 4JFEE 4OD3H 3VU2A 2D9QB 1VEPA 12E8H 4FQXB 4XNZB 5E03A 3MBEB 3IDXH 3HR6A 3UTTA 3Q3GA 3C5ZC 4QCIA 4C83B 1UXWA 3B9EA 4K7PY 2FBJL 2R39A 1UM5L 4LFHG 5KZCD 4LRNH 4YXHH 3OSKA 2Y25A 2NX5A 4HJGB 3QIBC 1E6JH 3R1GL 2OXGA 4A6YB 5FYJD 5LGJB 4JN2B 2AEQH 1GOGA 5IMMB 1SBSL 2QV2A 5IJKC 3GBLA 5HGAA 2YPKB 5F70A 3VFGH 4HUVA 2DDQL 5E8DL 3F58H 2EDQA 2WW8A 1KN2L 1MCSA 4O2FB 5IGXL 3GMOA 2EE2A 1QZ1A 5DLML 3KGRA 1FE8H 3RDTA 1T20B 3ARVA 1F3DJ 3QJHB 3GRWL 1P4LA 3O3EB 4QNPE 2VITA 4C4KT 4GAJH 4XB8A 1Q72L 5IESH 2OL3H 4HV8B 1F02I 1KCRL 3T0BA 3P40A 4XP9H 3WFCH 3TJEH 1NCDH 4I9WE 2ED9A 3JV5A 4WEUD 4GS7B 1N0LA 4WDIB 1V7NH 1Z6JT 1NCAL 2KZWA 4FZ8L 5JHLH 1V3JA 2JK5A 3EYVA 3MX0A 4FFYL 4JM4H 4HLZH 5D7KE 5LCVH 2ZNXA 1NMBH 4HIIA 5DK0A 1UWXH 4O5LL 3OKYA 3IFPA 4KRPB 5EA0L 5H2BB 4LCWE 4ERSH 1X4YA 2BMKA 1LDSA 3G6JE 2X9YA 4TPRH 1A7OL 1F45A 2H9GB 5I8OL 3MA9L 4TTDC 2MWCA 4YIQB 3U7YH 4KUCD 3S5LA 2FO4B 3WIHH 1X6LA 1JJUA 3GBNL 1DQLL 3VFVB 4X8XA 4MHHI 3A6CL 5GJSL 1U8LA 3CMOL 3UYPA 3V0AC 4LKCA 1G6RL 3BDXA 4HH9A 3HUJA 4K8RD 4NO5A 4QXUH 2HVKB 4HCRH 4X5LA 4NO2A 1P7HL 4PJGB 3IS1X 5DJ8B 4JO2L 1MWAB 2JB5H 2EIDA 3WIFB 1J87A 4HFWB 1NH6A 1DQJB 3UPRA 4OCNC 4X7TA 3LHPL 1FRGL 1BGXH 4WWKD 1CFTA 3BKJH 4I0KA 1F00I 5TDOA 1GGCL 3DVNA 2VUYA 5C6TL 1PX3A 3NZHH 3UMTA 1DEEB 1DQDH 1N6UA 1YQVL 1MCNA 2AK4B 4LSRH 5ESAB 4RA0C 3GSQA 4KFZC 1MEXH 3S4SG 3ALWA 1K4DA 3U9PH 3TPUB 4OF7A 4FFWD 5I8EB 3MREA 1ZLUK 5DTFA 3HA0A 1FNFA 3Q6GH 1EGJA 5I73C 4XMLH 4HLZG 3MQIA 2CIKB 4KI1A 5ACLA 1PYWA 4Z7VE 4YBQC 1YEHH 5TJWK 2QSCH 3TV3L 3SE8H 4LEXL 2BX5A 4KY1H 2EDHA 2HTKC 3D69A 1KB5B 3HMWL 1OM3L 3SE9L 3IKCA 2WANA 4NDMA 2EDRA 1YN7B 3VFMB 1OAQH 1OSZA 3OKOA 5EUOE 1FZJB 4V1DB 5HYQA 5FV2A 2Z4QA 3FQNB 2QQKL 4KJWC 5B21A 2D2OA 3QO0B 1D5XA 5GSVA 4OD2B 1B4JH 1JNLH 1KCSH 2JE8A 4OB5L 4YWGL 5I1JL 4EDWL 4CVZB 3B2UC 3DURA 1J0JA 4Q2ZB 3D39E 4POZD 1LQSR 3LKSA 5E6ID 3D3VE 3DYOA 5CHNA 4IOSD 4R26H 2V7HB 2YD2A 4QLRA 5F97E 4O51A 4I4WB 4ODUA 3L7FB 5JDSA 4Y1AB 5TFSH 1BWWA 1BZQK 4MXWH 2ZJSH 3JTSA 3LQZA 1IGFH 2H41A 1T6VN 1FL3A 3SPVA 2V2XB 5B4MD 3QPQC 3CH1B 4NN5C 4PJDA 2PR4H 4OFYA 4YC2B 1U8MA 3GIZH 3MLXL 3NOIA 3BVNB 2QL1A 3GIVA 4ESKA 3CDYA 4P0DA 4Q6IC 3HNSH 4JY6B 2QADC 4NUJB 5J06A 3FB8A 4I2XA 4MA3A 1NUNB 4GMTH 3MLSH 4E41E 1GRWA 1M7IA 4RA3A 1G9NH 5T5FH 3C5ZA 1CS6A 5LKNA 1EHNA 2DYPD 3DSFH 1IAKA 1H3PH 2XV6B 5T3ZE 5I1EL 1W8OA 4GRWB 3G9AB 3QUZC 2ZCLH 5DJAA 5IVXA 3MRFB 1JHTB 4U6XB 4NJ9L 4LPCA 3STZB 5B38A 1Q9LA 4W6WB 4HBCH 3H3KA 1L7TH 3SHSA 1R5VB 4HUMB 3OAUH 5A3IC 1YQ2A 2J4WH 3OTTA 4FQHB 4I8DA 3JWOH 5EC1B 3QEGL 4ONHB 2DIAA 4GT7A 5TQ2H 2ICES 2XG5A 1G7QA 3WO4B 5HHOB 1V7ML 2F54E 4RAVA 1MLCB 4LSUH 1OTTC 1SM3L 1UZ6E 1F5WA 2JJTA 3DUHA 1I8LA 1MREH 2MQ3A 3VDCA 3BZEA 2Y07H 3MGOB 5LGHL 3V52L 4HHAB 5EWIL 2VLKD 5BO1L 1KN4L 3SJVE 2V2WB 1EEZB 1TPXC 3MLRL 4MA7H 4KTEL 3U7AA 1LK2A 1LEIB 1I1AD 1WZ1L 1QQDB 3BPNC 2G9HB 4F9LA 4MJID 3CFKA 1HSBA 5TGBA 2IAMD 4P3WA 1U3JA 3VFTB 4NYLB 4P49A 1IC4H 1LO5A 3L5WA 3E2HC 4RFNB 2QQLH 5ISZE 3OPZH 4C56A 2FYYA 2E5EA 3ULUE 2XQBL 3HPLB 4HWEL 4Z7UA 1ZEAL 3VFPA 4HF5L 2WP3O 2VXUH 3QPXH 5DK3A 4R8WH 4PJ7B 2P46B 5D2NB 3S37X 4PRIE 3NIDE 4O00A 1NPUA 2VLLB 4PJCF 3SKMB 3ZL4L 2BVYA 5C07B 3MODL 4LSSL 5GJTH 3TZVA 5J11C 4JKWA 4PV8B 1A1MB 2HFEB 1KLGB 4XCNA 4JREC 1NAMB 2OJEB 1AQKH 2W1NA 4CN1A 2IANA 3HAEB 1KJVB 1KLFA 4QHUB 5GRJL 1KTLA 3MV8D 3E0GA 3BGMA 4I5BA 5BS0E 4QT5A 1LDPL 4JKKA 5DRNA 2ARJQ 1OW0C 3U0WH 4X6CF 3RA7L 3O6ML 2E27H 5DEGB 3SDAC 4IMLB 3QNXB 3RIAF 4JGMA 3BN9C 3FB6B 3GMPA 4LASL 4OJFL 5EZJA 5ACMA 2VDMH 5IBTH 4JN1H 5E6YA 2A1WH 4ENED 2EDWA 2MNUA 4JB9L 4CBPA 3TFKD 4LF3B 1NKRA 1T83C 1NJ9B 3C5JA 5C0GB 5IV2A 4OUOA 3C08L 4RGNB 1ZHLA 2VR4A 4JR9L 4I77H 1YC8A 4ZPTA 2C3XA 3VFOB 1Y18A 1MUJB 4F7PB 4UNUA 1SY6L 4M43H 4YEEA 3TIDA 1B6UA 5BRZB 32C2B 4PPTA 1EFXB 3TO2B 3O2WH 2PF6A 4ZFFB 4R2GB 4EN3A 5GRVL 1NFDA 5DR5L 4G7VH 1EVUA 1RUQL 3MLTA 2G5RA 4PJBA 3U6RB 4PGCA 5EC2A 3QH3A 3WBDA 1D5IH 3TF7C 1QP1A 1KCUL 4IRZL 4IOIA 5ACZA 1RIHL 2IG2L 2V6HA 4GW1B 2DF3A 1W2KT 3GB7B 1BQHB 3HLAB 4F57L 1TVHB 3DETD 4G9FB 2HKHH 3DTXA 4M7KH 3VXUE 5E8PA 2YRPA 4P9MH 3SQBA 5BQ7B 4AG4L 4LARL 1CD1B 3D0VA 3EHBC 1CGUA 4LPWA 2PO6D 1NKOA 1Z9MA 3HZVA 4RDQG 2JCCA 4MJ6B 2X70B 3MRCA 4X4XA 2R0LH 1Q1JL 2BNRD 1DL7L 4NQCB 3V0VA 4KU1A 5CFHA 2A73B 4UT9H 1J8HE 1DUZB 5E2VH 2NMSA 3TCLB 5J1SC 3P4OB 4NJAH 3WFBH 4HK0A 1T1XA 4MZ3A 1JRHI 1WWAX 3WV0A 1INEH 4XWGH 5JNYA 1T1WB 4MA8L 5D5MA 3IAPA 2X1PA 5DSCA 1LE5A 4FQJH 1RJLB 5C0CD 4GAGH 1MIEL 1Z5LB 5FOBB 5I1CL 5EBWB 1IQWL 4Q6IA 2CRIA 3TCXA 1WC7A 3UTPE 1MHPL 2ZOKB 3QDJA 2ZUVA 2F5BH 5I16A 4YPGB 3DX7B 3IU4L 2JF1A 2J7LA 2WIIB 3SKNA 2IEPA 3HZKB 4FXKB 1GZQB 2D3VA 3WLWC 1I1RA 3QUZA 2OI9C 2OX5A 5GS0D 1JFQH 4PRHB 1N5YH 4NWTH 2VAAA 3LKPB 4ZUVA 1VGEL 5I30L 2IPTH 2MPAH 1FH5H 3K0WA 3GDBA 3CGTA 5T33H 5HYSG 2GSIB 2A38A 2FWOB 5SV3A 2VIRB 1D5MB 3JV4A 4G6AD 4QOKD 1VADA 2LE9A 3K8MA 3T3ME 25C8H 1QEWB 2FZ3A 2NY1C 3LQAH 3SDCD 1AXIB 1MCRA 5HGDB 2VLRD 1A3QA 5D7JB 3P73B 3G08A 2AJZB 4H1LH 3WFEH 4C58B 3AB0C 4BZ2H 1AR2A 4KK9C 1S78C 2YD5A 1OAKL 1I3UA 1KPUB 2N7BA 4HJ0D 1I7ZA 4PYGA 3P9MA 4UBDD 4K3GA 1MI5A 1U91B 4HWZB 5BOZG 1ZHKB 1GGYA 4FQ2L 4JRYB 5KVMC 5C0RH 4GMSL 2NY5H 4QRSA 3ARRA 2ERJB 3QQ4B 1ZSDA 4HQQL 4JJ5A 3HG1B 5C3LD 3KYOB 1DCLA 2A9NH 5FYLL 2PW1B 5E5MA 5FHAH 3ARGC 4QXTA 3U2SB 2DKSA 4YDLC 4HGMA 2AEWA 5E9DE 2NTSP 1QTYT 2NPLX 3MRKB 4KMTH 3G6DH 1JVKA 5EU6D 1J88A 3C5SB 4R96A 2AK1L 2DTSA 3P77A 4KVNL 5MEOB 4DVRH 3ZSTA 1BZ9A 3DNKA 1YNTA 1S7WB 4LL9A 3IKKA 4UV7L 1KJ2B 1JPST 5FM5O 3S35X 1U58A 3GJFK 1YNLH 4NZJA 5JXED 2NTFB 4Y5VC 2WZPD 5E2JA 4Y4HB 2CKBH 3O6FB 4LU5L 1IGJB 4ELKB 4H0HB 3SKUD 5CEZL 4QCIB 2ENSA 4WI9A 1OT2A 1RZ7H 3K3QA 4GBXA 1G7IB 3TA3A 3ULVL 4KROB 5FO9B 4Y4KB 3HCVB 2AJ3A 5ITFB 5EBMB 1FSKB 1OW0A 1ZT7B 2YD3A 1B0RA 3IJHA 3AGVA 2AW2A 3O3AB 4MXQC 5C09D 4P3CH 3RKPA 3SGKC 3RJDA 1YEFL 3ISWA 3FN9A 3OGCA 4H1LG 3B9DA 5K93A 3O2VL 1T0MA 4ZO7A 5FKPA 1Z3GH 3PQYD 4M1DH 2GIYA 2B1AH 2UYLA 5FYJE 5IB3B 5DJXA 1RZJH 4YHOL 2D0GA 4EOWH 2CIIB 2OR8A 2BFVL 5IIEA 5B3JE 4H5SB 2I5YH 1YEDA 5K9KB 1KIPB 3PNWB 2BVOA 2R56L 4KJYB 3VJ6B 2APTA 1AJ7H 4U1IB 1Z0MA 5HGHA 2J1KA 1XGRA 1H15A 2Z31B 1VPOL 3ARPA 4NFCA 1GOFA 3I3BA 4GSDL 4K3HA 3W11D 3OKKA 4L3ED 1U3HB 3KXFA 4LPVA 4G6JH 2FB4H 1X7QA 3U48A 1JF1B 4PJ9B 5DMKA 1UQSA 5TF0A 1SVCP 4MAUH 1X4ZA 5F71A 4BUGA 4X6DE 1SYVB 5DK0B 1YN6B 3IFPB 4L29A 3QFDB 1E4XI 1BBJB 4M5ZL 3C2AH 4DQOH 5JIIA 5L9DL 2CDFA 2XTLA 1N59A 4GOSA 4R7DB 1OAZL 4NQXB 4DGIL 3EDJA 1KENH 3B3IA 2P44B 4KDVA 2DQTL 1FNEB 5L88H 4ZXBC 3HUJB 2WQ8A 1S9WB 4DGVH 2GK2A 4BFEA 3GHBH 3PGFL 4TN9A 2VDLH 4DEPC 2Q1EA 5IW3A 4JLRA 2C3VA 5C08A 3FT3A 1WVZA 4LLMA 3SDDB 5HJ3A 2NYYD 4GFTB 4QRQB 5DC0A 3CH8A 4OZIA 2OZ4H 1KXQE 3KYKL 1AGEA 5DUMH 5KSBF 4PRAA 1QLFA 1RHFA 5EIIB 1EV2E 4M1CD 1A7QH 1A47A 3GI9L 1IBGL 5EG6C 2IBGA 1N64H 4Z8FL 2BNQA 4RWYL 3ULVC 3GSQB 1CFNA 2QSQA 3BIKA 2Y6SD 3VGDA 1TQCC 4XNYH 3O11B 2EICA 4KRNA 4K9EL 1LMKA 4OF6A 1CICA 4JPWL 1OTUD 2XQYG 1A6TA 5HI4C 4BSVA 1OD7A 3I50L 2O5XL 3HZYA 5EH1A 5L8KB 3ULSA 1PYWB 3W9DA 4F7TB 5C2BL 1BFVH 5DEFB 3W0WB 4HGKC 2HT2D 1Q9KA 1D7FA 3PJSA 5H37H 2XA8L 4H0IA 5BZDB 3HS0B 4Z7WF 4KQ3H 1ZLSL 2DL9A 3VWJD 3ARTA 2VMFA 4MB3A 1OSZB 1O7SA 1RZKL 2ADIA 2X5PA 3TBTA 4QF1B 2I26N 3WFDH 2VABA 2HJKB 2VDRL 3BEVA 1TITA 1RK1B 5IKCA 3VH8B 2EC9U 3KPQA 2R2HB 1NCWH 3LKSB 1T2JA 3RQ3A 3AC0A 2J8UE 5M94B 4I18C 4OM1L 3IGAA 2P8MA 5GS2D 1JWSA 2HWZH 3FQRB 1EO5A 4PJEE 1MHEA 3RVTD 4JFFB 1VACA 1Y6NR 4OI9A 4TVPL 3V6FB 3ZYIA 3BHBA 4M6MH 1HXMA 1R5IB 3KLDA 4K8RH 5CEYB 3GIVB 4PRBA 4X8JA 3VDAA 4ZOBA 4Y19B 2HFFA 4ZYKA 3EFFA 4PG9B 5F6HJ 2IALA 3QP3A 4I2XB 4XNMA 1BD2A 1I9EA 3GSNL 3B83A 4Y5VA 1UM6L 1PSKL 5DQDL 1UA6H 1FZOA 4N0UE 2OR9H 5GGVH 5ADOH 1F6LL 5H37G 5IB4A 4UU9B 1TQBC 1OB1A 4R4FH 5E08H 4Y7MA 3SGEI 2NY3C 1P69B 3V95A 3RDTD 4MNGB 3QI9D 3IFLH 3RUGA 2CR3A 2GQHA 2W9DH 2GITA 3QIBB 4J1UB 4AT6B 3SGKA 5B38B 2GK0A 4CMMA 3GMRA 3QNYA 3ARBD 5FUCE 3BP5B 1BHGA 3VG9C 1MFAH 2M1KA 1SHMA 5GRVK 3GKWL 2A0LD 2VLJB 4U1MA 4XZUA 2RFXB 3DX6A 1PY9A 1RV6X 4PJXB 2CGRH 4M6OL 3WL9A 1PLGL 3FT4A 3WD5H 1FNGA 3OZ9L 4XPBH 1NCBH 2PXYD 5JR1H 1RULL 5MENB 1R24A 5C70A 1XEDA 4C4KO 2ESVB 3VXSA 2AERT 4OD3L 1M4KA 2C7UA 3IETB 4XX1E 2AXHA 2EYTA 4MWFA 12E8L 2N1KA 4CVXA 4JANA 4HAGA 5BVJB 1HSBB 1FVEA 4M4RA 5TGBB 1A5FH 4P23D 1S7UA 2G60H 3LRSB 1DLFH 2BVQB 2HJLB 3V6ZA 1DE4B 4QWWC 2C4FU 1RZKC 1S9VB 1X5AA 4MJIE 3NIGF 3F7YB 2IQ9H 1VKXB 4LRNL 4YXHL 1HDMA 2FD6H 1E6JL 4NT6B 1BFOA 1K8IA 5FM4A 4QGTA 4KGJA 4NSKA 5KW9H 1KPRA 2AEQL 4XNQB 3RVUC 3H9SB 5E7FA 2CH8A 3AXLA 3P9WB 3VFGL 2C3GA 3C6LC 4NRXB 3BWAA 5D2LB 3F58L 2VSDA 3TH2T 3STLB 2BNUB 4FS0A 1NCTA 2VZTA 2FHCA 5T5NF 4YNYB 1VSCA 3LSOB 2IMMA 3TH3T 3ARWA 4KDTC 1SJXA 3MV8E 3MROB 4GAJL 1QHOA 4ZUSA 5IESL 4ZUWA 2OL3L 2AP2A 2VQTA 1YMMB 2F74A 3MOQA 4Z9KB 1NCDL 4LHUD 5ID0A 3MJ9H 1OGAD 1TFHA 4NKDA 3KPNA 1V7NL 3IXAB 1QSFE 2VXVH 5JHLL 1QR1A 3CAFA 2KL6A 3H42H 4F37F 2ZG1A 4JM4L 1IEAB 3ZKSD 1NMBL 3DROA 1FFRA 4ZS6C 2YEZB 4ERSL 2IADA 4TPRL 1B2WH 5E70A 3MO1A 5I73B 1WFNA 2HRPH 3U7YL 1A9EA 1XF3A 3WIHL 4PP1D 1F4XH 1EA9C 35C8H 1CVSC 1Y18B 2G75B 2GEEA 3KYNA 1RJYA 3ARSA 2YMXH 4CVWA 3W82A 1P9MC 3BISA 4QXUL 1QLRA 1RIUH 2FJHA 4KHXH 4HCRL 1J8KA 1QPXA 3OKLA 4FRWA 4UZGA 2N7AA 2O5ZH 4HPOH 3D85D 1R3KA 1IEBA 1A4JA 2JB5L 3QH3B 4OLVH 2BCKB 3VRLF 5AZ2H 1U2HA 3JWDL 2CUIA 3RGHA 4APQC 4KAQL 5KBNC 2JIXD 4Y89A 4QY8B 3BKJL 3D25B 4FQPA 5B39G 3GM8A 3R06B 4Z18A 3IF1B 4KJPC 3NZHL 4DAGH 3X17A 1P7QA 1DQDL 4Y5XA 2JCCB 4POUB 1TVBB 2A6JA 2HA1A 4P2QE 3CUPA 4LSRL 1QACA 4PJBF 4CVUA 1ZWIA 4WI2A 4RAUA 4I18A 1MEXL 3E6FA 1YJDH 3U9PL 4NNXB 4BQCA 2BNRE 3D6GA 3Q6GL 5DD3H 1WISA 2BY3A 2L7JA 2OTUB 2XKSA 4NN5B 2X4UA 1KYOK 3DGGA 2UWEA 3IT8D 1YEHL 2GJ6B 2EDTA 2CSPA 3QZWB 4O2CA 3PWNA 3PWVB 4UV4H 3REWB 2QSCL 2R2BB 2CO7B 3SE8L 1XGYH 4KI5C 1MCWM 5FA3B 1G6RB 5J89A 4KY1L 3PDGA 3ECBA 3CXHK 1I1FA 3SDXA 1LP9F 4LVOC 5GXBB 2VNCA 1OAQL 2KPNA 1RUKL 1YY9D 4XPFH 1QRNB 4TSCH 4LGSB 2PCPB 2BC4A 1RUPH 4WW2A 3T8XB 5DHVA 1CF8L 2DQUH 3IU3B 1B4JL 1IKFH 1D6VH 1KCSL 5EZLA 2EDXA 3MR9B 5KSAC 3GJFB 2BZDA 4U1SA 4R26L 3PDOA 5F1NA 5IB2B 3S3PA 5KAQF 1CG9A 3CVHH 2ZJSL 1MCJA 4X0KA 4PJCE 3X3GH 3CFEA 1IGFL 1UCTA 3MRGA 1IAMA 2Z9TA 5M95B 5EU5A 1U92B 4U6YA 2P48B 3T65A 1QR4A 2PR4L 3RL2B 3G5YA 4YFLI 3VE0B 4XNUH 1X44A 1C12B 3HNSL 4UQ2B 3KS0H 3QFJB 5MEPA 3ROLA 4GMTL 3O3BA 2VLRE 4MS8C 2IQAB 3MLSL 3BPNB 4JPIA 4AEFA 1XGQB 5J6GB 1RK0B 5F9OH 1WTGT 2Q87A 1G9NL 1WAAF 5T5FL 2W0PA 5DD6A 1JN6A 5HI5C 4CRPA 3DSFL 4QGYA 1H3PL 2DLFL 1JZ2A 1IM3A 1NCCL 2GCYA 1IE5A 3OAYK 3E2HB 5SWSA 3V4PH 1VGKA 2ZCLL 1PKQB 4LOUC 3BT2H 5HHQA 4WW1B 3FZUD 1KIUA 2IWGA 3TBYA 3O0RH 4PJHE 1ORQA 3MRLB 4HBCL 3H9YA 3JVGA 1L7TL 4W6XB 3TESA 4N0FA 3RWGB 4IRJD 3OAUL 2EO9A 2J4WL 1QUNA 4K94C 5KSUA 2O61B 3JWOL 5J11B 1LGVA 4NHUB 5HSFA 2DKUA 3NH7H 1WIUA 1LEKB 4JREB 1WBXB 3LMJH 2MTPA 1T22B 4LSUL 3INUH 4LGRB 1MPAH 1MREL 2Y07L 3QIUD 3DWTA 2JKXA 2DL2A 1NMAH 1FC2D 3HR5A 2ICEB 4HIEB 3HE6C 2AJ3B 3NFPB 4KDTA 4MA7L 4OZHA 2F53A 4OTXH 1PZUB 3OX8A 4LLWB 4UINL 4NO3A 5DJ2A 3SDAB 4IJ3C 3SCMC 5DEZA 1ZMYA 3ARFD 5I66A 5F1IB 2Z8WC 5GZOC 4ZAKC 1T0MB 1IC4L 5C09E 3WDHA 1D9KC 3SKOA 1MH5B 2B4CH 4EVNB 3V6OE 2KQNA 2UYLB 2QQLL 3OPZL 4QRRA 4U0QB 1HIMH 3TP4A 3C9NA 4NPYA 2VKWA 1XR8B 3PQYE 4ZSOA 4PJIA 2VXUL 3QPXL 3ROOA 4OLUH 4R8WL 3N85H 1YEDB 2FX8H 2P5EA 2BVOB 3UAJC 2IGFH 8FABB 3GMLB 4WIQA 2PTUA 5GJTL 4OZFB 3U46B 3ZO0A 2OLDA 3BDYL 2ZG3A 3QUYD 5C0FA 5E00A 5ICZA 1AQKL 1T66C 1RURH 2OSLA 1I3RB 3ZTNH 3C87A 2RQ8A 1WIPA 5SX4H 4QXGH 5TDPA 2WUBH 3ZDZF 3FO9B 5L2KA 1FAIH 1IAOA 4NFBA 1HQRB 2DLGA 4ZNEE 3BP6B 1RZFH 3OKMB 3EBAA 4L3EE 3SE4A 3U0WL 3P4NA 3ZMRA 2E27L 5HGGS 1AKJD 1CGXA 3QDJD 5F9JA 2ICCA 1NAKH 1HCFX 3EDKA 3NCBB 1N0XH 2VDML 3C60D 2BRRH 5IBTL 4LLAA 2L7UA 4X80H 1BWMA 1RIVL 3WNNA 4JN1L 4CMHC 4H88H 1CDHA 2A1WL 1EEYB 5FM8A 2QLVB 5JHDB 1X3DA 5D1ZC 4LDLB 2XNAA 5I1AA 5FYKU 3WKNA 4PRDB 1T04B 4S11A 1OLLA 3L5XH 3FFCE 1FL5B 4GW5B 3RRQA 2DIBA 5AWNH 3MBED 1Z0NA 1BQLH 4Z5RA 3I9GL 2BVPA 4ZUTA 5GGSA 5IP4A 5DJDB 5JPMA 3MCLH 4P46C 4YEFA 4PJ8C 3JWOC 3RVVD 4OZIB 5D70H 3BW9B 4LAJH 3O2WL 4P48A 4WCYH 4YPJA 1NFIB 3BJLA 3DVGB 4G7VL 43CAA 3TNNA 2IH1B 2VQ1A 1DQQA 2XA3A 2X1OA 5JA8B 2EXWC 2IFGA 2VR9A 4IRSA 1CQKA 1D5IL 3TVMA 3FAXA 3DX8B 2NR6C 4JY4A 2XZCL 2ZSVB 3X11A 1K4CA 1QO3A 3BIKB 3KPRA 3EYSH 1QFWH 1T7XA 2XN9B 2HKHL 1YMHA 4M7KL 1HH9A 1GZPA 3CZFA 4HWBA 1A6TB 4WUKH 5A1AA 3P30H 4X4ZA 2OR7A 5I8KH 3MBXH 1E4JA 4UT9L 2NNAB 3O9WA 3P4MB 5E2VL 5FHBH 1T89A 2ITDA 3NFNA 1XIWB 4HIJB 3QDMB 3G5VA 3PWJB 4NJAL 3TEUA 5L2JA 1AY1H 3WFBL 1W0WA 2YBRA 2EE9A 4YGVA 4FFZH 4NOFA 1I4FB 1INEL 4G8GE 4XWGL 4OFDA 5E2UH 3FONB 2NY1B 2PTTA 2NW3A 2AXFB 4FQJL 3O4LB 1WZLA 3F5WB 4GAGL 5KVGL 5F7UA 3EYOA 5E94B 4WENB 1I7RA 1S7TB 3SEPA 7FABL 1AD0A 2QHRH 2YC1B 4WFFE 1QOKA 3EO0A 3QXAB 1QG3A 2AXJA 4H25A 3AB0B 3PHQA 2PYEE 4GRWF 1IVLA 5DD5L 2F5BL 3BEVB 3RL1A 4KRPD 2AABH 2W65A 4I0PC 4JFEA 3RBGA 1DEDA 2AJVH 1FIEA 4XMKH 5F7HA 5E8NA 3T0AA 1YDPA 3O41A 2SEBA 3G5XB 2J6EA 1MCQA 4GBXD 5I71C 1IZJA 3H3BC 3VXMB 1ES0B 3ARGB 1JFQL 4GAYB 5BXFB 1N5YL 4NWTL 4YDLB 3TBWB 3MJ7A 3UO1H 3LV3A 1FH5L 4W6YB 2GYSA 3FQUA 5JUEL 4ZFOA 3ESUF 2XWBB 3QUMH 2B8OT 3UXFA 1H3UA 3JZ7A 1U95A 5EFIB 5HYJE 4ALAH 4OFPA 5IW1B 25C8L 1BD2B 1KACB 4XH2B 3IDUA 3LQAL 4OCWH 3BO8B 8CGTA 3FOMA 1M6OB 1KT2A 5ICXB 2AJXH 3MV7B 5IR1A 4QHLA 4WV1A 2YD9A 3AY4C 2AK4D 4GRLB 2NXZC 5INDB 1NLDH 4Y16C 1F4WH 4BZ2L 1JF5A 3MFFA 2F5AH 5F7EH 3WFHA 1J1PH 1DBBH 3VFUB 2V5TA 2YPLB 4OQTH 5T1KB 5C0RL 4CMMB 5I17A 3KDMB 2NY5L 4NO0A 4JZOB 3H9HA 4HS8H 1OLZA 3QA3A 1QSEB 1JUFA 1JNHB 2A9NL 2DQEH 4N5EC 4U1MB 3WUWA 4PJ7F 5CD5C 1HE7A 5FHAL 3O2DA 1CE6B 2AV7A 3QEHB 5ALCH 3RUGF 5IQ9A 2LTQB 3GSUA 3FT4B 4Y2DC 1FNLA 5FO8A 4JFOB 4LCWA 1BF2A 1CDIA 3G6DL 3G6JA 4FMKA 1C5CH 4N0RA 1G0XA 2Y36H 3FCTA 1QHPA 4R4BA 1YNKH 4WY7H 4DVRL 1F90H 1R24B 4JHAL 4P5TA 5A2FA 4V1DD 2BSED 3QHZH 2QKIA 1VHPA 4LSPH 3MGAA 2FEDD 3BI9X 1GGUA 1XCQB 2WBWB 1YNLL 4OGAC 4AM0A 3V8OA 1LE9A 4MWFB 2CKBL 4FG6D 2YD4A 5KSBE 1S7UB 1YC7A 5C0AB 4DOHB 3BYYA 3BZDA 4GQPH 3V6ZB 3MLYH 2W9LA 4ZTPH 4HGWB 4ZNCD 4Y1AD 1J9CT 4U1GC 1B6DA 1JWUA 4P3CL 1G7HA 5ESVA 5IJVA 1SJHB 3RWCA 1XH3A 4LCUB 3AXLB 1Z3GL 5GS2H 5CBAB 3ZKMD 4M1DL 3U0PA 2B1AL 4ZXBB 1RZJL 2N56A 3BWAB 4BKLA 4EOWL 1G1YA 2BSTB 3MXVH 2ZUQC 5E4EC 1U8IB 2A6DB 4DEPB 1R3JB 2I5YL 4Z7WE 3MRHA 1WBZA 5E2WH 1AJ7L 2NXYD 4P46A 1LNUA 4PJ8A 4X7FC 3NA4A 5GZNC 2KQMA 2GFBB 4HW6A 3HC3H 4Z7VA 4WHTB 5F8RC 5JLZB 5C0NC 2IFFH 3CXDH 2XIDA 5F96H 3W39B 1VA9A 1ZGLM 1NCNA 3GMQA 4OCYH 5JIKA 3RY4A 1F8TH 4M7ZB 3V4VH 3UBXG 1K5NA 4KVCH 3KPLA 4G6JL 1A7RH 2FB4L 3JSSA 1FIGH 3RTQA 4MAUL 2AS5M 1J1OH 1ZGLA 1ZVYA 3WJLC 1OGAE 1CL7H 1E4KC 2MJWA 5EUOA 4YX2H 1VEMA 5HHOD 2IADB 4WGVB 3C2AL 3VXPA 4DQOL 1G9MH 2WK2A 4L8SB 1ZS8B 1O7VA 1IGMH 2Z0BA 2NY5C 3DRTA 5CP7A 1Q38A 1UXSB 4CU8A 1KENL 4JO1H 4P2RD 3D39A 1DN0B 1F3DH 1FG2B 5L88L 3BIBX 3D3VA 4DVBB 1AE6H 1M05A 4DGVL 1QLRB 3M1BA 4P3DA 3GHBL 3RWJA 5JPNA 3NMEA 2VDLL 5DVKA 3H0TA 1OP3H 4D9LH 1KJMB 3J7HA 4RBPH 4B50A 1FC1A 2X2YA 1F3JA 4DUVA 5JW4M 1IGYA 1MRDH 5MHSD 2NY2D 4JAMA 3FQWB 3RGVC 4R3SA 2X4QB 1YEJL 3TJHC 4NQDA 3C6SB 2A9ML 4KQ4H 2XTJB 1AXSB 2A83B 4I0PA 3SKJH 3VFSB 1A7QL 5DFTA 3L3IB 1NDGA 2EKSA 4WFEE 4PYHA 4HX1A 2X4OB 4E41A 4QRTB 2WWMC 1N64L 3VXNA 5JW3H 3S88H 4HMEA 2H45A 2CRMA 4LLDA 5C07D 3D0LA 3WHXA 4PTTA 4XNYL 4MAYC 5D1QA 3NA9H 1BIIA 3QULA 3HE7B 1BF8A 3H9ZA 4QRPB 3DO7A 1OF2B 4H8WH 1T21B 1H9VA 4IBLT 1QFUH 1BVLA 3QUKA 4UMGA 1PZ5A 3PWNB 2HT4D 4XGZB 2H32B 2YSSA 2ATPA 4KQ3L 1EGJH 2HT3D 2VC2H 1XF2B 4CAGA 1JPFB