2C1OA

Enaiihis fab fragment in the free form
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
ELVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIYLVSKLDSGDPDRFTGSGSGTDFTLKISRVEAEDLGIYYCVQGSHFPPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of an Enantioselective Fab-Fragment in Free and Complex Forms.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IGK-C PROTEIN
total genus 50
structure length 217
sequence length 217
chains with identical sequence L
ec nomenclature
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c1oA01
1E4XH 4U1NB 1H3GA 2O5ZL 4RGNC 4LFHG 1MCDA 1X5GA 3T0WA 4D9RE 3DSNA 4HUNB 4IM8A 5DK0A 2PUQT 3BKJL 2XV6B 1UWEL 2BP3A 1OY3B 5HD8C 3GKWL 1U91B 3GSWA 1KIQA 1CXEA 1A9BA 3N85H 1MFEH 4L9LB 3CFDA 3X17A 3NAAL 1CICD 3AROA 1MEXH 4MCZA 3TA3C 5M94B 1KJ3H 4J23A 5ICZA 1V7MH 2PW1A 4N5ED 5IMKA 2YC1B 2C3VA 3IXTB 5FV2A 2DWEA 2OTWB 5ETUA 2QQNL 2BOCB 5DD6B 1OSPH 3GIVA 3RUGF 1E28A 3E6FA 1G84A 5IQ7L 4GRWH 4N1EA 2YXMA 2OK0H 2DLFL 2YXFA 4NO0B 3LHPL 1L6XA 5DTFA 1U8OB 3UYPA 2VZOA 1UKSA 3AAZA 1LE5B 1YN6A 2X1PA 4NHUB 4TVPD 3RHWF 2J8UA 1YEFH 4WHTA 4Z95L 4QXTA 3U9PH 3UZVB 3BDYL 4K94H 2BVOA 4Z5RA 4BZ2L 3GJEA 1MCEA 4MAUH 1P4LB 4KRPD 4P4KA 1B0RB 3GI8L 1QP1A 5EORL 4F37K 2VDLH 1ES0A 1MEXL 3W9EB 1DR9A 2OMNA 1BVLB 4XCEA 1B6DA 2MCG1 4MCYA 3HLAA 2J3SA 4CVZA 4DGYH 5DFVC 1RJCA 5LWYL 2F8OA 5GQBA 1AQKL 3FO1A 3ARFB 2WM0A 3G04B 5CKAA 2F19H 3P4LA 2I07B 1DE4A 1BOGA 3O4LD 3IAQA 5DD0L 3GHBH 5DEZA 5D1ZB 2EE9A 3C6LB 2V2WB 4Y4HB 2DWDB 4NFBA 4CVXB 5KN5B 5TJWK 4PJCF 4ZTOH 1FGVL 5DT1H 1MQKH 2JIXA 1KFAH 1E4XL 3QUXB 5KAQF 4GAYB 4OZHB 3BEWA 5DK2B 2FRGP 3TP4A 2YPVH 2IH3B 3QAZB 4X7DC 3T1FA 1UT9A 3NCBB 1U58B 1SY6L 2AP2A 5JHLH 1G0DA 1U41A 1ZA3A 4JFXB 1UZ6E 4YBHA 2OZ4L 1PKQA 2BVQB 5GGTA 1K2DB 3BDXA 3HPJB 3K46A 5DA4A 5LBSL 5C3LD 4LIQE 3NBNA 1S7RB 1FC2D 3F5WA 2ZSVB 1G7JA 4CJ0A 3VMNA 4N0YL 3EYOA 3CSGA 5KS9A 1AGEA 1ETZB 5IMMA 1BMGA 1ZKAA 5FYJE 3QRFM 3QG7H 4K3DH 1F4XL 5I9QC 4JFEB 3C87A 2C1OB 5F3BA 4YFLF 1PY9A 5B39B 3QEQA 4ONFL 5E00B 1KCSH 2ORBL 1J87A 1NCTA 3I6KB 4G7VL 3J7HA 5HDLA 2J12B 1Z3GH 4U6HB 5C0BE 5D1XA 1L0YA 3RTQC 4PIRF 3U82B 3EYFA 1MFAL 4M48L 3VGEA 3VD4A 3GEWB 3HI1B 4C56B 4K2UH 1YY9D 2R1WB 3FFDA 2OR9L 4ZPTA 4J4PA 3PF2A 5FUCC 1A3RL 3UPRA 1MWAA 3IFNL 2ERJB 2PO6B 4P23D 3ULSB 2K1MA 3WN5C 5F21B 4RNRB 5C3TA 3FZUC 3GJFK 1ONQB 1RUPH 5IEHB 3M17B 5ISZB 2FEEL 2E7MA 4R3SA 2W9DH 5FYJU 5IVXA 3LIZH 5EZJA 1FNGB 4Y5XB 1P7QB 2FATL 2VDOL 2NW3A 4DEPC 3TT3L 1T04A 2Q3AA 3OKDA 5JQ6L 1FO0A 2PXYA 5IF0B 1MELA 3D0VA 4BFEA 1U93A 3AB0B 4HEME 1C5BH 5BMFH 4NZDA 4PJEF 4YHML 5I17A 2CKBB 4XP6L 4I1NB 4PJFF 4PR5A 4QRRA 5CINL 2EDRA 3PG2A 1QPXA 2FB4L 4LL9A 5MEQB 4PJXE 5HTSA 3BUYA 1J5OH 3U0TB 3REWB 4AEHH 1UVQB 1B88A 4RX4A 3RL2A 2YD7A 2P5EA 1U8LB 2HMID 3TN0B 2ZZUT 3PP3H 1L9NA 1MRCH 5K9QI 1P7KB 3P4NB 3OXRB 4BH7B 2H1PH 3PWPD 4CAGA 1GGBL 4G8FA 5JIIA 1PW3A 3KG5A 5DR5L 5ITBH 3EYOB 1KCLA 2XIDA 1G9MH 2FX9L 4JVWA 2B5IC 2DLIA 2HTKC 4I3GA 5B22A 3MTRA 2MCPL 4YE4H 2NY1D 3MCLL 3X3FL 5B38G 3AC0A 1H3PH 2YN5A 1F02I 3E6FB 1LO0L 2P48B 3IDGB 5C0AE 3FOMB 2JF1A 4PGEB 4TNVF 3WO4C 4OQTH 5DHXB 1F2QA 1J8KA 3KGRA 5GRUH 1F6AA 3MBXL 5IV2B 4D9LL 2FZ3A 4XPFH 2NY1C 1BF8A 2H9GB 3T09A 1L9MA 5IBUB 2C7UA 2P47B 2D7TH 1GOFA 4RBPK 4UNTA 1LD9B 2YPLB 3ULUD 4G9DA 5IGXH 2JJUA 4K23L 2V2TB 2P7TA 3TZVA 1RUAH 1IAII 4DQOL 1DLHA 1T7WA 5T5FL 5FK9A 5EA0H 2P49B 2JE8A 2RAMA 1U92B 3HE6D 2CXGA 2HRLA 5GGTH 3ZYZA 4I9WE 3QHZH 5DMGD 1EMTL 2MHAB 5ICYB 3V4PH 3GSVB 3H9YA 2VAJA 3G5YB 1XZ0A 4ONOA 1OP3H 1JRHH 3JSSA 5EU6B 5F7UA 4KKCD 1QO3B 5F96H 5GGTL 3VE0A 2R8SL 5T5FH 3L5XH 4KI5C 4O51A 4OD3L 3X3GL 2AEPL 4ODUB 4WFGD 1XCTA 1KJ2A 3EJYD 4JFXA 3DNKA 3A6OA 1IEAA 4NOFA 2CKBL 5IHBA 1NJ9A 5CJBA 2F5AL 4JCLA 4L4TA 1K2DA 5K9JL 2CQVA 3B2UD 1NLBH 4LCUB 5F9OL 3SE9L 4XCFL 1F6FB 2QSVA 4GQ9L 1EDQA 4JANB 1BFOB 4WI2A 4YWGL 4Z7UE 3VXPA 3QDME 4D9LH 5JOEA 3ULVF 3GM8A 3TJEL 3F58H 3QFDB 4JFEA 4ZNEA 4F7PA 3HRZA 3PWPA 1KBGL 4UILH 3QUXD 4L29A 2AJUL 5CBAA 4JKWA 5HJ3B 5J12B 5F7LB 4WFHE 2NY2C 1PGRB 4I0KA 1EBAA 2YD6A 5KZCD 1JGUH 2HTLC 2C4FU 1TVDA 2WANA 5IB3A 5JA9A 4NO3B 3Q1SH 1JWUB 1RUQL 1X9QA 4AM0B 3FAWA 3ULSA 1CTNA 4MD4A 5FCUL 4O9HL 1E4WL 4R9HA 1MCPL 3TNMA 3MXVH 3K80A 4PJXB 4U3XA 3UC0L 1EXUA 2HYMA 1DE4B 4FXLA 3G6DH 3DRTA 4FTVD 1S7SB 3GB7A 1DANT 3UXFA 4PTUB 4ZAKD 2ICEA 5HVHC 1XZ0B 2PTTB 4LGSB 3S3SA 1KCRH 2XTJD 1RSFA 3LB6C 5FHAL 5ELIA 3KVQA 4C4KT 4NN6C 5IFAH 3EDDA 3ARUA 5FDWB 2B39A 4P3DA 1N5YL 1WZMA 5F7WC 4NT6A 5D9SB 1WC7B 2G60L 3PV7A 2DLGA 4OFDA 4LCIL 1CFSB 2XKSA 5DUMH 4PS4H 2FSEB 4PB0H 4M6AA 3QUZA 1S7QA 3C5ZC 1YNLL 3JV4B 5H37G 4X7FC 5IP4A 1QD0A 1H3XA 1KN2L 4HBCL 2PXYC 3QQ9C 1U8PB 3W5NA 4PUBH 3A6BH 1S9XB 3CDCA 4XNZC 1OAUL 2CO7B 1JUFB 2GK0B 3SN6N 4OFVA 1T5XA 2UY7A 3NIGE 3D0LA 4KKAD 5FO7B 5DJAA 2YPLE 1WLHA 1OGAD 1F3DH 2W9LA 3WS6A 4JQVC 5TPWL 1A1OB 4PGEA 3MZGB 5BRZA 4HPYL 3QRGH 2LTQC 5EBMB 3RVXC 2EIBA 3NZ8A 1A6ZB 3S4SA 2BNRB 4PRIB 4UQ3B 2I60L 4P5MB 3DVFA 1R3LA 2X4TA 4Q6IC 4GXUN 5DQDH 3W2DH 1TZHA 3HB3D 3FQRA 3VMPA 5CSZB 2QSTA 1TQBB 5EC1A 3PWJA 1OP3K 4NRXA 2X4OB 2JKXA 3SDDC 1V7NH 1RK1A 1OP5H 3B8YA 3T0AA 5EOTA 3GKZA 3FONA 5IG7A 1S7SA 5A40E 3CDGA 1HH6B 5GIRA 2NLJB 4A6YL 5JORB 1N0XL 1JTTA 1NUNB 5D2LE 1CFNA 4I3RL 1LO5A 4Q97A 4GRWE 3CH1B 1MI5D 4HUMB 4JLRB 4Z78A 4WU7B 3GHBL 2A6KA 5BVJA 2DQUH 4ODVL 5CCKL 3JWOH 4FFZH 1S7XA 1W72H 5TGBA 5KSAC 3ILPA 2DYPB 1XF5B 1E4KA 1NCCH 4I4WB 3RNQA 4Y4FB 2GK2A 4LRIC 4ZS7L 4WEBH 4NQXB 4HWEH 3HPLB 3Q3GB 1T1YA 4YGAB 2DLEA 4JRWA 5EBLB 5H35B 1U95A 3W11D 5F1OB 5I1AA 4X83A 5IIEA 3QDMA 1W2KT 1AO7D 1UA6L 1RUML 3IFLH 3VXOA 5J1SC 1TXKA 4M6OH 1GGIH 1AGDB 2GK0A 4DVRH 3RX8A 3UJTL 2RCSL 3EO0A 4M1CD 1KG0B 4QRPD 3D85D 2EO1A 1KIRA 3JV6A 3O3BB 4Y19E 4FTVA 1CFTA 2HVKA 1U91A 5KSUB 4U1KA 1F4WH 2Y5TB 3MV9B 4L4JA 4KWUA 1J8HB 2FJHA 3P73A 4KQ3L 2UVFA 4Y2OA 2AGJL 1BD2E 3U7YH 3LDBC 1M05B 5KJRH 3UAJC 4LSRL 4OCYH 5IB5B 5HBBA 1AXTL 2YWZA 2CGRL 1GGIL 1RULL 2NY2D 4P57A 4YHPA 3MCG1 5DD1L 3WLWC 2X4PB 3MLUL 3HA0A 2B8OT 4ZS7H 1RJLB 1PSKL 3DX7A 3Q5TA 4JRYD 3MFFB 1NH6A 1NL0L 4IIQC 1TZGL 4FFYL 3EJZC 3U48A 5DVLA 5CCKH 4KK9C 1D5MB 3OZ9H 2WWKO 1JNHA 5B8CA 3PQYA 4B41A 4XAKD 1EZVX 2DQEH 5F1IA 2PTTA 4LLWB 1O0VA 5HYFA 3NZHH 1XR8B 3U83A 3RPIA 3BWUC 3ZDZE 1NFDA 3O6KL 4YZFE 1G6RL 1MCWW 4N0UA 3GIZL 3D39E 3DX8B 4M7JH 3WFBH 4F80A 3BO8B 1BWWA 5FHBH 2Q6WA 3IDJB 3U4EA 3S37X 2IPUK 3GO1H 1K9TA 2G5RA 1WT5C 2DL9A 5C0RL 3F7PC 5CZXC 3IDXH 1D5XA 1JPGB 2G75A 1UJTA 2DQJL 15C8L 4WUUE 2CIKA 1A9EB 2W0LA 4L3EA 2I27N 3BD4A 4S1QH 1J18A 3MLWH 2RB8A 4XXDA 3MJ7B 4LVNB 4HAFA 3WLBB 3K4AA 4JZJC 1ZA3B 1FG2A 2KQNA 4O2CB 3V0VB 5C09D 5C86A 5T1DL 4N0FB 1MFNA 5MERB 4XAWL 4DCQB 5HHOB 4RGNE 3IAGC 1Q9KA 1YYMH 5E4IA 5ICXA 1ZV5A 5FM5O 5C0ND 4JDTH 1IEBA 1DZBA 1JMXA 1GIGH 2RGSA 2R29L 1WCBA 2R2BA 5C09A 3AUVA 1EFXB 4IDJL 4JFHE 3FO0L 4TPRH 1KLUB 5F9DC 4XVUC 3BKML 4H1LG 4WWID 3QCUH 1N64L 4J4PD 3RWEB 1T5WB 2HTKD 4EI5B 3FQWB 4ELMB 4EDXA 5DUBA 1PEWA 1Q9LB 2D7NA 4TQEH 1J05B 3SDCA 1Q9OA 3K3QA 4BSVB 1JWSA 1CFNB 3BQUD 1MHPL 3GSUA 5E8NA 4NJAL 1C8PA 2NXZC 4JB9H 5IEHA 5D71H 3M17A 5ISZA 4CMHC 3QNXA 3O45A 2J4WH 2YD8A 4HH9B 3P40A 4K3GA 4Y19B 1N8ZB 4PJIE 3H42L 2R23B 1YEKL 4H25B 3O9WD 2AV7A 3C6SA 1E4WH 4I18A 1NGQL 1QFUL 1XGQB 4FP8H 4LQFL 4KKBC 5DSCA 4UIMA 1YEGL 3ARDC 4YDIL 3W81A 4UOW1 3VA6A 5FYKL 1FNEB 1OTUC 1IQDB 2HRPH 3B9EA 4I0PB 4PJFB 3VDCA 2DF3A 4DZBA 4Q9RH 1YYLL 5IMKB 4KPHL 2JCCE 4NBZB 1LDSA 3SDAA 3INUH 1IZJA 3H0TA 1IMHC 1N26A 3LN5A 2FR4A 3BI9X 3RNKA 4WO4B 5CFHA 2YPKA 3TN0A 3TVMC 4D94A 3KS0J 1ZHKA 5EO0B 4XWOC 4NDMA 2OL3L 3FZUD 2VIRA 1QBAA 5BS0A 2R1XA 5F9WC 4P5MA 3FB7B 4L3CB 3OR7A 3GSRA 5FOBB 3IDIB 3V8OA 4OIIH 4B0MM 1U3HA 3OXSB 5C0DA 4AMKH 1MLCB 4PGCB 4Y2DC 3KYNA 1NAKH 5K9JH 5MEOA 3MRFB 1AR2A 3MJ9A 3OAZK 3QEGL 3PDDA 3W82A 3WHXB 2RIKA 1UCBH 2EDLA 2GJZB 5DVOA 4NZTL 3T2NH 4O4YL 4Y5XC 2NX5B 1LQSR 3WFCH 4LDOB 4FFVC 5FM4A 1K4CA 2BNQB 5M95B 3GK8H 5DWUL 2BRRH 3F7VB 2GITB 3QXDB 2E9IA 3V4VH 3QCVH 4POZC 5E6ZA 1OW0C 4P99A 3OF6A 1QVOA 2GFBA 2GTZA 1FYTB 1I7ZA 4MYWB 4NC0B 4OFYA 4PLJC 3R8BB 4BQCA 2V5SA 3PIQA 5IHLB 1L0XA 1EGJL 3ILPB 1KB5H 2ICWI 1IT9L 4YQXL 5DRNA 3MRBB 3I2CL 2V7NB 3KYMA 3G5ZA 2R69L 4X5WA 5IW3A 4DGIH 5I1JH 5TE4L 3WBDA 1RJYA 1PKQB 2BVQA 3QZWB 3GMQA 3CDFA 1SEQH 4RGNB 4TUOB 1F3DJ 5D7SL 3UTTD 1NEUA 2BSTA 4ZFGH 3D18A 4K9EH 3H9ZA 5FXCH 3RVUD 2NQCA 4S1RH 4L3EB 3H8NA 3LQZB 1GZQA 1AGBB 1I3RB 1R0AH 1EK3A 2H6PA 3O2DA 4UUJB 3P73B 1GOHA 5I30H 2I9LB 2I9TA 4NQCE 2H32B 2PR4H 4YHNA 2YK1L 4PJAF 1DTUA 1OAQH 3DVIA 3WIIL 2BX5A 3HUJF 5JW4Q 5D7LE 3U36B 5L88H 2L4OA 4IRZH 4JO4H 4WTXA 1TVBB 3FT4B 4ALAH 1XF4B 4JFFA 4I0PD 4XPGL 4MAYC 5ALBL 1KB5B 1S9VA 1CN4A 2F54D 4LRNL 1UWGL 5FGSA 2IBGA 4F9PC 4DZ8A 5C7XH 4JN1H 4Y19D 3MA9L 2BOBA 4KTEH 2PXYB 5IF0A 3KPMB 4X8JA 3BISA 2HN7B 2XRAH 3CFBA 4NQSB 1DSFH 3DECA 4L5FH 2JCCB 1OP9A 3C2AL 1CDCA 4HXBH 3ULVD 1HQRB 1OGTA 3GUTA 2IGFL 4QF1A 3LIZL 3MRBA 1N8ZA 4MA7L 3MA7B 3B5HA 5E8DH 4F57H 3QO1A 4OZIA 1CE1H 5GGUB 1LILA 5C0EB 4KZDH 4TSBH 1DQTA 4WI8A 1QEWA 2RFXB 2VL5B 3FQNA 5F88B 4XHQA 4ODSL 1A3LH 1YECH 2VXSH 1JPFA 4K2UL 4LCYA 3BE1H 1WVZA 1RHHB 1SQ2N 2XICA 4D0BB 4F33A 3FOMA 4PJBA 1Z9LA 3V95A 2XWTA 4KUZL 4JKPL 3JV4A 3QUZB 2FDBP 2NX5E 2YC1A 1NC2D 3I6GB 4RMTA 5K9KA 2ZUTA 2Z31B 1F6AB 3ARDA 1N2RB 2R2EA 4PRPE 4R4NC 4LEXH 3LEVL 3GBNH 2VDQL 3GSNB 1MCRA 1YPZA 1AKJD 3WFZA 4D3CL 4LIQH 1IARB 5ANME 1U8QA 3BGFC 2BY0A 2D9QB 5DRZA 4YDLB 4OLWH 5CJXC 3VCLA 1JNLL 3U46A 1J88A 4P2QA 2EDFA 3OHXA 5JHLL 5HDBF 3DRTB 5GRZA 2YSSB 4OLXH 1KJMB 4AG4H 4QTHB 5B4MC 1FN4B 1U8MA 4XBEH 4N8CH 5I2IB 2MJWA 3TIEB 3O4OC 4X4YA 3KR3H 1PVHA 5DO2D 2ZOLA 4NQDB 1OAYL 4GXVH 1FGVH 4NM8H 5ICYA 5FYJD 5EPMB 4P3DB 5LKNA 4P5TA 4WW1B 5FCSH 4ZUSB 4ZAKC 5C8JB 1AD9B 1WBXA 1SJEA 4PJ5A 1QSFD 3AS2A 5BW7C 3TZVC 4OSUH 4XMPH 4JPVL 5AUMB 2J4WL 1LP9E 4P23A 4WU5A 1OPGH 4OV5B 1S5HA 1T0PB 3DETC 2QHLA 2VDLL 4MAYD 4P3CH 5EORH 2X1XR 1RJYB 5C9JA 2VQ1A 2JK5B 1ZT7B 3OG6B 5D7LB 1EHNA 2KZ1B 1ZLUH 4ONHA 4XH2B 4PRPD 4HHAA 5I8CA 1BFOA 5GJSL 4OZGF 3SJVD 4XBGB 1MCQA 4KMQA 2HG5A 3GGWB 4Y4KC 4XTRD 3QULB 4J4PC 5DZOA 3R06A 3NH7L 3QDMD 1KB9K 2B20A 5F97E 1BM3H 1UH2A 5AYQA 3AS1A 4WHYG 5CBAB 4Q6YA 4QHLA 3FHQA 2VDPH 2X4TB 5E6YA 4ETYA 3U6RB 3VH8B 2CDGB 1BREA 3RIFF 3VRIB 3NPSB 1RD6A 3FT4A 1TVBA 1NDGB 3MNWB 1FRGL 3O6FB 2BMKB 5L8LB 35C8H 5C0IB 1MIEL 2GT9B 3C9NB 3RIFK 5INCA 3IJHB 4E5XA 3LDBB 3QPXL 3BKJH 3SJVA 4Y89A 2FIKB 5E8OB 4HC1A 3B2UC 1QSFB 2GYSA 1FG9C 3OAUL 3QSKB 3T0ED 3CH1A 2AK4B 3ARSA 3QEQD 3OB0K 4Z7UF 1ZLWH 1A7NL 4JM2A 3ZHLA 3UBXB 1CXLA 2X89A 4FOMA 5IJKA 5TQ2L 3L3HA 1O5DT 3LEXA 4CVZB 3I3BA 5LGHH 5ADPL 1UXSB 1XT5A 3QNZB 1FL6B 3HMXH 3S36H 2Q76A 2EEBA 2UUDK 1FZOB 1HHHA 2GSGB 3MLYH 4ZFZA 5E8PA 1HK6A 3ZT7A 4CGTA 5JA8B 3Q2CA 5BRZE 4JE4B 3FRPG 1BZ7B 2ATKB 3LV3A 5T5NG 5ANMB 4I77L 3ARGA 2ZPKH 1EO5A 1FRGH 4PP2A 5GS0C 4U1SB 5GS3A 4HV8A 2ENSA 3WLWD 1GSMA 5I1DB 3TNNA 5D70H 3BPNB 2CGRH 1HWGB 2VN7A 2L7UA 4R4ND 2ARJQ 4P57B 1HKLL 1OCWH 2RQ8A 1FCGA 3CFKA 1I9JL 1A1MA 4R96A 3E3QC 4MNQA 3CMOH 3EJZD 5FUCE 3PWLB 1RAMA 4KKBD 1PZ5A 3GMMB 5HGBA 5EUOB 3VGFA 2FIRT 5GS1C 5D72H 1HHJA 3CD4A 4K55A 2V9QA 4JAMA 3G5VB 3QUYD 4IRSD 4OZHF 3QDJD 4LFHD 3TV3L 1H5BC 2EH8H 1MHCB 3RY6A 3M07A 2DBLL 1A6UH 3MRHA 2B0SH 1QBML 4NNXA 1SBSH 3NCCB 1RURH 3AS3A 4XVJL 2OTPA 4EDWH 1FNHA 3DGCR 3OAZH 5CUSL 1LO5B 3MRGA 4ENEC 4LSPH 2P5EE 4JRXB 4XC1L 4XRCA 4IMKC 1ROWA 4P48A 1WSST 1DEEA 3CFEA 5MEPB 12E8H 5HYSB 5C0CE 1FL6A 1H9VA 5AUMA 3FQWA 2HFFA 3BGMB 4OCLC 1IGFH 4IRJB 5E2VL 3ZE1E 4FQQA 3S97C 1FO0B 5EU3A 3TZVD 2ATPB 4N0RA 3EDJA 5BV7H 4KVCL 1MRFL 1KCVL 4NWTH 4M7LL 2NY5L 2NW2B 3QO0A 4HK0A 5DJXB 1DBBL 5ETUB 4QCIB 4LSTH 2DKUA 3BHBB 1HKFA 3LV3B 1U9KA 4MSWB 4DW2H 1IAKA 4RMUA 2JB6A 3FCTA 1X5JA 3S35X 1JWMB 4MJ2A 5EU4B 4LCWA 4YXKL 3SO3C 1OF2B 4Y8AA 5EC2B 1U8OA 1QACA 1EPFA 5C08B 3BP6B 1GC1L 1FQ9C 4LBEB 1YPZB 3S36X 5HPMA 2FECI 2GCYA 5HGHA 3H0TB 4LK4A 1EFXA 4U0RB 1F3JA 2EE2A 2Z8SA 4APQA 3U4AA 3MNVA 1CR9H 4PY8J 2AXHA 4WO4A 3MRPA 4NM4H 5EZIL 3ARBD 3WDHA 5J06A 5JIHA 5JO5B 1KXVC 3VXSD 3P0VL 5J57B 4KJQD 4AYFA 4TSCH 1XGYL 3GSRB 3OR7B 3WKML 5JDJA 4PJEA 4X99A 1ZHBA 5LGKA 3NFPB 3TBSB 3WD5L 2D7PA 5CZKA 1PLGH 5I1CL 1WFUA 4JFDB 5DUML 2CLVB 5MEQA 1MRFH 1MCBA 5BV7L 5IW6B 3BH9B 2IH3A 4OCMC 5J4MA 2ICWA 1IE5A 3L3GA 1X6NA 4QEGA 1J8HD 4A2LA 5CD3B 4Q9QH 12E8L 3HNTH 5KVFH 5FHAH 1T2QL 5BO1L 1WEJL 2NW2A 1CIDA 5F3HA 5FDWA 2GTZB 1G0XA 5DRXA 3JTSA 1I7UA 2F15A 2B7DT 3SDXA 3G6DL 3KXFA 1MAJA 3IKKA 1NBVL 1T22B 5ESVB 1KLFA 2A38A 4HPOL 3DXAB 2P8MB 1GXEA 4KAQH 3DTXA 3KPPA 3O3AB 3HZMB 5T1KB 2QKIB 3GMRA 3ZHDA 3S88H 3ARBC 4CMMB 3BWAB 3DYMA 5EUOE 1ODAA 4HWNA 1D6EB 3HZYA 4OCRH 1XFPA 2RBLA 4HKJA 4ODTH 2FBJL 1NMAL 3F12B 3EJJX 3D0LB 4R0LC 5E24E 3HHRB 4JR9L 4YFDB 2VLME 4Y16D 1MWAL 3MRFA 2GY7B 1PYWB 4PJ8A 3MLVH 4P4KC 2AERT 4R96B 4HX1A 5D70L 5GSRB 3W11C 4F7PB 3DMMC 3S88L 5KS9E 2VWEE 5INCB 1RIUH 5HY9A 3TM6A 4F15C 3MZTA 2ADIA 2HKFH 4CKVX 1UC6A 1T7VA 5JPMA 2ENYA 4YWGH 4X0KA 1AO7E 4LPWA 2RR3A 4MNQD 5F9OH 3DGGB 3SE9H 2OJZL 5KVDL 3ARTA 5D7SH 3DV4A 2YEZB 1UKQA 2FGWL 4I0CC 1G7IA 2WBJD 3MFGB 1Z9MA 4U31A 2UYLA 4KJWD 4P9HH 3EGSB 2DIAA 2FD6H 2E7LA 3I50H 3KHOA 1VESA 3QDGA 3T3PE 4DK3A 1KB5L 4U49A 4L3ED 5DMKA 4M43L 4HH9A 4Y19A 2XPGB 1H0DB 2Z9TA 4RAUA 4U1NA 4HUUA 3VFSA 5AG9A 1K6QL 4FQIL 5K9QG 3LKPA 1KYOJ 3ZYJA 1A6VH 2EYSB 3WO4B 4U1HA 1HHKA 1FH5H 4W6YB 3V4PL 4PGBB 4RFOL 1TTUA 1EIBA 1C5CL 2R0KL 4ZOAA 4RGMC 3ZE2F 4XHJC 4XNMB 1I8KA 2VDKH 4KRMB 3RVWC 2VAAA 4KRNA 4NM4L 1IAOA 4NNPH 5TE7L 3S3PA 5ICZB 4E41D 1FNSH 4ZYKB 35C8L 4BKLA 3T0VA 3TH2T 3CXHJ 4NBYB 1X5IA 3QDJA 4ZSOB 2VLKD 3AREC 5C0NC 3JWDC 1P4IL 4OIIL 1RIHL 1AXSB 2E27L 4M1DH 4LHQB 5D93C 1PAMA 1KF9B 1UWXK 5I8KL 5DC9B 4G3YH 2FJGA 4QHNB 1ED3B 3O0RL 5I16B 3G6JF 1YEHL 5C07B 2HH0L 1ND0B 3KJ6L 2FX9H 2BOBB 2R2EB 3TH4T 3V7AG 1QLFA 1NGWA 2IQ9L 4YUEL 5FGCB 1TJIL 4W4OC 4OGAC 3U30B 5L2KD 4LQ1A 1KCVH 1XCQA 2H1PL 3QIBA 2IPKB 1NGQH 3HG1B 2IG2L 4NSKB 3G04A 1ZWIA 5I76B 5EH1A 4OCXH 1CLZH 4ORZC 1I8LC 2IANB 4E42A 5EU7E 1A14L 3RL1A 4PBVC 1HH6A 3IRPX 4UT7H 4OSUL 4XMPL 5DGQA 3S6CA 4EDWL 2IFFL 1I9IL 1S8DB 1IEAB 4FTVE 4U1MA 3SGJA 1NCDL 5KOMC 1I8IA 4ZPVA 4OTXH 1AIFA 2R39A 4ZFFA 1LEKA 1MREH 3B6SB 4MHHG 3U2SA 5FFLA 5I75B 3JTSB 1I3GH 3X14A 2IC2A 3CC5A 1F3RB 2HTLD 2EH8L 3GI9L 4YHYC 3VI4F 4PTTB 3RVVC 2Z91A 3QCUL 1XF5A 5HXMA 4OV5A 4TPRL 2BERA 3BZFA 5IK3A 1CFVH 2FLBT 3TIDA 3WN5A 1RUPL 2X6MA 4K07A 3WXVL 4XCYA 4R97C 3V6FA 4JDTL 4O2EB 1DQLL 1G0YR 5HI5D 1ETZA 1QRNA 1AO7B 3BRGC 1G7QB 1D9KD 1JYWA 1XGUB 1FYTD 3GBNL 2E27H 3D25A 1YQVL 2IMNA 4ZFOA 5D7LD 3VGAC 4Z7UB 4HULB 3OKMA 5JUEH 3MV8D 4Y4HC 2LAAA 4LLUB 4DCQA 1MF2H 1RK1B 2CDEA 3CZFB 4UBDD 4X6CA 1T1WB 2DQTL 4JFQA 2I26N 1F90H 2AXJA 5TE7H 4Z7VA 2PYFA 1BLNA 4LASH 2ZWLT 1BJMA 3I75A 4GG6B 2EIDA 5ECJE 1XIWC 2JJWA 3FKUS 2ZOLB 4NQDA 4YBQD 1JF6A 4JFFD 4N8VA 2NY4D 4XXCC 2IPKA 2HKHL 4WUKL 2F8XC 3IU4H 2Q1EA 2NY2B 1Q0XL 5D7JB 2BJMH 4ZO6A 3Q5YA 3BH8A 2VLRB 1V3KA 2VXVH 5FB8A 4KJYB 4OKVB 1Q38A 5D2LF 4YK4C 4KZDL 1HHGB 2CPCA 5GSVA 4EIZC 2ZUQB 4XWGL 3JBG7 3VRLE 1NCAH 1VHPA 5IM7A 2NXYD 4I4WA 1NC4B 5GRJH 1D6VH 4POUB 3O6KH 2XT1B 5I19L 5L2KA 1EFQA 1CL7L 1MCNA 1C12A 1CQYA 4UU9B 1KFAL 4UV7L 2FCBA 4KI5E 3HZVA 4APQD 2QL1A 1EHAA 3H7LA 2J5LB 1S7QB 2HKHH 4WUKH 1NMBL 2RJMA 4X6DB 3LVEA 1R3KB 2HT3D 5GGUA 4UDUB 4QRPB 4WEUD 1YDPB 1ZHLA 3ZZ1A 4HLZG 2J2ZA 1TZGH 1UVQA 2VISB 5HYIA 4TRPH 4KROD 4HMCA 3GMRB 5FEBA 3WUWG 2XWBB 2H8PB 4P2RB 4OLZL 3UYOD 3ZKMC 5EFIB 4GBXB 3HTLX 5IJVB 1MJ7H 4HDIB 1EZVY 1A6WL 3O6ML 5FGRA 5C07E 2AJ3B 1SJHB 1LWRA 3BDYH 1GL4B 4HGKC 5D7IF 3QIWC 2VLKE 1A22B 4JDVB 1TDQA 5DDHB 3G6AB 1KACB 4OI8A 4GJTB 3LN4A 3CVIL 5IB2B 4B5EA 3TCLB 3LHPH 4OZIE 3IDYB 4GKSA 2W65B 3UBXG 3KLHD 1PZUB 3S5LB 4L3CA 4V2CB 1NGZB 2NY3D 4F8QA 2XN9A 3D3VA 3BRDA 4AK1A 4NQED 1CLOH 3IKCB 2R1WA 1FLRL 1A6TA 2GY5A 3EFDH 3P4MA 3QUXA 1UB5B 4OKVA 4P3CL 2CDFA 4DOHB 2DDQL 1TFHA 2QBWA 1GGUA 4KHTL 5AZ2L 1T2QH 5F7NC 2SEBA 2EH7H 4LSSL 1MLBA 2VLMD 3ZDZF 1UM4L 2IG2H 5CIPH 3L3DA 5KSAD 4ZOBA 4NM8L 5IVOA 3G08A 3GBLA 2QV2A 3C8KB 2IQ9H 4L8DB 4NCC1 5C2BH 1PLGL 2GJ6E 4Z7WB 1Q9WB 3STBA 1O7VA 5I15L 3CK0L 4ZAKA 1KIRB 3JV6B 2F54E 4QGYA 3MV9D 3U0TA 1KCUL 4XBGA 4G3YL 1LK3H 4ZYKA 1FVCA 2I5YL 2XXCB 4HZLA 3MGOA 4J1UB 2A6IA 5D6DC 4D3CH 4XNQB 4H1LB 4MQXC 1FNEA 4JDVA 1P4IH 2F5BH 4O2FA 4P4KD 5DJXA 5FK9B 4GG6E 2WWMC 4G6FB 1BZ9B 4AMKL 1IC1A 5I1IH 4PG2C 4W70A 1C1EL 3PWPE 5ALCH 5A3IC 3DURA 2MNUA 1JTOA 1EHLL 2W60A 4M5ZL 1GC1H 1KLUA 1SYVA 5FYLH 5CJOH 3RKDC 4NKDA 2OBGA 3GSNL 5IB1A 3JV0A 4JFDD 4YLQT 4GRLB 2APFA 3BZEB 1HDMB 4WW2C 1KLGB 4PRAB 2B1AH 5FUZL 4ISVB 5LVEA 2C7UB 3VRJB 1WFOA 2N4IA 4LKXA 3HS0A 4LSVH 4N8VG 4NSKA 3IGAB 5HVGB 5EG6C 4QRPE 4KK5D 2NY5H 4W6WB 1XF2B 1HXMB 4ZO7A 5CWSB 3GHEH 4FP8L 2Y25A 5ITFA 1MCWM 2VSCA 1OHQA 3HMXA 3DVGB 4LARL 1IGYB 3MOAH 1P1ZB 3KLAB 1IJ9A 3VFOB 2X70A 2W0PA 5E2TH 4XNYH 4CDGC 4I0PA 5J1TC 4OF5A 2LVCA 2FGZA 1A1NB 1CFQA 2DQGH 4JN1L 2D7QA 3MV01 3NTCL 3LS5L 4M6MH 3TJHC 5FO8A 1JV5A 3S4SG 4FQXB 1FV1B 4DUWA 2DBLH 4EIGB 4ZDHA 3DO7B 2JCCF 4JZNA 1HXYA 1G9MC 1DL7H 3QO1B 4M03A 4OZIB 4Y5VB 4QYOB 1RZ8B 2NCMA 3D39B 4Q6IA 4JM4H 3EFFA 2AJVH 2VERN 3EW3B 4GW5A 3MLVL 4YDKL 1RUQH 1N4XH 1MWAH 3KXFD 1G7QA 5I0ZA 3NFNB 2V17L 3MRIA 2QTEA 4LVOC 2R29H 2WBWB 1JL8A 1PG7X 3V52H 2G2RA 3SDXB 3I6LD 3BVNA 3EOYG 1E28B 2LABA 5F6HI 2XQYG 4J3SA 3TCXA 2A74B 2QKIA 3OJDB 5CMAA 1BEYH 2OMBA 4LF3B 3FAXA 2BNQD 1MOEA 3WJJA 5K59E 1K4CB 3IDUA 2R0ZH 4KK8D 2IAND 5C0AD 3N1FC 1KN4H 2Z92B 3L7FB 4QGTA 2AQ2A 5DQ9A 3CU1A 3PV6A 1AGFB 5D1XD 5BO1H 3GFUA 2EIEA 1XF4A 3QWRD 2IALB 1YA5A 3IDXL 4LRIA 1VB9A 5SV3A 2N7BA 3O9WC 4MQSB 3GRWH 2AEPH 1A64A 2AJSH 4QNPE 5IBLD 3ZT5A 1S9XA 1CL7H 1TJHL 3MLZL 1T21B 4H88L 4PGDA 2QEJA 1FFRA 1P6FA 1BJ1J 2DLHA 2BVTA 3MACL 2IPTH 4M6NH 5KSBF 4E41E 3V4VL 4QWWC 1Q0XH 1T22A 5ESVA 5MHSD 3TYFB 2KPNA 4UDTB 5EA0L 2E9WA 3KPSB 1HH9B 1IGML 2CMRH 3RWDB 4O4YH 3UYRH 1MI5A 2EE3A 3BUTA 2Z8VC 1RIVH 4QRUB 2XTJB 3H3BC 1MF2L 4PJIA 1ZLWK 2BXZA 3NFNA 1M7XA 1WTGT 2D0FA 3PP4H 1JGLL 1F2XK 4FQHA 3X13B 3ULUC 4PJFE 4AM0A 3CDGB 4XPFL 3QUKA 1PFCA 3VGHA 3NCMA 1CDBA 3L7EA 2PYEB 1R5VB 4RGOH 1AXTH 4M7ZB 3HUJE 2OL3H 3HAEG 1RHHA 5IEKB 1IAOB 1KTRL 4XVTL 1BM3L 1AP2B 4L8SB 4YBLB 1M05A 4Z78B 1CDHA 2ZCLH 2BSSA 5E0QA 1RZGA 3L6FA 3WNOA 1DBBH 3H2WA 3MLSL 3VH8G 1UJ3C 3QI9D 4U1GB 5BRZD 1MVUB 2D4DA 4PJCA 3T8XA 3TBSA 2JELH 1X5LA 3GJFA 3V0AC 2XY2A 2UYLB 2CRMA 3S34H 3PXJA 4PG2A 1DBAH 1DN0B 3O3EB 3LKQA 2IJ0C 3VCLB 4APQC 3BYTA 2BOCA 3LRGA 3FO9B 3L3JB 1CLZL 3P77B 3G5ZB 1QLFB 4RWHA 4Z7QE 4DN3H 5TDPA 1TPXC 4PJ9B 5F7HA 1XCQB 3GMLA 5DK2A 3S34L 3P9WB 4FABH 2B0SL 3Q0HA 4YHKH 2QR0B 1SEBA 2VLJA 4PV9A 1C08A 3D18B 1BECA 5E5MA 4NKMB 1E4JA 1N59B 1N64H 3SDXE 3MRJB 1G7PB 3O41B 3MLSH 1R6VA 1C7SA 4D9QE 1ORSB 2A0LC 4IDJH 2VDML 1DBKH 5D5MB 3VXTB 2LU4A 4I2XE 1JK8A 2NY7H 1RV6X 3D39A 4PV8B 2GTWA 4E9LA 5TQ0L 4O2FB 4N9OB 3HLAB 4U2ZA 1HKLH 1OCWL 2YD1A 4NO2A 5C9JB 1QBBA 5EZOH 3ARYA 4HKXA 4PBXA 4AIZA 1HE7A 2OTUA 2Q86A 3MXWH 1BAFL 4NKDB 4YK4B 3SE3A 3MV7D 4JGMA 4YFLI 3BZFB 5JW5A 2YZ1A 4KUZH 1RIVL 4BFIB 4NQCB 1R5IA 1M7DB 5IV2A 1MQ8A 3AB0C 3VDBA 3PE9A 15C8H 3RVVD 1HILB 1UB6A 4GMSL 4P49A 1QYGL 2D0GA 4ODSH 1J9CT 1QHOA 4N5EC 5C0RH 5LBSH 4OZ4A 5D1XC 3AMKA 1N7MH 5EBWA 4AQ1B 4RFOH 1D9KB 1MFDL 2IALA 2V2TA 4I8DA 4M7JL 3WFBL 1MHCA 3O2VL 4QXGH 2ZSVA 5LGHL 2W91A 2YBRB 3DIFA 3KPRD 4Z7VB 4F3FA 3ZE0F 3MRMA 1J05A 3SDCB 2XQBH 1T0NA 2VZTA 3MUJA 3I3EA 1KYOK 1A7NH 2JIXD 3GRWL 1V3LA 1Z0NA 4EN3B 5EU5A 1IM3B 4WFEE 3O45B 3L95A 1KG0A 4R26L 3TN0C 3TVMA 5SWQB 4Z7QF 1ORQB 5D7JD 4G6FD 3O9WA 1GGYA 5LWYH 4Y1AA 1JNNH 3HUJB 3C6SB 1PSKH 4I18B 3IDYC 5E9DE 2HKFL 4UOJA 2P5WD 3UC0H 1W8NA 3GSOB 4MA3B 4GW4A 4QY8A 5CHNB 5GGRB 4PJFA 4D0BA 1Y6MR 4MNGB 1DBMH 2VYRE 2X4QB 5IBTL 3OJVC 4K94L 2WK2A 4CN6A 1QNZL 4GW1B 4Y5XA 3D25B 4JGUA 1IEHA 2P5WB 4FNLH 3V52L 2R4SL 3U0PB 1DCLA 2GI7A 1P4BH 3L3OB 3FB5A 4ZD3L 1JGUL 2HT2C 5L0QB 1CD1B 2DI9A 1OVZA 5BVPL 2DICA 4GBXC 1Q0YH 4ZFOL 4JY4B 3L5HA 4HUKB 1J0HA 4TUJA 4G8GE 4UINH 3UTTB 3BPCB 1J1PH 5IVNA 3W0WD 4PREB 3TJEH 1T0MB 4ETQB 5IB3B 4S1RL 1ADQA 1RZKC 3WHE0 2VLRA 4PGJA 4KXZH 4XCFH 2AEQH 4YPGA 5C09B 2NX5A 2VQUA 1NFDB 3C5ZD 4R90L 4WI9A 3T4AA 4XPBL 1CD8A 4WHYH 4G8FB 3VW3H 4Y88A 4JPVH 3GNML 2WINB 3T0EA 4L1HA 5EU6D 3C09B 1JGEA 1HZHH 1OP5K 1IQWH 4LARH 3HC0B 5CGMA 3RNKB 4NCC2 1A7BA 1LEGA 5DK0B 4K8RH 1U2CA 3DX6A 4NN7B 3V5HA 2DQIL 2Y4SA 4W4NA 4DUXA 4F58L 3NABH 4RX4D 1R24A 4MMZC 2KKQA 4EUPB 4AG4L 1K3ZA 3MJ7A 3ZYOA 1V3MA 5IWLC 5KANI 4OLWL 2HG5B 4MD0B 4UT9H 3SCMD 3RA7L 1WBZB 3EYQD 2CUMA 1MUJB 2V6HA 4L1DA 2Y6SC 1RUAL 4JANA 5DQDL 1CGWA 3CAFA 3LEVH 3ARQA 5F8QC 1EHLH 5KTEL 2ED9A 5J11B 3CLEH 4NKIL 2Y9RT 3IS0X 4EOWL 4YC2B 2UY6A 5MP6L 1MNUL 1QFHA 4HPYH 2JB6B 4G6KH 3OKMB 2ZSWB 3BGAA 3VXMD 4PRNB 1T5WA 3S7GA 3TBYA 1QRND 3H3PH 3VFWB 3OKOB 5DI8B 1NGXA 4Y5YC 1ZVSB 4KKNA 4M8QB 2PETA 2DI7A 3OWEA 4TVPL 4LSTL 3RDTD 4BYHA 4JFFB 5HHXH 2ZNWA 1HHIA 2UZYB 4KPHH 4F57L 4DKEL 1QLEH 2XA3A 3QIUC 1CGVA 3GMOB 3FTGB 4YHIA 5FYKH 3FO2B 1A6AA 4WGVB 5J6GA 3ES6B 5H37H 5IVZB 1UACH 4AY0A 3V6OC 1MFBH 3G9AB 1KTLB 2C1PB 1MVFA 1UM4H 2BDNL 3WFDH 4XPTH 3MRLB 4WW2B 4U7SA 5JORA 3WFEL 2H6PB 4TSAH 1ZGLP 1DQQB 4DTGH 2DMCA 3KYKL 1XIWA 3PWVB 3QCTH 1WWCA 2D0HA 4JB9L 2BVPB 3SKOA 4LDEB 5GRVK 3NA9L 4XVJH 1VFAB 5IMOB 3O41A 3RJQB 5C0FA 4HS8H 2BDNH 3WFDL 5EIQA 3WIHH 4L9LC 2CK2A 5T1LB 5ANMA 3KYMB 1NFDF 3KPLB 3ULUH 1U95B 3FB8B 5AZEL 4NO2B 3TO4C 4BQBA 4WY7L 1UZ6F 1HEZB 2QHRH 3SOBH 3C5JA 4G8GB 1F42A 1G1CA 2BNRE 5SWSD 1M6OB 4CJ1A 1E27B 5E08H 2YS4A 4ODXA 4PJBE 2X40A 4HKBA 1MFAH 3V5KA 2QADD 4F37F 3RY5A 1A0QL 3F58L 4GKSB 3EO9L 4OFIA 1AFVH 2AI0H 2UZXB 1CZ8H 1S7VB 4OLZH 4RA3A 4ORGA 2XKNB 1EGJA 3P11L 3T65B 5ENWA 3SPVA 4GQ9H 4QO1A 4JO3L 4PRDA 3L3KA 5I66A 1TVHA 2HT3C 4NP4H 1VDGA 5GS2H 2BVOB 4Z5RB 1XGRB 2IQAA 1OAXL 2DQJH 2X42A 1A4JA 4QHUA 4LHUD 5DJ2B 5JXED 2CLVA 2DD8L 1IGJA 1RY7B 3BAEH 2VLKA 2DJSA 1WK0A 1AR1D 1Z9OA 3MLYL 3AU1B 4JQXA 1IT9H 1MCIA 2ID5A 3HMXL 2V5YA 5F96L 1PEZA 1M7IB 2Q8AH 4E0RA 4DZ8B 3AGVA 1PQZA 5I73B 4ZNCD 2D03H 4U7KA 1G6RH 2AW2A 5JXEA 3U1SH 2NXZD 1UM5H 2F54A 1FFQA 4RWYL 5SWQA 3KWWB 1MQKL 3F6LA 3C08H 1AH1A 5TGBB 1A6ZA 3GK8L 3BEWB 4XPAH 3QUZD 1QR4A 2P5EB 4HWZA 1KPVA 1IAIL 4YGVB 3GSNA 5J11C 4KRPB 4NQUA 1SY6A 1K5NA 4K23H 2A0LD 5CEYB 4P9ML 5EU4A 5F70A 2XI9A 2GAZA 4DEPB 1OSZB 1X5ZA 4MXQD 3D2UA 3IXTA 2C3VB 2BZDA 1J8HE 4XC3H 1UM6H 1GJIA 2DI8A 3MLTB 3BMWA 2VLLA 1EUTA 1G7LB 4HS3A 25C8H 1G6VK 1YMMA 3QB7C 2G5BA 4IJ3B 4P46D 3U9PL 1DQLH 1DQJB 3D69B 4R4BA 4PJIF 3L5WA 1F3JB 3VWJD 1AHWC 3RWGA 1BOYA 1Q0YL 4XCYB 1TITA 4C55A 5BQ7A 4TUJB 1LK2A 2MCPH 4Q2ZA 4AEEA 4GKZA 5H2BB 3UZQA 3VGDA 1X3DA 2ESVB 4Q9RL 4FNLL 1G9EA 2YPLA 1EFXD 1CDGA 2F53D 5C08E 4Q9BA 2HLFD 1HQ4A 4V2BA 3PNWA 1DVFC 1YEIH 5L9DH 1MREL 4N1CA 1MHHA 3DBXA 4KDWA 4OTXL 4PJAB 4J3OC 1NCDH 3OB8A 1UA6H 2E7HA 4Z7NE 3P2TA 4IMKA 3UTPD 3GMOA 3QDGB 5FECA 4GUPA 4RDQF 3WO3B 3HE7D 3OG4B 1KXTB 1DUZB 4NZRH 4I3SH 2FB4H 5HPOA 5CEZD 1RZJL 5C07D 1EAPA 4RFNC 1GOGA 3MRLA 4WW2A 4YHMH 3BP5A 4LP5A 5BMFL 4P5TD 5C6PB 1C5BL 1MCFA 1EV2E 4X9IA 1DN0A 2O5ZH 5C1MB 5F1SA 4CADB 5KG9B 3BT2H 4WUUB 2NXYB 4JFDE 3LQAC 4HGMA 4PJBB 3KJ6H 3MBED 3RL2B 3KDMB 3U7WL 2HH0H 5EUKB 2R23A 1BQLL 4H25A 3UJJL 1TQCC 3HC4L 1J1XH 2A9NH 4M1GL 4XNUH 4LCWE 2DTSA 3BZ4B 1T66D 5IHZA 5E2WL 5FYLD 1QQDB 4KH2A 8FABA 1BZ7A 4DZBB 2H2SC 1NGYA 2JK5A 4LIQL 4NPYB 2FLRT 1H5BA 1R3HB 2VB5A 3VFRA 1BOGB 3M45A 4OLYH 1KPUA 3BP4A 5B8CB 3OKEB 4PJ7A 1J0ZA 2DWDA 2I60H 3DUSB 1NC2A 3G6JA 5IJVA 4HK3J 4HV8B 1PG7L 2Q3ZA 1I9RL 3RKDD 4GAJH 1A47A 5BZWB 2OCFD 5LXGL 3VG9B 3EYVA 2DIBA 3GSXA 4J8RB 5D2NC 1T4KB 1I1AB 1TTGA 1KV3A 5F8RC 1RZIB 3BE1L 4RNRA 5ENWB 3SPVB 2V5RA 5E94A 3A67H 4NC2B 2R0KH 2WBKA 3MOQA 4JFHD 1C5CH 1BD2A 4PUBL 3NFSL 3K8LA 3P9LA 3MCKB 5IVXB 4M1GH 2B4CL 1KIUA 4G8EB 4FQIH 2VTFA 1SY6H 1EERB 4H26A 1AY1L 4H8WC 2C4XA 2AKRB 1NEZG 5IHUH 2BCKB 3QIBD 2IGFH 1DQQA 3BT2L 5KBNC 2VJXA 4LLVB 3I6LE 5DT1L 5C6WH 5HHMD 3CNKA 5IFAL 2XRAL 5FKAA 1IKNA 4X5LA 4NKMA 3WSQL 4JRYE 3A6CL 1HHGA 2HAZA 5C0CA 4BUGA 5I71B 5ACZA 2OX5A 1NBZB 3GRWA 3HFML 5K59F 5JOPD 1NANH 3WUWA 4MNQB 4UIMB 3EOAA 4OFYD 4PY8I 3MRRA 3QUMA 2CJUL 1RIUL 2OI9B 4MJ4A 8FABB 3G5VA 4L4TB 5ALBH 1RULH 3WIFB 4HC1L 3TJHD 1YEIL 1EEYA 2J8UE 4U4BA 4JY6B 1T6WA 1KPRB 2OSLB 1M71B 4PJGA 3HI6H 3H9HB 3VA2C 5B3JF 2ATKA 5L88L 1AGBA 1I3RA 4LEOA 1KGCE 3WIIH 4DKDC 1MJJA 3NIGF 2I9LA 4OCRL 1IGCH 4QHMB 2J88H 5ID1A 2PW2A 2Z8WC 2ED8A 2FJGB 5JHDD 5HVWA 3EYVB 3DUUB 3K7UA 3ZKMD 2X4QA 4J3VA 1JHKH 4GG6A 3RVUC 5KSBE 4PRHA 1A8JH 4RAHA 1WGOA 2Q20A 4M6OL 5HI4C 4ZUVA 4HPOH 1HSAB 2WIIA 3FN0H 1WIPA 5J1AA 4PJ7E 2CH8A 4LSQL 1JPTH 2P5WA 1JGLH 4FQQB 5T33H 4OBRA 3DROA 1WZLA 2R2BB 4PYGA 4WJ5B 2GJJA 5DMJB 4K3EH 3L3HB 4WRLA 1CD1A 1FYTE 4X5XA 3LEXB 1RUKH 5DEGA 1WEJH 3AAZB 1T2XA 4GH7B 1B0GA 1MIMH 3VJ6A 2IWGA 1FAIL 3ARPA 2R8SH 1FDLH 1ITCA 1BX2A 2ZCHH 4HIXH 2A1WH 4BELD 3QA3B 4BSVA 1QFPA 4PRPA 2YPKB 4JFDA 4RWYH 3VWKB 5FKPA 5D1QA 3U1SL 1AQDA 3MACH 4M6NL 1I75A 4A6YH 3FB7A 2V7HB 4OM1L 1IC5H 3ZL4H 2O5YH 1T20B 4X7EC 3JWNC 4JZOB 2MPAH 2R9HC 4EBQH 2JB5L 2G9HB 1ZA6A 3FRUA 1MLBB 4OT1H 4MCZB 2GAZB 4LGPB 2IANE 3QXWA 2R1YB 4CBPA 3K2MC 5I74B 2DD8H 4MWFA 4JREC 5T1LD 3WS3B 3B9DA 3TO2B 1UCBL 4X9BA 3EZJB 3VXPB 3OBAA 5IHZB 3W0WB 4FTVB 3PJSA 1K85A 2BHYA 2D7TL 3LN4B 4KFZC 4F7MA 3MR9B 1F5WA 1BFSA 5IESH 2NY6C 3OKNB 4RZCB 3SCMA 1I4FB 4NN5C 1LP9F 1JTPA 4S2SA 5DJ8B 3LKNA 5FYJL 2CDEB 3CZFA 3K0WA 4WHTB 4RA0C 4ELKB 2LAGB 4OQTL 4OF7A 4HLJA 1QFWM 4KTDL 1J0IA 2Z31A 3O8XB 1M7DA 3A6BL 4BFGA 4W4OA 5HYJE 4ZMAT 5T1MA 4KZEL 4NRZA 3HI5H 3KPTA 2Z0BA 1CGSH 3MV8A 5LJYH 3QPQD 3WEXB 4WWKB 4MCYB 4YDKH 3GMQB 3CCHB 2VOTA 3K1KC 1VACB 3E6HA 3SE3C 2CR3A 3ESUF 4YBLC 4MJID 4PJ8D 3EYFB 4JPIA 3S96A 3F7YB 3CX5J 3N1QC 4XVSH 3QUYC 5L2KB 3TIEA 3UTSB 1K8IB 4X6CE 4JM2D 3PL6B 3C8KA 4U3HA 3GBMH 2EDQA 3N0PB 4JN2B 4L4TE 1JYXA 4OZGB 4XP6H 4F9PA 1NUGA 2J8UB 3CZJA 4PYHA 4TSAL 3VFTB 4EXPX 5JW3L 3WFEH 2VLRE 4TQEL 4HJGA 3MXVL 5JQ6H 1MCPH 1JGDB 3AREA 4K7FB 3MODH 5GS0D 1WWBX 3GJEB 5F7MC 5D5MF 4X7TA 5ID0B 3VI3F 1TZIA 3JUZA 5EBLA 4HGWB 3MV7A 3BKMH 3OGOE 4NYLA 5ESQB 4PJ5D 1OL0A 3UTPE 5C0CD 4LSVL 4X6DE 4MXWL 4NZUL 4GRMA 3REVB 3D48R 1U8NA 2B1AL 2ZOKB 2WUCH 3O3BA 5FUZH 4F33B 4OUUA 3QXAB 1A1OA 5JIPA 2V2WA 4Y4HA 1YYML 4UILL 3VWKD 5KN5A 4GG6F 1KB9J 4GMTL 4LLYA 4MX7B 1Q72L 3T3MF 1BFVL 2QADC 2EKJA 5DYOA 4OCNC 1VGEH 3UO1L 5J3HC 2VN4A 4PJHF 3WS6C 5J89A 3ILQD 2EZ0C 1OTTC 3E1F1 2CKBH 2F5BL 2D2OA 5GISH 3FB6B 1ACYL 2ADGB 3ARDD 2M26A 1ITBB 1BVLA 4GG8B 1B4JL 5DMIL 3P0YL 1JF1B 5JTWA 1X5KA 4H26B 2WLYA 4TUKL 2HMIC 3S36L 1RZKL 1YMMD 3KNBA 5D96C 5GGSB 1NLDL 4OGYH 2X41A 4Y4HD 4XPHL 3O6LH 4OM1H 1TVHB 3QWRA 1EVTC 2VRAA 3NZHL 4K8RL 2EDHA 3BQUC 1D9KC 2VR5A 1RJZB 4HXAH 2IANA 3DTXB 2EDYA 1J86A 4LHUB 2HFGH 1HWHB 4FFYH 4HMEA 4FQCH 5J13B 2HFEA 1CQKA 4HKZB 4Q7DA 1FORL 5JMOC 3FFCD 1FLTX 5IGXL 2XA8H 4Y16B 1LEKB 2R1YA 4U1HB 5DD1H 5E5MB 2OS7A 4LSQH 4W81A 1QO3A 1A5FL 4F8TA 3FN0L 5HYJB 1FLRH 2GJ6B 3STLB 2YN3A 4OCYL 4XNMA 4LSRH 1EBPA 5GS1A 4H20L 5EOQL 3NCFB 3VXSA 4AIOA 5JDSB 3OKNA 3DETD 1HYRC 2X1OA 1IGCL 2C9AA 3IFPA 4XXCA 3ABZA 1X6LA 4RRPA 1H3PL 3CH8A 1R3IH 4PJCE 5K9KB 3WFHA 2V5TA 3FOLA 2H45A 1AC6A 5I1LA 3T3ME 4EI5C 3PV6B 4Y4KA 3X11B 2PN5A 1FO0H 5F7EL 1YEEH 4OD1L 2OL3A 3SQBA 5I1AB 5L2JB 1A6WH 3O6MH 2Y7QB 2ARJA 3OKLA 5B4MD 1XF3A 5F93C 3V0WH 2MMXA 3ES6A 3K81A 3WNPA 3HMWL 1IKFH 3VJ6B 3OAYK 1FN4A 3G5YA 2P8PB 1P1ZA 3KLAA 1UWEH 5C0GA 3DYPA 8CGTA 5IR1B 5F72S 5IT2L 3RWJB 1P69B 3QIUA 4GXVL 3C60B 2FZ3B 4RMVA 5IBUG 5E2JA 3QNXB 4I3RH 4PJXA 2XQBL 1L7IH 5B8CC 4N8CL 4FG6D 3QIWA 1D6VL 5F7KC 1PG7W 3RL1B 4YHPB 1BVZA 1B90A 3IETA 1V7NL 1ZS8A 3TO2A 4NRYB 3ARRA 1CGYA 2BJML 4IRSB 4PJ5E 5EN2B 2OR9H 2VXQL 1JYVA 5GGSY 4LEXL 3IS1X 3UAJD 1I7RB 1Z3GL 1T1ZA 4N8VB 4WO4C 2X5PA 1KNOA 4K7PX 4OAWA 1KCSL 2ORBH 5KVGH 1HCVA 1IAIM 4OLUH 5EC2A 4RQQB 2NNAA 5ERWA 1BVKB 4DJMA 1KIPA 1O7SA 3WUZA 3AXLB 4UZGA 2AVGA 3DX9B 4ONGH 1YQVH 2ITDB 2VXQH 2D31B 2YD4A 3DX8A 2DMBA 4M1CC 3G5XB 1OAUH 3DHMA 4POYA 2Q86B 3QZWG 4YHZL 5E2WH 4S0SD 1NFKA 5F7DA 5A2IH 3MLRH 1NGZA 2NY7L 3GDBA 4FXKA 3TA3D 3GSQA 2VDMH 3EO1B 4UDUA 4NJ9H 5I71C 1KSRA 1YNLH 3PQYD 3NACH 5GGVL 4PREA 1JF1A 3CFCL 2X7LB 1L7IL 1REIA 2FWOA 2VH5L 2W0FA 4LCIH 1OWRM 4KK6C 1YPZF 1F4AA 2H8PA 1G7HB 1DSFL 4LU5L 4JM2B 1OAZL 1WV7T 3X14B 4G43A 3HI1A 3ROLB 1AGCA 3BYYA 1TETL 4KTEL 1T3FB 1MHEA 1AQKH 3QQ3B 1GAFH 4JFYA 3MA9H 3UEZA 5JXAH 2HFFB 1OLLA 4XX1G 5IG7B 4TOYH 3L3DB 4I3SL 1FFNB 2CKNA 2VXUL 3VFVB 1HH9A 5ISZE 2MQ3A 1ONQA 3O2DH 3ZSTA 2X2YA 3QO0B 4UNVA 1FZOA 1HHHB 5BCAA 1R24B 4BZ2H 4Z7WA 1KTDB 3R4DA 5IOPA 1JHTB 3VD3A 2HFTA 4P59L 3RWCB 1BJ1H 4EN3D 3O8XD 2ZOKA 2IBBA 4YUEH 4F9LC 5DVKA 2NR6C 2OP4L 2KZWA 4MD0A 3T3PF 4OD2B 1KIQB 1ZGLA 3KPSE 3P4MB 4RISH 4AL8H 3Q3GA 1OAQL 7CGTA 2VO5A 5DURD 3G9VA 5IIEB 5GZNC 5C71A 5HYQA 3RQ3A 3WMSA 1CXFA 4U7MA 3KAAA 4TULL 3GZKA 3PWUA 4MA1C 3ZMRA 4B53A 2EDEA 3QFJD 3DPBA 3SO5A 4L8BB 3MJ8B 3S35L 2R2HB 5DZNA 5KSVA 2AV7B 3PP4L 1HQ4B 4KXZI 3T8XB 1VGKA 3RWIB 2WZPD 1SEQL 3OR6B 1MHHB 4TNWF 4GRLA 5CS7A 1ZLSH 1S78C 4P9MH 3LKQB 3TBTA 3PABB 3SBWC 5HHNB 1AKJA 5C0AB 3SEPA 4OGXL 4XNXL 5SWSA 4IHOA 3BGFB 3DWTA 3QBTB 3BPCA 1YMME 5DHVH 2GHWB 4L4VB 1EGJH 4R7NA 3OQ3B 4P5TB 2VDRH 4WW1A 3V5DB 3MV11 2XZZA 1LHZA 5C0GB 4GO6B 1OM3H 4PJ5B 1FGNL 3STZB 1OLZA 4PV9B 1K4DA 3CVHB 1L4IA 4Z7VF 4YBQC 5JOFB 1YNTB 2MKWA 1GC1C 3CFEB 3RAJL 3W5MA 1N59A 1T83A 1TJHH 1A02N 4OM0H 4WTZG 1LD9A 2XZAL 4OF0A 4FQJL 4M7KL 3VFSB 3PGFH 4BZYA 5ACMA 4X98B 3KS0H 2Y1VA 4YXLH 4N0CD 1CI5A 2HLFC 4XT1C 2XNAA 4A6YA 2AJYL 5EOTB 1TJGL 4LCWD 5KVDH 2YD2A 43C9B 2X4UB 4NO0A 4JFZL 1S9YA 2WSKA 3EYUH 3IFPB 1G1YA 1T1ZB 4J7RA 1X4YA 1D5BA 1Q72H 2XWTB 3HPJA 2EDJA 4GMTH 4FZ8L 4MDIA 5GRVL 5ITFB 3QUYB 4PRIA 1PYWA 1A7OL 4PJ8B 1U8KB 4NZUH 4YE4L 1YMHA 3ARBA 5I6XC 4JJ5A 1G9ML 1UWXH 3T0BA 3OJMB 5CEZH 2N7AA 2QHRL 3SOBL 1MJUL 4ODTL 3LY6A 1NJ9B 1LGVA 2HRPL 5EBWB 4O2CA 3H9SB 5TH2A 4JM4L 4EUPG 3NMEA 1AJ7L 3HCVB 1QLRA 3TT1H 4I48A 4PRNA 3TBYB 2YA0A 1VEPA 3WIHL 4CNIB 3L3KB 3FONB 4HS8L 3C6LA 4M3KB 1J5OL 3LS5H 5F1IB 2XTLA 1ZLSL 3SGJC 3QPQC 3FQUB 5D71L 3O3DB 1FNLA 1RZFH 2V9RA 4JLRA 4N0UB 1XR9B 2DQDH 2WWKT 3ILQC 3B3IA 4WDIB 3H6JA 3ULVL 1S7XB 4LCCB 2R0LL 3RDTA 1IGIH 4MQTB 5F1NB 4EDXB 4KHXL 5GGQL 4HZLB 4HUXB 3LKPB 2MWCA 4WNQA 3LKSA 1DUYA 4Z7VE 1B0RA 4IOFD 4RGMB 5J6HA 3O11A 3DI3B 1TCRA 1QR1A 3FO0H 2NTSP 3GMNA 4FQLH 4LLDB 4JFED 4LVHB 5DO2C 4U6HA 1JZ6A 1R3JA 3QJFB 2BVEA 3LRHA 1F11A 4KDTC 4YGVA 1QSEE 3I6KA 3HZKB 3K4ZA 3JTTA 4D8PB 1LDPL 1GGTA 3HR5B 4NFCA 2Y5TA 1BGXH 3P0VH 4RAVB 5DVNA 1WJ3A 2NNAB 1ZGLB 1CTOA 5I18H 5CD5C 3TNNB 4ESKA 3BZDA 3ARDB 3FQTB 3D85A 2X1QA 1U8IA 4TOYL 3NPZB 5E9DA 2ZKHL 1TTFA 3LQMA 4Y1AE 3UJIL 5FM5M 3MLWL 3EOBB 3RGHA 5KTEH 4PGDB 4RMWA 3C5ZB 4CVWA 1ZXQA 1OAZH 3FO2A 4FFWD 1Y6KR 3VGBA 5C0EA 4LLUA 3CXHK 1IL1B 2P8LB 4MD5A 4DN4L 5KW9L 1QEWB 2QADB 5E9DD 1JUFA 4PLNC 4LCYB 4M62L 2IAMA 3GMPB 3PNWB 3GJFB 4W6XB 4HIIA 1F45A 3BESR 2ZNXA 3VFGL 5I1EL 2FHCA 2EYRA 2ZJSL 3L3IA 1ADQH 4PRIE 4F58H 4IOSD 1AD9A 2QQQA 1JBJA 4B50A 5BV7B 5J56B 4H8WH 4HJ0C 1J0KA 3F7RA 1N5AB 2ZUUA 4C56A 5A1AA 2X4NA 2MOVA 1RU9L 4G7YL 3V7AE 3O4LA 1IQWL 1IGFL 5GZND 4I5BB 4LSSH 3E8UH 3QUKB 3SBWA 3QWOA 1GZPA 3QIBC 4W68A 4F7TA 3DXAD 3PWJB 1SJVA 4XPBH 5FYKU 4HK0B 5F44A 1JZ8A 3BPLC 3IDGA 3VFUB 1LE9B 1IM9A 1C08B 4P3WA 4PB9H 5BW7A 2ADJB 3LZFH 1INQA 4IMLA 1JPTL 3ZYIA 4DAGL 2ICES 5D2LB 4P23C 1SBSL 3W0WA 3T77A 4OZFG 3TWCH 1JHKL 4DGVL 4Z95H 1F4YL 2ILLA 4LSUL 4ZUUA 3EDFA 3JV5A 5B39A 3PUCA 1YEFL 5T3XE 2E5EA 2VIRB 1CK0H 5D8JL 4U1GC 4UNUA 5C08A 1YJDL 4CU8A 1FZJA 4Y16A 4OF3A 2DLFH 5H8DA 3CVIH 3FFCB 3U6RA 3PWUB 3QHFH 1NC4D 2AJXL 5DQ9B 1I1YA 1WF5A 1U8KA 5FDYA 5HYJA 2OM5A 5DJCA 4NWUL 1H8NA 1JI2A 1RUMH 3IFLL 4DWHA 1CFBA 5EO1B 3FTGA 3SCMC 5LCVL 4YHNB 3S5LA 4XMKL 1U3YA 2EEDA 5TE6L 4XB7A 1Z9SA 5EOCL 2XN9B 3D3VB 3HFMH 1IKNC 3MV9E 1DDHA 1FIEA 3EOTL 3S96B 2W9EL 3NOIA 3M8OL 4YR6B 4FFZL 4X7CC 2M2DA 1B4RA 4NQVA 2NZIA 2Z35B 4XI5C 2ZUSA 1KJ2B 4NWUH 4X4MA 1Z6JT 1D5ZA 4LVNC 5D6CA 4O51B 1FL5A 2KQMA 4UV7H 2RHEA 2AJXH 2OR8A 3QNZA 1QSEB 3HRPA 1ZLUK 5F71A 3SY0B 3IT8D 1DEDA 4JPKH 3DVNB 4KI5D 4QHKJ 2R56L 3EUUA 2VITB 2Q7YA 3O2VH 4QXGL 4AT6B 5CD5D 4P2RE 3HE7C 2NPLX 4V1DB 1ZHLB 3HRZB 2V2XA 3K2UH 4DGVH 1PD6A 4QRTA 1HEZA 4IIQB 1SEBB 2O26U 4BSWB 1QYGH 4Y1AB 5JW4N 3IJYA 1FFOA 3F7VA 1A7QL 4DAGH 4Y7MA 3JTTB 1QA9B 1CT8B 3IU3B 1I9RH 4PJ9D 1FZJB 1PG7H 2BY1A 4NDMB 3IETB 1Y18A 3BN3B 1EUUA 5TPWH 4Y5YA 5JUEL 4AH2B 5CP3A 5FOBA 3CSYB 2DM2A 3ZTNL 1T5XB 5E99H 4WENB 4AQOA 1J0YA 3D39D 3ARWA 5HY9B 4CW1B 1UYWH 1S7UB 3WXVH 5HGDA 3HC4H 4X6BA 5D7IA 3LEYL 3UJJH 5IUSA 2J1KA 2G75B 1CFVL 4LKCA 2DAVA 3VI3E 3C2SA 5D1QC 3HR6A 4S1DD 2ICEB 4MVBC 4GOSA 1UZ8A 5IB4A 1RZKH 1Z0MA 3QG6B 3MMEA 3QXDA 5B38A 2XXMB 4I0PC 1KEGL 3RI5K 1A21A 4X6DF 2MHAA 3T1WA 3VFNB 4FABL 4U05A 4ENED 4HG4K 2AQ3A 1VPOH 3RGVD 4YX2H 5GXBB 4P46B 5C08D 5GISL 4NQEA 1JRHI 3PIQB 4J3WA 5I1HL 1URLA 3MCKA 1CBVL 2ZG2A 4LGRB 5KOVC 2EYTB 3UJIH 5C0JB 4UT7L 2AV1A 1UEMA 2EICA 4GW1A 5FM8A 3SGEH 3Q6FA 2P43B 5BXFB 5E7FA 2VUOA 2NLJA 3QUXC 3JWDL 3L9RA 3G08B 3O4OB 4RDQG 4AT6A 3U0PA 5T3ZE 4Z8FL 4ZXBC 1MCSA 2EIZB 3IDMB 2IAMC 1KJ2H 4WFFE 4PJHE 5L0QC 4ELME 4HEPG 4O9HH 4X6EB 4KQ4H 5C8JA 2VC2L 2A6JA 2H3NA 4HS3B 1CLCA 2EZ0D 4HF5L 4XBEL 5F7FA 5CILH 3QEHB 5IFHH 4EVNB 4P4KB 4UTBL 3D2UD 3PWPB 32C2B 2WP3T 5BJTA 4IDLA 3WS3A 1KELL 3QUMB 2LU3A 2VABA 1FSKC 4LBEA 4BH8A 1J0JA 4JRXA 3MODL 3V6BR 5I8KH 1RZIA 3U4BL 2XN9E 3D3VE 5ADOH 5BOZG 5CSZA 25C8L 3ULVH 5I1LB 4NO3A 5HGGS 4NGHH 1CFTB 4GS7B 5D6DA 5C6TH 4PJDF 2YUWA 4KGJA 2AABH 1ED3A 3MBEB 5F89B 5I16A 2WUBH 4JKPH 2X9YA 1MFCH 2WIMA 5EO1A 4HJJH 5DJ0A 3K8MA 5FO7A 4LLVA 4PJDA 1A3LL 1AJ7H 1YECL 2VXSL 5JXEC 4KU1A 5MENA 3BXNB 4QRSB 4KC3B 4LPUA 3C08L 1FVCB 4KGLA 5INDA 5ISZD 4CVUA 1A9BB 4L9LA 4NUGH 1WBXB 4PD4K 2XOTA 3E2HC 1A6VL 2YKLL 2ADFH 1MHEB 2CUHA 5I0DA 3W9DB 3HI5L 3V9FA 4JGJA 4PJAE 1TIUA 2R0WH 3UPAA 1S5HB 4XNZB 4KK9D 4MDJA 2Q8AL 3SY0A 4M43H 2DM4A 2I07A 1KC5H 4HUUB 2XFXB 2FIKA 4C57C 3SDYH 1I1AD 2AJSL 4DQOH 3RUGB 4HUWA 5J0BA 3WIFA 2VQ1B 4JVUA 2YOCA 5HHVL 3I85A 5SWZB 4JFZH 1SHMA 4L8DA 4PJGF 1RFDH 1FV1A 1P9MC 1LE5A 2N1KA 1TENA 4M9OA 4JCMA 5GRUL 4WFED 1QBLH 5E2UH 3WXWL 4F7CB 5L7XL 3RKPA 3SDDB 2XZAH 5HVHB 1UH4A 4OM0L 4ALAL 1UJ3A 4OZFH 4PRBB 2O5YL 2R2HA 2ICWJ 4NZJA 4JR9H 4M00A 2D31A 3ARED 5DRWA 1NMAH 2NY0C 4OCWH 5I1KH 5DA0B 5DR5H 4RIRA 5ITBL 3RGVC 1XGTB 2X4OA 4QRQA 1EH9A 2CKBA 3L5IA 4HIXL 4N68A 3SKUD 3IXAA 1INEL 1I1CA 5FUOL 3RVWD 2CK0L 3EO0B 4ZTPL 1JGEB 3L7FA 1WWAX 2LFGA 5I1GL 1R0AL 1FYHB 1ND0A 3BQUA 3VFPB 4S1DC 4GKNB 1FPTL 5DURB 2UWEA 3CFJB 5LQBL 5TF1L 3DMMA 1A1MB 1JFQL 1RZ7L 3VWKA 1IGJB 4YEEA 3WJJC 3AVEA 2DM7A 3QQNA 4GG8A 1E0OB 3QDGD 2Q6WB 3KPQB 5JNYB 3KPOA 1U6AL 5DJDB 1RHFA 5TE4H 3F12A 4MZ2A 3BKCL 1CU4H 3DVNA 2G2RB 4JPIB 4KK8C 3U4BH 1D7FA 1T04B 2XFXA 1NUDA 3OKDB 4O00A 4YZFF 1QSED 2VE6B 5T3XL 4YAQB 1CVSC 2J88L 4KJWC 1MCOL 4RISL 2QSCH 3DYOA 3DX7B 3KPRA 3ZKXC 5CILL 3HKFA 4HF5H 1JPST 3MRKB 2NTFA 4L4VD 1OTSC 1XR9A 5HHXL 3MR9A 2DJUA 1SMOA 2XKNA 3RWDA 3T65A 5L8KB 2HT4C 2H32H 1JV5B 2R2CA 4JRYB 4E41A 5DWUH 5EO9B 5E8EB 5GRXG 4DVBB 3WL9B 3WFCL 4HWUA 3MLPA 1A4JB 1SM3L 5DFWH 3UBXA 3CFBB 4NQSA 1HN1A 1WCBB 3MO1A 3OKKB 4BJLA 3QEUA 3QJHB 4M5ZH 4ZXBA 3QEGH 3X12A 5ALCL 1MNUH 5T1MB 2PO6A 5GZOC 4YJZL 1GAFL 2F58L 1N6UA 4WUUD 3W39B 3HZKA 2X4SA 1VPOL 4YX2L 2DMKA 1T66C 4Z7UA 3EKCA 4WHCA 3RZCC 4YIQA 1ZHKB 5EO0A 4MX7A 3RA7H 1YNKL 2Z4QA 4YXKH 1T1WA 4YDJB 4MJ5A 5DJZA 1HCFX 2HVJB 3C9NA 3VFMB 3TYFA 3QI9A 1AY1H 1KCUH 2DQFB 3RI5F 3NACL 1X5XA 3D5OF 4OIAA 1U3HB 1FIGL 4YO0B 5GGVH 4X8XA 3DMMB 1VCAA 3RUGE 5KSBB 4F7EB 5C2BL 2DQIH 4PRPB 3QQ9D 4NWTL 5DJ2A 1XGPB 4XZUB 2GJ6D 4N8PA 2DN7A 4IEFB 5F6IC 2ZUQC 2Y23A 1DUZA 4LAQH 2NYYC 2WBJB 3OSKA 3D6GA 3AREB 1U8LA 1EAPB 2OJEA 4NNYB 4C54A 3H42H 5EU3B 3H9SD 5DC4B 3BO8A 1NCBL 2GSIA 2CRIA 4KHTH 1VKXA 3MGTB 2E3VA 2DDQH 4LVHC 1JMZA 4HWBA 5CUSH 1HNGA 3I84A 5D5ME 1NSNL 4I2XB 5I8OL 3TBVB 4HCRL 1HSBA 2P5ED 1OB1B 4BK5A 3PDOB 4MAUL 1G7PA 3O2WL 4TYUA 3C60D 5DFTA 5DUPH 5DUBB 4K7PY 2HJLA 1CLOL 4HWZB 2O93L 4JZJB 1Y6NR 1Q9OB 3U30C 4XNQA 2X4RB 2GTWB 3EZ8A 3TV3H 1F4HA 5EFIA 4S2SB 4MNGA 1FL3A 1W0WB 4JHWH 3CMOL 5LGJB 5I66B 2CR6A 2HT4D 2VLLB 3ROOA 1ZSDB 3ZTJH 4UAOB 2VDNL 4XMLL 3RJDA 1MSPA 1GZQB 3LQZA 1CG9B 1V8HA 2EXYD 3NCEB 3LKRB 1XGTA 4L29B 4MJ5B 5DJZB 3L1OL 4ERSL 5E6ID 3M8OH 5KVMC 1FYTA 4X9HA 1BQHA 1GGCL 1BFTA 2DQFA 4ZUTB 4CMHB 4CADA 5KG9A 3VXUE 1WFTA 3MYJA 4QOKD 1GGCH 2EEAA 3QYCA 2APXA 3HMWH 3LN5B 2FR4B 5EWIL 3BXNA 3GKWH 5A16A 5FAAA 1JWMA 4NO5B 3VXMA 1XCTB 3IDNA 3MRQA 1MAKA 1JVKA 4D0DA 1YEEL 4UTAL 3UDWC 3LSOB 5HHOD 4O2EA 1RK0B 3MPCA 3EJYC 3OGCA 5SX5K 2NZ9C 4PG9B 3N1MC 3VXRB 3QWOB 4KDVA 3BSZL 5JPNA 5GRJL 3RDTB 1EEUA 4TTDD 4HUWB 4FFVD 1NCAL 3DUHA 4IRJA 2DS4A 3EYSL 5EZLB 3C6LC 3MGTA 4XGZB 2AJZA 4HSQA 1MFDH 5SWZA 1N7ML 5EOQH 1JZ3A 3IU4L 4MS8C 1OB1A 5CEZE 1HIMH 3GMNB 2GKIA 1UQSA 1ZHNA 4FQXA 4GLRI 1NCUA 3O3AA 5EOCJ 1DBJL 1YC8A 1FL5B 1A5FH 4OZHE 4HCRH 1Q94A 2P5WE 4C59B 1UM6L 1F90L 2GFBB 4PY7B 4L8CB 1ORSA 4Q9CA 5CGYD 1IFHH 3MSPA 3BKYL 1MH5B 2R1XB 2JJTC 1G9NC 2A77L 5F6HJ 4EJ1C 2HA1A 3KPNA 3I02B 3VWJC 1KGCD 3B9KC 4PJGB 5CZVL 1OGAB 3IF1B 4LAQL 3UTTE 3BW9B 4XPAL 4HXAL 4ODUA 4OD2A 2OL3B 4LEOB 3KYNB 3TN0D 2JLLA 5F3BB 4R97B 3B9KD 1S9VB 5DF0A 3TO4D 2OZ4A 5EIIB 5BRZB 4CDHA 3SHSA 5I1EH 4YEFA 3HC3L 3NH7H 2EDOA 1NFDE 4WI4A 5T1KD 5J9PA 1NGPL 4FQXD 3DSFL 2Z4QB 4QXWA 1Y18B 1F4WL 3PHSA 2GQHA 5F6IB 3BZEA 1A7PH 4KROC 4ZO8A 4AJ0A 3MJ8A 1ZHBB 4K71B 2ITDA 3P0YH 1OARL 2Y06L 2ERJC 2PO6C 3VRJA 3IRZA 1II4E 4PP1D 1ACYH 3GSOA 5CHNA 3QIUB 1F97A 4NT6B 5ACLA 4MS8D 5I8EB 1KUMA 4HKJB 5E5UB 2Z93B 1OAKH 4H5SA 1DLFL 3CJJA 1LO2H 3SO3B 3P11H 1NCCL 5FYKE 1Z2KA 2XQYK 1T7YA 1JGVH 4R7NB 1AFVL 2AI0L 1U93B 4JY5H 4PGZA 5DLMH 5BZDB 4HD9A 4HX1B 3TO4A 5IBLC 1P7HL 2B4CC 3VGGA 2PW2B 2JELL 2YHGA 4LPXA 4ZUSA 4D0CA 3JVGC 2VKXA 2VWEC 2BY2A 4XCCH 5EB9A 3ROLA 1IBGH 5JHDB 4JHAL 4G6AC 3O9WB 3REWA 2X9WA 4MXQC 3HZMA 1CDJA 3MRDA 3VFVA 2E8YA 4HQQH 2A6IB 1HXYB 1S3KH 3DROB 3UTSD 5GGRA 3EFFB 4NRXB 5GGQH 3MROA 4KHXH 3LS4L 1MCJA 1TZHB 1NKRA 2R9HD 4M9PA 4F7MB 2HJKB 1JPSL 4ZG1A 5IWLA 1U8QB 4AEIH 2XZQH 1G6RB 3JWOC 2ATPA 3WE6A 1NMCC 1ZANL 3LKNB 2VXTH 1A7RL 5FYLE 4LKCB 4JQXC 5DMGC 3HNSH 3V5HB 1RVFH 1S9WB 3NCJH 4NNPL 1AQDB 1RPQA 3ZDXF 4QHLB 5EPMA 3VXRE 4YO0A 4H1LH 5FUOH 3V7MA 5FYKD 3BN9C 3OB0H 5CSGA 2DYPA 3QXUA 5K93A 3S37L 2BFVL 1AXIB 1HXMA 1W0VB 5K9OB 1GPOH 1IVLA 1YPZE 1N3NA 1NBYA 3I6GA 5DEGB 2E6QA 1N2RA 1H3WM 1U8JA 5H94B 5LAXA 1RK0A 3MLZH 3P3YA 1X5HA 2F53B 4L4TD 2FD6L 1RQ5A 5D1ZA 1I7TA 2EIZA 2G60H 4KDTA 1CD0A 4P9HL 5E7BA 1WITA 1AGDA 5DXWA 3GGWA 1HYSC 4V1DA 4OJFH 1J8HA 1ZOXA 5C07A 3MOBL 3GJFH 3KJ4B 5F88A 3CLEL 4NKIH 4B7LA 1ZVSA 5EU6E 4PRAA 2ZCKL 1T7ZA 3RGVB 1KEMH 4YFEA 5J6HB 5SV4A 4QRUA 3PGFL 4PY7A 4M3JA 3CCHA 4WU7A 1S7WA 4ZFZB 3SKNB 3ROOB 1KIPB 3HE7A 3K8KA 1M6OA 4X80H 1I3VA 2NZ9D 1S5IL 4FMKA 4MB5A 3QQ4B 5KAQG 1NANI 4IRZL 3IFOB 3O6FA 4HIEB 2PKDA 2X4PA 4LLYB 3WLBA 4FQ1L 2EXWC 4UB0H 3PWNA 1D5IL 1GCFA 1S7TA 2VDRL 5DRZB 1WBYA 2XYCA 2E9BA 3DXAE 4G6JH 2DWEB 2OTWA 5D7IB 4G9FB 5DD6A 5D4QA 3QFJA 1MIML 2FX8L 1G7MA 3L5JA 4OGXH 4S1SH 3UPRB 1JNJA 4NO5A 3VXMB 1DN2A 1NBVH 5DQJB 3T4YA 3CFKB 1U58A 5IW1B 3VWJA 3T2PA 2WAHA 4KJYA 4X7TB 4K9EL 2AABL 3LMJH 4K3EL 1ACZA 3V6ZA 5JIKA 3EBAA 1D3CA 1EA9C 4Y5VC 1NBYB 1IQDA 1J7VR 1U8HA 2W92A 4DGIL 4JG1L 2R69H 1L7TL 2XG4A 3MREA 3I2CH 4XB8A 5I76A 3MOAL 4QXUH 4OD3H 3X3GH 2C26A 1U8NB 1A9EA 2J7LA 5E6IC 5KS9B 4Y8DC 2YZ8A 1NDGA 3NVQA 3PL6A 3VXNB 3PWVA 4EI6A 3P9MA 2EDNA 3MFFA 3O4LB 2R4SH 1QTYT 4AEFA 3MGAA 3U9UB 2A6JB 2H3NB 5I8CB 4X7SL 2Y72A 4HKZA 1F13A 5E1AA 5GS0L 2A6DB 3ZTJG 3T0DA 3BGMA 2EDXA 5D7KE 2VE6A 3TZVB 3OPZH 4GAYA 4OZHA 5FYLL 3VXTA 3FB8A 3OF6D 1DQML 4FS0A 4J12A 3BZ4A 3QQ4A 4WI7A 1Q9WA 4LNRA 5MI0B 2XPGA 4U3CA 1HOCA 4ZAKB 5JDSA 4BQ8A 3VXSE 5DHVB 3TBWA 3HZVB 4U1IB 2E6JA 4LU5H 3AY4A 3MRHB 3BEVA 1X7QA 4X6DA 3NA4A 1IM9D 1YN7B 1KEGH 2A2QT 3F5WB 1ZTXL 5C0IA 3NZ8B 5BS0B 5MENE 3D85B 1C5DA 2XZCL 3THMH 5C9KA 1IILE 5DJCB 1MLCA 4PGCA 2A83B 1AHWA 2FJFA 1LO4L 1K5NB 3T4AB 1SMAA 2E7BA 5DJYA 5ILTH 4P4RB 4YDIH 3VFTA 4GUPB 3A67L 4LQFH 3P4NA 3ZDYE 5I1DA 2VNCA 2AEWA 3FJTA 3UMTA 3V4UH 5GZOD 3RU8H 2CLRA 3AM8A 3ULUE 3NIDF 1YEDA 4ISVA 1LNUB 4NYLB 4LHJB 5AZ2H 2B5IB 4Z0XB 3TCLA 3ALXA 5EUOA 1QR1B 4L3AA 2VXTL 4LSPL 1WCQA 2C5DC 4J2XA 4U1LA 4LCWB 3P4OB 4QCIA 4RFEA 1R3JB 4FHBD 3Q48A 1A7QH 1AD0A 1I8MA 5E70A 4PJDE 5FGCE 1FZKA 3QIWD 2P44B 3L6FB 2WWMD 3CPLA 1A6UL 2A6DA 1DFBH 3MNZA 4M7LT 3HG1E 2BSRB 2FATH 2VDOH 3BD3A 2VZUA 4MQXD 1J10A 2XG5A 3Q5OA 5GS2D 3DBXB 5IROC 1LEIB 5F3HB 4EUPH 3VG0H 4LP4A 4NKOB 5DRXB 4JPKL 4UBDC 1S7WB 1UGNA 2K7QA 5J8OA 1BZ9A 2F8VA 4IMLB 4XCCL 4F2MB 1W72B 3WHXA 4JFPB 5AAWA 1FZMA 4QOKE 1BF2A 2H2PC 1VFUA 4JZNB 5GS1B 3U0WL 4R4FH 4U1MB 4GRLC 4HWBL 4Q6IB 1TNNA 3A0OA 4IOIB 2ZPKL 3DOSA 2GITA 4L9DA 4NQCD 2VL4A 1OAKL 3SQOH 3HAEH 3V0WL 3TESA 1MPAH 1G9NH 1PX4A 2QLVB 3RTQB 5IMLB 5F7DB 2UWEB 3CFJA 1AR1C 1XF2A 5HGDB 1UB5A 1CG9A 2JTDA 2FH6A 2UUDH 1QFWL 5HVFB 1Z5LA 2IAMD 2MTPA 1QFWI 1T83C