2C1SA

X-ray structure of biotin binding protein from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
b'RKCELQGLWRNELGSNMTISALDVAGTFSGSYQTAVTATNKQILVSPLKGAQQPPGTKGQQPTFGFTVQWQFADSTTVFVGQCFVDRRGKEMLEMAWLLREEVPSRKDTWKATRVGTNVFTRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOTIN BINDING PROTEIN A
publication title Structure and Characterization of a Novel Chicken Biotin-Binding Protein a (Bbp-A).
pubmed doi rcsb
source organism Gallus gallus
molecule tags Biotin binding protein
total genus 23
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 2c1sA00
2C1SA 1NQMA 3RY2A 1VWNB 1SWEA 5K68A 4Y5DA 3FDCA 1LUQA 2RTMA 4JHQA 5IRWA 1PTSA 3WYQA 1RSUB 2IZIA 4IRWA 1NC9A 5IRAA 2RTNB 1KL4A 4CPFA 4I60A 3EW1A 3WYPA 1SLEB 1MM9A 1RXHA 1VWPB 1SWLA 3RY1A 3RDXA 2IZGB 1NBXA 2RTJA 1WBIA 2UYWA 4U46A 4BX7B 1VWGB 1SWRA 4CPEA 4EKVA 1Y53X 2A5CA 2AVIA 4GJVA 1Y52X 2RTEB 1MOYA 4OKAA 1VWLB 5CSEA 2A5BA 1VWIB 1LDQA 4BX6A 1KFFA 2RTDB 3RDUA 4GGZA 3RDMA 3VHIA 1IJ8A 4CPHA 2QCBA 2A8GA 2Y32A 2IZDB 5L3YA 4CPHB 1HXZA 1SRIA 1VWDB 2OF9A 3RDQA 3X00A 3T6FA 1VWJB 1VYOA 3EW2A 2FHNX 4GJSA 1SRGA 1SWAA 1STPA 1MK5A 1DF8A 1STRB 2RTPB 2IZCB 4DNEA 1SWJA 5B5FA 3PK2A 1SRJA 1STSB 2IZHB 1SWTA 2UZ2A 2IZFB 1VWOB 3WZOA 1N4JA 4GGTA 1SREA 1N9MA 2RTOB 1SWOA 4Z28A 1SLFB 4BX5A 3T6LA 2RTAA 1RSTB 1SWCA 1VWMB 2IZEB 4GGRA 2BC3A 1SWPA 2MF6A 4GD9A 2OF8A 1VWRB 1VWCB 1N43A 1VWEB 3T2WA 4BX6B 4Z27A 1NDJA 3WZQA 5JD2A 2G5LA 1VWAB 1Y55X 2Y3FA 1SWQA 2C4IA 2GH7A 3SZJA 1SWNA 2JGSA 2RTIB 4GDAA 2IZJA 2IZKA 2RTKA 2Y3EA 1KL3A 2OFAA 1MEPA 1VWKB 2RTLA 1SLGB 3WZPA 1HY2A 5F2BA 4BBOA 2F01A 1HQQA 2IZAA 5B5GA 1SWHA 4BX5B 2C1QA 5K67A 2WPUA 1LCWA 1VWQB 1HXLA 2FHLA 3T2XA 1SWBA 4Z2PA 4Z2VA 1AVEA 1SWUA 4JO6A 1LDOA 2CAMA 2OFBA 3VHMA 1N7YA 1NQNA 1SLDB 3VGWA 4BJ8A 1LCZA 2IZLB 1SRHA 1VWBB 1RXKA 3VHHA 2RTFB 1KL5A 1VWHB 1RXJA 1SWSA 2RTRB 1I9HA 2RTHB 3SZIA 1SRFA 4BCSA 1SWGA 1AVDA 3RE5A 1RAVA 2RTGB 1VWFB 4BX7A 4Z6JA 2RTBB 4CPIA 3MM0A 3WZNA 3RDSA 1N9YA 2RTQB 4Z2OA 4Y59A 4JNJA 5IRUA 2IZBA 3RE6A 1SWFA 2ZSCA 3MG5A 5CHKA 3RDOA 4YVBA 1LCVA 1LELA 1SWKA 3SZHA 1SWDA 2RTCB
chains in the Genus database with same CATH superfamily
3KVNA 1GKAB 3WVMA 2KD2A 3KZAA 2BS6A 3EBWA 1NQMA 1ZNDA 4GU8A 4I3CA 3ZW0B 1VWNB 5K68A 1X8PA 3FDCA 4HPAA 1PTSA 1T8VA 3WYQA 3FENA 4Y0RA 2ZAIA 5B10O 1NC9A 5IO6A 5B29A 3FELA 4OEMA 5IRAA 3S26A 3ZWEA 1UYOX 1PBYA 3ZUOA 4ORWA 4CPFA 3ELZA 1FTPA 1CRBA 2HYSA 2GTLM 2FKJA 1SWLA 1FEMA 5IXGA 1GX8A 4YDAA 3RDXA 2JOZA 1GM6A 2LFOA 2UYWA 4BX7B 5CE4A 4CK4A 3NPOA 1GGLA 2A2GA 1SWRA 1JYDA 1R0UA 1X8QA 4CPEA 4EDEA 1S7DA 3P6CA 1YWAA 3PQSA 1Y52X 2RTEB 1YWCA 1WUBA 2WQAE 3FYFA 5CSEA 5FQ8E 4TKJA 1LICA 4FBRA 2RTDB 4TLJA 1ADLA 2AMMX 4GGZA 2L67A 2OFRX 1I78A 2Y32A 3F8AA 1EPBA 5AJCA 4KIIA 5FQ7E 5L3YA 1E5PA 4NYRA 2OF9A 3CWKA 1VYOA 2OZQA 2FRSA 1E02A 4HFOA 1GT1A 4GJSA 4YKOA 1SRGA 1HBPA 1SWAA 1MK5A 3D97A 1STRB 2R56A 2NNDA 1ZNEA 1O8VA 2QOMA 4AW8A 5KHPA 1SRJA 1STSB 3B2KA 2UZ2A 1EPAA 2QOSC 2WEXA 2N93A 4ODDA 2CBSA 3WZOA 3ZW2A 4RUUA 5B2AO 4YCEA 4CDEA 1N9MA 2RTOB 3UEXA 3SLTA 2LBAA 3O22A 3T6LA 1L6MA 1SWCA 1GXAA 1FENA 1O1UA 1DF3A 1ERXA 4K19A 4KC7A 2MF6A 3BSZE 3WJEA 3U9PC 2K23A 1VWEB 2G8CO 3T2WA 3UEWA 2Y3FA 1X8UA 4YFPA 4N7DA 1G5WA 3B2IA 3C76X 4YGZA 1X8OA 2Z4IA 5HZ8A 1QFVA 5IO5A 1W6FA 2JGSA 2E4JA 2OFMX 3N91A 4TQ2A 5FFHA 2OL7A 4QAEA 5HCEC 3P6FA 2ASNX 5FQ6E 4YDBA 3S5VA 1Y9LA 3EC5A 4U3QA 3K3LA 3FR5A 2EU7X 4EQAC 5LKEA 1HY2A 5F7GA 1OBQA 1OPAA 5F2BA 1MVGA 2F01A 3KQ0A 1HQQA 4AZQA 3JS1A 3HWDA 1SY0A 3PH6A 4IABA 4GH7A 4IBAA 4WFUA 3D4RA 4M6SA 2WPUA 1EIIA 1MX7A 3FA6A 4NLIA 1GT4A 1LNMA 1AVEA 4JO6A 4EFGA 2OVSA 2JMBA 4IB7A 2ANSA 1SY1A 1A18A 3UEVA 4QZUA 1LCZA 5B27A 4ZGFA 4NNTA 3HOEA 2OY7A 5BVTA 1CBSA 1VWHB 2GTLO 4ZJ0A 5K06A 2RTRB 1I06A 2L9CA 2NNQA 2HNXA 2RTHB 4O3XB 1SRFA 3SZIA 4YGGA 1EXSA 2OVDA 1AVDA 1HN2A 1S2PA 1XCAA 2QO6A 2KT4B 2VFBA 5FAZA 3OD9A 2XSTA 3MM0A 3NX2A 3RSWA 1MUPA 3B2HA 3RDSA 3WJFA 1BWYA 2L68A 5LKFA 4Z2OA 1VPRA 3FA7A 4YMYA 2AF5A 5B11O 2FKGA 2W2BA 4AZRA 1SWFA 1BEBA 2ZSCA 1H91A 5CHKA 4A1YA 4YVBA 1XKIA 3FLLA 1G85A 3SZHA 1SWDA 1GKAA 2LA7A 2RTCB 4GDAA 4HPDA 4LZVA 1BLRA 5HZ5A 4A1HA 2M4LA 4NLJA 4QGWA 1SWEA 5AJBA 1CBIA 3CKFA 2KTDA 4LZUA 4ZHCA 1LUQA 3TGBA 4FBOA 1OBUA 1E2TA 2RQ0A 1RSUB 4I3DA 1AELA 4IRWA 1N0SA 1T0VA 2PY1A 2RCTA 2RTNB 1GT5A 1ICMA 3FR2A 3HTYA 4I60A 3EW1A 4ORUA 3WYPA 1KGLA 1MM9A 1RXHA 1VWPB 1EI5A 2MWHA 3U0DA 3HWGA 1KQWA 3O19A 4ORSA 1SY2A 1KOIA 2XKLA 3B2JA 5EZ2A 1NBXA 2X32A 4U46A 5LJGA 1VWGB 2QO4A 3MBTA 2JU7A 2A5CA 2IFBA 4GJVA 1JQPA 1SXUA 2AL0X 1SMPI 4LKTA 5FENA 2X56A 4MISA 4BX6A 4GNYA 1BRPA 1KFFA 2RD7C 3C77X 4LQZA 3CKGA 1A57A 5D4AA 4GRJA 3P6DA 5D8JA 3TF6A 3VG7A 2QCBA 4NV7A 4IB9A 1EIOA 4NYQA 3Q6LA 2PI3O 4U8UO 4QYNA 5EEDA 4KCAA 2MHDA 1VWJB 3EW2A 4O49A 1IFCA 2FHNX 2YMSA 3HK1A 4HPBA 3VU1A 1BSOA 1YIVA 3FR4A 2OL6O 1DF8A 1YWDA 1KQXA 5LJBA 4ZH6A 4DNEA 4ZFXA 1SWJA 2Q4NA 3RBYA 1KZWA 4UU2A 4QGVA 5AEOA 3TGCA 1Y9TA 3EMMA 3BRNA 3PK2A 1SWTA 3VE2A 1TVQA 3L4RA 4ZHFA 3BLGA 5D48A 1I05A 5EPQA 1DFVA 1SWOA 1FELA 3P6GA 5LJDA 4BX5A 4YBPA 1VWMB 1EUOA 4IB6A 1DC9A 5C0NA 1X89A 3FEKA 3P6EA 3U03A 2F09A 2ACPX 3FIQA 1SWPA 3OE3A 1TOWA 2OF8A 2WQ9A 4NW4A 3FW5A 4BX6B 4Z27A 5HZ9A 4CSBA 2AH7X 3WZQA 2G5LA 1VWAB 1Y55X 3CMPA 4I9RA 1P6PA 5AQ6A 2GH7A 2WUTA 3SZJA 4YCHA 1A3YA 4I9SA 4XMCA 2G7BA 1KT3A 1SWNA 2X55A 4U8UN 1DZPA 2WEWA 4ES7A 3UAQA 4YBUA 2Y3EA 3HPEA 3P6HA 2OFAA 4HWMA 1HBQA 3KFHA 3LHNA 1MEPA 1VWKB 4IMNA 4TNNA 3AEHA 5D47A 1LIBA 2AT5X 3KFFA 2L5PA 3QQ2A 4DQ3A 1ZNKA 4Y0SA 4ZR2A 3S60A 3OJYC 1I04A 4WFVA 4IAWA 1KT4A 2FWVA 3HOLA 4BX5B 2LB6A 1PMPA 3PPTA 5K67A 1GT3A 4B55A 3NQKA 1FE3A 4Z2PA 4O3WA 5D45A 4Z2VA 2HZQA 4NV8A 4RUNA 1MX8A 2AT6X 2CAMA 1BM5A 2DJFA 1SRHA 1VWBB 2GTFX 5LJCA 1D2UA 5L8NA 2FGSA 3TZSA 2A2UA 1A2DA 2I5VO 3VHHA 3SLJA 1RXJA 1TXLA 5HAEA 1NGLA 3ELXA 4MVKA 4GETA 3HWEA 2OVAA 3VG5A 1U18A 2RTGB 1VWFB 4I3BA 4UU3A 2POAA 3BX8A 3WZNA 1LF7A 2BS5A 2RTQB 4ZCBA 3G7XA 4A8ZA 1JJJA 2OVEA 5IRUA 2X8SA 3O2YA 3MG5A 2ALLX 1EQDA 2RA6A 2JW1A 1SXXA 5H9KA 2CM9A 1LELA 1Z24A 2C1SA 1JZUA 4YH0A 3BU1A 3PQUA 4Y5DA 1IIUA 3BS2A 4JHQA 4OS3A 1JV4A 1GX9A 1ALBA 2IZIA 1G7NA 5LJHA 4GK9A 4I6SA 1BRQA 5HCDC 1QABE 4PJ2A 3AKNA 1KZXA 1UYNX 2FT9A 3NQ9A 4CDFA 1CBQA 4ZHHA 1OEEA 4TKBA 4O9SA 1JBHA 3VG3A 3OBLA 2RTJA 1WBIA 4QNIA 1KT5A 2Q39A 1MDCA 2QO5A 4QQ1A 1VWLB 4IB8A 1UREA 2A5BA 1AB0A 1LDQA 4Y0PA 2WWPA 3DTQA 4BQUA 4ML7B 2KW1A 1LIFA 3VG2A 2R74A 3RDMA 1IJ8A 3APVA 3VHIA 3NX1A 5H8TA 2A8GA 2ACOA 2IZDB 4N7CA 4CPHB 1HXZA 2CBRA 1SRIA 3RDQA 1FDQA 3X00A 1DZJA 1QY0A 1K24A 2YG2A 3FEPA 3NADA 3NP1A 4U9CA 1BSYA 1HMSA 3WJBA 3FIDA 4MIRA 3I0AA 3STMX 1GX3A 2IZCB 5HA1A 4C5PA 1AVGI 1IKEA 1JYJA 2GJ5A 2LBVA 5B5FA 2P8GA 4MVIA 3SLOA 2GTLN 4O4XA 1RBPA 2IZFB 3UEUA 2BT9A 1VWOB 4ALBA 1N4JA 1LIEA 1KT6A 1SREA 3LV4A 1QQSA 4Z28A 1SLFB 3ZW1A 1YP7A 1ACDA 2RTAA 2IZEB 1TOUA 2X8TA 3CBCA 1I4UA 5DG4A 1G74A 3TGAA 2BC3A 1FJ1E 4XMGA 5L8OA 4GD9A 3RKGA 1TW4A 1VWRB 3WJDA 3APUA 3PEDA 3VE1A 4EEJA 3WJGA 1OEJA 1NDJA 3MVFA 4AZOA 4YKMA 4O3YA 2Q9SA 4ORYA 5KICA 1SWQA 2C4IA 4OMXA 2QM9A 3EBKA 2O62A 3CQNA 3RE5A 4EXZA 2FS6A 2HZRA 2RTIB 3VG6A 4OMWA 1IW2A 5F58A 2IZJA 1SY3A 2RTKA 4LKPA 2X46A 4A60A 2RTLA 1SLGB 4QYPA 2NNEA 1NP4A 2AT8X 3WBGA 3WZPA 4D6AA 5HBSA 1SXWA 3ZI8A 5DPQA 2LKKA 5EDCA 1EALA 2DJGA 2G79A 4BBOA 1ZRYA 2IZAA 4GDZA 1OPBA 5B5GA 1SWHA 5IO7A 4WHIA 4KT5A 3ZW1B 3NQ3A 1Y0GA 2C1QA 3PECA 1LCWA 1VWQB 2MJIA 1B4MA 1QFTA 2I5ZO 4Y0QA 3JSQA 1SWBA 1OSPO 2HKDA 1SWUA 3FA8A 3WJCA 5HTDA 4O4UA 1BJ7A 3APXA 2OFBA 3VHMA 1N7YA 1NQNA 2AT0X 2MO5A 1NP1A 4ZGUA 5HZQA 2IZLB 5HCCC 3E3CA 1DZMA 1HQPA 2DM5A 3RZYA 1PBOA 1QY2A 4ORRA 1KL5A 2CZUA 1SWSA 2FTBA 2HMBA 3D95A 3QKGA 4GKCA 4BVMA 5LJKA 1I9HA 3IFBA 4BCSA 1SWGA 1B8EA 5HZ6A 2RTBB 4CPIA 4MVEA 4KH8A 3MX7A 2OYBO 1JJUA 5LJEA 4JNJA 2FS7A 2G78A 5F6ZA 2ZAGA 2IZBA 4XMHA 3RE6A 2Z4HA 1VYGA 2JU8A 3AUMO 4ALOA 5HWZA 3D96A 1HMRA 1BSQA 1SWKA 1W5RA 4YGHA 1B0OA 2WR6A 2CM4A 5BVQA 1UZ2X 4FBVA 1ZNLA 4MEEA 3RY2A 3S5XA 5JR8A 2OL8O 4L1NA 4R0BA 1ML7A 1JJXA 1EW3A 2RTMA 2RCQA 5B3MO 5IRWA 2JU3A 3WXQA 4TKHA 1RLBE 1CJ5A 4DCBA 3PH5A 2BSZA 4INNA 1PM1X 1YWBA 1JIWI 1KL4A 1X8NA 1ZNGA 4M7MA 1E00A 2R73A 4WBKA 1SLEB 1KT7A 5F1EA 4IMOA 5KIDA 1OBPA 4O4OA 3RY1A 3VPJE 4AZMA 5L8IA 1X71A 2BLGA 2IZGB 4D6BA 1IFBA 2WSJA 4QGXA 4BGFA 1K3BA 2RN4A 1YUPA 3JQOA 3CBSA 3CR6A 2FR2A 3LTWA 1JMXA 4MVLA 4EKVA 1BBPA 1QWDA 3I17A 1Y53X 2AVIA 4O4SA 3RWXA 1MOYA 3F6ZB 3PDFA 1IKJA 4OKAA 4ORXA 1VWIB 4CDDA 3GE2A 1AQBA 2Q2PA 1S44A 3RDUA 5F6BA 3ZQ3A 4CPHA 3B2LA 4KC8A 1O1VA 4CDCA 1VWDB 4O3ZA 3BDRA 3KFGA 3T6FA 3SOTA 4GZVA 4U8UM 1STPA 2RTPB 2FLJA 2MM3A 3APWA 3P24A 4QZTA 4DQ4A 2IZHB 4AYHA 4XMEA 1B56A 2X34A 4GNWA 5HA0A 4GGTA 4OELA 1LFOA 3P02A 3V8UA 2BHVA 1RSTB 1PEEA 4GGRA 5H9AA 1OEKA 3WOVA 2X4MA 1U17A 2F73A 3FW4A 3ZUIA 4ZHDA 1VWCB 3NR3A 1N43A 3H3IA 1YP6A 3Q34A 4PSQA 4BOEA 3F9DA 3C78X 5JD2A 5CYBA 3BX7A 1CBRA 5BYPA 1DV9A 5EEEA 2HLVA 4I95A 4NNSA 3T1DA 1SA8A 2A13A 4XMDA 4JGLA 1VYFA 4IAXA 1U0XA 3BU9A 2GC9A 2X8FA 3STNA 2IZKA 1KL3A 3KFIA 3ZZVA 1KXOA 3PP6A 3EM0A 4NP1A 2VDFA 2OY5O 1QG5A 1ICNA 2FR3A 2VFCA 3CQRA 1DZKA 3NBXX 4ARHA 4QRLA 1D3SA 3GAQA 5HTEA 4CV7A 3IA8A 5H9NA 4ON1A 3ZW0A 2NP1A 3FMZA 4ZH9A 1HXLA 2FHLA 2W2AA 3T2XA 2OY1O 1LPJA 4YFRA 2JN3A 4L3RA 1LDOA 2OY8A 5EDBA 1SLDB 3VGWA 2A0AA 4BJ8A 3SAOA 1LIDA 2KTSA 3STKA 2AT3X 1RXKA 2RTFB 1ZNHA 4HPCA 1HMTA 4XMFA 1E06A 4ID2A 3VG4A 4OS0A 3BY0A 3EYCA 1T68X 4AZNA 4Z6JA 1QY1A 1RAVA 1JMZA 2QMIA 4BX7A 3HWFA 2CZTA 4OS8A 1ERBA 4COTA 1SXYA 2W2FA 1LKEA 1N9YA 4Y59A 2A3FX 2K62A 4ZHGA 5BVSA 2Q2MA 3AKMA 4FQBB 4GUZA 3D9WA 4FGIB 4TJZA 2AKQA 4YFQA 3RDOA 4GE1A 3FA9A 1LCVA 4AZPA 1W4TA 2X45A 3DSZA 5H9LA
chains in the Genus database with same CATH topology
2C1SA 1NQMA 3RY2A 1VWNB 1SWEA 5K68A 4Y5DA 3FDCA 1LUQA 2RTMA 4JHQA 5IRWA 1PTSA 3WYQA 1RSUB 2IZIA 4IRWA 1NC9A 5IRAA 2RTNB 1KL4A 4CPFA 4I60A 3EW1A 3WYPA 1SLEB 1MM9A 1RXHA 1VWPB 1SWLA 3RY1A 3RDXA 2IZGB 1NBXA 2RTJA 1WBIA 2UYWA 4U46A 4BX7B 1VWGB 1SWRA 4CPEA 4EKVA 1Y53X 2A5CA 2AVIA 4GJVA 1Y52X 2RTEB 1MOYA 4OKAA 1VWLB 5CSEA 2A5BA 1VWIB 1LDQA 4BX6A 1KFFA 2RTDB 3RDUA 4GGZA 3RDMA 3VHIA 1IJ8A 4CPHA 2QCBA 2A8GA 2Y32A 2IZDB 5L3YA 4CPHB 1HXZA 1SRIA 1VWDB 2OF9A 3RDQA 3X00A 3T6FA 1VWJB 1VYOA 3EW2A 2FHNX 4GJSA 1SRGA 1SWAA 1STPA 1MK5A 1DF8A 1STRB 2RTPB 2IZCB 4DNEA 1SWJA 5B5FA 3PK2A 1SRJA 1STSB 2IZHB 1SWTA 2UZ2A 2IZFB 1VWOB 3WZOA 1N4JA 4GGTA 1SREA 1N9MA 2RTOB 1SWOA 4Z28A 1SLFB 4BX5A 3T6LA 2RTAA 1RSTB 1SWCA 1VWMB 2IZEB 4GGRA 2BC3A 1SWPA 2MF6A 4GD9A 2OF8A 1VWRB 1VWCB 1N43A 1VWEB 3T2WA 4BX6B 4Z27A 1NDJA 3WZQA 5JD2A 2G5LA 1VWAB 1Y55X 2Y3FA 1SWQA 2C4IA 2GH7A 3SZJA 1SWNA 2JGSA 2RTIB 4GDAA 2IZJA 2IZKA 2RTKA 2Y3EA 1KL3A 2OFAA 1MEPA 1VWKB 2RTLA 1SLGB 3WZPA 1HY2A 5F2BA 4BBOA 2F01A 1HQQA 2IZAA 5B5GA 1SWHA 4BX5B 2C1QA 5K67A 2WPUA 1LCWA 1VWQB 1HXLA 2FHLA 3T2XA 1SWBA 4Z2PA 4Z2VA 1AVEA 1SWUA 4JO6A 1LDOA 2CAMA 2OFBA 3VHMA 1N7YA 1NQNA 1SLDB 3VGWA 4BJ8A 1LCZA 2IZLB 1SRHA 1VWBB 1RXKA 3VHHA 2RTFB 1KL5A 1VWHB 1RXJA 1SWSA 2RTRB 1I9HA 2RTHB 3SZIA 1SRFA 4BCSA 1SWGA 1AVDA 3RE5A 1RAVA 2RTGB 1VWFB 4BX7A 4Z6JA 2RTBB 4CPIA 3MM0A 3WZNA 3RDSA 1N9YA 2RTQB 4Z2OA 4Y59A 4JNJA 5IRUA 2IZBA 3RE6A 1SWFA 2ZSCA 3MG5A 5CHKA 3RDOA 4YVBA 1LCVA 1LELA 1SWKA 3SZHA 1SWDA 2RTCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1S A;  1NQM A;  3RY2 A;  1VWN B;  1SWE A;  5K68 A;  4Y5D A;  3FDC A;  1LUQ A;  2RTM A;  4JHQ A;  5IRW A;  1PTS A;  3WYQ A;  1RSU B;  2IZI A;  4IRW A;  1NC9 A;  5IRA A;  2RTN B;  1KL4 A;  4CPF A;  4I60 A;  3EW1 A;  3WYP A;  1SLE B;  1MM9 A;  1RXH A;  1VWP B;  1SWL A;  3RY1 A;  3RDX A;  2IZG B;  1NBX A;  2RTJ A;  1WBI A;  2UYW A;  4U46 A;  4BX7 B;  1VWG B;  1SWR A;  4CPE A;  4EKV A;  1Y53 X;  2A5C A;  2AVI A;  4GJV A;  1Y52 X;  2RTE B;  1MOY A;  4OKA A;  1VWL B;  5CSE A;  2A5B A;  1VWI B;  1LDQ A;  4BX6 A;  1KFF A;  2RTD B;  3RDU A;  4GGZ A;  3RDM A;  3VHI A;  1IJ8 A;  4CPH A;  2QCB A;  2A8G A;  2Y32 A;  2IZD B;  5L3Y A;  4CPH B;  1HXZ A;  1SRI A;  1VWD B;  2OF9 A;  3RDQ A;  3X00 A;  3T6F A;  1VWJ B;  1VYO A;  3EW2 A;  2FHN X;  4GJS A;  1SRG A;  1SWA A;  1STP A;  1MK5 A;  1DF8 A;  1STR B;  2RTP B;  2IZC B;  4DNE A;  1SWJ A;  5B5F A;  3PK2 A;  1SRJ A;  1STS B;  2IZH B;  1SWT A;  2UZ2 A;  2IZF B;  1VWO B;  3WZO A;  1N4J A;  4GGT A;  1SRE A;  1N9M A;  2RTO B;  1SWO A;  4Z28 A;  1SLF B;  4BX5 A;  3T6L A;  2RTA A;  1RST B;  1SWC A;  1VWM B;  2IZE B;  4GGR A;  2BC3 A;  1SWP A;  2MF6 A;  4GD9 A;  2OF8 A;  1VWR B;  1VWC B;  1N43 A;  1VWE B;  3T2W A;  4BX6 B;  4Z27 A;  1NDJ A;  3WZQ A;  5JD2 A;  2G5L A;  1VWA B;  1Y55 X;  2Y3F A;  1SWQ A;  2C4I A;  2GH7 A;  3SZJ A;  1SWN A;  2JGS A;  2RTI B;  4GDA A;  2IZJ A;  2IZK A;  2RTK A;  2Y3E A;  1KL3 A;  2OFA A;  1MEP A;  1VWK B;  2RTL A;  1SLG B;  3WZP A;  1HY2 A;  5F2B A;  4BBO A;  2F01 A;  1HQQ A;  2IZA A;  5B5G A;  1SWH A;  4BX5 B;  2C1Q A;  5K67 A;  2WPU A;  1LCW A;  1VWQ B;  1HXL A;  2FHL A;  3T2X A;  1SWB A;  4Z2P A;  4Z2V A;  1AVE A;  1SWU A;  4JO6 A;  1LDO A;  2CAM A;  2OFB A;  3VHM A;  1N7Y A;  1NQN A;  1SLD B;  3VGW A;  4BJ8 A;  1LCZ A;  2IZL B;  1SRH A;  1VWB B;  1RXK A;  3VHH A;  2RTF B;  1KL5 A;  1VWH B;  1RXJ A;  1SWS A;  2RTR B;  1I9H A;  2RTH B;  3SZI A;  1SRF A;  4BCS A;  1SWG A;  1AVD A;  3RE5 A;  1RAV A;  2RTG B;  1VWF B;  4BX7 A;  4Z6J A;  2RTB B;  4CPI A;  3MM0 A;  3WZN A;  3RDS A;  1N9Y A;  2RTQ B;  4Z2O A;  4Y59 A;  4JNJ A;  5IRU A;  2IZB A;  3RE6 A;  1SWF A;  2ZSC A;  3MG5 A;  5CHK A;  3RDO A;  4YVB A;  1LCV A;  1LEL A;  1SWK A;  3SZH A;  1SWD A;  2RTC B; 
#chains in the Genus database with same CATH topology
 3KVN A;  1GKA B;  3WVM A;  2KD2 A;  3KZA A;  2BS6 A;  3EBW A;  1NQM A;  1ZND A;  4GU8 A;  4I3C A;  3ZW0 B;  1VWN B;  5K68 A;  1X8P A;  3FDC A;  4HPA A;  1PTS A;  1T8V A;  3WYQ A;  3FEN A;  4Y0R A;  2ZAI A;  5B10 O;  1NC9 A;  5IO6 A;  5B29 A;  3FEL A;  4OEM A;  5IRA A;  3S26 A;  3ZWE A;  1UYO X;  1PBY A;  3ZUO A;  4ORW A;  4CPF A;  3ELZ A;  1FTP A;  1CRB A;  2HYS A;  2GTL M;  2FKJ A;  1SWL A;  1FEM A;  5IXG A;  1GX8 A;  4YDA A;  3RDX A;  2JOZ A;  1GM6 A;  2LFO A;  2UYW A;  4BX7 B;  5CE4 A;  4CK4 A;  3NPO A;  1GGL A;  2A2G A;  1SWR A;  1JYD A;  1R0U A;  1X8Q A;  4CPE A;  4EDE A;  1S7D A;  3P6C A;  1YWA A;  3PQS A;  1Y52 X;  2RTE B;  1YWC A;  1WUB A;  2WQA E;  3FYF A;  5CSE A;  5FQ8 E;  4TKJ A;  1LIC A;  4FBR A;  2RTD B;  4TLJ A;  1ADL A;  2AMM X;  4GGZ A;  2L67 A;  2OFR X;  1I78 A;  2Y32 A;  3F8A A;  1EPB A;  5AJC A;  4KII A;  5FQ7 E;  5L3Y A;  1E5P A;  4NYR A;  2OF9 A;  3CWK A;  1VYO A;  2OZQ A;  2FRS A;  1E02 A;  4HFO A;  1GT1 A;  4GJS A;  4YKO A;  1SRG A;  1HBP A;  1SWA A;  1MK5 A;  3D97 A;  1STR B;  2R56 A;  2NND A;  1ZNE A;  1O8V A;  2QOM A;  4AW8 A;  5KHP A;  1SRJ A;  1STS B;  3B2K A;  2UZ2 A;  1EPA A;  2QOS C;  2WEX A;  2N93 A;  4ODD A;  2CBS A;  3WZO A;  3ZW2 A;  4RUU A;  5B2A O;  4YCE A;  4CDE A;  1N9M A;  2RTO B;  3UEX A;  3SLT A;  2LBA A;  3O22 A;  3T6L A;  1L6M A;  1SWC A;  1GXA A;  1FEN A;  1O1U A;  1DF3 A;  1ERX A;  4K19 A;  4KC7 A;  2MF6 A;  3BSZ E;  3WJE A;  3U9P C;  2K23 A;  1VWE B;  2G8C O;  3T2W A;  3UEW A;  2Y3F A;  1X8U A;  4YFP A;  4N7D A;  1G5W A;  3B2I A;  3C76 X;  4YGZ A;  1X8O A;  2Z4I A;  5HZ8 A;  1QFV A;  5IO5 A;  1W6F A;  2JGS A;  2E4J A;  2OFM X;  3N91 A;  4TQ2 A;  5FFH A;  2OL7 A;  4QAE A;  5HCE C;  3P6F A;  2ASN X;  5FQ6 E;  4YDB A;  3S5V A;  1Y9L A;  3EC5 A;  4U3Q A;  3K3L A;  3FR5 A;  2EU7 X;  4EQA C;  5LKE A;  1HY2 A;  5F7G A;  1OBQ A;  1OPA A;  5F2B A;  1MVG A;  2F01 A;  3KQ0 A;  1HQQ A;  4AZQ A;  3JS1 A;  3HWD A;  1SY0 A;  3PH6 A;  4IAB A;  4GH7 A;  4IBA A;  4WFU A;  3D4R A;  4M6S A;  2WPU A;  1EII A;  1MX7 A;  3FA6 A;  4NLI A;  1GT4 A;  1LNM A;  1AVE A;  4JO6 A;  4EFG A;  2OVS A;  2JMB A;  4IB7 A;  2ANS A;  1SY1 A;  1A18 A;  3UEV A;  4QZU A;  1LCZ A;  5B27 A;  4ZGF A;  4NNT A;  3HOE A;  2OY7 A;  5BVT A;  1CBS A;  1VWH B;  2GTL O;  4ZJ0 A;  5K06 A;  2RTR B;  1I06 A;  2L9C A;  2NNQ A;  2HNX A;  2RTH B;  4O3X B;  1SRF A;  3SZI A;  4YGG A;  1EXS A;  2OVD A;  1AVD A;  1HN2 A;  1S2P A;  1XCA A;  2QO6 A;  2KT4 B;  2VFB A;  5FAZ A;  3OD9 A;  2XST A;  3MM0 A;  3NX2 A;  3RSW A;  1MUP A;  3B2H A;  3RDS A;  3WJF A;  1BWY A;  2L68 A;  5LKF A;  4Z2O A;  1VPR A;  3FA7 A;  4YMY A;  2AF5 A;  5B11 O;  2FKG A;  2W2B A;  4AZR A;  1SWF A;  1BEB A;  2ZSC A;  1H91 A;  5CHK A;  4A1Y A;  4YVB A;  1XKI A;  3FLL A;  1G85 A;  3SZH A;  1SWD A;  1GKA A;  2LA7 A;  2RTC B;  4GDA A;  4HPD A;  4LZV A;  1BLR A;  5HZ5 A;  4A1H A;  2M4L A;  4NLJ A;  4QGW A;  1SWE A;  5AJB A;  1CBI A;  3CKF A;  2KTD A;  4LZU A;  4ZHC A;  1LUQ A;  3TGB A;  4FBO A;  1OBU A;  1E2T A;  2RQ0 A;  1RSU B;  4I3D A;  1AEL A;  4IRW A;  1N0S A;  1T0V A;  2PY1 A;  2RCT A;  2RTN B;  1GT5 A;  1ICM A;  3FR2 A;  3HTY A;  4I60 A;  3EW1 A;  4ORU A;  3WYP A;  1KGL A;  1MM9 A;  1RXH A;  1VWP B;  1EI5 A;  2MWH A;  3U0D A;  3HWG A;  1KQW A;  3O19 A;  4ORS A;  1SY2 A;  1KOI A;  2XKL A;  3B2J A;  5EZ2 A;  1NBX A;  2X32 A;  4U46 A;  5LJG A;  1VWG B;  2QO4 A;  3MBT A;  2JU7 A;  2A5C A;  2IFB A;  4GJV A;  1JQP A;  1SXU A;  2AL0 X;  1SMP I;  4LKT A;  5FEN A;  2X56 A;  4MIS A;  4BX6 A;  4GNY A;  1BRP A;  1KFF A;  2RD7 C;  3C77 X;  4LQZ A;  3CKG A;  1A57 A;  5D4A A;  4GRJ A;  3P6D A;  5D8J A;  3TF6 A;  3VG7 A;  2QCB A;  4NV7 A;  4IB9 A;  1EIO A;  4NYQ A;  3Q6L A;  2PI3 O;  4U8U O;  4QYN A;  5EED A;  4KCA A;  2MHD A;  1VWJ B;  3EW2 A;  4O49 A;  1IFC A;  2FHN X;  2YMS A;  3HK1 A;  4HPB A;  3VU1 A;  1BSO A;  1YIV A;  3FR4 A;  2OL6 O;  1DF8 A;  1YWD A;  1KQX A;  5LJB A;  4ZH6 A;  4DNE A;  4ZFX A;  1SWJ A;  2Q4N A;  3RBY A;  1KZW A;  4UU2 A;  4QGV A;  5AEO A;  3TGC A;  1Y9T A;  3EMM A;  3BRN A;  3PK2 A;  1SWT A;  3VE2 A;  1TVQ A;  3L4R A;  4ZHF A;  3BLG A;  5D48 A;  1I05 A;  5EPQ A;  1DFV A;  1SWO A;  1FEL A;  3P6G A;  5LJD A;  4BX5 A;  4YBP A;  1VWM B;  1EUO A;  4IB6 A;  1DC9 A;  5C0N A;  1X89 A;  3FEK A;  3P6E A;  3U03 A;  2F09 A;  2ACP X;  3FIQ A;  1SWP A;  3OE3 A;  1TOW A;  2OF8 A;  2WQ9 A;  4NW4 A;  3FW5 A;  4BX6 B;  4Z27 A;  5HZ9 A;  4CSB A;  2AH7 X;  3WZQ A;  2G5L A;  1VWA B;  1Y55 X;  3CMP A;  4I9R A;  1P6P A;  5AQ6 A;  2GH7 A;  2WUT A;  3SZJ A;  4YCH A;  1A3Y A;  4I9S A;  4XMC A;  2G7B A;  1KT3 A;  1SWN A;  2X55 A;  4U8U N;  1DZP A;  2WEW A;  4ES7 A;  3UAQ A;  4YBU A;  2Y3E A;  3HPE A;  3P6H A;  2OFA A;  4HWM A;  1HBQ A;  3KFH A;  3LHN A;  1MEP A;  1VWK B;  4IMN A;  4TNN A;  3AEH A;  5D47 A;  1LIB A;  2AT5 X;  3KFF A;  2L5P A;  3QQ2 A;  4DQ3 A;  1ZNK A;  4Y0S A;  4ZR2 A;  3S60 A;  3OJY C;  1I04 A;  4WFV A;  4IAW A;  1KT4 A;  2FWV A;  3HOL A;  4BX5 B;  2LB6 A;  1PMP A;  3PPT A;  5K67 A;  1GT3 A;  4B55 A;  3NQK A;  1FE3 A;  4Z2P A;  4O3W A;  5D45 A;  4Z2V A;  2HZQ A;  4NV8 A;  4RUN A;  1MX8 A;  2AT6 X;  2CAM A;  1BM5 A;  2DJF A;  1SRH A;  1VWB B;  2GTF X;  5LJC A;  1D2U A;  5L8N A;  2FGS A;  3TZS A;  2A2U A;  1A2D A;  2I5V O;  3VHH A;  3SLJ A;  1RXJ A;  1TXL A;  5HAE A;  1NGL A;  3ELX A;  4MVK A;  4GET A;  3HWE A;  2OVA A;  3VG5 A;  1U18 A;  2RTG B;  1VWF B;  4I3B A;  4UU3 A;  2POA A;  3BX8 A;  3WZN A;  1LF7 A;  2BS5 A;  2RTQ B;  4ZCB A;  3G7X A;  4A8Z A;  1JJJ A;  2OVE A;  5IRU A;  2X8S A;  3O2Y A;  3MG5 A;  2ALL X;  1EQD A;  2RA6 A;  2JW1 A;  1SXX A;  5H9K A;  2CM9 A;  1LEL A;  1Z24 A;  2C1S A;  1JZU A;  4YH0 A;  3BU1 A;  3PQU A;  4Y5D A;  1IIU A;  3BS2 A;  4JHQ A;  4OS3 A;  1JV4 A;  1GX9 A;  1ALB A;  2IZI A;  1G7N A;  5LJH A;  4GK9 A;  4I6S A;  1BRQ A;  5HCD C;  1QAB E;  4PJ2 A;  3AKN A;  1KZX A;  1UYN X;  2FT9 A;  3NQ9 A;  4CDF A;  1CBQ A;  4ZHH A;  1OEE A;  4TKB A;  4O9S A;  1JBH A;  3VG3 A;  3OBL A;  2RTJ A;  1WBI A;  4QNI A;  1KT5 A;  2Q39 A;  1MDC A;  2QO5 A;  4QQ1 A;  1VWL B;  4IB8 A;  1URE A;  2A5B A;  1AB0 A;  1LDQ A;  4Y0P A;  2WWP A;  3DTQ A;  4BQU A;  4ML7 B;  2KW1 A;  1LIF A;  3VG2 A;  2R74 A;  3RDM A;  1IJ8 A;  3APV A;  3VHI A;  3NX1 A;  5H8T A;  2A8G A;  2ACO A;  2IZD B;  4N7C A;  4CPH B;  1HXZ A;  2CBR A;  1SRI A;  3RDQ A;  1FDQ A;  3X00 A;  1DZJ A;  1QY0 A;  1K24 A;  2YG2 A;  3FEP A;  3NAD A;  3NP1 A;  4U9C A;  1BSY A;  1HMS A;  3WJB A;  3FID A;  4MIR A;  3I0A A;  3STM X;  1GX3 A;  2IZC B;  5HA1 A;  4C5P A;  1AVG I;  1IKE A;  1JYJ A;  2GJ5 A;  2LBV A;  5B5F A;  2P8G A;  4MVI A;  3SLO A;  2GTL N;  4O4X A;  1RBP A;  2IZF B;  3UEU A;  2BT9 A;  1VWO B;  4ALB A;  1N4J A;  1LIE A;  1KT6 A;  1SRE A;  3LV4 A;  1QQS A;  4Z28 A;  1SLF B;  3ZW1 A;  1YP7 A;  1ACD A;  2RTA A;  2IZE B;  1TOU A;  2X8T A;  3CBC A;  1I4U A;  5DG4 A;  1G74 A;  3TGA A;  2BC3 A;  1FJ1 E;  4XMG A;  5L8O A;  4GD9 A;  3RKG A;  1TW4 A;  1VWR B;  3WJD A;  3APU A;  3PED A;  3VE1 A;  4EEJ A;  3WJG A;  1OEJ A;  1NDJ A;  3MVF A;  4AZO A;  4YKM A;  4O3Y A;  2Q9S A;  4ORY A;  5KIC A;  1SWQ A;  2C4I A;  4OMX A;  2QM9 A;  3EBK A;  2O62 A;  3CQN A;  3RE5 A;  4EXZ A;  2FS6 A;  2HZR A;  2RTI B;  3VG6 A;  4OMW A;  1IW2 A;  5F58 A;  2IZJ A;  1SY3 A;  2RTK A;  4LKP A;  2X46 A;  4A60 A;  2RTL A;  1SLG B;  4QYP A;  2NNE A;  1NP4 A;  2AT8 X;  3WBG A;  3WZP A;  4D6A A;  5HBS A;  1SXW A;  3ZI8 A;  5DPQ A;  2LKK A;  5EDC A;  1EAL A;  2DJG A;  2G79 A;  4BBO A;  1ZRY A;  2IZA A;  4GDZ A;  1OPB A;  5B5G A;  1SWH A;  5IO7 A;  4WHI A;  4KT5 A;  3ZW1 B;  3NQ3 A;  1Y0G A;  2C1Q A;  3PEC A;  1LCW A;  1VWQ B;  2MJI A;  1B4M A;  1QFT A;  2I5Z O;  4Y0Q A;  3JSQ A;  1SWB A;  1OSP O;  2HKD A;  1SWU A;  3FA8 A;  3WJC A;  5HTD A;  4O4U A;  1BJ7 A;  3APX A;  2OFB A;  3VHM A;  1N7Y A;  1NQN A;  2AT0 X;  2MO5 A;  1NP1 A;  4ZGU A;  5HZQ A;  2IZL B;  5HCC C;  3E3C A;  1DZM A;  1HQP A;  2DM5 A;  3RZY A;  1PBO A;  1QY2 A;  4ORR A;  1KL5 A;  2CZU A;  1SWS A;  2FTB A;  2HMB A;  3D95 A;  3QKG A;  4GKC A;  4BVM A;  5LJK A;  1I9H A;  3IFB A;  4BCS A;  1SWG A;  1B8E A;  5HZ6 A;  2RTB B;  4CPI A;  4MVE A;  4KH8 A;  3MX7 A;  2OYB O;  1JJU A;  5LJE A;  4JNJ A;  2FS7 A;  2G78 A;  5F6Z A;  2ZAG A;  2IZB A;  4XMH A;  3RE6 A;  2Z4H A;  1VYG A;  2JU8 A;  3AUM O;  4ALO A;  5HWZ A;  3D96 A;  1HMR A;  1BSQ A;  1SWK A;  1W5R A;  4YGH A;  1B0O A;  2WR6 A;  2CM4 A;  5BVQ A;  1UZ2 X;  4FBV A;  1ZNL A;  4MEE A;  3RY2 A;  3S5X A;  5JR8 A;  2OL8 O;  4L1N A;  4R0B A;  1ML7 A;  1JJX A;  1EW3 A;  2RTM A;  2RCQ A;  5B3M O;  5IRW A;  2JU3 A;  3WXQ A;  4TKH A;  1RLB E;  1CJ5 A;  4DCB A;  3PH5 A;  2BSZ A;  4INN A;  1PM1 X;  1YWB A;  1JIW I;  1KL4 A;  1X8N A;  1ZNG A;  4M7M A;  1E00 A;  2R73 A;  4WBK A;  1SLE B;  1KT7 A;  5F1E A;  4IMO A;  5KID A;  1OBP A;  4O4O A;  3RY1 A;  3VPJ E;  4AZM A;  5L8I A;  1X71 A;  2BLG A;  2IZG B;  4D6B A;  1IFB A;  2WSJ A;  4QGX A;  4BGF A;  1K3B A;  2RN4 A;  1YUP A;  3JQO A;  3CBS A;  3CR6 A;  2FR2 A;  3LTW A;  1JMX A;  4MVL A;  4EKV A;  1BBP A;  1QWD A;  3I17 A;  1Y53 X;  2AVI A;  4O4S A;  3RWX A;  1MOY A;  3F6Z B;  3PDF A;  1IKJ A;  4OKA A;  4ORX A;  1VWI B;  4CDD A;  3GE2 A;  1AQB A;  2Q2P A;  1S44 A;  3RDU A;  5F6B A;  3ZQ3 A;  4CPH A;  3B2L A;  4KC8 A;  1O1V A;  4CDC A;  1VWD B;  4O3Z A;  3BDR A;  3KFG A;  3T6F A;  3SOT A;  4GZV A;  4U8U M;  1STP A;  2RTP B;  2FLJ A;  2MM3 A;  3APW A;  3P24 A;  4QZT A;  4DQ4 A;  2IZH B;  4AYH A;  4XME A;  1B56 A;  2X34 A;  4GNW A;  5HA0 A;  4GGT A;  4OEL A;  1LFO A;  3P02 A;  3V8U A;  2BHV A;  1RST B;  1PEE A;  4GGR A;  5H9A A;  1OEK A;  3WOV A;  2X4M A;  1U17 A;  2F73 A;  3FW4 A;  3ZUI A;  4ZHD A;  1VWC B;  3NR3 A;  1N43 A;  3H3I A;  1YP6 A;  3Q34 A;  4PSQ A;  4BOE A;  3F9D A;  3C78 X;  5JD2 A;  5CYB A;  3BX7 A;  1CBR A;  5BYP A;  1DV9 A;  5EEE A;  2HLV A;  4I95 A;  4NNS A;  3T1D A;  1SA8 A;  2A13 A;  4XMD A;  4JGL A;  1VYF A;  4IAX A;  1U0X A;  3BU9 A;  2GC9 A;  2X8F A;  3STN A;  2IZK A;  1KL3 A;  3KFI A;  3ZZV A;  1KXO A;  3PP6 A;  3EM0 A;  4NP1 A;  2VDF A;  2OY5 O;  1QG5 A;  1ICN A;  2FR3 A;  2VFC A;  3CQR A;  1DZK A;  3NBX X;  4ARH A;  4QRL A;  1D3S A;  3GAQ A;  5HTE A;  4CV7 A;  3IA8 A;  5H9N A;  4ON1 A;  3ZW0 A;  2NP1 A;  3FMZ A;  4ZH9 A;  1HXL A;  2FHL A;  2W2A A;  3T2X A;  2OY1 O;  1LPJ A;  4YFR A;  2JN3 A;  4L3R A;  1LDO A;  2OY8 A;  5EDB A;  1SLD B;  3VGW A;  2A0A A;  4BJ8 A;  3SAO A;  1LID A;  2KTS A;  3STK A;  2AT3 X;  1RXK A;  2RTF B;  1ZNH A;  4HPC A;  1HMT A;  4XMF A;  1E06 A;  4ID2 A;  3VG4 A;  4OS0 A;  3BY0 A;  3EYC A;  1T68 X;  4AZN A;  4Z6J A;  1QY1 A;  1RAV A;  1JMZ A;  2QMI A;  4BX7 A;  3HWF A;  2CZT A;  4OS8 A;  1ERB A;  4COT A;  1SXY A;  2W2F A;  1LKE A;  1N9Y A;  4Y59 A;  2A3F X;  2K62 A;  4ZHG A;  5BVS A;  2Q2M A;  3AKM A;  4FQB B;  4GUZ A;  3D9W A;  4FGI B;  4TJZ A;  2AKQ A;  4YFQ A;  3RDO A;  4GE1 A;  3FA9 A;  1LCV A;  4AZP A;  1W4T A;  2X45 A;  3DSZ A;  5H9L A; 
#chains in the Genus database with same CATH homology
 2C1S A;  1NQM A;  3RY2 A;  1VWN B;  1SWE A;  5K68 A;  4Y5D A;  3FDC A;  1LUQ A;  2RTM A;  4JHQ A;  5IRW A;  1PTS A;  3WYQ A;  1RSU B;  2IZI A;  4IRW A;  1NC9 A;  5IRA A;  2RTN B;  1KL4 A;  4CPF A;  4I60 A;  3EW1 A;  3WYP A;  1SLE B;  1MM9 A;  1RXH A;  1VWP B;  1SWL A;  3RY1 A;  3RDX A;  2IZG B;  1NBX A;  2RTJ A;  1WBI A;  2UYW A;  4U46 A;  4BX7 B;  1VWG B;  1SWR A;  4CPE A;  4EKV A;  1Y53 X;  2A5C A;  2AVI A;  4GJV A;  1Y52 X;  2RTE B;  1MOY A;  4OKA A;  1VWL B;  5CSE A;  2A5B A;  1VWI B;  1LDQ A;  4BX6 A;  1KFF A;  2RTD B;  3RDU A;  4GGZ A;  3RDM A;  3VHI A;  1IJ8 A;  4CPH A;  2QCB A;  2A8G A;  2Y32 A;  2IZD B;  5L3Y A;  4CPH B;  1HXZ A;  1SRI A;  1VWD B;  2OF9 A;  3RDQ A;  3X00 A;  3T6F A;  1VWJ B;  1VYO A;  3EW2 A;  2FHN X;  4GJS A;  1SRG A;  1SWA A;  1STP A;  1MK5 A;  1DF8 A;  1STR B;  2RTP B;  2IZC B;  4DNE A;  1SWJ A;  5B5F A;  3PK2 A;  1SRJ A;  1STS B;  2IZH B;  1SWT A;  2UZ2 A;  2IZF B;  1VWO B;  3WZO A;  1N4J A;  4GGT A;  1SRE A;  1N9M A;  2RTO B;  1SWO A;  4Z28 A;  1SLF B;  4BX5 A;  3T6L A;  2RTA A;  1RST B;  1SWC A;  1VWM B;  2IZE B;  4GGR A;  2BC3 A;  1SWP A;  2MF6 A;  4GD9 A;  2OF8 A;  1VWR B;  1VWC B;  1N43 A;  1VWE B;  3T2W A;  4BX6 B;  4Z27 A;  1NDJ A;  3WZQ A;  5JD2 A;  2G5L A;  1VWA B;  1Y55 X;  2Y3F A;  1SWQ A;  2C4I A;  2GH7 A;  3SZJ A;  1SWN A;  2JGS A;  2RTI B;  4GDA A;  2IZJ A;  2IZK A;  2RTK A;  2Y3E A;  1KL3 A;  2OFA A;  1MEP A;  1VWK B;  2RTL A;  1SLG B;  3WZP A;  1HY2 A;  5F2B A;  4BBO A;  2F01 A;  1HQQ A;  2IZA A;  5B5G A;  1SWH A;  4BX5 B;  2C1Q A;  5K67 A;  2WPU A;  1LCW A;  1VWQ B;  1HXL A;  2FHL A;  3T2X A;  1SWB A;  4Z2P A;  4Z2V A;  1AVE A;  1SWU A;  4JO6 A;  1LDO A;  2CAM A;  2OFB A;  3VHM A;  1N7Y A;  1NQN A;  1SLD B;  3VGW A;  4BJ8 A;  1LCZ A;  2IZL B;  1SRH A;  1VWB B;  1RXK A;  3VHH A;  2RTF B;  1KL5 A;  1VWH B;  1RXJ A;  1SWS A;  2RTR B;  1I9H A;  2RTH B;  3SZI A;  1SRF A;  4BCS A;  1SWG A;  1AVD A;  3RE5 A;  1RAV A;  2RTG B;  1VWF B;  4BX7 A;  4Z6J A;  2RTB B;  4CPI A;  3MM0 A;  3WZN A;  3RDS A;  1N9Y A;  2RTQ B;  4Z2O A;  4Y59 A;  4JNJ A;  5IRU A;  2IZB A;  3RE6 A;  1SWF A;  2ZSC A;  3MG5 A;  5CHK A;  3RDO A;  4YVB A;  1LCV A;  1LEL A;  1SWK A;  3SZH A;  1SWD A;  2RTC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...