2C29D

Structure of dihydroflavonol reductase from vitis vinifera at 1.8 a.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
324
structure length
324
Chain Sequence
ETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNAHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVDTCRAKGLLPPSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Grape Dihydroflavonol 4-Reductase, a Key Enzyme in Flavonoid Biosynthesis.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords DIHYDROFLAVONOL 4-REDUCTASE
total genus 116
structure length 324
sequence length 324
chains with identical sequence F
ec nomenclature ec 1.1.1.219: Dihydroflavanol 4-reductase.
pdb deposition date 2005-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c29D00
4Q3NA 1KY4A 3DOCA 2PLAA 1UZLA 3JQAA 4XYGA 5TS3A 2YQ5A 1I32A 4IDGA 1MC4A 1GYPA 2GYYA 3I3OA 3K6JA 4TROA 1DC3A 4FDAA 3VPFA 1KEUA 2YYYA 3DWFA 1TXGA 4WASA 4FFNA 1E77A 3IKTA 1JN0A 1E6EA 3JQFA 3DBHB 3ROPA 2CVZA 4IMRA 5AYVA 2C20A 4YAKA 5TJ9A 1H2BA 1O6ZA 3ICPA 2HO5A 5KVQA 2Q1UA 3I83A 2X5OA 1KVSA 2JCVA 1GYRA 4YJHB 3CPSA 3WXBA 2C0CA 4NFYA 4CLOA 2NVUA 1AUPA 5ICSA 3I9OA 2O48X 4BL5A 5JW6A 1WNTA 5FWNA 2OFPA 3JD1A 3EDMA 1DRWA 1YJQA 1V9LA 1CIVA 3S2IA 4INAA 1H2HA 3UW3A 1UDAA 4YAEA 1ADCA 3I6QA 4R51A 1UZMA 2DPHA 4CMIA 1P74A 1ORRA 3PHIA 1RYDA 3RFXA 1VJTA 2H9IA 2Z95A 1P1JA 1IL0A 1QSGA 1MFPA 2J6IA 2VRCD 3GDGA 3GEMA 3JCZA 4RQUA 3HUDA 3E9MA 4DGSA 4I9HA 3VZPA 2HMSA 2JJYA 2W4QA 4J0EA 2ZK7A 1NVMB 3M1LA 4HNGA 3X2FA 1MV8A 4RDIA 1X7GA 4RPGA 5HBRA 3WTCA 1QYXA 3AW9A 1LTHR 2VYNA 2NADA 1O8CA 4IS2A 4B7UA 3U5TA 2Y1OA 3ROQA 4L76A 4DIOA 4O59O 1H9BA 5G0WA 1S7CA 3GOHA 4RCVA 4HP8A 2DBQA 4Y6PA 1ZVMA 3LF2A 4DREA 1GEEA 4UEJA 4RPLA 4WEQA 3NDRA 4CUKA 2EGGA 3WGTA 2Y1GA 5COBA 3RCBA 5TX7A 1T4BA 1PL7A 4YAIA 3ZV6A 3H5NA 4JP2A 2VWHA 5LC1A 5JBIA 2H1SA 3W1VA 1Q7GA 4XRGA 2PH3A 2PR2A 5BNTA 4ALJA 3HDJA 1HE4A 2NNLD 3RI3A 3SX2A 3D5TA 5T57A 3ZV4A 4XYBA 4ALIA 4ZHSA 2B4TO 3GN1A 1R0KA 2AA3A 3QV1A 5C3MA 3ASVA 3M6IA 1ZK1A 3G17A 4N5MA 5I7EA 3KLMX 4XGNA 2ZQYA 5A1TA 1VI2A 2ZJ1A 1F8FA 3E5RA 4ALLA 4RLHA 1PQPA 3LSYA 3EUWA 1QG6A 5DBIA 3DOOA 3OJFA 5JC1A 2PKQP 1GQQA 1Z7BA 1U3TA 4HNHA 4DBVO 1ZKMA 4QO8A 1DLIA 1ENOA 3I1JA 2HKIA 1H9AA 4BIIA 1PWZA 1KVQA 3NEPX 2F1KA 4MIOA 3AY7A 1ID1A 1GAEO 3BIOA 1Y5MA 1HL3A 4QEDA 4A26A 4J4BA 3TZCA 3PWZA 4WKGA 2BH9A 2O2YA 4XA8A 4JQCA 3ZWVA 3TZKA 2GLXA 2F00A 4JNKA 1XYGA 3VDQA 4FQ8A 4PFJA 2IYPA 3WGQA 2NTNA 1U9JA 4CQLA 4G81A 3AUAA 4B4VA 1ZJZA 4MPDA 2V6FA 5JS6A 2QIOA 1Y1PA 2ZB7A 5L7WA 1NFRA 3D1LA 3QWIA 3R0IA 5EN4A 3F5QA 5T67A 3DHNA 4TKLA 4EI2A 4CLEA 4HUJA 3Q6IA 4M8SA 3KEQA 3ZWBA 1XA0A 4J3FA 2ZTLA 4BGVA 2O3QA 2PD3A 3KV3O 1VL6A 2X6TA 4FFMA 4MVJA 1EUDA 1Z73A 2BHLA 5JO9A 1PTJA 4YBZA 5ADHA 1C1DA 3MJ4A 1GU7A 3ZNQA 3TPCA 1FDSA 1RM0A 4PZEA 5JPIA 3PDJA 1DBVO 1PJLA 4XQEA 1SZJG 2OP1A 3GMSA 1A4IA 5FFFA 3MCVA 4YEDA 1C0KA 2DTDA 3W4JA 4PN3A 5CDTA 5I7SA 3Q3CA 1A71A 1TVEA 2YDYA 3DEYX 4F6LA 5EQFA 2X5KO 4XQ9A 3L77A 1JA9A 1CRWG 1A4UA 5KJEA 4E4YA 2W2KB 5ER9A 2FN7A 2PZKA 4OMUA 2X86A 3MTJA 3A28A 1P1RA 4LRSB 3RBVA 1P0CA 3ROKA 1ZIDA 1U3WA 3IIEA 1GV1A 1P1KA 4XX0A 3RFTA 3GT0A 4RDHA 4RPJA 2G1UA 5MGBA 3LQFA 3WBFA 3WMWA 4W9NA 5TT1A 1J49A 1QYDA 4DIBA 3LT4A 4UVEA 1B3RA 2GD1O 4CMEC 3RC1A 4HFNA 4EW6A 2EKQA 3L4BC 1BSVA 1NX6A 3ZV3A 3ANLA 1SEPA 1DPGA 3I52A 3E03A 5L7YA 4J0FA 2CF5A 4YYZA 1LLQA 1ONNA 3PJFA 3NX4A 4EUFA 3CH6A 1HRDA 4IZHA 3G49A 4ROSA 4XDZA 2FZWA 4DQXA 5JMWA 5DBFA 5THQA 2OHXA 2C5EA 3HE3A 1C0IA 2Q3EA 4PZCA 1YBMA 4CM9D 2Q2VA 3OM9A 5EQDA 1XHLA 3R3SA 4PG4A 2QW8A 4OXNA 1C3VA 4C4OA 1R4MB 3EZLA 1P1HA 2DUUA 3WJ7A 1U2GA 3FTPA 2EHDA 1GQYA 3QVOA 3RKRA 4E5NA 2FPPA 2OORA 3GMDA 4BNIA 3TJRA 1U8XX 3I9NA 4LMRA 4AICA 3KOUA 3WNQA 1R16A 4MVJH 4E30A 1YB1A 4OO3A 4IDAA 3G1UA 3HN7A 4TVBA 2W90A 1MG0A 4M89A 4ZQBA 3FWZA 3U9LA 1MFZA 1AHIA 1PZHA 4BNMA 2DT5A 2O7SA 2FY8A 2AEFA 3FPCA 4JJGA 4Q3EA 3ON5A 4BGIA 1YQGA 4XIJA 2BFOA 3JD3A 1KEPA 1IULA 4NR0A 5AOVA 5CDSA 1E7QA 5JCJA 3ETDA 2H5LA 4NBUA 1K3TA 3HQ4O 2VYND 1ULSA 1DIGA 4JK3A 5F1KA 3SLGA 4YT8A 5F21A 2BELA 3OQ6A 4IJUA 2HUNA 4CM7A 1YOVB 4DRYA 3A1NA 1X0VA 3OHSX 4KTVE 4FFRA 3L9WA 3I9KA 3ZU4A 3OH8A 3FPLA 3GRKA 2GASA 3DC2A 1LC0A 2BFAA 4BQRA 4KQWA 4NBVA 4IDFA 5CPBA 3L07A 1OBFO 4R41A 4YTEA 1XSEA 1BWSA 3OBBA 2DFDA 3ZW8A 5DCYA 4I8XA 3KETA 5EMHA 3SJUA 4A2CA 4ALKA 2JCXA 4FB5A 2EKPA 3LC1O 2FR0A 2O4CA 5TSDA 2X4GA 5CPFA 1GPDG 3QHAA 3TOXA 4GBJA 2YY7A 2UUOA 3VHRA 3HADA 1YOVA 3RC7A 2P4HX 1HE2A 3ENKA 4BNLA 4L4XA 4CMHA 1WVGA 2PV7A 3WYCA 3RU9A 3U62A 1YL6A 4E13A 1UAYA 2VHZA 1YDWA 3H6KA 4KWHA 1A7AA 4XYLA 2LDBA 2TMGA 4ZJUA 2D0IA 1PSDA 2R2GA 1CQJA 1JKIA 4DLAA 3AWDA 2D5CA 4MKRA 5ILOA 3DB2A 2ZB8A 1Z7EA 3EC7A 2D2IA 4CODB 3JQBA 3UN1A 1U3VA 3K2BA 3OJOA 3JYOA 3PFFA 5JC8A 1LDGA 1YWGO 4TZTA 3GG2A 3EK2A 3I5MA 4MVJG 5KKAA 4S3MA 5L95A 1ISHA 3OQ1A 4CLXA 4H15A 1ADBA 1GEGA 3Q1LA 1DAPA 2P2SA 3D0OA 2QRJA 2YDXA 3BMCA 2VRCA 4DQUA 1BMDA 1PGNA 4H3VA 3UOGA 3C7CB 5IDWA 4U5QA 1SB9A 3VPSA 1PR9A 3WS7A 1QLHA 1I3LA 4D0SA 2NVBA 1UXGA 3MWEB 3LZ6A 5JAIA 2CZCA 1R4MA 1QR6A 1BDMA 5A9SB 2CF6A 5GZ3A 1SOWA 3ASUA 3M1AA 5IXSA 4BQPA 2W2LD 1MGOA 1FMCA 2C7GA 2XF8A 3K9QO 4QXMA 3GGOA 2FPIA 5K6AA 4AJ2A 3VVBA 4DBZA 3FF4A 3JV7A 5T8KA 1HLPA 3CEAA 1PJ2A 3ZHYA 2JAHA 1LNQA 2UUPA 2G17A 4I5EA 2B35A 3UGKA 3JQAD 3DAFA 3Q9UA 5A3VA 2NU6A 3FSRA 2EG9A 3ETGA 4P4GA 5H81A 3GUCA 4MINA 3LYLA 2X5JO 2VQ3A 5DBGA 4CR7A 1U7TA 1WDMA 4CQLB 2R00C 4Z3KA 2P4QA 3V2GA 3HHPA 3GZ4A 4KQXA 1UXIA 1LBEA 1M75A 1ZXBA 5A9SA 1U1IA 3KZVA 3U09A 3HFSA 2OO5A 3L6DA 3DZKA 2VT3A 4D3SA 1HDXA 4NBWA 5THKA 4BO7A 3KHUA 3RVDA 1R0SA 1KVUA 5FYDA 1CF2O 1X1TA 2X0RA 1J0XO 3ZHBA 2X0IA 4WLFA 4OKIA 5A3JA 3BMCB 5EL0A 4Q3BA 1PJBA 5JCJD 1NXQA 4JX8A 3CUKA 2PGJA 4GQAA 4CR6A 4CM9A 3UCEA 4HV4A 2A94A 2IZ1A 4CLOB 2FSSA 1XU9A 4BNWA 2EWMA 3OIGA 4EUEA 1LRKA 3RIHA 3ZWWA 3MOIA 2DBVO 1EUCA 4DLBA 1TA4A 1N7HA 4YR9A 1YO6A 1PJCA 1ZMOA 4PG7A 1YL7A 2HDHA 4AJ1A 1DJQA 4GVXA 4KUGA 4DYVA 3OQBA 5L9AA 1BDBA 3TWOA 2IZ0A 4P4NA 4OGWA 3V2HA 1E1LA 4GKBA 2RAFA 1HTBA 1T1RA 1I0ZA 4LK3A 3G79A 1IB6A 1EVIA 3C1OA 3HN2A 5COQA 3JQGA 2IZZA 1UR5A 3NV9A 2YHIB 1Q2XA 4J4HA 3UCFA 5KOIA 2AE2A 4J90A 4RZIA 4LSWA 1A9ZA 1KY5A 4IDCA 3UHAA 2PKRA 1TLTA 3LT1A 5L53A 4XWYA 1UZNA 2FHSA 2X58A 3RU7A 2Y1DA 4JBIA 2RBEA 5JFOA 5ENVA 1ISJA 2AG5A 3H9GA 1CDOA 5DDIP 2PA3A 3DFZA 1E3EA 1C1XB 1ISMA 3MJVA 2PNFA 5ICMA 3ZV5A 3E6AA 1B8PA 2AQ8A 4FIZA 4XB2A 5HS6A 3HJAA 3C85A 4J9VA 1NFQA 3IL2A 4CM4A 3QWFA 4P38A 1RM5A 4HADA 4IJKA 1DIHA 2LDXA 2I76A 5L4LA 2NQTA 2PK3A 4UEKA 1JAXA 2FP4A 1B3BA 2RH8A 4DLLA 3G3EA 2Q2QA 3CSDA 2VNSA 4MP8A 1KS9A 5KJ6A 1YKFA 1ZK3A 2NLOA 3COSA 3KEOA 5B4VA 1R0LA 2VCYA 4Y6SA 2YV1A 3VKVA 2WD8A 4BO6A 2UYYA 1M6WA 1NBOA 2OBYA 3MJTA 4WE3A 5AXAA 4LCJA 3B20A 3TFOA 2A35A 4XIYA 2E4AA 4EGFA 3DBRA 4D43A 5BSGA 3QSGA 3KSDO 1WW8A 1JTVA 1SB8A 3AK4A 3S8MA 4K6FA 3LC7O 4KOAA 3L9XA 1GR0A 1IHYA 4DUPA 1ISFA 1GUYA 3PEFA 1E3LA 2DBRA 3DBRB 4W9NC 3OA0A 2R6JA 2PD4A 1NQOA 1U5CA 2NU7A 2Q99A 3PVZA 4OIMA 3GK3A 3W4KA 3CIFA 4BNHA 1UUFA 3ETEA 3WBBA 4YQYA 1PZGA 1D4FA 4R1TA 3AY3A 2UVDA 4NK4A 1E5LA 5CHEA 5ER6A 4N54A 2JD2A 5JDIA 1U4SA 5A9TA 3TF5A 3VTFA 4Z9FA 1QV6A 5BSHA 5FEUA 3DZHA 1TI7A 5IG2A 1CETA 4Y8VA 3MJSA 4NU6A 1E7RA 8LDHA 4JBGA 1XELA 1I33A 1LDBA 3JQ8A 1NPTO 3RUDA 1NYTA 4E2WA 5JY6A 4A7PA 1UXJA 3E48A 3GVCA 2BI7A 3GVIA 2IEDA 4LN1A 4R01A 1CEQA 1LEHA 3GH3A 4FFLA 1Z75A 4B3IA 3BMQA 3D4PA 3ICCA 3B1JA 4W7IA 4W6ZA 3RSHA 4CV0A 1N7GA 4HFJA 2BGMA 3GRPA 4J4TA 1YQXA 4R3WA 1NQ5A 1BVUA 3Q2IA 2VRBA 3FNEA 4FS3A 5A03A 5FI3A 4GLLA 5G4LA 3DMYA 4I5DA 1FDUA 3O9ZA 2I3AA 1DHTA 1HSZA 1ZW1A 3EVTA 1KETA 4GH5A 1WP4A 5KKCA 3GQVA 2AQKA 3WFJA 2BFPA 4RPKA 4DQVA 3VOSA 1ZJYA 3S2FA 4A73A 1HT0A 3NT5A 1BXGB 5I9NA 5U1PA 1N5DA 4XR4A 3I9LA 4MOWA 3L0DA 1PJTA 2NACA 4PRKA 4CMGA 2GN6A 3JQ9A 2HU2A 2W2KA 1IYZA 2NM0A 3ZH2A 4FPXA 5AQ1A 7MDHA 5CG1A 3V2UA 1LXCA 4CQMD 1XWFA 3JQCA 3IP3A 3HB5X 1E3WA 4YAGA 1O94A 2WSBA 1T2AA 4BNJA 5B12A 5KWEA 4AFNA 4CV2A 1ZZEA 4L73A 2GCGA 5JAQA 3R6DA 3NTQA 6LDHA 4MVJF 3RFVA 1DC6A 2VTEA 5L3ZA 2C2YA 3UKOA 1E7SA 3IJPA 2WEKA 2X23A 3ANNA 3BTUA 2DTEA 2JHFA 4IDDA 5KJFA 3DONA 3W6UA 1C0LA 1WDKA 3IP1A 3LC2O 4CM8B 1FF9A 5HA5A 2D5AA 1JW9B 3NRCA 3P2YA 3DMTA 4FFPA 4YJDA 4ZQFA 4CV3A 1C0PA 3OF2A 5HS4A 3B1KA 3BYZA 4FGWA 4JROA 1HE3A 1EVJA 1LSSA 1L1FA 2HMUA 2UDPA 4E2XA 1DB3A 2ZTVA 1VC2A 3ZW9A 4FJ0A 4AJHA 4YXFA 2GSDA 3H3FA 3WWZA 4KP7A 2TMDA 1E92A 4KDFA 3TZHA 3DZJA 4PLCA 4XCVA 1LQTA 1MLDA 2Q1SA 3G0OA 4FGSA 1B26A 4FOOA 3DMTC 3KBOA 1HYGA 2NVWA 3HSKA 4E0BA 4J1SA 1P45A 3VC7A 4CJXA 1A7KA 2BGKA 4A5OA 1YS4A 4BNXA 5CDGA 1HYEA 1SOVA 3QRWA 3JD4A 1D1TA 3T4EA 1NWCA 1NAIA 1NHWA 3AJRA 2ZQZA 2HK8A 1K89A 3PTZA 2Y99A 4NHEA 3VPGA 5CDUA 5IZCC 4NH4A 1YL5A 4WLVA 5T6BA 1FXSA 1A27A 2Q49A 2QRKA 3BTOA 3FR7A 1LUAA 3SEFA 3WGGA 1QKIA 3PLNA 1X15A 2VOEA 1LRLA 1ULUA 2Y0EA 3D7LA 3PHHA 3QQPA 1AN9A 1DEHA 3KTDA 1NAHA 3DXFA 3GGPA 2BLLA 1MA0A 3AOGA 4LMPA 4U0JA 3ZU5A 4N18A 4GPD1 2X22A 2EIHA 3PHJA 4M87A 5U4QA 1AXEA 1KERA 4W82A 4QT0A 1EK5A 2DKNA 4XKJA 3FTNA 2P9CA 4XQCA 3I9MA 1PJQA 1UAGA 3WGYA 4YT4A 3HG7A 3H9EO 3DAPA 4RVFA 1PU2A 2P9GA 1N8KA 4IS3A 3CZRA 3WGHA 1B8VA 1F0YA 3DOJA 2DTXA 3LF1A 2PZJA 1PJ4A 1IHXA 2JFGA 1K6JA 4U7WA 3TL2A 2Q50A 1LA2A 1W4ZA 3JSAA 4BO4A 3F47A 2NU9A 3GF4A 5DOZA 4ZRMA 1R6DA 3PFWO 4PLFA 1WZEA 4BKOA 1LC3A 4KWIA 1JDJA 2OP0A 3QW2A 4XR9A 1PGOA 3JQBC 3JQFC 1AGNA 4DC1A 1ADFA 3C7DB 4MIEA 4Y9DA 2AQIA 3PDUA 4NG5A 1B7GO 2VUTA 1CWUA 3OJLA 1JU9A 3V5NA 1JLLA 3VKUA 4LRTB 2GPTA 1GV0A 4PLWA 2FZEA 3QVTA 3G1TA 3MWDB 2OXIA 1DHRA 1P9LA 3MOGA 4J1NA 4DIFA 1BTOA 4IGEA 4AJPA 1KVTA 1EVYA 4EBFA 1HDGO 1XG5A 2CDBA 4WGGA 3PGXA 1JKJA 1P1FA 2POQX 4NJMA 2GNAA 1XQ6A 5FI5A 1JKFA 2Z1NA 1PS8A 4YJFB 1GZ3A 4P4LA 1ZCJA 2FSVA 2D1YA 2FRDA 1NPDA 1EBUA 5TQVA 5HTOA 2ZB4A 2I3GA 1V3TA 4AJEA 1KYQA 3O03A 4BKUA 2ZYAA 3N58A 4CQMA 2CVOA 1BRMA 4NMHA 1E1MA 2VOJA 1ENYA 5DP1A 2WDZA 2X9GA 1YQDA 3OICA 2CSUA 1XGKA 1KEWA 2CFCA 2I66A 3EYWA 4PVCA 5LCXA 3ZNPA 1JVBA 4EJMA 5DZSA 3PXXA 3W8DA 1Z45A 2NV6A 4RVGA 4I9UA 5JAZA 3DFUA 1PR3A 2AG8A 4IXWA 4K6CA 4BS9A 1ZK4A 2JCYA 3WTBA 4B8WA 3U4DA 2D3TA 4BNVA 1DRVA 1E6WA 5DF1A 1E3SA 4GLOA 3F6YA 2GO1A 3GVXA 4LISA 4R9SA 2X7HA 4EJ6A 4CLRA 3TL3A 1LLCA 1I8TA 3RUHA 5C7IO 5JE8A 2Y1CA 4R54A 2Q4EA 3QWAA 3RAJA 2EJVA 3WG9A 3FBGA 5B4UA 3JD0A 3WMXA 3RKUA 2FR1A 2O3RA 3I4FA 3OEWA 4PLGA 3W4IA 2HRBA 2EERA 1WWKA 1VKNA 4U0KA 2WYWA 4NU5A 4I1IA 4N5LA 1M67A 1P1IA 5B4TA 3A06A 4IJVA 4BNGA 3FCOA 4YQZA 1NPYA 1P33A 3C8MA 3FHLA 5TLSA 1F12A 4BNFA 1SBYA 3OJEA 2XXJA 3WGZA 2Q1WA 3E8XA 1WMAA 1G6KA 2ZTUA 3HB4X 1XCBA 3KRTA 1KC3A 4XGIA 1D8AA 4YRDA 1B2LA 1R4NB 5G0UA 5BT9A 3TRIA 1U28A 4CM3A 4BKPA 2CMDA 4Q3CA 5IDYA 3NYWA 2Y05A 3LU1A 3NAQA 1HYHA 4IJWA 3QWHA 3DO5A 2VYVA 2PH5A 1T25A 1G1AA 1HDZA 1QV7A 3EGOA 1WAMA 3K30A 3C3XA 3GR6A 5KJCA 3B1FA 1I2ZA 3AU9A 4J16A 2NTVA 1MXHA 4ALNA 1DC4A 1DFIA 4ND4A 3Q11A 2Y0CA 4WJZA 2HJSA 1X1EA 4PGFA 3JQEA 4L0QA 1DSSG 1YH3A 1V8BA 3ZWCA 2DAPA 3PJEA 1UXHA 2HJRA 1O9BA 4D46A 5F5LA 1MB4A 3U0BA 5JLAA 1JVSA 3D5QA 2IEBA 2QYSA 3BXXA 3F3SA 4TMFA 4UUMA 3WLEA 4I9NA 4I08A 4XD2A 1EQUA 2H63A 9LDBA 1XQ1A 4YRAA 1KVRA 1H6DA 2J3HA 2J3IA 4GWGA 4B3HA 4CM8A 4IDEA 4DYDA 5JDCA 4QFDA 4J1QA 1I3NA 2AEJA 4EITA 3D4OA 4KUEA 1J6UA 4HXYA 3KXDA 5IDXA 4YJHA 4M55A 1GY8A 1DIRA 4YRBA 4FW8A 3S1LA 2QHXA 3GHYA 2BKAA 3MJCA 5T8KC 2JD0A 1T4DA 2C7VA 2YHIA 3MEQA 4NJMB 2GN8A 4GGOA 4OHUA 1NWHA 5K0ZA 3QLJA 2XAAA 3BHJA 3WQQA 4ALMA 4AJLA 3T4XA 3AM4A 4RO0A 3D3WB 2HMVA 1V3VA 3H7AA 4CUJA 2C5AA 1ML3A 2E49A 1WPQA 3IAHA 1OC4A 1UXKA 2EGHA 3OECA 4GL4A 3RJ9A 1PX0A 4NBTA 5JSFA 4M1QA 3INTA 3MTGA 1FDWA 3DZFA 4IBOA 5EESA 2O4UX 3WOHA 1DIAA 1SCUA 1H0KA 3WWYA 4E5PA 6ADHA 1V3UA 1ARZA 4BO0A 4NPCA 9LDTA 2P5YA 4HY3A 3FNHA 4I5GA 4YPOA 1NM5A 2C82A 4YT2A 1WDLA 3F4BA 4WLOA 3ZZNA 4BHTA 5TF4A 5TC4A 1NQTA 4JJIA 4DVJA 4E12A 2NUAA 3A4VA 4GX0A 4OSPA 4L74A 4LVCA 3ZI0A 1W73A 4R5HA 2ZCVA 3ADOA 1MUUA 1RWBA 3GZNA 2VHYA 5CP8A 2EEZA 1LSUA 3O8QA 4JJFA 4XJSA 4WCDA 4AG3A 2PFGA 4CL3A 5F1PA 5H83A 5TT0A 1P31A 3AM3A 4RGBA 4OSOA 1EK6A 3ITDA 3PPIA 3LLSA 5L51A 3QVXA 2G5CA 4TRNA 3ZU2A 1DAOA 1M66A 2ZB3A 1OC2A 1YONA 4DPMA 1Q0HA 3IUSA 3K8ZA 4UUPA 3OIDA 5IZCA 4NBRA 4UVIA 2O3JA 1GZ4A 3MZ0A 1HLDA 4ESOA 3H4VA 4OQYA 3RBXA 2SCUA 4B4UA 5CFZA 3F1KA 4FR5A 3ZWOA 3NT4A 3I9JA 4BNUA 1LLUA 1LJ8A 1HWYA 1T26A 4D0RA 5U9CA 4BV9A 4P22A 3GA0A 1GCUA 5ENDA 5L4SA 2B0JA 2PTGA 4RPHA 3VZSA 3U49A 1HE5A 1SMKA 3VPHA 1R4NA 3HDYA 2VT2A 2JD1A 3NJ8A 4ILKA 4J2OA 2OBNA 4JN6B 3WQRA 1TT5B 1WMBA 4RF4A 1EVZA 3OMLA 1BG6A 2EW2A 2ZJ0A 2O2SA 1BXKA 3GAZA 4P8RA 5I8ZA 4A03A 2ILTA 2QZ9A 4II3A 3DZBA 4D3FA 1DDOA 3PHLA 3VH4A 1Q7CA 4RF5A 5BSEA 2EP5A 2B83A 5KVSA 1FK8A 4MJLA 4C7KA 3U4IA 2YFQA 4OM8A 1T2DA 4FBGA 2Q46A 4CMBA 4IINA 3MJEA 3TSCA 1TB4A 3PYLA 1QYCA 1KOLA 1NR1A 2O23A 3EHEA 3EW7A 2NSDA 4GAEA 1Z6ZA 4J43A 4PCVA 2J3KA 1P3DA 3CMMA 1K2WA 1OI7A 1X7HA 2VWGA 4DMLA 5IAAA 1F17A 5I7VA 4CMJA 2AQHA 2GDZA 2WJPA 4MVJD 4WUVA 4EZBA 3GDFA 5JCXA 5IZ4A 4ZD6A 3ZGYA 2P91A 3ADPA 2P5UA 2RIRA 1EE9A 4UAGA 3JQ9C 2ZYDA 5C5IA 3WLFA 1IY8A 3GEGA 1Y5RA 2RHRA 4FN4A 5L40A 2X0JA 3SXPA 2VHWA 4BOYA 3WFIA 3SVTA 2ZATA 3PWKA 3RBZA 1M76A 1DIBA 1VJ0A 3BAZA 4MP3A 4UULA 4LGVA 3D3WA 3VTZA 2OZPA 3ROMA 2HCTA 2J5RA 1NFFA 3K92A 3QA9A 4BMSA 4BGEA 1PZEA 3WNVA 4ND1A 4L4RA 1VLLA 3I6IA 3KM0A 3ONFA 3P5SA 1F14A 2PGLA 3NTRA 1LDEA 2DFVA 4NNJA 1GFSA 2YHUA 2ZCUA 2FMUA 2HRZA 3GGGA 3IS3A 3KYCB 1Q0LA 1Y8QA 1U5AA 4UUNA 5K9ZA 4UVDA 2HQ1A 1C14A 5B37A 4WOKA 1YJ8A 1NR7A 1ZNQO 1ZBQA 1X7DA 2W8ZA 4NI5A 4TRRA 4WNCA 4IMPA 4BB6A 2VZ8A 4DL9A 1GD1O 2Q45A 5TNXA 3VAZA 3WICA 4PG5A 4IDBA 3GEDA 2QYTA 4FC6A 3ABIA 4BO9A 1N1EA 4CM1A 4GSLA 2EP7A 4GMGA 4XYEA 5JDIC 1GTMA 4CMEA 5BQFA 5A05A 4D79A 4D41A 3TQHA 4RF2A 4EEXA 3R1IA 3BMQB 4WNIA 3L6OO 3GY0A 1L7DA 3WQSB 4IY1A 4NJOA 4NFSA 1IZ0A 2VUUA 3UICA 2AEMA 4IM7A 1HDYA 3JQ8B 1RJWA 3O8QB 3UAGA 2YZ7A 1V0JA 1T2EA 1YRLA 2NQ8A 1ONPA 2CNBA 2I65A 2GN9A 3X2EA 2YV3A 3RUEA 1NTOA 5CDYA 3LT2A 5BNIA 1RM4A 4W7HA 3EY4A 4JLWA 1X0XA 3OA2A 3RC2A 3E82A 4EJ0A 2ZYGA 4OXYA 3K31A 1OOEA 1ZK2A 2B36A 3BTSA 1Y9AA 1T2CA 1ZUD1 2OUIA 2P9EA 3HNPA 1A9YA 1KIFA 1MX3A 1LDYA 3H9JA 4R9RA 4YJGA 3NKLA 4CM6A 1E6UA 5EIOA 5HRUA 1QLJA 1PWXA 3R3JA 3H8VA 3GNTA 4EDFA 3ORFA 4RL6A 3JQ7A 1K0UA 3AY6A 2IXBA 3BHMA 2HLPA 2YV2A 3O4RA 4J7CA 4OJNA 4DTIA 2Y68A 4Z6KA 5A4DA 5TIIA 5J23A 1ZK0A 1H5QA 3NT2A 3T7EA 1IE3A 3C1TA 3PZBA 1PJ3A 4M54A 1SC6A 3D64A 3ZU3A 3BMOA 4CLHA 2O3SA 1GQ2A 4GSKA 3FNGA 3WIEA 5C37A 3CKYA 1W0CA 1YE3A 1B14A 5TJHA 2CDAA 1P77A 2E48A 2C29D 3CMCO 1Y8QB 3U4CA 3V8BA 4AJIA 3NUGA 2CY0A 3INRA 1BHSA 1RM3A 5JYEA 5IXYA 4IQ0A 1QORA 3PRJA 1DFHA 2PZLA 4AJOA 1ONOA 5IDQA 3M2TA 4PLZA 3KLPX 4E5YA 1PGQA 5G4KB 3BZUA 5ES3A 2WYVA 2IODA 7ADHA 3UF0A 3GFGA 3U4HA 2ZKLA 1E7MA 1IOLA 3A14A 1C1XA 1L7EA 4FOSA 2DVMA 3WYEA 2FWMX 4CUZA 3JQ6A 3P2OA 1KC1A 1SO8A 3IKVA 1HZJA 2FR8A 5DOVA 2JAPA 4TRMA 1RYEA 1IZ9A 1NNUA 3S55A 4BMNA 4YWJA 2B4RO 4CQMB 1VSUA 1QXSA 1T2FA 3DR3A 3KYBA 4Z0PA 4E33A 1Y9EA 1RKXA 5DP2A 1O5IA 1ISIA 2DLDA 2VZ0A 4DMMA 3F1LA 2P68A 1D3AA 2I67A 3PIDA 5GY7A 4Z9YA 3GNSA 3TOZA 4PLHA 4WK6A 4BO1A 3S2GA 2YJZA 4L8VA 2EKLA 5H82A 3I4CA 3D4NA 5FF9A 3WSWA 2NWQA 3E9QA 3RC9A 4DC0A 4PLPA 4Z0TA 1FDVA 3L6EA 1VRWA 3EZYA 3HZZA 2O3UA 1MC5A 2GUGA 4QECA 4J7UA 3PQFA 4OOEA 1FJHA 2PD6A 3FNFA 4RQTA 4K1LA 5HM8A 3BA1A 4RVDA 1SNYA 1U8FO 2R00A 4URFA 3IOYA 2Q2WA 5A02A 3QP9A 5B1YA 4KZPA 3RUIA 4W4TA 4E21A 2J8ZA 3ST7A 5LDHA 3AI1A 3GC6A 3E1KA 1EUZA 4GX2A 1KBZA 3K73O 2IE0A 3H65A 1HDCA 1EE2A 2B5VA 4MO2A 2C54A 4RJTA 1LRJA 4ND2A 1A5ZA 1DRUA 2X1HA 2DBZA 4B4OA 3CINA 4JXKA 4JBHA 5K6AC 4XQGA 1K6IA 1R12A 4U8GA 4CR8A 1PGPA 3FN4A 3CZMA 1DFGA 3UVEA 4QFCA 2J5KA 3ZN2A 3QWBA 2OOSA 4O6VA 1PS9A 2EXXA 3H9QA 2Z5LA 3GVPA 4YDRA 1CERA 2X8LA 2EV9A 3PI7A 1E7YA 4QUKA 5A04A 2DUWA 1YBAA 4R1SA 5CEJA 4IIVA 5G2OA 4BMVA 1C1DB 4K28A 3GG9A 3KYDB 3RQSA 5T64A 3AU8A 1N92A 1HZZA 2Y67A 2DC1A 3FBTA 3PLRA 5BNFA 2YW9A 3DBVO 4MVJM 4KUHA 5COAA 4RF3A 2JKVA 4YJFA 3ZNNA 1HEUA 5EINA 1Q0QA 3H2ZA 4G5HA 3PJGA 3JQ7B 4C7JA 3SBOA 5DNAA 4HFMA 1HETA 4YAJA 2V6MA 4BNZA 2O50A 3EMKA 4ND5A 2J3JA 3PP8A 3EVNA 3VH2A 4S1VA 3FRJA 3I23A 1A72A 4A0SA 3AUTA 5AXCA 2CDCA 5A06A 4NFHA 2Y1EA 2RHCA 4YACA 4B79A 4J6FA 1JWAB 1LDMA 3E18A 4G2NA 3SC4A 1Q7BA 4WLEA 2RCYA 1X13A 3NGLA 4DWVA 2AW5A 3ZWYA 4RVUA 3AOEA 4OL9A 4RLSA 4E2YA 4OYRA 3H5RA 3H9UA 2G82A 1QRRA 3TZQA 3IJRA 1NP3A 4Y98A 1ZSVA 2PY6A 2DU8A 4ZVVA 1H6AA 1H94A 4CPDA 4ONEA 4XEHA 3HWRA 4CLRB 1G0NA 3PQEA 3H2SA 1UDCA 2D4AA 1OAAA 5TGDA 2C07A 1GUFA 1OMOA 1VE9A 2WD7A 3GAFA 2G0TA 3STHA 4MDHA 2VNAA 2AHRA 4D7AA 2OMEA 3JQGB 3VZQA 5JXWA 2CVQA 2VUSA 4M49A 3VH3A 5ITVA 3UCXA 1YB4A 4WPGA 1IPFA 3CXRA 4FJ1A 5I8WA 4D45A 5KNLA 3JQDA 3H5AA 1PS0A 3KYCA 1O0SA 1PEDA 1RPNA 1M6HA 2BI8A 2VWQA 2WWRA 2HMWA 2A92A 4IZIA 5T5QA 2Y93A 3P7MA 2DPGA 1OFGA 1I30A 1I3MA 5C7OO 3RUFA 2JHGA 1XIVA 4U6SA 2JFHA 2GZ1A 1N9GA 1QYWA 1EEHA 2J5QA 3ZWMA 4TSKA 2D59A 1R15A 1DOHA 4GVLA 1I36A 2BD0A 2PGDA 4GI2A 3ENNA 4XYMA 2VTDA 4CV1A 3QVSA 1QYVA 1IPEA 5I9LA 4D42A 5A5EA 5GZ1A 2I6TA 5L7TA 3PQDA 4PLVA 1I5RA 1ZFNA 3TN7A 4EYEA 1UDBA 2XXBA 4JIGA 4PZDA 4BVAA 1D1SA 2AXQA 1IUKA 4GMFA 2YFHA 4E3ZA 2HK9A 1EDZA 2GERA 3F4LA 4J9UE 5JAMA 3QIVA 5EPOA 1P0FA 3FWNA 3LT0A 4HKTA 4ZQGA 3KSZO 4FCCA 2EW8A 4OQZA 4CM4B 3DTYA 1CYDA 4R5MA 4XRRA 3HFGA 5IFLA 3L4BA 2V65A 3V1YA 4R68A 2G76A 4K26A 1ZXLA 5C7LO 5AXDA 1BVRA 2BMAA 3OEYA 1U7HA 2BRUA 4FD3A 2VHXA 4KMSA 1AHHA 5KTKA 3DDNA 1XR3A 1PL6A 2PWZA 4QO7A 4YJGB 4NIMA 2NTJA 4YT5A 5G4KA 3ZNOA 4ID9A 4KDEA 2RH4A 1BW9B 1GCOA 5AXBA 3ULKA 1JQBA 4Q39A 3K2EA 4YVFA 3KSUA 4WOJA 4G65A 3ZDFA 4Y67A 2PZMA 4XDYA 3U3XA 4FC7A 4Q3DA 4B4WA 3DBHA 3CE6A 3E5MA 1PQWA 4R1UA 1XDWA 1E1KA 4WLUA 2IDZA 2DM6A 3DAGA 4MKZA 4AJNA 1ZEMA 3ZCXA 3ZHXA 1EFLA 4TWRA 4LW8A 2IXAA 4M86A 2Q4BA 2WM3A 3P19A 3VVCA 2QRLA 1WZIA 2HAEA 2EF1A 1AE1A 1TEHA 1UP7A 3DBLA 1EDOA 4OAQA 5LDGA 1NVTA 1YGYA 5F1OA 4N7RA 4BO3A 2GR9A 4HBGA 4IUYA 4J7XA 4B7CA 1Q1NA 2B5WA 3GDOA 5DT9A 3DTTA 4WLNA 3KYDA 4O5OA 2D8AA 4YA6A 4LVUA 3LDHA 1EZ4A 1PJSA 1PQUA 4GGPA 4F45A 5DULA 1I24A 3INGA 3WB9A 5KCZA 1GPJA 1HKUA 3GPIA 3GVHA 4GKVA 3A9WA 1BGVA 1XEAA 2YUTA 1N2SA 4R4JA 1Z74A 1QMGA 1I01A 2Y1FA 2E82A 3JYLA 5DN9A 2C59A 3AFMA 4MVJI 4PLTA 1W8DA 3NDIA 5KJ1A 4RVHA 3T7CA 3PWSA 5JNLA 3NGXA 1GDHA 3QY9A 1GYQA 3UH1A 1ZSYA 2GZ2A 1MG5A 2PKQO 4GWKA 4A10A 2VYVD 3ZWPA 4OXKA 1V35A 1QP8A 3AUSA 5ILGA 1HDRA 2ET6A 3JYQA 3Q2KA 4O63O 5A5FA 3RASA 1DO8A 2Z1MA 4FSHA 1VL8A 3GNQA 1BW9A 3VZRA 4BNKA 4AJ4A 3QJ5A 3F5SA 4IPTA 1I2CA 2WE7A 3O26A 1D7OA 4KTTE 1G0OA 3AUUA 1B8UA 1NQAO 3FI9A 1J5PA 1S6YA 2C2XA 4CMCA 4D3DA 3WJAA 1UP6A 1YBVA 4Z3DA 4XZ3A 1J4AA 1ADGA 3OSUA 4H16A 2V7PA 1ISGA 1XKQA 4DPKA 3KB6A 3FD8A 3PYMA 5GMOA 3ZWAA 1T24A 5CG2A 1UH5A 2YQ4A 4W99A 1ZMTA 3IC5A 3UUWA 3PGJA 4ZRNA 4F6CA 3BHIA 1XLTA 5JMPA 3OFSA 3HDHA 1SAYA 1ZEJA 1O95A 4PRLA 3DL2A 4PLYA 3KUXA 4GX5A 4PVDA 2XPCA 3RUAA 1F8GA 4QTZA 3BMNA 3RROA 3F46A 3OP4A 4PIVA 1H93A 5JO0A 4F46A 4NQZA 4AJKA 2VN8A 2WE8A 4L9RA 4BKRA 5G0VA 2BGLA 4BNNA 4NZ9A 5IF3A 4MKXA 3C7AA 4MVJP 4QQRA 3TFQA 4AVYA 4BV8A 3WR5A 3VDRA 3JYPA 1N9GB 1JWBB 4IQ8A 3GLQA 4IQGA 1EMDA 1LX6A 1JAYA 1P44A 4GX1A 4R69A 4RV9A 3Q9NA 3AOEC 1FDTA 4IGFA 3RD5A 3TNLA 3N7UA 2O3TA 4Q3AA 4BGUA 5A9RA 5BSFA 3BMOB 3DHYA 4DA9A 4J2HA 4L4SA 1LSJA 2QX7A 3DHEA 4B8ZA 3JTMA 2E6UX 4LCEA 4RORA 4BO2A 4YB8A 3IUPA 4E2ZA 3AM5A 3DZIA 4HFRA 5CAEA 4HX5A 3IQDB 3E9NA 2DQ4A 2Q1TA 1E0DA 2HMTA 5KVCA 4MVJE 3VH1A 1SEVA 2NVUB 2EJWA 1VL0A 3K5PA 4PG8A 2FOIA 4DXHA 3CTMA 2WMDA 1F06A 1PL8A 3C24A 3ZWNA 3TDKA 4CL8A 1WXDA 1I3KA 2ZIZA 3DZGA 4L75A 1Y7TA 2X9VA 4QX6A 2O7QA 4TZKA 1HDOA 1VSVA 3W8EA 5DCWA 3WGIA 4JCOA 5G0SA 1LU9A 3O38A 3QE3A 4BUCA 1LSOA 4B3JA 1E5QA 3GHHA 2AMFA 5HWSA 5EJ2A 4UEOA 3D3EA 1U4OA 1V6AA 2BFMA 1SPXA 5IJZA 3NJ4A 4CMKA 4UVGA 2E37A 3OETA 3LVFO 1GADO 4D44A 4F3YA 5TRTA 3PK0A 1E7WA 3NTOA 2QZZA 1K5HA 4NDNE 1GL3A 2A9FA 4ZICA 4E5MA 5CEFA 4UREA 5GZ6A 2JL1A 1E3IA 5KVVA 5IN4A 1CJCA 4IIUA 5L4NA 2WTBA 3DQPA 4R16A 1LLDA 3ONDA 4AL4A 5G0TA 4ZQHA 3IDSA 4BKQA 3M2PA 4CLDA 3LK7A 3W6ZA 1B16A 4EEZA 5AVOA 3ZHZA 4NK5A 4JP3A 4R1NA 4RVSA 3ITKA 5JDCC 3WDSA 4EUHA 1R66A 1ZO8A 2Y0DA 4LSMA 3SLKA 4N5NA 3PHGA 3GPDG 4E6PA 4DPLA 1ENPA 1U3UA 1PGJA 1VPDA 4RZHA 4E31A 2WYUA 2AE1A 1NASA 4OOFA 3RWBA 1Y8RA 1NHGA 1UJMA 3LLVA 1W6UA 4FFOA 3WSVA 1O89A 2GN4A 2HSDA 2I99A 5JY1A 1VM6A 3VPXA 1Y81A 4QSMA 4I5FA 2VHVA 2B37A 4BB5A 1AXGA 2I9PA 3JYNA 4AJJA 1E3JA 1OZAA 3C1AA 3ZWXA 3PYXA 3WYBA 4J1TA 4IXTA 4TQGA 3KO8A 3S2EA 4MP6A 5EERA 3EAGA 2OGUA 4TVOA 1E1NA 3L4SO 3V1UA 1LI4A 3BMNB 2UV8A 1H6CA 5KIAA 4WCFB 4J49A 2OL4A 4B7XA 2WD7B 3OJ0A 5IN5A 4II2A 3RUCA 4O1MA 1T1SA 5ITWA 1DJNA 3B70A 4R3NA 1EBFA 4XJTA 4UUOA 4A27A 2UAGA 2W98A 1ZSNA 1I2BA 3JQAB 4ZU3A 4H7PA 3IMFA 1B15A 1Y8RB 3GUYA 1YXMA 3WIDA 2JFFA 4OH1A 4ZQEA 4WCFC 2GRAA 1B0AA 3BTVA 2A4KA 4CMIB 3HDQA 3UXYA 2Y66A 1BXZA 4FJ2A 3GZNB 2GZ3A 4K9DA 1LQUA 5DCUA 4CMAA 1YB5A 1M2WA 2VWPA 3UFXA 3WGOA 1U2DA 1VJ1A 1CQIA 3W8FA 8ADHA 1UP4A 5I7FA 1HF3A 4WCFA 3RJ5A 1E3WB 1Y6JA 3JD2A 3Q0EA 3ONEA 4Y6RA 2QG4A 2X0NA 4ZN6A 5CEEA 3TZ6A 1I10A 3ANMA 1ENZA 3KVOA 4Q9NA 4X54A 5F3RA 2XOXA 4UVHA 3PJDA 1GZ6A 5MDHA 3QVWA 4ITUA 1PIWA 2IRWA 1YDEA 3PZRA 3N74A 2VZ9A 3V1TC 2V6GA 2V6BA 4ND3A 2IYOA 1ZH8A 2I5PO 2QQ5A 4ZGWA 3B6ZA 4CM5A 1BXGA 1WLYA 5L45A 2ZTMA 4J91A 1LDNA 3AI3A 3OIFA 4JGBA 2CD9A 2H6EA 2FPGA 3H3JA 1GUZA 1EFKA 5JYDA 1HXHA 1VKOA 1EQ2A 4E32A 4HWKA 3AI2A 1TT5A 2B4QA 3SC6A 1DLJA 1TT7A 1YVEI 3SJ7A 4E5KA 2W2LA 4TKMA 2BF7A 4O0LA 1Z82A 4OKNA 2X9NA 5BR7A 2CUKA 4WEOA 4PG6A 4XGKA 3GFBA 3K96A 1KEVA 2HK7A 2GF2A 4WECA 2GGSA 5F5NA 3DBLB 4BO5A 4Z0HO 4BNYA 4YCAA 1R37A 4Z9XA 3WX0A 1K6XA 1HSOA 1MXFA 1H6BA 3NDJA 1PZFA 5I9MA 4XB1A 2B69A 3GN2A 3FR8A 4BO8A 4U6QA 2NU8A 4BNTA 1NVGA 4TRJA 1DXYA 1X14A 3AFNA 1DC5A 3F9IA 1MP0A 4ZA2A 1N1GA 3PIIA 1XU7A 4MIYA
chains in the Genus database with same CATH superfamily
1AB6A 2JIOA 2BHTA 2PN1A 1XVVA 3LUFA 5E4FA 4CU5A 3HJFA 1H1LA 5TS3A 2PIDA 4JMPA 1QVRA 1Z33A 1EXNA 1UQRA 4JOQA 5LM3A 2HB6A 1DOAA 1R4AA 4NZPA 4EKYA 4XM2A 2ZFUA 2IWHA 5SY4A 3DUFA 1NN5A 1IB0A 2EARA 4FFNA 4QU9A 4TUYA 4DCCA 4CGZA 2G04A 1TK2A 3K0SA 1O03A 1X8LA 3R6LA 5C1PA 2XR1A 1FPMA 5TJ9A 4C14A 1H2BA 4ZI3A 5KVQA 2D13A 3AWIA 4TVKA 5TVKA 3I83A 1CY1A 1KVSA 5B3JA 3VAYA 5FV4A 3MINB 4YJHB 2QN6A 3CPSA 3OZEA 4LG1A 5J2TB 1GSOA 4MROA 4R7TA 1SBTA 2PQ0A 4WXMA 2NVUA 4KIUA 5HR5A 1AUPA 1P39A 1RBMA 2X4DA 2H51A 4FSXA 4QPPA 5CURA 2QXTA 3CW2A 1AUOA 2X2OA 5BWOA 2VAWA 1OE0A 2WJHA 4HQ6A 2OFPA 3MS7A 3EDMA 1AURA 7REQA 3RNLA 3E3MA 1E3QA 1OT3A 1TO6A 1V9LA 3SMQA 1Q44A 4D25A 4INAA 4LSZA 2CXTA 3GEIA 5FNVF 3U31A 4MUAA 4MHSA 5JHHB 1P74A 2HRCA 4AF8A 4BPRA 2WQ6A 1VJTA 2VTBB 1II8B 1U8YA 2J6BA 2PZBA 1CY4A 1U3CA 5FUBA 4HGRA 4ZDWA 4FE4A 3GFRA 1UINA 2VRCD 3WMEA 4RQUA 2F3SA 3E9MA 3M3HA 3VI4B 4I9HA 3THOA 3E81A 2DHEA 2ZK7A 3LKZA 3VKHA 3HXQA 2GHIA 4R1PA 4XPIA 2EZTA 4JX9A 4D4IA 1ZC4A 2W58A 1OJLA 4ZVRA 3PCTA 2HJ9A 3WTCA 1X7GA 1LTHR 1KK0A 1XKTA 2PMCA 4MVWA 2VYNA 1O8CA 4J6EA 5LDDC 5EWLB 1XNQB 3DYVA 4MYHA 2E89A 2ZAOA 1OAOA 5F98A 2A57A 1N2CB 1NONA 1GUDA 1H9BA 2GZSA 2X9LA 2YWGA 4QD3A 4OMCA 2DBQA 1U1DA 4WMLA 2DKOA 2D2FA 4M1OA 4Y6PA 2YICA 3U9SA 3LF2A 3C97A 3KALA 2DHRA 3NAZA 4Z7OB 2DFLA 4OB6A 3P27A 1X92A 4EUNA 3EGEA 2YZKA 3LX8A 1UPAA 3RCBA 3SXJA 1L8QA 2FPIB 1PL7A 3IOEA 3B36A 1ZIPA 2H1SA 1Q7GA 1Z06A 4XRGA 4P81A 3VR6H 1R6UA 2YVQA 3I01A 3T41A 1FJGB 4PPGA 3RVNA 2OG1A 4D4JA 3B51X 5EXEA 1JAHA 2LE0A 1ZUWA 2X19A 3FPAA 3HU1A 4UBIA 4ALIA 3AIOA 2AI1A 2B4TO 2ISCA 4I55F 4F4DA 1R0KA 5D85A 3ROEA 1DWOA 2XZDA 5ALPA 1RXYA 2EDAA 5K0BA 3ASVA 1V9SA 2CNKA 3G17A 4AS2A 4BDSA 1ND5A 4KAJA 4LY0A 4XGNA 5IJ9B 5JUWA 1VI2A 1X7YA 4TV9A 1PYDA 1UC8A 4ALLA 3PFGA 2ZCJA 3A9SA 3LSYA 1XMOB 4JWKA 2WY2D 1P3JA 4F4FA 3L6CA 2AVDA 3OJFA 1COWD 4HATA 4ZKEA 4TL8A 4QYWA 3SBDA 3AL2A 5JSZB 3RVLA 2A9KA 4BU0A 4YO7A 5BN3B 1GQQA 4RK0A 1FJXA 3KXIA 1YE8A 1PHPA 3AFHA 2NZYA 1AMUA 1G7RA 1V6SA 3THXB 4QO8A 1ENOA 4R8KA 5BWNA 1DI0A 1H9AA 4MLDA 3DV0A 1PWZA 3TW8B 3UJ8A 3LTNC 4C6HA 3URMA 1URPA 1JG7A 1OX4A 1PV1A 1TU4A 5A71A 1M2FA 1N6LA 2GSWA 3DMPA 2ZVQX 4S1NA 3WOVA 1LW7A 1Y5MA 1G5RA 1I1HA 3TZCA 1C30B 1RQRA 3SLRA 2O2YA 2QLLA 4WDQA 2AV6A 2O7NA 5DO9A 2GDJA 1K3UB 2F00A 3FCYA 2Z58A 2RHGB 1A5BB 5DX8A 1ECLA 1XYGA 1KMIY 1RJ9A 1G21A 1U9CA 3NFYA 3WJ2A 4IIJF 3WGQA 1NKTA 3PUJA 4CQLA 2C9BA 4G81A 2NW6A 2HREA 2IF0A 3AUAA 3DUFB 4TUYB 1ZJZA 4B4VA 1W35A 2V6FA 2QIOA 5JS6A 1T5SA 4CXMA 2ZB7A 4DSZA 3GUVA 4ZCQA 3R0IA 2QAGC 1TF5A 3MELA 4GG1A 4MB0A 2ZUWA 5T67A 4ERNA 2AYZA 1OZGA 1ZCFA 4QL3A 4QUAA 4EI2A 2WFZA 4CLEA 3IB6A 1JXQA 2VH5R 4HUJA 4B3SB 3D0KA 3CFYA 4M0LA 4P86A 2WVGA 1SVIA 2PBFA 1PEKE 3ZWBA 3FHTA 2NP6A 4P3OA 5DISB 3QI2A 3D7MA 2XF2A 3GBSA 2HZ7A 1VL6A 4FYIA 5A62A 1A8HA 2PUDA 1H0RA 1ULAA 1CEEA 2X1LA 4KBFA 4LF5B 4L6AA 3BXEA 3MWLA 3C48A 3MCUA 2YYZA 4PPNA 4A8JC 2IZOA 2OZLA 3STXA 1C1DA 1OYOA 1QE5A 4EECA 1O1YA 2HF8A 4WGFA 3E4DA 3CLUD 2GH1A 3EA4A 3F49S 3LBAA 4FYHA 1FDSA 2WJ6A 3RS4A 1WF6A 1EWRA 4FE7A 2Q07A 4DEVA 4F4JA 3OZVA 4AT1A 5JPIA 2IZ5A 3PDJA 3AQ4A 3FMPB 2ZPUA 3KL2A 1DBVO 3LNCA 3VO1A 4CL0A 3GMSA 2GHQA 3BWYA 2MYNA 3DMHA 4IIGA 3S5JA 3L0PA 3W4JA 4DNOA 3S29A 1L4NA 3NYQA 4C4AA 3DWIA 3NTVA 4JUCA 3VU9B 3Q3CA 2ZRDA 4F92B 1A71A 1RYZA 4AZSA 3K4PA 1WPRA 3B52X 1O3YA 4L08A 2IXGA 4A16A 4F6LA 5IKEA 1JA9A 1CSEE 4N5IX 4GNKA 1J56A 2W2KB 3SE0A 2FN7A 1JHPA 4JI4B 4HSEA 2FYTA 4LRSB 2O1EA 2OM6A 4E14A 1U8EA 2DWQA 2VDNB 4L16A 3LW7A 3K6RA 1LJUA 1CUZA 4Z9AA 4EB8A 2WT8A 3IQFA 3LQFA 4OBBA 5TT1A 4M22A 1U1FA 1NJ8A 4UVEA 1BN7A 1B3RA 4HH4A 2GD1O 2XXAA 3V8RA 4JLUA 4E6EA 3SWWA 4F3KA 1DX4A 2AYXA 4QQKA 2EKQA 5ALZA 4EW6A 2ZWOA 4KG7A 1WO8A 1TUGA 2HXYA 3ANLA 2BKVA 1DPGA 4RMNA 5IBPA 2QYOA 4W6QA 2PT7A 3THRA 3T7TA 4J0FA 4X20A 4IXMA 3SDSA 2WU3A 4Q4DA 1LLQA 1PFYA 5E3HA 4D97A 1ONNA 2XD4A 1JXAA 4C4TA 2V7VA 4EUFA 1TC1A 1HRDA 1QGDA 1G18A 2ZI9A 4GI3A 2PXCA 4OFBA 4RHYA 5HCIA 1J8QA 5GVRA 1W93A 3QI7A 2BWJA 4OHWA 4X6XA 1X7ZB 3AO0B 4IH4A 1PSWA 3W6NA 2ZJFA 5LLDA 2GPNA 1EJBA 9MHTA 2QN7A 4B3FX 1ATZA 2C2HA 2WINI 2Q2VA 1YR7A 2BJVA 2COKA 3OF5A 3R3SA 1C3VA 4I4CA 4OXNA 5D84A 3EZLA 1P1HA 4L0MA 4PN7A 1QJ4A 1U2GA 3TGLA 2ZTSA 1T1JA 2EHDA 2FF7A 4ENPA 3QVOA 1LKZA 3G2HA 4E5NA 1JSZA 3WL8A 3GMDA 2ZRCA 3LS2A 1U8XX 5F9HA 3TVYA 3KOUA 3EOZA 4JVSB 1R6AA 4MVJH 3T0IA 3ZKAA 4BJ6A 1NNEA 3NBMA 4BPBA 1YB1A 2A0KA 5E8JA 3U4MA 4FDTA 2W90A 5BXQC 4ZQBA 4AXBA 2X15A 3HBNA 3M6VA 2PLRA 4B83A 4HLDA 3BE4A 3SHTA 1EDDA 3PKJA 3D43A 1HI9A 2REBA 4PQFA 1PW5A 1W36B 4UQPA 1K4MA 2AG1A 4UEQA 1J0EA 4NU8X 4TWJA 2ZXEA 3GFOA 4QNNA 4XIJA 1KEPA 4DS3A 1ZD4A 3WB2A 2O59A 2ZUSA 2BFNA 4IVQA 1AZLA 1JR3E 1QPGA 4OIFA 3HR7A 2CHQA 3I8XA 3LXRA 4FN5A 1K3TA 3IUNA 5BNWA 1M7HA 1E79A 3S7ZA 4RZSA 2VYND 1HO3A 1N0WA 1NJSA 2HK6A 5T3UA 4MKFA 1E32A 5FRDA 1FY2A 4B6SA 2AB0A 2YIDA 3KK0A 3OQ6A 3VFDA 2OYCA 5LR6A 2R6GA 1U1CA 2DETA 4M9XA 2HUNA 1J21A 3AH8A 4I14A 3O8NA 1OR8A 4YCCA 2F62A 4PHFA 4YP5A 3GARA 2ODPA 1NVWQ 4FFRA 4LTMA 4IFIA 3I9KA 3TS1A 3W3AH 3VNAA 2PLFA 1JALA 3DNMA 5EXTA 4LC0A 1D1PA 4RSGA 3ZU4A 3ZZ1A 5JMTA 3AERA 3VOTA 5BSWA 4RXUA 3ZDEA 3MPUA 4E22A 3RAEC 1LC0A 3EIQA 3EASA 1YRQA 1YZNA 2XQJA 4TMKA 2VQ6A 3HWSA 1VFPA 4H27A 4TKVB 2XMRA 2V5UA 4LX0A 2ADFA 1T0IA 3OEHD 4AY6A 1I6LA 5FO1A 2AS0A 2P65A 2DFDA 4DIKA 2AG6A 1QVVA 3WA7A 4G8CA 5EVCA 1ES9A 3ZY4A 2IW1A 4WKNA 2A6PA 4ALKA 3K5HA 4RKQA 3WWPA 3ZY2A 2Z9CA 3JTEA 1UBTS 3Q3GE 2ZANA 2FR0A 2O4CA 3MRXA 3IE1A 3S40A 4RESA 1RWVA 3T3NA 5KWVA 3HYTA 1XQYA 3TMAA 5CPFA 1GPDG 1VLZA 1DAFA 3QHAA 4V0LA 3BFPA 1JMYA 2YY7A 1Z12A 1P7VA 2JGFA 4KIFA 3DJFA 3OFKA 4FINA 4DABA 1XMJA 2P4HX 3ENKA 1QO0A 4P34A 5KX5F 2PMFA 3EDOA 4BFUA 3B78A 3ND5A 4IICA 3LYAA 1CZOA 3U62A 1FQKA 2J4FA 4C78A 2VL7A 3H6KA 2FDRA 4KWHA 1XLUA 5ENZA 2QTZA 2TMGA 4YMTA 4XYLA 2PKCA 2D0IA 2W2VA 2ZLBA 2ZAMA 2WD9A 4KKVA 3ROTA 3ZGVA 3REOA 2KWIA 4DJTA 4HD8A 1PF7E 1ABFA 1CC1S 3LWBA 5CK5A 3C8UA 2M1ZA 1Z7EA 4JBYA 3RBAA 2D2IA 3UN1A 1K1EA 5KNBA 4ZU1X 3JYOA 3ISTA 3PFFA 3N5KA 5JC8A 1RTTA 1YWGO 2MSKA 3WLJA 3KSMA 4YMVA 1VOTA 1SELA 2H57A 4KGXA 4S3MA 4OQNA 3RC3A 3SDZA 4QATA 4YBRA 4KVZA 2FWRA 3V4SA 1GEGA 4EW1A 2VXOA 2YDXA 3BMCA 5LYYA 1ZP6A 1SHUX 2BMEA 3QKIA 1GARA 5EE9A 5JNTA 1EGQA 4DQUA 2DG2A 4DV1B 2WF7A 3IEIA 2WPNA 3ASZA 3C7CB 3ITNA 1RS0A 4DZRA 4LCBA 5DK4A 1MABA 3EF3A 1I3LA 3QJYA 2NVBA 4QASA 2VF2A 1IHPA 1BCSA 1MJNA 1W75A 4YH1A 3T4UA 5JAIA 2HBQA 2RCNA 3QEBZ 4TWZA 3ENQA 1CY2A 1UDXA 1QU3A 1WOMA 2FUG1 5EJ7A 4DMRA 1SIWA 3M1AA 4BRZA 1SXIA 7YASA 5HXAA 1GJRA 1SKUA 3AVQA 1C1HA 4V0RA 1HQCA 2WVJA 2QN8A 4YCDA 1DKRA 1RHJA 2GA8A 2GK6A 3MK31 2ZREA 3EG9B 2VPQA 1EX7A 4IHQA 1WABA 4R9NA 3OLZA 4X41A 3FF4A 1VPTA 4MYUA 5T8KA 3VAAA 3E9CA 3WWOA 1S3IA 3C8DA 1BH6A 1QU2A 1P4HA 1ADJA 1XB2A 2HSZA 3GI1A 3X1KA 3ZX4A 5JJBA 3NMUF 2UUPA 2V45A 3BK2A 3EEFA 4I5EA 4C07A 1PT7A 3Q9UA 3QA3E 3B6EA 5A3VA 5GONB 2QTHA 3EPRA 1U6JA 3FSRA 1FYXA 2EG9A 1XZCA 3ETGA 1CULC 4P4GA 5LWHA 2IS6A 3KJIA 3LYLA 1UKYA 3FDXA 4MIKA 4MQBA 4Z3KA 1K98A 3GIDA 4BVJA 2F8LA 4TS4A 3BT7A 4NL4H 1M0EA 1SH7A 5H0IA 1LBEA 1UAAA 4CL2A 1IJEA 1M75A 4MUFA 2B9EA 4C3UA 5HKKD 1CR2A 3KZVA 3U09A 3HFSA 2OO5A 2WU0A 5KDOA 3L6DA 3NALA 2PLWA 1XJ5A 4HI0E 4MWCA 1QQ5A 1JQEA 1VL5A 2GJSA 4RYDA 4KIWA 1VCIA 4EF4A 4A2QA 5JS7A 1YT5A 3PNKA 5E7JA 1GNSA 5BWLA 1LGYA 2P4SA 1J0XO 1BDHA 1O9GA 2QZPA 4OKIA 4UPDA 4CM4B 1Q0RA 2B1QA 2M9MA 2P8JA 3M6XA 5K3DA 1AO0A 5A3JA 1HY3A 1Z0FA 3BMCB 1L5YA 3OT1B 1YHNA 4HR7A 4MJ7A 4Q3BA 1S8NA 4ETMA 5JCJD 4UTNA 3GT3A 1VHLA 1TO1E 1DDIA 1FEZA 1WULS 2PGJA 3CUKA 3EXHA 3PVSA 4GQAA 4M9ZA 4CM9A 2FDCA 1TJ4A 3OZBA 2C04A 3A9RA 1PFKA 3UCEA 3E1GA 2OGWA 4B6GA 4CLOB 4RHXA 1XU9A 5DJ5A 3UXMA 4DGQA 4EUEA 5CFMA 4NMLA 4KO3S 1NW8A 2E6KA 1GPUA 1W581 3HGQA 1TA4A 2W2XA 4FP9A 1M2JA 4TGLA 4WWHA 3ZC3A 4DA7A 1YO6A 3RAFC 1ESNA 1PJCA 3HYRA 4TMYA 2ZVDA 4DDMA 2E4YA 4ZAWA 1DJQA 3E22B 1OFHA 3TI9A 1A8IA 1FBTA 4DYVA 3O73A 4NOKA 3CLRD 5F76A 1MDBA 3EG9A 3TWOA 2DR2A 2F8SA 1Q1EA 2I6SA 3F9CA 4KLZA 3U3ZA 3BD7A 2Y1WA 2Q8QA 4WX2B 4MS3A 5LJIA 3IEVA 1GZDA 4YLEA 5B7NA 5J4KA 3C1OA 4ABYA 3A1FA 3SM3A 3NV9A 1UR5A 4G23A 4J4HA 5KOIA 3VO8A 1PLJA 4J90A 1RPTA 2FFQA 5CBPA 1TC2A 4PYNA 1ODIA 3OT5A 2E5FA 3LT1A 4XWYA 2DPYA 2FHSA 2X58A 2FMXA 3DJYA 3RU7A 4JBIA 2A30A 4RTRA 3HO1A 5HCNA 2AK3A 4EFKA 1ISJA 1T0JB 2I7VA 5AJYA 2F48A 3QQ5A 2B4AA 3KBBA 1OQAA 1VIDA 2LGJA 1B8PA 2AQ8A 4PINA 3QNMA 1UBHS 4G4GA 5AVRA 2F3UA 3H1AA 3P20A 3CWZA 3NLLA 3ROFA 1U6IA 2FP4A 1ICIA 1EP9A 1OXVA 2AXNA 3FVVA 4FILA 1B3BA 1QMPA 4RMJA 1Z22A 5IK2D 3FSJX 1Y4AE 4Q00A 3G3EA 2Q2QA 2QJRA 2OC4A 3CSDA 4Q01A 3F2IA 3QE2A 2C9ZA 1MU0A 2RGNA 2JK0A 2QTNA 13PKA 1CVLA 1JHDA 1T4CB 2CXNA 4RH3A 5KJ6A 2AN3A 1VCMA 2HA7A 3CX3A 4JIMA 1H8HD 3DWEX 2DT8A 1Z0IA 4AN1A 4E5DA 3COSA 3KEOA 4ZT5A 1AG9A 1FXWF 3H9BA 2YV1A 4Y6SA 2WD8A 3KQQA 3O1IC 1XZ8A 4Q1FA 1NBOA 3MJTA 5EIAA 3CZPA 4WE3A 3Q10A 1GPLA 4MCAA 4EG7A 3OMWA 5C8YB 3OFVA 1R6XA 2JIZD 1A2KC 3UMJA 2IYQA 3JXEA 3DBRA 5CX1B 3BCHA 5ALIA 3QSGA 4ILEA 1RFGE 2UYCA 3UQZA 1WOYA 3T7AA 1WW8A 1JTVA 2CJFA 3GBVA 4OFZA 5AOBA 2WMOB 3LC7O 1VG1A 3KXLA 5BPFA 4W9RA 1FRQA 4O2BB 4DUPA 3AILA 1JG1A 4E07A 2PX3A 1E3LA 1KL7A 3U3KA 1MW9X 1US8B 2VCEA 1GTG1 3PTAA 1Y7IA 1NQOA 5L3SA 4RENA 3IQHX 2Q99A 3PVZA 3PUYA 3O2QB 3GK3A 1G8FA 3CIFA 4OIMA 2I7CA 1TEXA 4BNHA 1UUFA 5JAOA 2QRGA 3ETEA 3L02A 4MKHA 4UE3S 1U8TA 2JVKA 2OZLB 1J24A 1WQ4A 2FOXA 2QP9X 2XEXA 1E5LA 3R5JA 1BD3A 4FYXA 4HAOA 1TPYA 1NW6A 2BEUB 3TQOA 4J07A 3TF5A 2X76A 1XK6A 2FF5A 4IIDA 2VLBA 1QV6A 4Z9FA 3VTFA 5ELXA 1YJAA 1JA1A 5LFAA 5FEUA 5HIKA 3DZHA 1ZHOA 2O8FB 4S12A 2CLMB 1TTTA 3TNFA 4ZCMA 2G9UA 1G1MA 4EB0A 3EYAA 2B34A 2Z2IA 3O8OA 1EWYA 4V24A 4JBGA 4U7PB 1LDBA 1NPTO 3FYUC 2FQQA 3QXCA 2C4VA 1UXJA 4NLLA 2C84A 5EPUA 3GVCA 4JQOA 3SX0A 4LN1A 2A58A 1CEQA 1N2GA 1QO7A 1LEHA 2RKBA 3GH3A 4UZEA 1Z25A 2JEOA 1EX9A 1WTCA 4RIFA 4MQFB 4JELA 4R8VA 4RAQA 4CCWA 4BQOA 1KRWA 4RTOA 4R3WA 1YR3A 3ZHUA 5K3BA 4GR9A 1SRRA 3FNEA 4FS3A 5A03A 5EHIA 5HQ3B 5I5EA 2EHJA 2XY4A 5G4LA 4FZJA 3K9LA 4MWEA 3V9PA 1XBTA 1YCGA 4I5DA 4C01A 3O9ZA 1OB2A 2JLCA 3VHXB 4QEKA 4PX3A 4ACBA 1QRDA 2C9MA 1WP4A 3K0BA 3C74A 2AD1A 2ZG6A 3BSSA 5F3DA 1AKRA 1T8RA 3WFJA 3G2MA 1P9NA 3PE6A 3S2FA 2BN4A 1QQ6A 1E6CA 2RHMA 3D02A 2Q5JA 1L5MA 5I9NA 3L4JA 4YAFA 3I9LA 2AK2A 3AMVA 1SK9A 4AS1A 2FWIA 2PT5A 3O92A 1NXSA 2GN6A 2IELA 3LVQE 4JUDX 2HU2A 1NZFA 2EX4A 2H54A 2W2KA 4RTMA 2JATA 3BJEA 3DM5A 2PGOA 3OX1A 4W5TA 3HY6A 5AQ1A 2GJKA 3V2UA 4RK7A 5G1NA 5A6SA 1B8OA 4Y1FA 1XP5A 1CZHA 4N12A 3DCYA 3JQCA 3IP3A 4M0PA 3HB5X 1ST3A 4I6GA 4PYJA 4XM0A 4MCIA 1SCIA 2BKUA 2I7XA 3K0AA 4MTCA 3LCMA 1I6WA 1QG0A 5CLJA 5KBYA 3U7GA 1XEXB 1JEAA 2H9YA 5DXFA 1E60A 2GCGA 3JVEA 3SKXA 4X3PA 4X1OA 3V80A 1FRZA 2GM3A 1ECGA 2ODTX 1HG1A 4BX8A 2V7BA 1K27A 4MVJF 3G8YA 5DEOA 2QMYA 1Z8FA 1Z7WA 3IBTA 1FP4A 1QE3A 5E4YA 3MWEA 2CMKA 4BFLA 3BDVA 2MYUA 1CUVA 3ANNA 5T4EA 1T0UA 2O2ZA 4ZOEA 2JHFA 4IDDA 3T9BA 5BSTA 2P2GA 1TQ4A 1U7OA 1EDBA 3IAM1 3SF0A 3W6UA 5KJFA 4L02A 2QT1A 3IP1A 3LC2O 2WPDA 2WNSA 1QYIA 1OI2A 1RLUA 4FFPA 4EKGA 5ITSA 3MWGA 1Z4NA 1C0PA 2VP9A 2XEDA 2DR0A 3W6OA 3EXHC 3VR5A 4JSYA 1VG9B 3BYZA 1GUAA 4FGWA 2C98A 4JROA 4YPVA 1E6MA 2BGTA 3OEED 1D2EA 4HDMB 1D7AA 3D7NA 2UDPA 2VPTA 3AF1A 1DB3A 1FUYB 3EVFA 3PD7A 2UXCB 1VC2A 3LUKA 4FJ0A 5DWQA 2YRFA 3H3FA 3WWZA 1HYQA 2WTMA 4NH0A 4AJHA 4KP7A 2TMDA 3AJEA 2QTLA 2XTAA 3KAJA 5LQKA 4DB2A 5DSZA 4MV7A 2Q0QA 1AKWA 4UM8B 5CMLA 4UU0A 4HQNA 3G0OA 3VR3A 4AK9A 4CG1A 4JJEA 1IAQA 2OFXA 2H2FA 2WG1A 3D3KA 3KBOA 1BO6A 2NVWA 3HBJA 3MF4A 3OM1A 4KQCA 3PGMA 721PA 4C0XA 2IKQA 1P45A 1TVMA 2HFKA 4J1SA 3WLSA 2BGKA 4A5OA 4DRXA 5HJ7A 2VHJA 3I2IA 3OO1A 2CFSA 1MO6A 2WT4A 4C30A 1PE0A 2RMKA 3UXEA 3ZDBA 2E4UA 3L06A 3I6BA 3DTVD 1SOVA 3PQ5A 2W8BA 3JD4A 3T4EA 1NWCA 1NAIA 4BNDB 4UTZA 3DM9B 3CRQA 1YSCA 3WRWA 2EFYA 4J3JA 1E6KA 3UYKA 3VPGA 1U0JA 4EHKA 1FLVA 1Z5VA 3TE6A 4PSAA 4WESB 5T6BA 4RSRA 1FXSA 2VDLB 1M34B 4L3OA 5H9WA 3BTOA 1YF3A 2IEYA 2GXUA 3A6JA 3FR7A 3ECSA 5HKLA 1QO9A 1N9ZA 3WGGA 4KVAA 1X15A 4C76A 3TZEA 3QQPA 1T4GA 1JB1A 1D2AA 3PUKA 5FA8A 2Y2VA 4ZYVA 1SC9A 4PHHA 1NSYA 2R8OA 3AOGA 1VDMA 1PJAA 4LHVA 3LBFA 2FCRA 2VDRB 4QWWA 2X22A 1QOZA 1IY9A 1KOJA 4J76A 4NNPA 4BWFB 4QDZA 3DZCA 2HIMA 4LZWA 3NBXX 2BZGA 2DKNA 2NPIA 4XKJA 2QGNA 1U4NA 3FTNA 1GNPA 3KQSA 4B43A 4BNDA 4DN6A 4XQCA 1UFRA 4DQ0A 4OK3A 1JSCA 1KYZA 3UMBA 2EFGA 2RHDA 2NT3A 1OIVA 1UAGA 2G1JA 3ESZA 3Q3IA 2WF9A 5C0OE 3WGYA 2P9YA 4RVFA 1PU2A 2F3QA 2ZJ4A 1N8KA 2HJGA 2L18A 4R2HA 4LBWA 1B8VA 4LJ5A 4U2GA 3A9TA 5LVAA 3U3RA 1BGWA 2DGDA 4MWGA 2ZRJA 1IHXA 3PRYA 4NEHB 4EK9A 2B94A 2B7CA 2CZGA 2P27A 2PIAA 5ADWA 4C87A 4XWAA 5DOZA 3GF4A 1J2YA 1T5DX 2NSJA 2IJGX 3NQ41 1Z0DA 5J9FA 1VSTA 4MWOA 1WZEA 3K6KA 1SK8A 1WZCA 1K7XB 1DAIA 3CHYA 4NVRA 4BWYA 1KGSA 3K7EA 4K3UA 5GJCA 1XV5A 1BWPA 2Q8PA 3FYUA 4B6RA 1YQUA 3KVNA 4DC1A 1ADFA 4Y9DA 5FNVA 3ZDXB 1LNSA 2AQIA 1I4LD 2DR3A 3WLQA 2P6PA 2NU9B 3VNSA 1J23A 4ITVA 1CWUA 4JC5A 1MB0A 3IXMA 4OBEA 1QFZA 5H1YA 2J45A 1PV2A 5J2TA 4Q6BA 4HGPA 2YMMA 4EQZA 2HY7A 4NZZA 2EFEB 3HCPA 2DQSA 1YDGA 2BKXA 1GPYA 3G1TA 5KOYA 3WL3A 3LXMA 4I50B 2OXIA 2G88A 1P9LA 1T43A 3MOGA 3QOXA 2GZDA 2PHZA 4J1NA 5FOXA 4CG0A 1BTOA 5AJVB 4AJPA 1ZVVA 3L4KA 4FB4A 3O3NB 1MAWA 1QGZA 1XCPA 1XG5A 1SUWA 2CDBA 1D4ZA 4OI2A 4Q05A 4QU0A 3WIOA 2P2CA 5F7JA 3P9NA 4H2DA 4M1KA 1H4SA 3ZE2B 4MJ3A 1RLTA 2QI9F 4LBYA 5FI5A 1JKFA 2XE7A 3FVRA 4YJFB 3A04A 1NMEA 2OFFA 2FRDA 2RHOA 4OMDA 3D2AA 4GZ3A 4K0KB 3WKAA 4DAEA 3EOBI 1NRIA 2FWNA 4CU2A 1CR4A 4H59A 1KYQA 2QK4A 2FMHA 2R5FA 1JTFA 1Y5NA 1X7XB 3IQXA 2VFAA 5BRAA 2VOJA 4ACAA 2IBTA 2WILA 2WDZA 3HGMA 1J9EA 2JRCA 2PBZA 1XXLA 2VSNA 1G19A 3GJ0A 2I66A 4H7KA 4Q3KA 5BN5B 5KHOC 4EJMA 1JVBA 3ZIUA 5I7WA 5DZSA 1ZUNB 1CFJA 3Q7SA 4P36A 5HFAA 2JGDA 4CCAA 4DLTA 2FQ1A 2YVLA 4Q66C 4RVGA 4RLQA 5DX1A 3GFPA 3DFUA 2FV8A 1PR3A 3ZWKA 4X97A 3O47A 4IXWA 4UTOA 4BS9A 1QV9A 1YR2A 3HCAA 4PCLA 4R83A 2Q6LA 1FUIA 9ATCA 4F11A 5JWOA 2XVXA 3GGSA 1DRVA 2O8EB 1XVAA 2HRRA 3G2NA 4JLKA 3N6RA 3T95A 4GLOA 3ZCRA 1TMKA 4AWBA 3UBMA 2Q0SA 4F93B 1ZRMA 3TL3A 3HJNA 3RUHA 3EVEA 5C7IO 3EEOA 4K05A 6REQB 5EY5B 1JHAA 5JE8A 4ZIRA 2JGRA 1ZUIA 4F3CA 4JHLA 5BT8A 1JEEA 2A0UA 2OGSA 5FPYA 4D3YA 5EUQB 4AMUA 4G0QA 1DQZA 4PLGA 1NURA 3W4IA 4JYAB 3IQGX 4OUDB 2BFCB 2GTHA 4L8GA 4U0KA 5DXJA 2FUKA 2PSSA 3WMFA 3KJQA 1M67A 1P1IA 1U2DC 3AKYA 4R2XA 4A6EA 4LOJA 2HU7A 1XD2A 2H5JA 3DF9A 4ZVOA 3IO5A 3FCOA 5ALYA 2WHYA 4YQZA 3TX2A 3L0YA 4KODA 2K4MA 4BJ1A 3FHLA 1MVLA 3I42A 4TLMB 3NNSA 4ER5A 3WGZA 2JPDA 4N3AA 1JIKA 2RD2A 2FXVA 2OR3A 1R18A 5JSUA 1YZGA 3EN0A 2CUNA 4OL0A 3Q3EA 3MQ4A 1B2LA 1F0KA 2QQ0A 1JHXA 1U0FA 1VMKA 2B8WA 2P2NA 5BT9A 1JEYB 4CM3A 1TW3A 2CMDA 1THTA 5JPDA 3LU1A 2UZIR 3D4LA 1HYHA 3ANYB 3M3PA 4IJWA 3LV8A 4CEHA 2PH5A 4UE6A 1G1AA 4WD3A 5GTDA 3K30A 1K86A 4LWPA 4WTOA 2I2DA 2K5UA 3GRYA 2Z6UA 2AOTA 3QHPA 3AHHA 3QTTA 4XUEA 3TAHA 5DYGA 3NEYA 5JADA 1MXHA 4HRXA 5FUWA 1UK8A 4ALNA 3SJBA 1HEIA 4Q9HA 2I22A 2Q29A 1PFVA 3W2EA 1P6QA 4B31A 2HJSA 3B12A 3GD5A 4NZOA 3JQEA 2M2IA 2ORWA 5TEWA 1D4OA 1IY1A 3BORA 2DAPA 5DI3B 4EA7A 4AKEA 3HPQA 1O9BA 1L8OA 1B00A 3JZAA 1MB4A 1F6WA 1N2IA 1SXGA 2AXPA 3U3DA 4D46A 1Z2DA 2IEBA 1P7ZA 2QYSA 1TU0A 3STTA 4GP9A 5DHTA 3GEBA 2KPOA 3H42B 4BKMA 3FJOA 3UK0A 1KE2A 1P0QA 4C6SA 4I46A 4YRAA 1H6DA 2J3HA 5D51S 4EG8A 4B3HA 4OQLA 3ZBQA 4G0ZA 4JYBA 5JDCA 2YOFA 2NO0A 1P9WA 2F6RA 1AF4A 3KEMA 1I3NA 4EITA 1AD2A 3D4OA 3LAWA 4KUEA 1KFJB 3P9IA 3KXDA 1BD4A 4BMYA 4BWGA 1JPVA 2HQBA 3R3WA 1SUIA 1RQGA 1YGPA 3GHYA 4E7PA 3M6FA 3CX8A 3MJCA 1O08A 3NHBA 2JD0A 5T8KC 2J0UB 2WKRA 4M76B 3KOOA 4NJMB 1NWHA 2G08A 5K0ZA 1SUCA 1X7WB 1JHOA 2PH1A 3QENA 2I4NA 4K3VA 1Z5GA 4OB7A 3T4XA 4KLAA 1DEAA 1GIAA 3MTQA 2HMVA 4KMRA 3H7AA 4LE1A 5I9TA 4DNXA 1JEYA 1ML3A 2VAMA 1JMKC 2G5PA 1Y1QA 2OV4A 4MJXA 4BZPA 1J1UA 4ZC8A 5E1OA 3R5HA 4NBTA 1XP8A 3BPSA 5IT5A 5EESA 4IHAA 1DBIA 4LJYA 2QRZA 1UIMA 2VK8A 1FPQA 5M04A 4DMHA 4DLWA 5CB4F 3AF6A 1CRZA 3O4HA 2OZVA 4FSDA 5CVTA 3OE4A 4DKJA 3NOOA 3FNHA 3EDQA 2EX1A 1ZD8A 2NPFA 4ZP1A 1RXIA 2R6R1 2VXBA 4GGMX 4YT2A 3QNWA 4DVJA 5TF4A 4EO7A 3O9MA 4QGBA 4KXFB 5LOVB 2NYAA 2NUAA 3GRVA 3W77A 5CVUA 3K9NA 4LVCA 4R5HA 3ADOA 1M8FA 4EI9A 1CUFA 1MUUA 3GZNA 2VHYA 5CP8A 4X44A 5LIPA 4DSAA 3ETLA 3PIRA 1WB4A 1RKQA 2A9VA 1VA5A 1YVUA 2IQIA 3K9GA 3IYLW 1VQ1A 4EHHA 4WCDA 3FHCB 1XQ9A 3KOXA 1T3LA 1U2SA 3AM3A 4RGBA 4OSOA 4ZIRB 4YPFA 2R3SA 3T8YA 4BQNA 1NN0A 3HUTA 1DU4A 4OQQA 5HNKA 4HB0A 3ZU2A 2ZRGA 1NN3A 2ZB3A 2JGEA 3F9RA 1LJLA 3MWKA 4G56A 1YONA 1OU0A 4HO1X 3VBCA 1Q0HA 3K8ZA 5IZCA 4C7BA 2Q7OE 1M8KA 2O3JA 4LJ8A 1QQ7A 1EPUA 2D2XA 2EJUA 5HIMA 2Y1KA 3MZ0A 4ESOA 4Y9RA 4OX9B 3ESDA 3BBPA 3F6CA 3KT8A 4M0CA 4OYLA 4WXPA 4YQEA 3RBXA 2SCUA 4YASA 4BZWA 1UJNA 3C6KA 3QKWA 3ZWOA 4D9FA 4DMFA 3EPJA 1TZ2A 1GZ7A 2WZQA 4EPYA 2XYRA 3MJDA 3ZHVA 1KFKB 2X9QA 5ENDA 1KF0A 4KSCA 2B0JA 3CN9A 4P0TA 2FW6A 3PEEA 4G41A 3U49A 3EH1A 1R8SA 1EESA 1IFXA 3EF1A 4MNTA 1B8NA 4YK7A 3VPHA 5GP1A 1VPVA 1TT5B 1V8FA 1BG6A 1ULHA 3GAZA 2DH6A 4G5YA 3OWXA 5ICFA 2ILTA 1JEQA 1P8JA 1Y9DA 3EGXB 4WOPA 2QZ9A 3U17A 2FE4A 2H59A 2WM8A 3P9CA 1GSIA 4RU1A 5HJ5A 1VYTA 2R66A 3MHTA 3E84A 3PHLA 1X80A 4ZV7A 3A1TA 5BW5A 1YMUA 2P9TA 2R96A 3N6XA 3GGJA 2B83A 3QYJA 3LC0A 4REMA 1FK8A 5BSRA 5TEVA 4EW2A 4MJLA 3FYDA 1QANA 2GXSA 3PE3A 5EJ9A 4C1BA 1X3LA 3BXFA 3R23A 4FBGA 4BUJA 4TM7A 4RZUA 3MJEA 3VPBA 3TSCA 1R5OA 1TB4A 3C87A 4MV6A 2O23A 3EW7A 3OI7A 2NSDA 4W1PA 3M4XA 4GAEA 4TKVA 4PCVA 1WMFA 2J3KA 3EGWA 1M6NA 1IXKA 1OX6A 1W88A 1OT5A 1R3UA 1V8PA 2GEVA 3C8ZA 4FQ5A 4JC0A 1AUXA 2VHEA 2VWGA 2XRMA 4EGAA 3U4QA 1F17A 1B6RA 2JIDA 4O4HF 4G9GA 4TLLB 4D8XA 4R0NA 2GDZA 1DAEA 2VTVA 3HL4A 4LF7B 2FZKA 3SXUA 4C3OB 1RPZA 1CE8B 2GJAA 2H17A 3P2KA 3O74A 4HYTA 1TGVA 3MM4A 4Q4JB 4UBLA 3BICA 3KTAA 1IN4A 1F0NA 3ADPA 3QLVC 3T3HA 1T2VA 1ZGGA 3RS9A 3ZGYA 4PC2A 4UAVA 2O6HA 1IY8A 1E9FA 5LBIA 4MX8A 1XZBA 2ZTHA 3MLEA 5FP0A 4B5LA 3IRVA 3R41A 2QLBA 2WSMA 3IBCA 2DX7A 3FCUB 1BU8A 3KWJA 3WFIA 2WJZB 2WSLA 3SVTA 2CYAA 2H4XA 3PWKA 4IHJA 1M76A 4WKOA 1TK9A 4UULA 3BM5A 5BYJA 4DC9A 4D26A 5FR1A 3VTZA 2FW9A 2G06A 2IYYA 4MYCA 4OHKA 2VK2A 2OZPA 2ZBPA 3CV3A 1IQUA 3K92A 4WA7A 3IR7A 4JYPA 3WKEA 1PZEA 2FUCA 3OLWA 4MWBA 5EA2A 4ISCA 2RHLA 2YZ2A 4L0CA 4ND1A 4F5DA 1N33B 1F2TA 1SQ0A 2BMWA 2JEYA 3ONFA 2EKDA 3P5SA 1XZQA 2PGLA 3CF2A 1RABA 3O4VA 2IX3A 5CDTA 5LYJF 3IS3A 1AQNA 2HRZA 3GGGA 1YDHA 1XC7A 5ERGB 2ABWA 4N8EA 4EF6A 4KREA 4TXNA 3KQOA 3IUMA 2VLIA 4WOKA 2VXYA 2VSQA 3N2GA 1DEXA 1NR7A 4R8RA 3PD1A 5LP6A 4AY2A 1X7DA 2W8ZA 3ECAA 4TRRA 1LPNA 2VZ8A 2Q45A 2FXIA 2NG1A 4KHZA 4L8WB 5ULLA 3VAZA 5JH7F 1Y6FA 1AOXA 3QX7A 4EPVA 1N25A 1FP2A 4KAFA 4AS3A 2IY7A 2AR9A 3GEDA 4IDBA 4L95C 5KYWA 2D2EA 3O8CA 4KR3A 4DR6B 1ZH0A 3VR4D 4MGEA 1N1EA 4CM1A 3EC2A 3FY4A 4EMSA 3MUOA 2EP7A 2WHQA 5F2OA 2LCIA 1KDRA 3EBLA 1YR8A 2GAAA 2Y9PB 2ZRIA 3OOWA 1TTPB 6NULA 3B85A 5A05A 2E21A 2GETA 3CNBA 3JAWB 1IIBA 3TQHA 2X3UA 4X7RA 1BGXT 3R3UA 1DARA 4EEXA 1ZS9A 5JV5A 1KZ1A 2P6UA 4AWAA 5IMSA 5FR2A 2FPOA 1OIXA 4OFXA 3COPA 3NC4A 1NUQA 3O5AA 4E5SA 3VR5D 3SBXA 3JQ8B 3EIWA 1T2EA 2GT1A 3O0TA 4ML3A 4ZEOA 3WYFA 4MXDA 5TE9A 2AOTB 1PZXA 3R9KA 1OFIA 2QQGA 5MFPA 2Q7XA 2VJLA 3RT7A 2VPXA 3PX2A 5ECYA 2ILVA 4LRXA 5IASA 2H48A 1DTWA 1I1NA 4HJRA 3GQBA 2YWEA 3O84A 4ZV4A 5CDYA 1UOEA 3G0GA 2IVFA 2YZNA 4UDOA 4FD2A 3FZEA 5C18A 1TCCA 1OI3A 4NYIQ 1X0XA 5A7FA 1UDWA 5F78A 4UHDA 3LX5A 2GBCA 3AZQA 3P52A 1FMFA 3FLEA 3UY4A 2VF4X 1NBAA 4ENUA 4H9GA 2OUIA 4XIFA 3G82C 3H05A 4NP6A 1KIFA 4IZ6A 4LXQA 1KJQA 4GM4A 4A8JA