2C2HA

Crystal structure of the human rac3 in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
168
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Rac3 in Complex with Gdp
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
total genus 58
structure length 168
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c2hA00
2QZ4A 1KMQA 2QA5A 5KU1A 4GT1A 4JBYA 2RB4A 1ZBDA 3NH6A 5HCNA 4BEJA 3AP3A 4Q1CA 2VH5R 4XSGA 4KYUA 4FCTA 1EX7A 1ESMA 2BBTA 1VCOA 3KKNA 3DKVA 4QRHA 5GJCA 1LV7A 5UKDA 3U7EB 2UKDA 3IIMA 1LY1A 1SKYE 2OLKA 3U3KA 1DS6A 4LV5B 4OI2A 4O2LA 3KDSE 4C7OB 2VIIA 3I4LA 4Q7KA 3PQCA 5CK5A 4CDGA 1D9ZA 1JJVA 3QXSA 3X1DA 2VF8A 1T0HB 3SE0A 4YXWA 3LLMA 3QKRA 3KL4A 1LF5A 2O0KA 3T1TA 1NLZA 4E09A 2A9KA 1IBRA 5B30A 2GNOA 4JL5A 2J9RA 1WB9A 4NTZA 1IONA 1BS1A 2IYQA 2N42A 3VR4A 3EAQA 4J0QA 4WOPA 4YDSA 421PA 1XD2A 2BBOA 4WAUA 2BKEA 2RGDA 2ZRJA 1V5WA 5FUYA 1MRSA 3I73A 4UNPA 1I4DD 1VKJA 1D2NA 1DOAA 1TTTA 4MDEA 4B71A 1DELA 3UKDA 3B2EA 2XJ4A 5J40A 2XNSA 2REXB 2Z5FA 1NI3A 4EFMA 1F3OA 3EZ6A 3N2EA 3N2IA 4A2PA 4BE7B 4OYHA 1JR3D 2A78A 2DBYA 4AKHA 3GFOA 3OEHD 5KNBA 4ZI2A 1Z8FA 2QT1A 1FX0A 3THXB 1XD9A 2D7CA 2WJYA 4TQ9A 2IXEA 5BN4A 4B73A 2VP5A 1FQJA 1YVDA 2P0EA 4ZKDA 5CIWA 3WBKA 3PEVA 1E6CA 1E9DA 4MYTA 4KVGA 4TSFD 4UNSA 4US0R 5FBQB 3DMDA 4B32A 3HPRA 1P60A 1W36D 3IEVA 4D6PA 3FKQA 3QIAA 3EA5A 4A0FA 1OIXA 4ESVA 2MMCA 4P4TA 1W48A 2F3RA 4XVQA 2XTNA 4NHOA 1GL6A 4ARZB 3TUIC 3BFVA 4TLDA 4P32A 2QAGC 3TW8B 3AM1A 3REFA 4W7SA 1ZINA 3BJIC 2WWFA 4DLXA 1E0AA 4DDVA 2CLSA 1FL9A 3ZGXA 3LQQA 2D06A 1OB5A 1S4QA 1Z2CA 2QUZA 4UJ5A 4HSEA 5KYKA 1E1RA 1N5JA 1XEXB 1P3JA 3AGPA 1AIPA 1SKYB 2CK3A 3CONA 4A8JA 4PZZA 4XJXA 2YC4C 3U2QA 2ZIAA 4C0HA 3CIOA 3U6KA 1FNNA 2CCGA 2ODNA 3AKDA 4GMDA 1YR9A 2HJGA 4FXPA 4LPKA 2ZR7A 3RS7A 2RGAA 3R7WA 2RH5A 1P2TA 5AJVB 1PZNA 1GNRA 3RC3A 3SDZA 3KUCA 2WPDD 4PHGA 5FOWA 5GVSA 2ZJOA 3LLUA 3C4JA 1Z0DA 1FTSA 2J5XA 4OL0A 2HUPA 1JI0A 2B21A 1JQJC 4BLSA 2DY1A 2JIZD 4AYWA 1BIFA 4QG7A 2QAJA 4Q48A 3RRNA 4B33A 2W2TA 2ZYTX 1E69A 4EPTA 2O8EB 1NF3A 3GD7A 4ZV4A 1R5OA 2ZJ5A 4P31A 4Q4HB 3OEED 3O8CA 5JS8A 1PV4A 4B76A 4D0GA 4D4JA 1E2HA 3SQXA 5FBLB 3EXAA 4KFRA 1OKKA 3CRQA 3F5FA 2QP3A 2ZRCA 3W6PA 2FZLA 3DVLA 2CVHA 3B1WA 2V1UA 1SGWA 4HUQA 5GJVC 1ZD1A 1T3LA 2EFGA 2WJHA 1ZC4A 3TSZA 4MGIR 5JMTA 1KO7A 2FWRA 1OH7A 2O8FB 2OZEA 3FMIA 4LHVA 2NO7A 4LYFA 4P3YA 4AWXA 2O0JA 2ZRAA 2WHXA 4Q18A 1ZYUA 5TDHA 2CEAA 2WOJA 3K0FB 4U5XA 3TVDA 1XD8A 4A1FA 3CNOA 3AVUA 2ZEJA 2OAP1 1ZNWA 3CBQA 5EQTA 5DI3A 1ZM4A 4D80A 4B3CA 2NO6A 2B7BA 3B78A 1T5LA 2V55B 3X1WA 2HT1A 3THYA 3GLGB 3IQWA 3BORA 1GL9B 1FP7A 3CRRA 3CZQA 3BK7A 3EIEA 5HPYB 4FMBB 1W4CA 1M1YE 2AFIE 2VYFA 5CB6A 2D2FA 1SXJA 2WJVA 4HAXA 3BB4A 3AB3A 3PG5A 4JYCA 5FUXA 4FW9A 3CR7A 5KDOA 3FE2A 4MDFA 4A36A 3P26A 3PUWA 3FKSD 2HV8A 4Q7JB 1YR8A 5CJ2A 3SR0A 3ZD7A 3SN6A 4CGZA 4OI0A 2Q0HA 2ORVA 3LBIA 3LA6A 1YZLA 2CL6X 3H4MA 2FGKA 3PENA 1DBSA 1ZUHA 1AGRA 3AF4A 1AKEA 4IDNA 3R8FA 2BM1A 3NG1A 1E2LA 1B0UA 3FFAA 1AK2A 3TR0A 1M2OB 5C4MA 2WIBA 1G3RA 2PMKA 2W6ID 4XOIA 2GTPA 1ZIOA 2A3RA 3OIYA 4K81B 4KVAA 4M8NE 4EJSA 4ZIRB 1Y63A 2CCKA 4MKGA 3W90A 2X2EA 2ZANA 2AFHE 3GLIA 2G1JA 4QHSA 3SFVA 1TNDA 2VLIA 5CM8B 5FPKA 1RFLA 3LWNA 2GJAA 3SJZA 2C9CA 2VP2A 4K46A 2J7PD 1VYUA 3CF2A 4QKQA 4Z1MD 1IN5A 1ZUNB 4RCZA 5GJWC 1Z08A 1E2JA 1N6OA 3B13B 2Q3MA 3DL0A 1BMFA 3ZVLA 2ZAMA 1KMHA 2OXRA 3U4QB 4LJ9A 2NO0A 1G19A 3HR8A 4HATA 3TH5A 2IYSA 1UDXA 3PR1A 1G1MA 2ODEA 4TT3D 5BXQC 4YONB 4BFSA 4TYYA 2LWIA 2ZXUA 1FW6A 1TQ2A 4F4JA 2ZSEA 2DPXA 2ERYA 2ZQ5A 2FFQA 3IGFA 4TLCA 4WBSA 3VKHA 3KQNA 3Q8XB 2OILA 4N0EA 1NBMA 4PC3A 4H1VA 4ZDWA 4Y0AA 1XU4A 4A92A 3O8BA 4Q9KA 2C99A 3K9NA 4HB4A 1XTIA 1SVIA 3A1SA 3TW4A 3I1FA 1E9RA 1K5DA 3D8BA 2O8FA 2JJ8A 3VQTA 3PFIA 4DLWA 4HLQB 1E9BA 1G3UA 1S8FA 3QEJA 1P73A 1G5RA 2QROA 2ZVQX 5CJPA 4DJTA 4MUAA 2KJQA 2QL6A 1TAGA 3GJ7A 2G1KA 1U0JA 3UPUA 2QBYA 1G3QA 1E0KA 4Q1AA 2AD5A 1YR6A 3KX2A 5G3ZA 4Q7LA 2FE4A 4LC0A 4PQYA 5A0FA 4NE2A 4YC7A 5E95A 5HTKA 5J4LA 2VHTA 1X3SA 2JIZA 2OFXA 1JQLB 3C7KA 4UNQA 1ZP6A 3WNBA 4BZXA 2IWRA 1RJ9B 3K0SA 1I4LD 4PXAA 4ASUD 5AWFC 2FA9A 2QGNA 4PHHA 2AHOA 2DR3A 4ZPXA 3CNLA 2OCBA 3OIWA 2A5YB 1KYIA 2J59A 3RSLA 1XNJA 2V1XA 3ADKA 4D25A 4WVFA 1IN6A 2H7VA 1VCMA 2WKQA 5A4JA 4A2WA 1RE0A 2OXCA 3Q3JB 2GRJA 2QSYA 1JEDA 2RGNC 4EFLA 1SXJC 4OKSA 2ZITA 1DAIA 3ZLJA 1TF5A 5HR5A 1EWRA 4YDHB 2QMOA 1H8HD 1M7BA 3BERA 3RLFA 2IUTA 1NLFA 2OFOA 3KQUA 4Q9IA 3ETLA 5CLQA 1P9RA 1E4YA 4UKDA 2QT0A 3TBKA 1UBGA 3QXXA 1Q22A 1FPMA 3RANA 4BFUA 1IN8A 3SBDA 3KTAB 4XH9B 2WMOB 2Q9CA 3Q5DA 1FOEB 4C30A 1MH1A 4URZR 1K5GA 4DLRA 3RS5A 1UBFA 3F8TA 1OXUA 4NCJA 2VQSA 2FV8A 3K53A 1DAMA 3B8HA 2FX3A 2YNMA 2XJ9A 3I92A 3L2OB 5GADl 1KAOA 3FYHA 1W0KA 1P4SA 1RYHA 3GLHE 4NH0A 3T06B 2W0MA 1N5IA 3QPWA 4TMTA 1F60A 3EG5A 1RW4A 4FWTA 4KHZA 2CE7A 2GXSA 2H92A 3ND8A 4OHZA 1YQTA 2J0UA 4Q9LA 4TL7A 121PA 5ANRB 4BQSA 2UZ3A 2BWJA 2VP9A 1WBBA 4A6XA 3ZVMA 1YZKA 3NC1C 3W34A 2ZROA 1H8ED 2IS2A 3VHLB 3A1TA 5KTYA 4EQ6A 1JAHA 2W2VA 4M2LA 1KSJA 2JLQA 1E96A 2MSDB 3ADDA 1FQKA 2RKOA 3B6EA 2GDJA 4QBFA 4QC2A 2NTYC 1E2GA 2E1RA 5FUVA 1YKSA 1ZNXA 1WP9A 1G5TA 4IEEA 4L4UA 2WAXA 1CS4C 2QQEA 4EUNA 4TMVA 1R0ZA 3A4LA 5JRZA 2XSZA 3NEYA 5AUOB 4C0AC 6Q21A 3LH5A 1C9KA 3UMRA 1GVNB 4RCYA 4V03A 2IS1A 2LKCA 3FOZA 4C7OA 4B2IA 4LGMA 2ZE8A 2CXXA 2ZTSA 4URYR 4ZCLA 1T8TA 2RGEA 4YLGA 4H1UA 3HYTA 1IHUA 3GLHB 3U3OA 3W5JA 3GPLA 4IXMA 3AV0B 4BRWA 1RRGA 4E07A 1U9IC 4JLPA 1NBMD 5DYGA 1Z47A 2QG6A 2ZRNA 4M1OA 2B6HA 1NVWQ 4PANA 1BH2A 3VX4A 1EFRD 1FMJA 2A2ZA 1OV4A 4UXJA 3QPUA 4LHWA 1TQ6A 3WY9A 5DI3B 3CX8A 4QL3A 3B1ZA 1Z0KA 2E9SA 3T35A 1R0XA 4ERNA 5JI3E 3CR8A 3IILA 4M1MA 5IK2D 4RZXA 3TGPA 2XOKA 2GILA 3RC8A 2XITA 1XWIA 3BBPA 4DUGA 4OQLA 1XEWX 1Z3IX 3A1WA 1QDEA 3CO5A 2A5JA 2HYIC 1NIJA 1KO5A 3BWDD 1CIPA 1XDBA 4G1UC 1E9AA 4A0HA 4LHZA 4DEYA 2CMKA 2PBRA 4OQFA 1SXJD 3B85A 5EXSA 1XF9A 4JMPA 3K9GA 4CF7A 3NBXX 4IXNA 1X1RA 2O8BA 4OJQA 4Q4HA 5DISB 3F0TA 4AK9A 1XPOA 2OLJA 3G0HA 2PX3A 4B3XA 4TMZA 3ZIAA 2VP6A 2Z43A 5FTKA 3SJAA 1IN4A 4DKXA 2WWYA 1DG3A 2G3YA 2XGJA 2ZI5A 4LC1A 2HXYA 4Q1EA 2ZJBA 2ZUCA 4JLNA 4LJ7A 1WF3A 5B2ZA 4D4LA 4URXR 2Z0MA 2ZI9A 2AD1A 2VBCA 4TSFA 5D3MB 1N5LA 4BFYA 5LD2B 1NSFA 3QQ5A 4DCTA 1W4BA 1RPZA 4TN1A 1Z0IA 2GA8A 4GMXA 1VIYA 4MRNA 1KY3A 1MO6A 4EKDA 1A5TA 1E2KA 4QNRA 1Q21A 4DLZA 1TF7A 1CR1A 5CLLA 4OHXA 2IX3A 2IF2A 3BB1A 3RRMA 4IEIA 1XPRA 2J7PA 3DKPA 2X2FA 2OCAA 4AURA 1W36B 4QXAA 1TQDA 2QAGB 1ZJ6A 4OK3A 2RGCA 3FMOB 3LBHA 4DSUA 3K0AB 5L3VA 5JHGB 3C16C 5LDDC 2QPOA 4LJ6A 1ZCAA 1AA9A 1G17A 3TSWA 2EYUA 2WWWA 2CLDX 5K8TA 3K0EA 1Q1EA 5L3QB 1A2BA 1T3HA 1XMVA 1AQUA 3AF1A 4QJ4A 2I3BA 1YRBA 3UMSA 2HF8A 2WIAA 3PUXA 5EUQB 4DLYA 1IXZA 2V3CC 3GEEA 3QF4B 3V4RA 3CUEF 4Q1BA 4TTPA 3SJBA 3NTUA 4LV8B 1CEEA 3PUVA 1JXMA 3EIQA 3T12A 1I2MA 3NH9A 3CB4A 1KI4A 4IOMA 4FMDF 4FMCB 2ANBA 2C03A 3GMTA 2OE2A 4CT5A 1ANKA 3ZS8A 1XXHA 2BOVA 4GI7A 2RMKA 4HB2A 1F2TB 2RCNA 4B47A 1EESA 4KXFB 2KE5A 5EE0A 2W2XA 4MUBA 3VR6A 1D6JA 4MRRA 5FUWA 1ZC3A 3BFKA 2O8DB 4AYXA 2IW3A 3FHTA 1RJ9A 2R6AA 5FTMA 4JVLA 2RGGA 1M6NA 1R10A 2LCFA 3L43A 5JFGA 1KDPA 2OG2A 5JJIA 2GESA 1KGDA 3NVAA 3VNVA 5J4HA 4ASUA 2ZYWX 1IM2A 3HJNA 5FH9A 1ODFA 1OJLA 1N6KA 1QHNA 5FR1A 3GJ0A 3AH8A 4POAA 1DAHA 1FFHA 1W2GA 4JLMA 4X8MA 4DRZA 5IDVA 2RGBA 3OF5A 1P72A 2OUKA 3UXMA 2V6JA 2AWNA 2JJ2D 1JECA 4GZLA 4HAVA 3U3MA 2Z83A 1R5NA 3GJ4A 2AXNA 4Z51A 4LJ5A 4V0MA 1KDOA 1N6HA 1UJ2A 1VG1A 4RZUA 1YU9A 4DDTA 1KNXA 2P2LA 2ZSAA 5H68A 4V0OA 2OO7A 2QPAA 3A4MA 5AJXA 5TVKA 3QKSA 1MO3A 1IJEA 2VHUA 1EG7A 4IHQA 4NYJQ 2Q3FA 2JCSA 5B64A 5HZHA 1LTQA 4QGFA 3BS4A 4PFSA 5EXTA 3THWB 2OV2A 3CLVA 4O0MA 2ZETA 4JT2A 3ADCA 3ONWA 1L2TA 1G7RA 2CNWA 1TL7C 2IYTA 1T3SA 2R6CA 2OBMA 2FJUA 3L0PA 1KO1A 5L3RA 2CCJA 3K09A 3NWJA 4C0BA 3SOPA 3PEWA 4GOJA 1NN3A 2O8BB 5L3SB 1DO0A 2R44A 2DYKA 3MUFA 1G8FA 2YJTD 3LX5A 2BVNA 5JSZA 2KBFA 3VU9A 4LBZA 4CEIB 2BBWA 2PCLA 2N46A 4NPHA 4F7WA 3A37A 2OESA 1P7CA 1LVGA 1E94E 1LB1B 1P9NA 3SYKA 4CRWB 1P2VA 3T1OA 3ZIAD 1CR2A 1GP2A 4PHTA 4Z54A 4PPQA 2FF7A 2WICA 3MLEA 1CRPA 4NCNA 4URUR 1IOZA 2DFTA 2GJKA 1ETUA 3K0CC 4IVRA 5A5GA 2ORIA 5EE3A 3G82C 4XWOA 5CYPA 3T15A 1NLYA 2CJWA 1KJWA 3VTKA 4PQFA 1X6VA 3MFYA 1Z83A 4BFXA 3B1YA 3K70D 4BLTA 4NYMR 3LX8A 3UG6A 3NKVA 3NHBA 3U4QA 1ZCBA 2AK2A 2ZS7A 1BMFD 1Z22A 4Q4LA 2NZ8A 2XEXA 4PSKA 1G3IA 3VX3A 5SZIA 1X8LA 2BIFA 1S9HA 3AKCA 3BE4A 3NEJA 5D3MA 2PJZA 1N25A 1MOZA 2OCPA 4E5UA 1K6MA 3RWOA 2ZU0C 1TX4B 4P4SA 1NG1A 3JZAA 4R9UC 4UXHA 1QHHA 4O2RA 2ZRMA 1W5SA 4F91B 3TE6A 4EPRA 1TF2A 2G9NA 4YQFA 2CL7X 4R98A 1SVMA 4ZIRA 5C18A 1AS0A 5TY0A 4QGGA 3L82B 3KJHA 4TYWA 3BAFA 2QTFA 4XVRA 4LYAA 3KQHA 4LHXA 1TUEA 4ACBA 1IY0A 1E2IA 3SFZA 2EYQA 2ZM5A 1RIFA 1XZPA 1VCNA 4KU4A 4HAUA 4KCGA 1M7HA 5CIQA 4KFTA 2QMUA 2NOAA 3UK6A 1KJZA 4PSAA 1DARA 5J47A 3GJXC 2YVUA 2IS4A 3QENA 1QG2A 4ACAA 4EQ6B 1GKYA 2XNDA 1YRAA 2J41A 4DLSA 3EPKA 1U9IA 3TKLA 4DVGA 3R8CA 1J7KA 3DMNA 4Q4JA 4DSNA 1GRNA 2PMDA 2O8CB 5KPDA 2VO1A 4XTCS 2AKYA 4P4UA 3B60A 4DZZA 1E2QA 4W5WA 2GBLC 4M22A 3ASZA 1BYUA 1P5ZB 3IDQA 3KXLA 4Q9JA 2W6JA 3OFNA 4YMTA 1D9XA 4IFBA 2HT6A 4E22A 3U7HB 1G291 1F5NA 1DADA 4RFVA 1R2QA 1ZU5A 1P2UA 1E1QD 4TMKA 3B9PA 4XIGS 3MG9A 4TLBA 1TMKA 5H1YA 3THWA 5H8WA 3V00A 1X8KA 3BRWD 4JLBA 3M0EA 4KI0A 5DH9A 1T6NA 4JIMA 3OIVA 3H86A 3EPJA 1XMIA 4HAWA 1F2UA 2O8CA 2G6BA 3UWOA 4B2PA 2ZJ2A 1I4TD 2HCJB 1NG9A 1CJMA 2AWOA 4LYHA 2OBLA 1MRNA 1N6LA 4IDHA 1KSFX 2FN4A 3FTQA 4G5QA 5IRCD 3QG1A 4WW0A 3A58B 5FBRB 3ZZTA 3FVQA 2IYUA 1N6IA 1QRAA 1AS3A 3ZD6A 1EFCA 1T4GA 2WSSD 3C5HA 3FWYA 4RFSB 3TUZC 4JL6A 1W4AA 4TYQA 5JEEA 2XXAA 4LUCA 3VR3A 1ESNA 1UBCA 3X1ZA 2GCNA 1LNZA 3VR5A 4PPNA 1TPZA 2ZJAA 1GUAA 3G5UA 4BGDA 2AX4A 2V6IA 4DWJA 4WZBE 1II8A 5JZVA 1EK0A 4D0NA 4ARZA 2FZ4A 4S35A 5E3HA 3QKUA 1QHHB 2FDCA 3AUYA 3OZXA 4B6EA 4LBWA 1QHGA 1F2TA 2C95A 2Q3HA 1VECA 3CX6A 4ON9A 4BLOA 3OAAD 3QG5A 2G77B 5F98A 3AKYA 4CW7A 5BYKA 4PC2A 4KFUA 1PVOA 4HDCA 4W5HA 1TU4A 2ZREA 1N3BA 4EJSC 3B9QA 2IWHA 3NIBA 2KBEA 3THXA 1E2NA 3VFDA 1OXSC 2CHQA 5LPNA 4GNKA 5FPHA 1P6XA 1KDTA 2QRNA 1QG4A 4G0NA 4NCKA 4Q1DA 2IXGA 3ICQB 5FR2A 5EE9A 2WVJA 2ZRGA 3MWLA 4Q00A 1KI6A 1T8UA 1G3MA 1GG2A 2BEKA 2W00A 3CF0A 3OHMA 4NYMQ 2QMHA 4KBFA 5FPTA 2JEOA 3KTAA 1T9HA 4V02A 1AKYA 4MITA 2P67A 1CJTC 3AVXA 1GKIA 4IOLA 4HEJA 3QXHA 3VU9B 1KI3A 4HLCA 4I4LA 3EIHA 4Q1FA 1UPTA 4JLAA 3OEHA 2DB3A 1ZM3A 2ZPTX 1G8HA 4MQBA 3ICEA 3FMFA 2IYRA 2WZQA 1GIAA 2NGRA 1COWD 4PHFA 2R6DA 2VTKA 4QM6A 3ZQ6A 3EPLA 2IEZA 1UADA 3MRSA 5CB8A 2W6IA 3A1UA 1R7RA 2G83A 2GZDA 4TLEA 2JLSA 1CF4A 1CULC 5EJEA 2X1VA 2F3TA 5JWOA 2BEJA 4GP6A 2B7CA 3I8SA 621PA 4EPVA 4FMCF 2NPIA 3GLGA 1U81A 5DO9A 2QN6A 5FL7D 5C4GB 3TNFA 2FSIA 4DC9A 2DWOA 3PCRB 2J45A 2C77A 1XXHB 3GEHA 1KSGA 5B58C 2IS6A 3C15C 1CJKC 4XVUA 1U90A 5ELXA 5KDLA 4YMUA 3HR7A 3SS8A 4JT4A 5BN5A 3ZZUA 4RY2A 2GKSA 3BOSA 1Z6YA 5CM9C 4LK2A 4Q03A 1CU1A 4GRAA 3KQLA 4M1TA 4AC9A 3DHWC 4RFSA 3K0FA 4NZYA 2UZIR 4PQRA 5G53C 1YE8A 3X1XA 4A9AA 1JNYA 2CK3D 1A1VA 2C9YA 4DCUA 5H70A 721PA 1KIMA 3SQWA 3ZDQA 2F7SA 1VMAA 2F1JA 1J70A 3O47A 4BFVA 4US2R 5HKKD 1AM4D 1XXHE 2H18A 3BGWA 3EA0A 2P6NA 3MWKA 1IXSB 1KI8A 1MO5A 3RYTC 4JBXA 1SHKA 2WPDA 2NMVA 3KXIA 4ESHA 3SYLA 1AS2A 2JLVA 5FFMA 5JHHB 4W5JA 1DEKA 4EIWA 3CPHA 4FINA 3PUYA 3HYRA 2ZRFA 3V9PA 2HCBA 3WHLA 3WBJA 3TJZA 4M0LA 2QNRA 4JYBA 2JLWA 4RD1A 1OFUX 2EU8A 2JJ1D 4Y0VA 4ZCMA 5K8LA 3AVWA 2R2AA 1ZRHA 4URWR 4F4IA 4V0KA 5LB2A 4IJMA 3GQBA 3UIEA 1U98A 1G6OA 4P4SB 4M9ZA 2FSFA 1E0JA 3KXKA 1HEIA 3QOFA 3UWKA 1FX0B 4Q47A 3QF4A 3K8YA 1OKKD 1W1WA 1GFIA 2NO9A 5DE3A 2PEYA 3UANA 1AZTA 1CJUC 3LO5A 5L3QA 2WJJA 4L16A 5DN6A 1HUQA 4M9SA 4OHYA 2C9OA 4IVQA 4KLNA 2C2HA 2JA1A 4IDPA 3LW8A 1Q3TA 1P61B 3TIFA 1KZGB 1JBKA 3ZVRA 1G9XA 1IAQA 2FPKA 4PC7A 1EFHA 2J3EA 4TL8A 4DEXA 2ZS8A 3EC1A 4BRUA 1OSNA 1HQCA 1CR4A 2W58A 2VEDA 4US1R 1JR3E 4BLRA 2G0NA 5FI1B 2OAQ1 2O8DA 1UEIA 2GHIA 1FTNA 2ZRIA 2F1RA 4XTRA 4KBGA 4RSGA 3AQ4A 1JJ7A 5JSZB 4TTRA 1SXJB 1E0SA 1G7CA 4KO8A 4RKFA 5L3SA 1DAGA 4B44A 5JS7A 5CDFA 1XTSA 3HU1A 1F6BA 1ZD9A 4U00A 3FB4A 4MRVA 1T0JB 2BBSA 1OPXA 2KSQA 2XNDD 5E7IA 5K8UA 3W6OA 4TMWA 2J0UB 5CITA 1DAEA 2FH5B 4G5RA 3M4YA 3PIRA 1W49A 3AP2A 2WOOA 4C0KA 5J4VA 1M74A 3JZMA 4PSVA 4FCVA 1I2DA 1NKSA 2D62A 2WKPA 2HEIA 2NG1A 2EFDB 3H0KA 3KKPA 4MGZR 3TQFA 2PL3A 4BLQA 3I5YA 1M8PA 3L8ZA 1UF9A 2ZU6A 1RVDA 1XMSA 1GAJA 2BC9A 3K9LA 2XZLA 3SEAA 2BV3A 2H5EA 4IDQA 1EX6A 2ZE6A 4HZUB 1CJVC 1ZU4A 2CE2X 3AVOA 2J46A 4HUQB 4KFSA 1OFIA 5AJZA 4D4KA 1CKEA 1YHNA 2AXPA 4KODA 4LOAA 1OH5A 1ZM7A 4F4CA 2ZJZA 4NMMA 2A5DA 1NJGA 3ECCA 1GTVA 1P62B 3A1VA 4CIDA 3U3RA 1GITA 2FFHA 3QSYA 1GNPA 2QE7D 2ZSBA 4NP6A 5CDFE 1E9CA 2DFKB 3JVVA 4DLVA 4AKEA 1NN0A 2IHYA 2IYWA 3CRVA 5FL7A 1R4AA 3DOFA 1CRQA 4CZ2A 4AI6A 4QOSA 1NY6A 3RAPR 4C2UA 3SZRA 1KNQA 3EARA 2RHMA 2F1IA 4B6FA 3EZ2A 4V0NA 5D3QA 1OHHA 4WIAA 3OIUA 3SJCA 4KAXA 2QM7A 5DYIA 3SHWA 1GRRA 2YWEA 4PAMA 3FMPB 3LW7A 4LJ4A 4FMDB 2QTVB 3FFBA 1GKUB 3FDIA 3GEIA 4HDQB 2F55A 3WYGA 2ZSDA 1SULA 3F3YA 1UDWA 1W0KD 4RD3A 1PUIA 4JSTA 2GAAA 4NL4H 1Q1BA 4C0QC 2IL1A 3ADBA 4MGYR 3DM9B 4KV9A 3OAAA 2GXUA 4I99A 3LQRA 3LVQE 3PXGA 4DT1B 5SZKB 1SVOA 1E2DA 2H57A 2HDNB 4PZYA 3B1VA 2WJGA 3DOEA 4URVR 1LS1A 2YOGA 3D3QA 4RZ2A 1CP2A 5GVRA 3VNUA 1J2JA 4FIDA 3A6PC 1J8YF 3K70C 2NPFA 1AGPA 1ZW6A 4N3NA 2YOHA 1NBME 3IIKA 1M34E 2EFEB 2PEZA 2IEYA 2FU5C 4U7DA 3IUYA 3U7FB 2O0HA 1EFUA 3T61A 3Q5EA 3CPEA 4RD0A 4PPGA 5EP2A 3KZ1E 1KHTA 3HU2A 1XJ0A 2WBLC 1S3GA 4BPBA 3I61A 4Q21A 1E32A 4YMWA 2A30A 2BHRA 3W3AA 1T5IA 1KTVA 4G5SA 4N0DA 5JWHA 1DAFA 4TLAA 4LBVA 1ZM9A 2IYZA 4OBEA 8OHMA 1GDDA 3WP0A 4ZI3A 1TADA 1S0UA 1G8GA 2BMDA 2H1LA 4GZMA 4OK6A 1ZVQA 3LBNA 4Z8XA 4B74A 2PLRA 2ZUBA 2X77A 1R8SA 1OXTA 4FN5A 5F3WB 1WXQA 4G5OA 2FEMA 4IFEA 2VL7A 2GCPA 3BH0A 3RRYA 3GJ3A 1A82A 1YZUA 4EJSB 5JWRA 1VG8A 1SVLA 2Y8EA 4QGHA 3WNCA 2DWPA 1TQ4A 1A2KC 3NDBB 5DGXA 1XTRA 1Z07A 5FPSA 1K8RA 2MSEB 3L0OA 3LD9A 2QAGA 1YJ5A 1Q12A 4FD2A 2QBYB 1JR6A 1MV5A 1NN1A 1GNQA 1HA3A 4C0SA 1E9EA 1VCIA 2ZSFA 4X8LA 2YYZA 5FOTA 2O5VA 3REGA 2D74A 3C41J 2XTZA 3L0SA 1KAGA 2G88A 4M53A 1S9DA 5FTNA 1Z5ZA 2XX3A 2VRWA 1NVVQ 2XOKD 4QNMA 3I3SR 1MR3F 4A8JC 1NNEA 4QJ3A 3EZ9A 4B43A 1ELOA 3SYNA 1UAAA 1UFQA 4U02A 4AG6A 1HQYE 3R9WA 4B48A 2V7QD 1P2SA 2XZOA 3EX7C 1NRJB 2FG5A 1II9A 2IC5A 2EW1A 3WMFA 4JBWA 4L8GA 4BZPA 5LB4A 1SVKA 2CHGA 3BB3A 1MT0A 1S3SA 1UKYA 2HJVA 2HYDA 4JL8A 2ONJA 4C0LA 4OK5A 1E3MA 2VP4A 3GLHA 2QM8A 2PX0A 1SVWA 3UG7A 1N5KA 2PT7A 1JEEA 1DPFA 3QNUA 2P5SA 3SC3A 2GJSA 2QU8A 5AR1A 5JLJA 1W4RA 2WSSA 3KFXA 1W0JA 2VSXA 1DAKA 1E2PA 1PLJA 4XWAA 2WV9A 3RVBA 3GLFB 5E7MA 5KPJA 1XTJA 1L7VC 2E87A 4V0LA 3PJRA 4HAZA 4JS0A 3VR2A 1XTKA 2HLDA 1G8PA 4II7A 1RKBA 5AUPB 5KNCA 3CWZA 3X1YA 5IF9A 5KSOA 2F9LA 3MAAC 4NBSA 1BYIA 1SHZA 1XCMA 4IW3B 2ZI4A 3T1VA 1N6RA 2O8EA 2F1HA 2UVQA 4LX0A 4KSBA 4A0GA 4DSOA 4GL2A 2WAYA 3TUJC 3DPUA 5FOSA 2WWXA 2F43A 1Q1QA 1Z6XA 3KKQA 3K1JA 3RS0A 1N6PA 1XMJA 2JAQA 4OQMA 5BQ5A 3AVVA 4ZKEA 3LNCA 1HYQA 1IJFA 1ZNYA 3LDAA 1V43A 5EE1A 1RZ3A 1FZQA 3EC2A 2SHKA 1ZD8A 2MMGA 4HLUA 1R0WA 5SZHB 2WMNB 1NIPA 5IK2A 2KWIA 2A5GA 4M1SA 3CNNA 3CWQA 4B3FX 2IUSA 2C5LA 2Q9BA 3QXJA 4I1VA 5JRJA 3ND9A 3IBGA 4QHYA 3T5DA 1S96A 2FMXA 4LPSA 1KI2A 2CLCX 4A8JB 2OBNA 4TWZA 3QE0A 3FHCB 2A5FA 3IO5A 2YWFA 1PUJA 2FSGA 3NDPA 1X1SA 2I4IA 3U44B 1KY2A 5FBWB 4MKFA 2LKDA 2PJRA 4JVSB 4A0RA 4DLTA 5KHOC 1IY1A 3QY0A 1A4RA 2J1LA 3BFXA 2ODWA 1OXVA 2O52A 2QENA 4LI0A 3MCAA 4M1WA 3NBFA 4DCSA 4GSYA 3MD0A 4KSCA 4C3ZA 2ZAOA 3ZVNA 4P0TA 3W6NA 1TUIA 1UKZA 1OT3A 2YWGA 2W83A 4TZ0A 2JLUA 2C04A 2AR7A 4TQUS 4BZQA 2ZYUX 4I1OA 2VHCA 5B57C 4EAQA 4F93B 3DDCA 3AGQA 2IF0A 4TL6A 4UQOA 4HB0A 2X19A 5G3YA 5AK0A 5LD2C 3TVTA 1HT1E 4BECA 2D2EA 2L0XA 2QQ0A 1SXJE 2MSCB 2ZE5A 3QVVA 3GLGE 4G3XA 5C2JB 1J8MF 3NBYC 3GLIB 4O25A 3VAAA 2GVDC 4MYHA 1QHXA 1L4YA 5HZKA 1TEVA 2Z6VA 4GPTA 4X8OA 4PTLA 2F9MA 2QP4A 3B1XA 2REOA 4GBMA 1OH8A 4D26A 4DUGD 1VG0B 2FNAA 3DZ8A 1S2MA 4ITRC 3WYFA 4LRWA 3IQXA 1NP6A 2DHRA 1E1RD 2ZR0A 4C4PA 2BDTA 4YXWD 2ZRKA 3FPAA 4LSGA 4QHTA 2CNWD 4W9MC 3PV0A 5EUMA 4PZLA 3DEFA 4RD2A 2RGXA 2VHQA 1P9WA 4RVCA 3B5JA 4Q01A 2YZ2A 2AK3A 1ZAKA 1FMLA 5BW8A 4CEHB 4A15A 4TQAA 3BXZA 1Z06A 2FFBA 2IHBA 2B92A 2IT1A 3B7GA 3WP1B 3W5IA 2ZRPA 4WA7A 4AD8A 1U0HC 4Q66C 1NVUQ 3TAHA 1Q0UA 2FSHA 4G01B 2NZJA 1WMSA 5BYJA 4D81A 4HZUA 4HDOB 4MYCA 4M9QA 1KSHA 1QVAA 3KJIA 4AKIA 3H2YA 4P33A 3CM0A 5FOVA 4AYTA 1NMYA 1QF9A 3VKWA 5KO2A 4I81A 4DIEA 3IO3A 2ONKA 3E1SA 5IHPA 1OIVA 1OYWA 1II0A 4Q4AB 1KK3A 5DN6D 4E03A 4RD6A 4CEJB 4JKIA 2CL0X 1NVVR 2OHFA 2WM9B 1Q20A 1RRPA 3GCGA 1NMXA 1JPJA 1QHIA 4KJZA 4MGKR 3LY5A 1HV8A 3SNHA 1CR0A 3SU8A 4NU0A 4S2EA 1UKVY 1SKQA 3W3ZB 1Z0JA 2HXSA 4R2IA 4PX9A 2G0TA 3IEUA 1Y3AA 2PZFA 2C96A 4Z1MA 4A4DA 1W2HA 1MKYA 5EP1A 4GOKA 2ZYVX 2YKGA 2ZS9A 2GXAA 3SI7A 2JDID 4LBYA 2R62A 4C2TA 1CTQA 5FOXA 1DE0A 5BN3A 5FOUA 4HAYA 3RABA 2DCUA 1CXZA 4FCWA 1KMHB 3MGCA 1Z6TA 3UATA 1NN5A 5TARA 3QPVA 1WDTA 2GAOA 1XRJA 4RD4A 1LW7A 5JBQA 3B82A 3TR5A 4L9WA 3D31A 3A4NA 1N6NA 2P3SA 3U61B 4YMSA 1U0LA 4RKEA 3RS4A 3THYB 1EXMA 3FKSA 1D2MA 2TMKA 3CRMA 1HE8B 4L15A 2J0QA 2IXFA 3MJHA 4ZDKA 2CJWB 2BMFA 1U94A 5GJBA 3EWAA 4M1KA 1YZNA 4M1YA 3CX7A 1Z0FA 3C8UA 3ZYCA 4Q9HA 2C8VA 3OE7A 4M21A 4N1AA 1US8B 2YV5A 2V8OA 3OEEA 3SHFA 3WRXC 1XEFA 2QSZA 1QVRA 1E1QA 3OESA 5EXXA 2FPLA 1YR7A 3CZPA 3BH6A 4XD7A 2I1QA 1G6HA 2JJ2A 4KLZA 1DG1G 2FFAA 2C78A 1E79D 4NCIA 2ODBA 1KI7A 3MWJA 4DDWA 4F38A 5DHAA 2ASEA 5SZJA 2DFLA 1HURA 2ZRBA 2J87A 2YHSA 1WQ1R 2ZR9A 1IY2A 3T5GA 1G5PA 1SVSA 2B8WA 1CBUA 2FOLA 3AEZA 1XEWY 1OHHD 2ANCA 3CW2A 3H84A 3P4YA 2R9VA 3Q72A 1Q1ZA 1P75A 1G4UR 1NSTA 2Z4SA 3RS2A 5DHFA 5JCPA 3K70B 1G7SA 4QBHA 3QBVA 1G18A 1H8HA 4MH0R 4DB2A 4D0LB 4IRUB 4Q4AA 5JJKA 1SQ5A 5JECA 3SBEA 3NHAA 1N0WA 1PJRA 2BJVA 2DFNA 5JCZA 1KZ7B 3R9XA 2HF9A 3GLFE 3IIJA 1JXOA 2ZRDA 2VSFA 4RZ3A 2QGZA 3DO6A 1U8AA 3H1TA 1MO4A 4BUJA 4ZDIA 2CVFA 5TXGA 2WWIA 3K0CA 3AF3A 2XAUA 1E2EA 4PC1A 4IOKA 3TRFA 1XFAA 2GETA 3AVYA 1EFRA 2FEOA 3P20A 221PA 3KUDA 2JLXA 4UNRA 1XJCA 3E5HA 1U99A 3AVQA 4B35A 4LYJA 4PAOA 4EPXA 4OQNA 3LFUA 3EZFA 4M4SA 1EGAA 3I5XA 2ZJYA 1EWQA 4LHYA 4NYIQ 3TQCA 1XPUA 2GXQA 4TYPA 5KNDA 2EWVA 5AUQA 1E2MA 2VSOA 3EW9A 2FPMA 1L4UA 4BEBA 1O3YA 1IXRC 1XZQA 2WWHA 1XBTA 3U6BA 3KJGA 1TEXA 5HKKA 4DSTA 1Q44A 2JLYA 4GDFA 1MABA 2RGNA 3IHWA 1OE0A 4L9SA 3I32A 5AUNB 5FTLA 3ZJYA 2PCJA 4DLUA 3EPHA 2OCYC 4L5BA 4AG5A 1KI6B 2ZI7A 1KJYA 3P32A 2P65A 1KDRA 1US8A 1SZPA 2XZPA 1JPNA 1EFTA 1E99A 3D6TB 3HPQA 4DBLC 1OYYA 5TMPA 3VKGA 4CT4B 5CK4A 2BM0A 1KI1A 4HYYA 2PZGA 3QF7A 2QORA 3IPYA 2XSZD 2J0SA 1XEXA 1HE1C 1G41A 2GEUA 1VHTA 4LV6A 1R5BA 1GOTA 4LCBA 1HTWA 3WRYC 3U7GA 3AP1A 3EZ7A 4I1UA 5FBVB 1RC8A 4HUTA 1Z29A 2ATXA 4JLJA 4PPFA 1AZSC 4GFDA 2NO1A 2YC2C 3HDTA 3IKJA 2ORWA 1XTQA 2QTHA 1OF1A 5TB5A 1GSIA 4F92B 3K0AA 2CDNA 3CF6R 1VDZA 1N2CE 3P27A 2C98A 3PITA 5AJYA 1KKMA 4DIDA 3VHXA 4XSHA 1II8B 2H8KA 2WJIA 3RNLA 4NKRA 2P6UA 2WWGA 2P5TB 5EP3A 5KSZA 3HP1A 4CEHA 2W0SA 4PC6A 3EWSA 1S1CA 1N0UA 4JKYA 3BIFA 4DCNA 2BJWA 4AKGA 2V7QA 2W6JD 1D2EA 3I8XA 3OFND 4OHWA 3QEOA 5DLQC 4QJ5A 4B3DA 1D5CA 1RRCA 2N1BA 3VMFA 2A7QA 3M6AA 5DSZA 4HB3A 2GZAA 2I1VB 5K8IA 4WXRA 3ZH9B 2H16A 2PLFA 2IYVA 2IYXA 5F9FA 2YWHA 1ZM2A 3Q7PA 1HY3A 1KK2A 1F2UB 1ZIPA 3KFVA 1OIWA 4B3GA 4A6PA 3E70C 3HWSA 4CEJA 5P21A 1OFHA 2Q9AA 1XD2B 1RYFA 1Z63A 2ZJ8A 1W0JD 3IBYA 1ZNZA 4ABYA 3U5ZB 4NYJR 4MRPA 4PO9A 1FUUA 4Q19A 4MRSA 2IA5A 4QBIA 1R0YA 3DZDA 1OFTA 2BMEA 3LXRA 2D3WA 2HLDD 4HLDA 1Z2AA 4LZZA 1G4AE 1XCPA 2F43B 2ZUDA 2GF0A 3QKRB 1GILA 3V4FA 2JJ1A 1AN0A 2NIPA 1JALA 1L8QA 2QP9X 3AF0A 4Q7MB 3LVRE 4A82A 2EFCB 1F48A 2X8AA 2H17A 4JVNA 5HE9A 3J81k 1PLLA 1Z28A 3NBZC 4K8OA 5KOYA 4TMXA 3THOA 1G16A 4YMVA 4XD7D 3U3JA 4NCHA 1VTKA 2EWWA 4JLDA 4Q4JB 4R7ZA 3PUZA 3WNDA 4KITB 1E9SA 1AJEA 2V54A 3GJ6A 2GBLA 4I1SA 1M7GA 3AVTA 2GCOB 3Q7QA 3BD9A 2ZRLA 1YZQA 4B34A 4WZ6A 3U60B 3KKOA 5M04A 2BCJQ 4XWKA 4IDOA 3WMGA 2GK7A 3KB1A 1S1MA 2AL7A 1G8YA 2GEVA 2XB4A 3QXCA 1W44A 5EE5B 2Z4RA 4GOXA 2JDIA 3TAUA 3TSOA 2PT5A 3FHOA 5EP4A 1WE2A 2WSMA 5FPYA 5C46F 1XJQA 3N5CA 1E9FA 3RDPA 1U2RA 5J4KA 1KK0A 4IKEA 3GJ5A 821PA 3L8YA 4TZ6A 4WXPA 1LS6A 1U8ZA 3S1AB 3CH5A 1ZUIA 2QY9A 4PAQA 1KO4A 3BH7A 1AQYA 3NXSA 4JJKA 1G7TA 1NMZA 1VG9B 4Z8YA 1W7AA 3QI2A 1Q3HA 2CHVA 1J90A 4C0JA 5KSPA 2OEPA 3LV8A 4MA4A 2VP0A 2IK8A 2JLRA 4BFZA 4WZAE 1G21E 5DI9A 3BC1A 1VIAA 3CKLA 4RJLA 3QUSA 3CRW1 4DHEA 3O8DA 1KK1A 2GJ8A 4G5GA 3JVUA 4ZDJA 3NC0C 2KI5A 3W8RA 4PO8A 4D4MA 1XB2A 2F6RA 2Q21A 2GCOA 3OE7D 4B75A 1H65A 4PR0A 2VF7A 2ECKA 3ZQJA 2NQ2C 3C14C 4MKHA 1N0VC 3D7MA 4JLVA 2IYYA 3O8RA 2PZEA 3KB2A 5C1BA 1WBDA 4ZCIA 4DCVA 2J7KA 4DXAA 3FGNA 3IHLA 1NJFA 4A2QA 3WXMA 4MYUA 3PVSA 2GEDA 3GLIE 2OM2A 1X86B 4HLUC 5CYOA 1XX6A 4CEIA 4EPWA 5HE8A 5KUTA 2EVWX 1Z0AA 2QE7A 3E2IA 4BASA 4TTQA 1YZTA 3AKEA 1FP6A 1X8JA 4KYIB 2QMEA 1J99A 4TL9A 1NVXQ 2OSBA 2QRZA 2OT3B 5DNYB 2YINC 4OJKA 3MJRA 5TV2A 3WMEA 4ZO4A 1BKDR 1RRFA 3K9HA 3ZZ0A 3IPXA 2QEQA 1GL7A 3RWMB 1B23P 2V4ZA 1FUKA 3AVPA 3MMPA 3RRZA 3C5CA 2OFWA 3GFPA 4JZKA 1KI9A 4TT3A 1D8TA 1GWNA 3QKSB 1Z6AA 1C4OA 1UBEA 5J5CA 1LFDB 3CPJB 1ONBA 5EZ5A 4ILEA 3PEYA 1QBKC 2R8RA 3TLXA 2XXAB 2BKUA 1TU3A 2REBA 1XP8A 3ASYA 3LRPA 3ZS9A 1W5TA 3CH4B 4IOJA 4DT1A 4UNNA 3KQKA 4OI4A 2VPPA 4QFMA 5JEDA 2WTUA 3EASA 2J0VA 3QKTA 4CYMA 2EFHB 1IN7A 1DTSA 3AUXA 4NDZA 2V9PA 3W9YA 4NYIR 1OLOA 1C1YA 4LJAA 3A8TA 1JR3A 3S1AA 1UM8A 1NL3A 2QI9C 3R7WB 3WYAA 3RSOA 4AIIA 4B2LA 2BCGY 4B3BA 2XTMA 3W8NA 2AN9A 1HT2E 5E7JA 5HCIA 2K5UA 1Z6GA 4QM7A 5FTJA 1Q57A 2GK6A 5G40A 4D2IA 1G64A 4Q5IA 4BFWA 3T34A 3UMFA 2CBZA 2GZHA 5JI2E 1OB2A 2P6RA 5F2EA 1GRQA 1QHSA 4FWIB 1KO8A 3MSXA 3M1IA 3R20A 1HH4A 3QBTA 4DDUA 2ZI3A 2GWHA 4PO1A 1OW3B 1OH6A 2QPTA 4UJ3A 5AJWA 5DIFA 5F9HA 2IYLD 1NY5A 2ERXA 1DO2A 1LF0A 2ZE7A 1O87A 4QBGB 3K09C 4TYNA 2Q6TA 4OQXA 4BFTA 3GLFA 1A7JA 2RAPA 5L8VA 2D7DA 2B8TA 3WHKA 4CVNA 1WA5A 2JGNA 3GP8A 1CLUA 1BOFA 1UEJA 2GVZC 4OHVA 4MKIA 2JLZA 3U44A 3L0IB 4LY6A 2D4HA 3TMKA 3LXXA 2ATVA 1GM5A 3I62A 4EDHA 1E2FA 4JVMA 5BWMA 1GZSA 1NKTA 4JLKA 1VYVA 3P1JA 2KB0A 2R65A 1W46A 2R6FA 1VHLA 3I72A 3KJEA 5EZ6B 5LBIA 5KDDA 2VHJA 5IT5A 1BO6A 1OXXK 4HI0E 2AKAB 2PH1A 1PLKA 3GFTA 3PEUA 1WCV1 2ZRHA 5FL3A 1W36C 4LWZA 5J4YA 1MABB 5FI0B 2BMJA 4JLOA 521PA 4OI1A 1ZMXA 1U8YA 1G20E 5EXPA 4R71A 1JAIA 1E79A 2DWQA 4DB4A 4LDJA 1E98A 3KKMA 1DVRA 1FNMA 1XCGB 2GF9A 3QVUA 4IVPA 4D82A 3R9IA 4H9GA 1JB1A 4LJ8A 3VR1A 3AF2A 3N70A 2EQBA 3RHFA 5E4FA 1R8QA 1E4VA 1H8EA 4EPYA 1UKEA 4GP7A 4UXIA 4EFNA 4R2HA 4NONA 2IUUA 3RS3A 4O3MA 5G41A 4AY2A 3T1QA 3HU3A 2R6GA 3DM5A 2JASA 1T91A 1KOFA 1YZGA 3A36A 4JJZA 5KSYA 1R6BX 1WRBA 3Q85A 4X8HA 2FGJA 1VYTA 3MWYW 2ZVPX 4V0ME 4C9BA 1VPLA 4HZIA 1QHYA 5JJLA 4JSYA 2VA8A 4QGAA 4BLPA 4Q02A 3Q9LA 1W47A 2JATA 2WKRA 1IQPA 4FI3C 4LJYA 4M9XA 3X2SA 4BWYA 2IBMA 3P4XA 3QJYA 3TK1A 2RHDA 2ZI6A 3LAWA 3GJ8A 1QZXA 2XB2A 1COWA 2GJ9A 2YOFA 1KKLA
chains in the Genus database with same CATH superfamily
1CUGA 1HORA 4DIOA 2YNMC 2QA5A 1NBAA 2ZIUB 2P4SA 4EHHA 1COZA 2D7JA 2IODA 4GT1A 4JBYA 2B1QA 4MVJD 1GTL1 5HCNA 3CHYA 2OM6A 4LCJA 5I8ZA 2M9MA 3ZCVA 2VH5R 1MEEA 4MV8A 5EJ7A 1WJGA 1RPTA 4UW9A 3WO1A 1ESMA 1L6IA 4QQFA 3IA7A 1FDVA 2VG8A 2BTOA 1JB9A 2YQ4A 2Q4BA 4M99A 4Q93A 2BGJA 5I7UA 3U7EB 8LDHA 2I2DA 4ZTUB 1TZKA 2VDMB 4ZC1A 3NB0A 1U3TA 1ZK0A 3IUSA 1XK6A 3Q2KA 4MQFB 5CB4F 1LY1A 3U3KA 1BVUA 4GKVA 4G1MB 4HNHA 3AHFA 4Z53A 3N53A 3RS8A 4C7OB 3LS2A 4TWIA 4XE5A 3KR1A 4CDGA 4OQQA 2VPZA 1D9ZA 2J3DA 5E4JA 3GHHA 5C8VA 2ZZKA 5D2CA 3A4TA 5JDIC 1X7ZB 1LC0A 4MW2A 1NT4A 1JLLB 1LF5A 2OFPA 1GRCA 4QSMA 1KGSA 3NO4A 4Z9YA 2A9KA 5JR3A 1WB9A 1JXAA 3HEAA 4W63A 4XB2A 1BS1A 1CUEA 3OCJA 3ZGOA 5CDGA 4N48A 4YDSA 3HB4X 1A76A 1XD2A 4NK5A 4HDMB 1QGUB 2VPXA 2ZRJA 3E82A 3FSRA 4AY5A 3PGLA 3WXBA 3SDSA 3KSAC 4YB8A 1EA5A 1DOAA 4RPJA 3T9DA 5EA2A 3B2EA 5J40A 3L9WA 4B3HA 2Z5FA 1VJCA 4JBHA 4BP3A 1G5FA 1F3OA 3WAGA 1B14A 3N2EA 4BE7B 2BL4A 3AB8A 2AVNA 1NXXA 4JVOA 4LNUA 3RRFA 4NSNA 4TUYB 4KLCA 1Z8FA 3GLKA 3KDAA 5E9AA 3ZWQA 4QLAA 1TC2A 3PRYA 3KJQA 4LE0A 2QTRA 4ZZ2A 3H3JA 4BVBA 3K9FC 1WQ3A 1LVHA 5A0VA 4R2WA 3LUDA 2XB8A 3OLWA 3IQEA 4RVUA 1CX9B 2P0EA 2QMZA 3D59A 4BB0A 4ZP1A 3MWEA 3WBKA 3RQSA 5I7WA 4MYTA 4JB3A 3D02A 3E9QA 4TSFD 1W36D 3EN0A 1P60A 3DE2X 2C59A 1DHTA 2JLCA 3CUVA 1UDCA 4D4HA 5BP7A 1UKBA 2PM8A 4HTAA 5JSYA 2XZTA 4ESVA 4KQMA 4EY4A 1W48A 3DGEC 2PS3A 4RHEA 4FGZA 3M83A 1GL6A 1Y3BE 2VRBA 1Z35A 4ARZB 2EX1A 3EXHB 1PR3A 3TUIC 5LP6A 1HGXA 3BFVA 4TLDA 1RWWA 2P9GA 3KPJA 2Y1FA 4HC4A 3AM1A 4IO1A 5IM4F 1DTWB 4BAUA 1EB8A 1ZWKA 2YXNA 3QMPA 2VHVA 1T8SA 3BJIC 3EG9B 3HXTA 4KIGA 3DNFA 2NAPA 4DLXA 2G5GX 1E0AA 3H5WA 3ZLUA 1RBZA 1S4QA 3NATA 1E1RA 2NVOA 2D1QA 2CLEB 1GGEA 1N1GA 3H9UA 3AGPA 3QU7A 1G8MA 4NBNA 4ENQA 3ZDDA 3CONA 4B4OA 1P31A 1SZCA 1E3DA 3G2HA 4B31A 1GFWA 2YC4C 4Y6RA 5M2QA 1FFDA 1YS4A 4DRXA 5KX5A 1FNNA 3RYIB 2GAFA 3AKDA 4GMDA 1B8UA 2FEPA 4LPKA 1EUYA 3BWBA 1TJNA 1ZONA 1P2TA 1U31A 4QZVA 2AC7A 2VF5X 1P4AA 5JD4A 4XDYA 2IHNA 1GNRA 4MICA 3D0KA 1XO1A 2XGGA 4GOOD 1OWPA 4ZO9A 3OTOB 3WLOA 2NNLD 3HADA 5FOWA 4F9EA 3UJ7A 2VRCD 5CHEA 2BAGA 2JI8A 3QKWA 1TCAA 2O0LA 5AM0A 2EX4A 2HUPA 5IFLA 3ILHA 3KR9A 4PU0A 5H3LA 1OI4A 4EMTA 1JQJC 2AMLA 1W30A 4AYWA 3KSBC 2DUJA 3MLAA 4QG7A 2QAJA 3I39X 3L0YA 4Q48A 4C88A 1OX6A 1KPIA 1PJTA 2H29A 3INGA 4MWSA 2ZYTX 4XDZA 1E69A 2H2FA 5ERYA 5B3LA 4QTTB 3GD7A 4U8GA 4PG4A 4ZV4A 4XPIB 2NU7A 2J4DA 3CW9A 4OL9A 4G4JA 4IGAA 1OU4A 4MI6A 3STWA 3UQZA 1E2HA 3QLTA 5FBLB 4KFRA 1EFAA 1JIUA 3F5FA 4WRRA 1YQEA 4RDXA 5L45A 3FGOA 1DRKA 3UY4A 4DJEC 1H3EA 3B1WA 1WKVA 5JV5A 4QUDA 1VSQA 3L1VA 2EFGA 1OH7A 3ACCA 3JQGB 1KYWA 5TMBA 4I1YA 2VSNA 1GA6A 2RBGA 2Y1DA 3FOWA 4P3YA 5CT8A 2HAEA 1KBOA 1RAIA 1M73E 1AG9A 5FEUA 4Q18A 3ZX5A 4DLPA 1VLZA 4R2JA 3AM4A 4K88A 2NWQA 3PPWA 4U5XA 3IX7A 3KLBA 3TVDA 1XCJA 4EL5A 1IU9A 1SB9A 2ZEJA 3FUWA 4P4NA 1PT6A 4RTLA 5EQTA 4J0HA 3N86A 4AAYA 5DI3A 2R68A 3I83A 5F5NA 2YIJA 4R9VA 4B3CA 3PE4A 3B78A 1O0SA 1RHRA 3OZRA 3UC5A 3UV6A 1VI6A 1YS6A 4QARA 1OFVA 1E5LA 2HT1A 3GLGB 1KERA 3HVIA 3EIEA 3CRRA 3IUBA 2OPHA 4BLVA 4E0BA 1QTIA 5AHKA 3BD8A 3F7MA 1M1YE 5KYWA 1FTWA 3RBZA 3SF0A 4C21A 1REQA 1R8YA 3HKBA 1TYZA 4P08A 3WKAA 1GYRA 2LDBA 3T7SA 5AFSA 1NOKA 3C3DA 4MDFA 1E1KA 2Y1WA 3FE2A 3PUWA 3FKSD 2Z8ZA 3JSAA 4FCCA 4ZVRA 4QVIA 3F4BA 1PQUA 3SR0A 3WLPA 2PGJA 3O8OB 4DOMA 4CGZA 2BI8A 5LCXA 2RHRA 5JMWA 4NJMB 2ORVA 5ELLA 3LA6A 3C24A 3R3ZA 2NV2B 1ZUHA 2ETVA 4KDEA 1U6KA 1TO2E 3FBTA 3LY7A 1ECLA 3NALA 4LK3A 1Q1NA 3CG0A 1P17A 5T8KA 5AP9A 2C42A 4H7IA 4TRJA 2G07A 3NOXA 2XYRA 4PLFA 3IAHA 4GOMD 3QX3A 1BHJA 2FUNB 3GDOA 3RSGA 2IYEA 3ENVA 4TKUA 4FDUA 1ZG3A 2A3RA 1TE2A 3JQQA 4K2HA 4M8NE 5H16A 3UMGA 1VL5A 2V45A 4EJSA 1JU9A 1KZ1A 4IXWA 1Y89A 1A9PA 2Y05A 1FLDA 4ZANA 16PKA 1KFKB 1YQXA 1H6DA 1P1RA 1QAOA 2ZANA 3GNQA 4NJOA 4DKJA 4FS3A 4ND4A 3SFVA 1Y1QA 4NQZA 1ID8A 4XVCA 1DEXA 3M9WA 4AJNA 5CFOA 5FPKA 1SQGA 1REQB 4K46A 1VYUA 3K1AB 1IN5A 1DAPA 1ZUNB 2FDXA 1E2JA 1GXSA 1E92A 3DTVD 2ZAMA 1QRTA 3T6KA 3OOJA 4IJVA 3U4QB 1FVXA 3AJDA 4HEQA 4LJ9A 4B80A 3IXMA 4OB7A 4R8SA 1UDXA 1OC4A 1G1MA 1ZCFA 2HA4A 2RFLA 3KP1A 3OF2A 4HQ0A 4BFSA 4F3KA 3DH0A 4EJ6A 4PCUA 3EGOA 1BS2A 4K9QA 4F4JA 1FW6A 3B53X 2CUZA 5CFPA 3KAKA 4I9UA 4PRKA 2ZQ5A 1MOQA 2B7LA 4BN5A 1B0AA 3EPRA 2CMFA 2OILA 3A7EA 3K9QO 4IGFA 2IQ5A 3B36A 5C7YA 3I37X 4RA6A 4AMBA 4E6PA 4H1VA 3M4JA 4ZDWA 3G0IA 3MINA 3NRBA 4HXYA 5HK8A 2C99A 4HB4A 4PGMA 2EC5A 5M7EA 2UV8A 2PZKA 3PGKA 2O3TA 3LRTA 5A9RA 2GR9A 2IVFA 3ZNNA 4A8PA 5BPHA 5KNDH 4ZYLA 1K5DA 3H4VA 4O2BF 2JJ8A 2REQA 4J4BA 1RI4A 2EX0A 3M6MD 3HZHA 4HLQB 1S8FA 3W5BA 2W42A 1M1ZA 5KYYA 2QROA 3L7LA 3WSVA 2SCUB 1RXSA 2CNOA 1YWGO 2QL6A 3DZGA 1V41E 4JI1B 3QM1A 1ODTC 1K2VN 1YC5A 1CRLA 2I6QA 4KGDA 2PSHA 1E0KA 4R6XA 5CNKA 5KYXB 1BS9A 3CEJA 5L7YA 2FMKA 2FE4A 1J8FA 4PQYA 4NE2A 2P3LA 1CZLA 1K8ZB 2WD7A 3LQ4A 3ORFA 3Q2IA 2VHTA 5HTKA 1RQ2A 2JIZA 1JQLB 3EFEA 4G4SP 2GA9A 4OSPA 2YWXA 3C74A 3EOZA 3CTMA 3EC7A 3I64A 4AJIA 3HEMA 4QQKA 3ZWDA 4M7OA 4MWDA 2L17A 4DC0A 1DBWA 1O5IA 3PFWO 2DR3A 1MG5A 3EVCA 4J7CA 3TLKA 2I6SA 3UUFA 2B2NA 2J59A 2YIMA 4NU6A 1QU2A 2MYPA 4M7WA 4KPGA 1A95A 1NOIA 1C1XB 4ZVOA 3RAJA 3ZWOA 4D25A 3D4LA 4E3WA 2H7VA 1VCMA 4HNAB 5A4JA 3Q9SA 3C48A 2OXCA 2QKYA 3R6WA 3T5TA 5KNBD 2F1KA 1XP5A 2PQMA 4I8XA 2GRJA 4UOEA 1FX1A 2QSYA 1JEDA 1ORTA 4K03A 3RC8A 4FR2A 2B61A 4OKSA 3MF4A 1TF5A 5HR5A 3RLFA 4BDSA 3UJAA 2ZUTA 2RC6A 2C7GA 4DIUA 3H9GA 3WRWA 1P9RA 3TBKA 2PXCA 4HDKA 1FDWA 3OLQA 1Q22A 3QXXA 1W59A 4YWHA 4YRGA 1IN8A 3KTAB 3QUCA 3Q5DA 3O26A 1DTWA 2CJPA 4BYMA 2R25B 3UOWA 3EFOB 2J9FB 3IHTA 3ETCA 3F8TA 1EVLA 4LN1A 1VFPA 1ZK2A 1QGYA 4H77A 2ZUWA 4NCJA 4X7MA 4KZKA 3CO0S 3K53A 5DEOA 3D7LA 1MVLA 2XJ9A 3QTBA 1XZEA 1GQRA 4AUKA 1W0KA 1I6WA 4NH0A 4NMHA 3T06B 1J1ZA 4FB4A 1Q74A 5AK4A 1DT5A 3QPWA 4FHDA 3EG5A 4BLUA 5KCMA 4ERXA 3AW9A 1P5JA 2BFCA 4KHZA 3CU5A 4WV3A 4FWTA 3ND8A 2DQYA 2Q0SA 3LF1A 4TL7A 2DUNA 3USCS 4IGIA 4BQSA 5C37A 2UZ3A 2BWJA 2YMPA 4ZCSA 1WBBA 3SPXA 4AWBA 5KTKA 2DPGA 3G0DA 2ZFUA 3K1TA 4INOA 1P1KA 4CR8A 1UMCA 1AGNA 1H8ED 1Q0HA 1ULSA 2Q6KA 3A1TA 2UZ0A 3E18A 2JI6A 4J0KA 5EWMA 3V4PB 4EQ6A 4N8SA 5AVTA 1R50A 2BFDA 2V0NA 4WUTA 5C9ZA 4GHWA 1IE3A 2MSDB 3ADDA 3C7AA 1GPWB 3TE7A 1IWPB 1KOGA 2GDJA 1VC2A 2NTYC 1WLYA 2JAXA 1Q3KA 3MMNA 3L8DA 2QNIA 5FUVA 4Y18A 1Z68A 5IANA 4XGKA 1KRXA 3DEJA 2HZBA 1X19A 3W9SA 8ATCA 2N3ZA 2X1MA 2DSTA 4IH9A 3OQ6A 5FD8A 3K16A 3T5AA 4OU5A 1CS4C 2QQEA 4KR9A 3A4LA 4E30A 1YS7A 2XSZA 5KC9A 1DC8A 3NEYA 1SMKA 4E2YA 2RIPA 3LH5A 1C9KA 4V03A 2FW8A 1GPLA 4MV6A 3L92A 5G02A 2OHXA 3QBEA 4PHCA 7ADHA 2C8JA 4LGMA 5KTOA 1MG0A 5K0NA 2W2NA 5ICCA 2XE7A 2I03A 4KRFA 3QE2A 3HYTA 4IQ0A 3SKVA 3ZJUA 2C97A 3QXGA 3G2JA 2P9FA 4HO1X 3F2VA 4IXMA 4J43A 4M8IA 4C01A 3HM9A 3JRWA 1U9IC 2H4XA 4JLPA 4M86A 3EGCA 1Z47A 2ZRNA 1I94B 5EHNA 1YE3A 5DWVA 5JJBA 2A2ZA 3LUCA 1A4UA 2RHTA 4MMYB 5LM3A 3KIPA 3WY9A 3M70A 5JQWA 1E3SA 1KXZA 5FOQA 1DKLA 3R0IA 4H35A 1Y6JA 4UUPA 5DLDA 4EY5A 4L3WA 1HQKA 3B1ZA 3E48A 1JI3A 1R00A 1Z0KA 2E9SA 3LJKA 3Q11A 1R0XA 5IJXA 4ERNA 4MVJI 4G41A 1L5HA 3V46A 4BLWA 1K9SA 3Q41A 2Y9PB 2QT9A 2XITA 3IDAA 2FK7A 1U0RA 4WK4B 1P29A 3ITKA 4OQLA 3QIVA 1RP7A 3PNPA 1U9YA 4OYYA 1UOPA 1FNDA 4JKOA 3CO5A 2A9FA 1C5KA 1RQPA 2XI4A 1JG1A 3DDUA 3G89A 3OTIA 1T8WA 3BWDD 1XDBA 3AWIA 3L5KA 4XR4A 1ORHA 2PO7A 4AP9A 4KMSA 2FZ5A 2CMKA 2PBRA 1SXJD 3B85A 1R6TA 2CV2A 2L42A 3NHMA 4CF7A 3NBXX 1Z13A 2GEFA 1FXWA 2FWBA 4KDCA 3RRJA 4AZTA 4E5PA 1D1SA 4K9RA 3RYFB 4AK9A 3FOAA 4QO7A 3G0HA 3D3JA 4FE3A 3W06A 2PX3A 2H52A 3DWFA 2VAMA 2E4UA 3OE5A 1K3UB 4TTIA 4H2DA 1RFGE 2WWYA 4EB6B 1KYYA 5AMXA 2DPLA 2Q6IA 2EHDA 2G5PA 3HO6A 1QTNA 5D86A 5JAQA 5JC1A 5KC8A 2ZI5A 2QRVB 1KL7A 1RJFA 3G2LA 4J3NA 3EVAA 4Q1EA 5B2ZA 3L7OA 1WF3A 2ZI9A 3PGA1 3Q8MA 2ZJ0A 3WYCA 4TSFA 2Z6UA 4BFYA 3PKZA 1NSFA 3ZE7A 1W4BA 1W5BA 3LVBA 3WL7A 4H7JA 1Z0IA 1XYGA 1RPZA 1T8PA 4MRNA 1H0HA 4ANFA 4EKDA 4CQLA 2H3EA 2QVGA 1ZXXA 4QNRA 3ZDZB 2AMYA 1D0IA 1TF7A 3CVOA 1AC5A 4DRXB 3T38A 3MUOA 4P34A 4CIWA 3INTA 3RRMA 3WDMA 4IO0A 2X2FA 4AURA 4N47A 2H63A 1P6UA 5C5EA 5K9ZA 4OK3A 2Z8YA 2PSFA 2WU4A 3A6LA 3W5CA 4MWGA 5A05A 2ZGVA 5L3VA 1UBSB 3HJUA 4X6UA 3C16C 4QRIA 5CH8A 3HBJA 1AMNA 1DOHA 2AHRA 1EIZA 3TQTA 1D4AA 4MUMA 4ECAA 3TSWA 3EEQA 3ILXA 4DIBA 1EXNA 1R0RE 1UBKS 2PSSA 2DRIA 2QZZA 2WFLB 2FW0A 1Q1EA 3EEIA 1A8SA 4JY7A 4K9OA 3AF1A 5KTTA 2C2GA 4H27A 4TROA 4KUHA 2I3BA 4AF6A 3UMSA 5FLXA 1IXZA 3GP3A 2CLIB 2YN0A 3OC0A 4IMPA 4YUZA 2I71A 4ZJYA 1W93A 3V4RA 1YIAA 3CUEF 3FUCA 3Q3EA 1KPGA 3RK0A 1L1RA 5LA6B 3LSYA 2YUIA 1ISJA 1JXMA 3BWCA 1Q0RA 3KVRA 1YB6A 2P5YA 4FS8A 4UZFA 3TTWA 3P9IA 3ZWXA 4CQLB 3OP4A 4CMEA 1KJQA 2C03A 4PNHA 5J2TA 2C5EA 4MEJA 3AI1A 4CT5A 3ROZA 1X7DA 3I6MA 2C2KA 4GI7A 1ZGJA 1JP7A 2RMKA 4P84A 3GDFA 2RCNA 4TUYF 4KXFB 3CVJA 5EE0A 1NW6A 2P7HA 4DCMA 2VDKB 4MUBA 1NYTA 4WESA 4MRRA 1M6YA 3HB5X 3B70A 1ZC3A 2R6AA 2IIPA 1L4MA 4IXDA 4JYZA 5A7HA 1M6NA 1R10A 2Q6OA 1NGSA 3KETA 3IXQA 2CYBA 4BMNA 2AC4A 1DZ3A 2RGWA 1PQWA 3KELA 4YRAA 2VFAA 4M8KA 5J4HA 1IJBA 2E4XA 3DTNA 4H59A 4BGIA 2YRWA 3NTRA 1N6KA 2PXHA 1O89A 1QLJA 3GGDA 4K3VA 4POAA 4RL6A 3WB0A 3ZCXA 4XRGA 4JLMA 4X8MA 4DRZA 4DJAA 1FSFA 4EG1A 5BV2P 2AFIB 3OF5A 3LF2A 3UXMA 4DJDC 1GA1A 4BGVA 4V1CB 2V6JA 5F7OA 5JT1A 3DKKA 2FG7C 1VB3A 1MORA 2ZWPA 5FDFA 2YZNA 4BQFA 1K97A 1R5NA 1XDGA 4KYVA 2X7JA 3SR3A 2R85A 2FEXA 3R5JA 5BN5B 1BAPA 3E5RA 3G5TA 4RZUA 4DDTA 4COKA 4ESOA 1X94A 3F6CA 1UK6A 4QXRA 2OO7A 3OMLA 1SIOA 1URPA 2QPAA 1Y9AA 3OLXA 3PLNA 2HHHB 2P8SA 1Y8ZA 4P7JA 3JQ8B 2VHUA 1IJEA 5EJAA 4F8EA 1A98A 4NYJQ 2Q3FA 2CNKA 2JCSA 3BWVA 1GNVA 5B64A 3PC4A 4BNXA 2WP8J 4YT8A 4PFSA 4ZMBA 2B35A 3THWB 2BGNA 2Y1KA 3W7VA 4DQKA 4O0MA 2FSSA 4BO2A 2ZETA 3TQHA 1IZYA 2VXCA 1B74A 4Y7DA 3JAKA 1QP8A 4KW7A 1G1AA 1TL7C 2IYTA 1JDVA 1T3SA 2R6CA 3VO2A 4BTEA 5JAOA 3TGLA 2IDMA 1UT5A 2FRDC 3I9NA 1YCHA 3K09A 2RH9B 3O3OB 4C0BA 4BQEA 1WZIA 1P0QA 3PEWA 5ALGA 2O48X 3RO7A 3F6BX 5JO0A 3DT6A 2GPBA 4XM2A 4N6NA 2ZIXB 2R44A 1D03A 3UA4A 3MUFA 1G8FA 3C7CB 1MX9A 5LJIA 4KI7A 4XQEA 4QOGA 2BVNA 4CEIB 4ZQGA 3CJRA 1FVHA 2MU1A 2O2XA 4LBZA 4ZOAA 1VM6A 3RSZA 2OXEA 1R9JA 3AUTA 2YN4A 4HV4A 3EEFA 2N46A 1PVVA 4KLRA 4F7WA 4CCYB 1J22A 1NURA 3TIGA 4ZOEA 5TVGA 1FY2A 1Y1TA 1WXIA 3DB2A 4PSCA 2CFRA 4UTNA 3T7TA 3R3WA 1BE0A 1P2VA 4B17A 5B4VA 1CUFA 1WKBA 4GWGA 3ZIAD 2FF7A 4GBGA 3WE7A 1CRPA 1W1IA 1P2FA 4CMBA 4J1SA 1ETUA 1XHFA 4IVRA 5KTPA 2ORIA 3MUNA 2IUFA 4UVGA 1L7AA 5CYPA 1M34A 2ATIA 3A14A 1NLYA 1WEHA 2X41A 2CJWA 3UW1A 1I7QB 4S05A 1M5RA 3QNWA 3GWGA 4F7DA 3HB9A 2WI8A 4RVNA 4G89A 2P79A 2X6QA 5IC6A 3W8EA 5TPWA 2A92A 3DR5A 4NYMR 2SBTA 2W70A 2RBEA 4P93A 3TD9A 1Z22A 9LDBA 2NZ8A 3MCWA 3C1AA 2FG6C 2GFHA 2OHVA 4MV7A 3QP9A 1M5UA 3AKCA 5ALJA 3PC3A 4RTSA 1U0BB 2NV6A 4WFQA 2PJZA 3ONEA 3UAWA 2OCPA 3AHDA 1F4PA 1XTPA 3ROGA 2ZU0C 4P4SA 1JSRA 1PJZA 5LYJF 1GAWA 5DWQA 2GN1A 3A9UA 1PT8A 3ND7A 4R9UC 5E2BA 3IUQA 3LOQA 5AVUA 1APBA 5A0TA 2PZLA 1TF2A 3EJWA 3QLJA 3ZPXA 1AT1A 2G9NA 1GNLA 3B6JA 2XV1A 4EL0A 2RHHA 4R98A 4BNMA 1T5TA 1R6VA 4FYYA 4YQFA 5CBKA 5AW0A 3ACBA 2IQIA 4DQXA 3I42A 4NENA 4L7VA 4QGGA 2HNKA 2DU8A 2QTMA 4N54A 3E53A 2QTFA 3QOYA 4XVRA 1DIAA 4HJRA 4CL2A 2JAPA 1DC3A 2GN6A 1P3Y1 3IOBA 1IY0A 4HDNB 3VTFA 2EYQA 1XNQB 4NBLA 4HAUA 3E9EA 2AOTB 3NASA 2CHUA 1NUTA 1ZD2P 3BMOA 2NOAA 5FA8A 2CUTA 1KZYC 1ONNA 4EHNA 5LU8A 4PSAA 5J47A 3K5WA 1RXVA 2Q07A 4TVOA 3ZE0B 5LNK6 1J23A 4N39A 3S44A 4DLSA 2J41A 2GKOA 3EPKA 4Q9NA 4F8YA 1JFSA 4DG9A 1J7KA 1C9YA 4Q4JA 4DLNA 1SUAA 1GRNA 5FV4A 2O8CB 1WXHA 4HVLA 1U2DC 2AKYA 3IQHX 3G6WA 3HGQA 3BULA 1U1DA 3B60A 4P3OA 4GVPA 4DZZA 4W5WA 4YCJA 4QYWA 2NXWA 5DVZA 3ASZA 2UYHA 2ZDHA 1P5ZB 2NZWA 3KXLA 1B26A 3TPFA 1U1CA 4CF3A 2I2BA 1Z0ZA 3AR7A 2POCA 2OZKA 5AM3A 2ORYA 3TZKA 1OBHA 3L46A 5ITSA 3AF6A 1DADA 2PUEA 3SHVA 1R2QA 1FU7A 1PHPA 4WTOA 3NMUF 4FP9A 3P0IA 1K2WA 3OM8A 4KSYA 4NBUA 1P4JA 3V00A 3AM3A 1RI5A 5JQGB 1AUXA 5CPFA 4YO7A 2VS1A 4QASA 1VP3A 1NRWA 3OQ1A 4JIMA 4FC7A 5KHLB 1CD5A 3H86A 4WECA 2C00A 3AX6A 1F2UA 5CDYA 3VNQA 1OX5A 2G6BA 4LQCA 1Y9EA 4DIFA 1JH8A 1TT7A 3WQRA 3KCNA 4XYEA 2YMLA 1DKQA 1MRNA 1N6LA 2X0DA 5IRCD 2G4CA 3T1NA 1FS4A 5FBRB 3NT4A 4B84A 4MEAA 2P5UA 2OYSA 3FVQA 2VPIA 4W4TA 1EM8B 1WDLA 3O83A 4B7UA 1ISSA 3LCJA 3NOOA 3OJXA 4JCOA 2OZPA 1GSHA 1W581 2G70A 5DGTA 5EGSA 5CDUA 1XQXA 3CY6A 1DQSA 1M34B 3GUYA 4EF4A 1P19A 3QLVC 3KSZO 3NHRA 1UMDA 2XXAA 2FUG1 3HY6A 4LUCA 1ESNA 2OO5A 1M2NA 2GCNA 3ETDA 1JQAA 4QFBA 3BDVA 3VR5A 3X1ZA 4TV9F 4JUIA 3ZI4A 1GUAA 2EG9A 2OCGA 3FZNA 4IS3A 3EDOA 3TFWA 3VI4B 4GF5A 1B4DA 2HJRA 4S0ZA 4BGDA 3KQMA 5K09A 4LTNA 1QCCA 2CLHB 3I28A 4MDHA 1EK0A 1N2CB 3E0QA 2A8YA 4GMKA 2C07A 4S35A 1IZ0A 1DFIA 4BP8A 1QHHB 2BZ1A 3OZXA 4MCJA 3SOZA 4DUZB 3DLIA 2C95A 3L40A 4ON9A 3CX6A 1PR4A 1CUYA 1NR5A 3OAAD 1SXHA 4JELA 2CL5A 3ZY6A 1CIVA 3A3NA 1OAOC 1D2RA 1V8ZA 3VPAA 3AKYA 4CW7A 5F98A 4D41A 3TL6A 5LQCA 1V2HE 3UGKA 2WHQA 1TKRA 3U37A 1PVOA 3BT7A 4CLXA 3SY8A 1SRRA 3HVUA 4DA0A 2CVPA 5IP5A 1C30A 3B3FA 4JOCA 4W5HA 1MJ5A 4LI3X 5FPPA 3GH3A 1R64A 3U7JA 1N34B 2CHQA 1MN6A 1J21A 1U0FA 2I3DA 3DBHB 3QPDA 2IZZA 5LPNA 1P6XA 4BKPA 5EJ5A 1KZHA 1PVDA 2FX5A 1HTBA 2IFTA 4OMFG 2ZRGA 1EE2A 4QJIA 4EJ0A 1G3MA 2DJ5A 2W00A 3O95A 2BI4A 4UMDA 2HMAA 5FPTA 1RM4A 3KTAA 4PIPA 4R1NA 3IAS1 4BQPA 4MITA 2QRMA 3PP8A 4MGHA 5JXWA 4N49A 3BMXA 1MAUA 1UC5B 2P67A 4BJ1A 1F6DA 1IPFA 3VA7A 1XZ8A 2QR3A 2OCXA 4NBKA 1D7AA 2G1UA 4OP2A 1KI3A 2BI7A 4PLGA 1XOIA 3AO0B 3EIHA 4U2DA 4DY6A 4Q1FA 4E5YA 3OEHA 4WI1A 8ADHA 1G8HA 3HBMA 3FMFA 4HX2A 2WZQA 3AG5A 3L18A 1NQXA 3NHKA 4WACA 5BUSA 4PHFA 5JROA 4GI3A 2IOYA 3WWOA 2IEZA 3M4ZA 4B7ZA 5C8YB 3MRSA 1NMEA 4NMWA 5ARDA 2QUAA 5AI9A 4BJ6A 2J31A 3DBIA 2YHIA 3JAKB 5EIXA 2C7RA 1JMKC 5KJ6A 3DE3X 2P7IA 3OJEA 1C50A 5CEFA 1AZWA 2JFYA 3WIOA 2O54A 4WKGA 2X1VA 2FWJA 1ES9A 2BEJA 3T0FA 3I8SA 1HBJA 3I9OA 3IC5A 5ITZA 2NQTA 3D2AA 4FMCF 1O2DA 1BSVA 2NPIA 3O94A 3GLGA 3VSDA 1CVIA 4QELA 3HY4A 1U2QA 2DWOA 2J45A 2C77A 1XXHB 2JHGA 3H1BA 3BJZA 2EHJA 1U90A 1RACA 4FZRA 4RH3A 2K87A 4HQKA 3WTCA 5DX1A 4D0RA 4WK2B 1T8RA 2A59A 2V74B 2FLVA 1DP4A 1S4MA 3QYPA 4LK2A 2A9RA 1WD5A 3B7WA 2YMQA 4KQ6A 3KQLA 4AC9A 4BEVA 5KYVA 4NZYA 4MKXA 1EFPB 4Y9SA 4O1IA 2ATCA 3X1XA 1JNYA 1WNFA 4H0NA 3VPDA 3BF8A 1WXFA 1BG6A 2CK3D 3WG9A 2C9YA 2YMMA 1A1VA 5H70A 1DZIA 1KIMA 1E3IA 4B6RA 4A27A 2GNPA 4FM9A 1G66A 1CW2B 1RNLA 1H9BA 4LRXA 3PKIA 3DVAB 2XBUA 4ITVA 5BT9A 4DG8A 1V16A 2ZIXA 1J1IA 3MWKA 1SBNE 4FFPA 4EY3A 4RSRA 2MSKA 2Z8YM 2WPDA 4HNRA 2HH9A 4WESB 3KXIA 2AJCA 3L7YA 2IYPA 3RJTA 4UFNA 3SYLA 3KAPA 2XMRA 3CPHA 2I0FA 3FMVA 3PE3A 1AZLA 4AKTA 2X0FA 3PDUA 3K71B 3WHLA 2HCBA 4OX9Y 4Y1FA 3TJZA 1HZJA 4M0LA 2JLWA 1OFUX 2G25A 3MRXA 2EU8A 4WBNB 4KREA 1CERA 1ZRHA 2CBXA 4F4IA 4PG6A 4JQSA 4E4YA 1BKSB 3ZKWB 1G6OA 3OX1A 1NFQA 1K6EA 1RI3A 1T3GA 4RY8A 5ENDA 3IESA 1MNAA 4F6CA 5L95A 4HAOA 5I6DA 4GECA 4A5SA 2OV8A 3GPBA 5JVDF 3DOCA 3NNDA 3WLIA 3MOSA 2PEYA 3RIEA 5JAPA 2TRSB 2PUBA 4QDXA 2WSBA 4RZSA 1JHQA 3WQQA 1VZ2A 4OHYA 1NATA 2C4TA 2X58A 4FZJA 3NANA 2HZ7A 1Q3TA 4HJXA 3TIFA 2F00A 3RSHA 3M9XA 5TEWA 1QK5A 2WZBA 4UUOA 2HRBA 1EFKA 5HF6A 3DTVA 2FPKA 1W96A 1CC1S 3RK4A 2BD0A 2JI4A 2WE7A 2J3EA 5EI5A 4TL8A 4RHFA 1WL8A 1F2VA 3FA2A 2Q1XA 5B6IA 2R97A 3L1UA 1T1GA 2LW7A 4JXXA 5DCWA 3PPVA 2W58A 3NP9A 1HG0A 1JR3E 2AEFA 2C2YA 1QONA 3DL2A 1BH6A 2F17A 1YJCA 4GVXA 1L5SA 1L1EA 1EEHA 2G0NA 2AVDA 2O8DA 2B20A 2ZRIA 4BJHB 4XTRA 4AO8A 2JG3A 2HXGA 3WWCA 3S81A 5A3SA 2Q1SA 5JOQA 5BQPA 1QKJA 2O59A 3BGOS 3KOWA 2R6HA 1C7FA 2WZDA 3L8EA 5DNDA 1GPBA 3IEKA 4NXMB 1F6BA 4U00A 1RWXA 1T0JB 4M0MA 5AVOA 1OPXA 2UVPB 2QRQA 3IEXA 2OC4A 1V5FA 2ZT7A 4JX8A 4R0VA 5ALDA 3RYIA 3W6OA 2J0UB 5B3JC 4HNTA 3U26A 5ALVA 2VYNA 2BFCB 4ES6A 3RTBA 2QL7A 2WOOA 4BKMA 5ECWA 1O5TA 1AF4A 3JZMA 4IG9A 4XXHA 1IBLB 4KXMA 4E5DA 3NWEA 5IKEA 2WKPA 2HEIA 5CVCA 4RDHA 4UUNA 1QMGA 2PL3A 3ZJVA 1RZVA 2PH7A 1V7QA 3O4GA 1XMSA 1VLLA 3RIMA 1WOMA 4U3JA 3HZOA 1EUDB 2O7SA 2XUIA 1U2GA 2QN9A 2ZE6A 3EJ6A 5JJCA 2XADA 1DIRA 2BCEA 3OCCA 2UZ1B 3DP7A 4XAQA 1DEOA 2FPXA 1E3LA 1ULBA 3OOSA 2F62A 3NVKI 2J46A 4KFSA 3H5RA 1Z5GA 1SUDA 2D2IA 1CKEA 1PFYA 2AXPA 4KODA 4D4KA 4F12A 4WXEA 1ZM7A 3C3AA 2IZ7A 3CMCO 3UZUA 3JQBC 2W2MA 3CJQA 4CG2A 4CQNA 2IOFA 4RH1A 1ZJ5A 4O4IF 3V1KA 2H6EA 4FUTA 5JPDA 3KKLA 1GITA 2ZUSA 1Z2EA 4EYKA 3WAJA 2DFKB 1O1YA 3Q7TA 4E51A 4ETNA 3PQFA 1VZ3A 1THMA 3I1YA 1DKRA 2IYWA 3CSUA 3QELA 1ZD5A 3REQA 3L02A 3W5VA 1R4AA 3DOFA 4BOYA 4E4TA 2BGUA 2IKSA 3CN7A 1NNLA 4QOSA 4HP8A 4F56A 5JNRA 3LGXA 3QUBA 2FWPA 2HSEA 2Z2JA 4V0NA 2QRVA 4NZ9A 2P69A 1QV6A 3RM3A 3K6KA 3SJCA 2HJ9A 1O6BA 4KAXA 1GPKA 1B41A 1CNFA 4JR2A 4HFMA 4Q0MA 2YWEA 3SHWA 4DCOA 4F0JA 3LW7A 5HQTA 2B1IA 5DOVA 3O84A 4KE9A 4BO1A 1GKUB 4X61A 1N3YA 2AZXA 1Q14A 3QUQA 1EDDA 3N1UA 4KQCA 2V6MA 3AOEC 4KIJA 4FDVA 1T36A 4GX5A 3F3YA 4BO5A 1UDWA 1W0KD 2CFCA 4I8DA 2JIMA 4CM4A 1CQXA 4XCVA 1NHWA 4ZT2A 2B37A 1CVLA 1KEPA 1Z7BA 2GAAA 3ROEA 2IL1A 3ADBA 5KQPA 3O92A 3IMKA 4I99A 5BSHA 1PYOA 3OJCA 4KDFA 4ZQBA 1ZMOA 7REQB 1I24A 4D0SA 2HDNB 3LQ2A 4X63A 3FWZA 1HX7A 1A5ZA 3DOEA 4XDGA 1JWBB 1VHWA 5LC1A 4URVR 4C3VA 2YOGA 2B98A 1ACLA 3D3QA 4RZ2A 2OP0A 5EUBA 3VNUA 1LRKA 2CD9A 3FTPA 4K40A 2IDJA 1FVOA 2IELA 1J8YF 1CUWA 2ZIFA 5A04A 2ZYAA 3UUWA 1ZR2A 3G88A 4NOKA 2LCIA 1UK8A 2W11A 4EABA 2EFEB 4KO3S 3FN4A 1TLFA 3GT4A 1XPJA 4ER7A 2GDZA 2FU5C 1F4LA 1R16A 2IEYA 2XYHA 3W05A 4E32A 3JWEA 1CUDA 2NT4A 2O0HA 2VBIA 3O8LA 3QBDA 4MUHA 4QAJA 1HDCA 3PXEA 1AK1A 2ZIVB 3CPEA 3KBOA 3AHGA 3KJFA 1U9ZA 3DPSA 4YJ3A 5EP2A 2VVTA 3KZ1E 3VZRA 1EVJA 2EARA 3VZQA 3T1HB 1N9KA 1BCSB 2VNAA 2WNIA 1XJ0A 4OUKX 2WBLC 5GGXA 4KPEC 2ZVDA 3CX3A 3PNBA 4Q21A 1M54A 4YMWA 1X0XA 3FJ1A 2EFJA 1T5IA 1CR6A 1KTVA 4ZCQA 4HWPA 3SIRA 3TNJA 1E7RA 4W7HA 5CAEB 3OJWA 3IPRA 3WP0A 1DL5A 1JEOA 1H4VB 3P0EA 2IU3A 2ORED 2G1PA 3J7AC 1W5FA 1JQDA 1NFFA 2WU3A 3LBNA 1FRNA 4LMAA 4F2WA 4Q1VA 2X77A 3NGXA 1GU0A 1VIDA 3DAGA 4FXOA 4B0PA 5J59A 1H2RS 1XWFA 4CG1A 5F3WB 3AETA 2ZUEA 2FEMA 4IFEA 3GJ3A 1ZCJA 1FXSA 3FY4A 3GVPA 1BNCA 3NGLA 4QGHA 3TTTA 4JR1A 3KLOA 5BMVF 3NDBB 4L50A 5T7BA 4GC5A 5FHRA 1TJ3A 1XTRA 5FPSA 2MSEB