2C2HA

Crystal structure of the human rac3 in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
168
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
publication title Crystal Structure of the Human Rac3 in Complex with Gdp
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 168
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c2hA00
5E7MA 4KFRA 1NLZA 4E07A 2IYUA 2BJWA 3PUVA 2WJJA 4A2WA 1Z06A 3NDPA 4IDPA 4PO1A 5HKKA 2B21A 3ZYCA 4MH0R 5AUPB 4XWKA 3AEZA 4LRWA 1Q20A 4Q1AA 4CT4B 3LQRA 2A30A 5C46F 1UKZA 1KNXA 3T1TA 2WMOB 1Q1ZA 1P9RA 3LXXA 2ZREA 1E2LA 3MLEA 1OXSC 5EE0A 1QG4A 2NO0A 2R8RA 3AGQA 3OEEA 5K8TA 2QN6A 2QY9A 1XPRA 4Q7LA 1KSGA 1J99A 1QVRA 1X8JA 3N2EA 1E79D 1FUKA 1CRQA 1W4AA 2F3TA 5KOYA 1MT0A 4KYIB 2BKUA 4TL8A 3AVWA 3AQ4A 2PJZA 5DHFA 4V0MA 2J3EA 5LPNA 1FX0A 4FINA 3U3RA 1YZGA 2ZR9A 2GXAA 4YXWD 4JLDA 2PLRA 4PSVA 5JEDA 1WP9A 3K0FB 4IW3B 2ZYWX 3B78A 3WY9A 3AVXA 2OXCA 4Z8XA 1W0KA 4B3XA 3NWJA 2QP9X 1HT2E 2DFLA 4JZKA 3ADBA 1IN4A 1N5LA 3QBVA 1EGAA 4OBEA 1X6VA 2Z83A 1GDDA 1E4VA 2VP0A 4OYHA 4Q4AA 4TSFA 1CIPA 5FPSA 1TMKA 3O8RA 1JBKA 4GI7A 1W7AA 2ZSFA 3SN6A 2IS6A 3GLHB 3AB3A 1GRRA 4Q9IA 1CEEA 5L3VA 1FOEB 1TL7C 1E1RD 1KKMA 1SQ5A 3UWOA 2WAYA 5G40A 3QQ5A 1SVWA 4RJLA 5J40A 3X1DA 2IXGA 2QGZA 2BVNA 1JR3E 4MRRA 4TZ6A 1JXOA 1N5KA 1XJCA 2P65A 5J5CA 4FCWA 1M7BA 2CEAA 5ELXA 3GJ0A 2J9RA 3BJIC 3CRW1 5D3MB 3BD9A 1DO0A 5HCNA 5CJ2A 1RYHA 1Q1EA 3KQHA 1Q3HA 1IOZA 4UNQA 1G21E 2JLUA 3PENA 3LX8A 1G5RA 2WJGA 3AF4A 1M34E 4NYJR 2IUSA 2G83A 5DN6A 3T5GA 1DAKA 2G6BA 4M21A 3IQXA 1SHZA 2KSQA 4LJ4A 1V5WA 2AFIE 1KGDA 2CCKA 4DC9A 4FMDB 4PO8A 3NBZC 1AGRA 5IDVA 3S1AA 3E5HA 3IIMA 3R20A 4M9QA 3BC1A 3HP1A 4E03A 5FR2A 1KAGA 4Q1CA 5FOWA 1TUEA 3KJGA 1K5GA 1RKBA 2ZU6A 4D25A 4HLDA 4Q18A 5EP3A 1KDTA 5GJBA 2GBLA 1X1SA 2AXNA 1NIJA 1OF1A 2XJ9A 2ZQ5A 3PIRA 4TZ0A 2FH5B 2D62A 3K9NA 2QRZA 4MRNA 4FI3C 2CBZA 3KKOA 1LW7A 4JLOA 4C0JA 1Z8FA 1KI9A 4DIDA 1UDXA 1IJEA 3BRWD 2WVJA 2IYVA 2WHXA 3UG6A 2P5TB 1P60A 4A0HA 3QKUA 3MCAA 4V0KA 1KI2A 1MABA 2W2XA 3CIOA 2CLCX 3WP0A 2FPMA 1UKEA 1UDWA 4XD7A 1VIYA 1SXJC 3KKMA 4LZZA 4M1KA 4TT3A 2FNAA 1CR1A 3G0HA 2WWGA 4ZV4A 2YOHA 1TAGA 2J45A 3BE4A 2R6AA 2W83A 4D80A 1GUAA 1O3YA 1QHSA 2MMGA 4GP6A 4HDQB 4MGYR 1PVOA 1UBEA 5GVSA 2MMCA 1XMJA 1XTKA 2D4HA 2GZAA 2QE7D 5AUNB 4LJ8A 1ZCAA 2IX3A 4AKHA 3H0KA 2F7SA 2WBLC 1GZSA 1YZNA 1DO2A 4DLVA 4DWJA 2J41A 4NYMR 1ZUNB 3NXSA 2LKDA 2GXUA 2JCSA 3HWSA 2QP4A 4LK2A 5GJVC 1XMSA 5JZVA 3Q9LA 5EZ6B 4OI0A 1MRSA 4IEIA 4JIMA 1T91A 4XTCS 2NZJA 3W90A 2BMFA 1F60A 2JLZA 4N0DA 2R6GA 2RMKA 1OH7A 4PPGA 4XVRA 4A36A 4C2UA 3R9WA 2C9OA 4LC0A 3WYGA 2I4IA 1EK0A 4DT1A 2BEJA 2PZEA 1P2TA 4CEJA 4Q4AB 2RHDA 2YKGA 3VAAA 1G291 4B43A 3ADCA 2VEDA 4V0ME 5JWRA 2WJIA 2R44A 2W0MA 1DAHA 3ZIAD 2SHKA 1P3JA 2ZRMA 4DJTA 4KXFB 2QTHA 3DMNA 3QG1A 2CVHA 4KVGA 3TVTA 2ORIA 2E9SA 1G8YA 3NKVA 3VU9A 4KYUA 1W5TA 3BH0A 4ACAA 1FL9A 4QC2A 3Q85A 3QNUA 2YJTD 3CRRA 1YR6A 1IM2A 3AF3A 3GLFB 3C4JA 2G3YA 4M1MA 1F48A 2GCNA 2X2EA 3AKCA 3O47A 2V7QA 4EJSC 3Q8XB 1KY3A 4JKIA 4ZDKA 2QT1A 3ZZUA 4NPHA 3C14C 1DG1G 2QL6A 2WOJA 4IHQA 5DLQC 2BBOA 3K9HA 2O8EA 1Z6XA 3G5UA 1GNRA 4NCIA 3BK7A 4MKGA 3P4XA 3U6BA 3ZVMA 3PJRA 1P2UA 1DADA 1Z6YA 4Q7MB 2CK3D 4G01B 1OXUA 4M8NE 2E87A 4MKHA 1G8HA 2QBYA 1W4BA 2VHUA 3U60B 3SJZA 4PSAA 2GXQA 2WJHA 3R9XA 1AZTA 1F2TB 1VYVA 2J7PA 2ZPTX 3LBNA 2NOAA 4GRAA 1XTRA 2R9VA 1HA3A 2GEVA 1E9CA 3FFBA 4MYTA 4FMBB 4OJKA 1HEIA 1QBKC 2PBRA 4LI0A 4N1AA 5KPDA 2JASA 2XB4A 2JIZA 3N70A 1G3UA 2IUUA 1N0WA 1G8PA 1Q21A 1ETUA 4LV6A 1RVDA 3V4FA 4MGIR 4B32A 4BZXA 1MR3F 4GPTA 1TU4A 4H1VA 2ZRLA 5JI3E 3CPJB 2QG6A 2GTPA 3V4RA 4DCTA 5FTLA 3U4QB 3TSOA 1NI3A 2VP4A 4OQFA 1KYIA 2VIIA 5DHAA 1R7RA 4CGZA 4NBSA 2HYDA 2H16A 3CZQA 3THWA 1GIAA 1JALA 2VH5R 1G41A 1E2GA 2ZRBA 3I1FA 1E2HA 4I1SA 1NN0A 3C7KA 4KO8A 1DOAA 1ZW6A 1SXJE 4KV9A 4C0KA 3AVQA 4B3GA 2IYRA 2JLXA 2IL1A 1XD2A 2XITA 3KUCA 3NEYA 4QBHA 3MFYA 3T34A 2F1HA 1EWQA 3QEJA 3T5DA 3ECCA 1T0HB 1UEIA 2D06A 2YC2C 3F8TA 1NG9A 2CCGA 5FI1B 2X19A 5FBRB 4FXPA 2ZETA 1IY2A 3ZJYA 1KMQA 3QKTA 4V0NA 3EPLA 2AN9A 5LDDC 1MO4A 3EPHA 1G5TA 1WA5A 1KDRA 3REGA 1G7CA 2GHIA 2AK3A 3SYNA 1GKIA 5BYJA 1II0A 3FTQA 2IK8A 4HZUA 3B1YA 1MRNA 1S96A 1JAHA 2PZGA 2RB4A 5DIFA 1RIFA 3CH4B 1W0JA 4JBWA 5CDFA 5GADl 3C15C 3C5CA 5G53C 1GWNA 1V43A 1JJ7A 4FMDF 1GOTA 1OJLA 4JVSB 2QZ4A 1N6KA 3GFTA 1ZD8A 1GL7A 4G5GA 2EYUA 3QPVA 4LBVA 1KO7A 1RZ3A 4DDVA 3QXXA 2A2ZA 4MUAA 3B8HA 4JYCA 3LO5A 1J2JA 3D6TB 4TYYA 3A1TA 3SOPA 2QAGA 3BWDD 3GEEA 1Z63A 1XD9A 1JPJA 2KI5A 2G77B 3RWMB 2EWWA 1EG7A 2KWIA 4LGMA 3QJYA 5HCIA 4GZLA 4HEJA 3AF2A 1A4RA 2ODBA 1EWRA 4KCGA 1R10A 4I4LA 2YNMA 5HPYB 1Z07A 1TQ6A 4IXNA 2PZFA 4CZ2A 2VSFA 5C4GB 2KE5A 3R8FA 3A1WA 3CX8A 3ZD6A 1MKYA 1H8EA 4IDOA 3SDZA 1UKYA 2H5EA 4ABYA 2O8EB 4IEEA 4QRHA 1OHHA 1NSFA 4ZPXA 5FL7A 1OIWA 3NBYC 5CYOA 1Z3IX 2AD1A 2CXXA 2DFTA 2ZM5A 2YVUA 4ZI2A 1W36B 4IXMA 1VCNA 2P2LA 1A2BA 2ZS7A 2WIBA 2BBTA 4GBMA 4W7SA 1PUIA 2QP3A 4UNRA 3MUFA 1LVGA 1W46A 1UF9A 4A1FA 2XXAA 4GOXA 4NP6A 1R4AA 4BLQA 1T3LA 2UKDA 1G3MA 1OYWA 5P21A 5EQTA 3A6PC 2W00A 4D81A 5HZKA 1T0JB 1XXHB 4MUBA 4NYJQ 2WWWA 5FUXA 4B2LA 4Q1DA 2OESA 4BQSA 4JLNA 4EFLA 3VX4A 2RKOA 3EX7C 4P4SA 3THYB 2A7QA 3QXJA 5J4LA 4QBGB 4ZKEA 1KJWA 4MGKR 5BYKA 1WBDA 1XBTA 1XEFA 1XMIA 4QBFA 3LW8A 3R7WA 4NTZA 4CW7A 1MO5A 3UPUA 1G18A 2WAXA 5KDLA 2HDNB 2OZEA 3L82B 3OIVA 3PG5A 5EZ5A 1N5IA 1ZNWA 5CJPA 1H8HD 4HB4A 1HH4A 3BERA 3TSZA 4D0LB 2NO9A 2REBA 2VO1A 4R2IA 1U0JA 4PZYA 3T61A 3SBDA 4LYHA 2ZRJA 3K09A 4DBLC 3IUYA 2XEXA 1XPUA 2C99A 5F2EA 2EWVA 4V02A 4EQ6B 4I1OA 3ZQ6A 3RRNA 1SVKA 4TLEA 1IXZA 1NN1A 1YR7A 3GCGA 4URZR 5E4FA 5G3YA 2IUTA 2G1JA 3VNUA 2QPOA 3OFND 3RRYA 2RGBA 1EXMA 3DDCA 2VYFA 5HE9A 4D2IA 1OXXK 3K09C 1KK3A 1T6NA 3TLXA 1VCIA 3A1UA 4CT5A 3THXB 1OIVA 4A0FA 4FCTA 3W34A 4IFBA 3CF6R 4MGZR 4QKQA 5DI9A 1XTIA 5JFGA 4M22A 3RANA 4YMVA 3QKRB 4A4DA 1YQTA 5TY0A 4HATA 3SEAA 1XCPA 5F98A 5CLQA 2CHQA 1KI1A 3EZ9A 4JKYA 4XSGA 3K70B 3FHCB 1XJ0A 2NTYC 3X1ZA 2HYIC 3HPRA 4TYPA 1P72A 5CIWA 4KITB 3M1IA 4J0QA 2JLQA 3DM9B 4U5XA 1GP2A 4UQOA 3W6PA 1GL9B 1EFUA 1W47A 1IQPA 4QJ5A 4YMWA 2ZRDA 5CDFE 1Z28A 2GJ8A 1IONA 4URVR 4PHFA 4RCYA 3BAFA 2EFCB 3QXCA 1ZMXA 4A92A 5LB2A 3CONA 5KHOC 2JLYA 4NKRA 2RGNA 1Z5ZA 2FGJA 4Q47A 1W44A 4R7ZA 2ORVA 2ZYVX 3V9PA 5JWOA 3UG7A 1WDTA 3C41J 3LBIA 2C95A 3QUSA 4OHXA 4MDEA 4CEHB 1E79A 3KQKA 2PCLA 3LFUA 4U00A 1OH8A 1KO4A 4O25A 1Z22A 5TMPA 4LX0A 1TNDA 1U99A 3K8YA 3E70C 3OIUA 2ZROA 1YE8A 5CLLA 2RGNC 1L4UA 4ZKDA 2WKPA 4YXWA 3TW4A 4ITRC 5L3QA 3MWYW 4R98A 4Q01A 3ND9A 1W1WA 1KIMA 1FPMA 2J59A 3L43A 1OFIA 4Q00A 2WSSD 4RZUA 2B7BA 3VHLB 4WXRA 4C0AC 4E5UA 3GJXC 5J4YA 5KDOA 4M4SA 5FOVA 3EZFA 2RGEA 3OEHD 1S1CA 4B73A 2QPTA 2XOKD 1UKVY 1VDZA 2D74A 2ZUCA 3L8YA 3T12A 3U3JA 3GLIA 1PLKA 3C8UA 1Z0AA 3AVOA 5L3SB 4Q9JA 1GM5A 2EFEB 4IJMA 3KB2A 5AJZA 2CDNA 4FN5A 3QIAA 2FN4A 3LVQE 5UKDA 4AYWA 4ZCMA 1OPXA 5FUWA 2IF2A 2Q3FA 3SYLA 1DS6A 4QG7A 1G16A 1Q22A 4WIAA 2RGGA 4AWXA 1DPFA 4NCJA 2ZSAA 3BB1A 2GKSA 3BB4A 2ZAMA 5DI3A 5E7JA 1CJTC 1SZPA 4PQRA 1TQ4A 4PPNA 1UBCA 4ZIRB 2FZLA 2JEOA 4Q9HA 4H1UA 3CUEF 3GJ6A 1TEVA 2YHSA 1N6OA 1DAIA 2CE2X 2ZRNA 4I81A 2OSBA 1B23P 2EW1A 2ZJ8A 3PEYA 3WHLA 4D4JA 2IYZA 1QHXA 5AJXA 5EE1A 1NP6A 1RJ9B 1XRJA 2FU5C 1E1QD 3AKYA 2ODNA 3PEWA 4DSOA 3CWQA 4Z8YA 2CLDX 3CBQA 4HUQB 4X8OA 4DLZA 3P26A 1NJFA 1Y63A 3U7GA 2GCOA 4XWAA 1KJZA 4L15A 4HUTA 1KO1A 5KYKA 3NG1A 1JAIA 4ILEA 3SJAA 5KPJA 2AR7A 3W3ZB 5DYIA 4LHZA 1Q1QA 2IYSA 2WOOA 2XZLA 2A5DA 3TH5A 3SBEA 2I3BA 3O8BA 3RS0A 3BOSA 4URYR 3LQQA 2QUZA 1JR6A 4BZQA 1I2MA 1RRPA 2ZSDA 4NYIR 4L9WA 4L5BA 4ASUD 4DUGD 2IS4A 2Z4SA 4NCNA 2CE7A 1P73A 5EUQB 4DLWA 1IY1A 3PEVA 3W5JA 1P4SA 3DMDA 1G6HA 1ZCBA 3RRZA 4F38A 1ZM9A 4Q4JB 3RABA 2GXSA 4RSGA 2PX0A 3EA5A 5FBVB 2RHMA 4EDHA 1L2TA 2ZTSA 1KZGB 4PX9A 4AD8A 4PSKA 1JEDA 3BIFA 3ADDA 1KMHB 4BEJA 2QE7A 3EZ7A 2RH5A 2D2FA 5KO2A 2NG1A 1TPZA 4HB0A 4OQXA 4TL7A 2OFWA 2A5JA 1K6MA 2VHCA 2F43A 1GTVA 1CRPA 2J0UB 5JRZA 2O0KA 2QEQA 2CVFA 4QHTA 4LBYA 1XZPA 4Q4HA 4BLSA 2YOFA 2X2FA 5E95A 4B3BA 5L3QB 2WJYA 5FH9A 3WYAA 5J4HA 4P4UA 4PC2A 4GOKA 4W5HA 3I62A 1LS1A 4QBIA 2OXRA 2VL7A 4KU4A 3WBJA 1T8TA 1A7JA 1NL3A 2B8WA 4NHOA 1AQUA 2O8DA 1IJFA 1R0YA 2G0TA 5TVKA 3TIFA 3BH7A 2WWIA 2QMHA 4C9BA 1OB5A 1DAMA 1T8UA 4BFZA 2F3RA 3LW7A 1QVAA 2ZR0A 4UJ3A 2I1VB 3CWZA 3CH5A 3DVLA 3ZIAA 1Q0UA 5JECA 2F1IA 2UZ3A 5JS7A 4IVPA 4TLAA 3DZDA 4FMCB 4XH9B 3DOFA 3MD0A 2YWHA 4V03A 4AIIA 4HAXA 4DCSA 1X86B 4B74A 2GJAA 4C3ZA 5JJLA 3AVYA 2XAUA 4PQYA 1E2QA 4OI4A 2XTZA 2ZYUX 4YONB 3AGPA 3EC2A 3F3YA 5AWFC 1G8GA 3GLIE 1IY0A 1S3SA 1CULC 2FEMA 2V9PA 5FOTA 3FWYA 3DZ8A 3NC0C 3UANA 1E9BA 2N46A 4X8MA 3KTAB 5DI3B 1P7CA 4ZDWA 3MSXA 4G5OA 1H65A 3AKDA 1ODFA 3GP8A 4RKFA 2BBWA 4Q02A 4TL9A 2IF0A 2CLSA 2IXEA 4JLPA 4BFSA 2CK3A 3TAUA 4TQUS 5EXSA 3EPKA 4EPWA 2WM9B 1AS3A 1U8YA 2PX3A 2FG5A 2F1RA 2XNSA 1E2PA 2CNWD 2GCOB 2QQ0A 3K0EA 4JBYA 4WBSA 2G0NA 2A5YB 2IEYA 3A4NA 1YHNA 4BE7B 1KSFX 1AJEA 2QI9C 4B3CA 4BUJA 1M8PA 2RAPA 4WZAE 5TV2A 2O8CA 1PJRA 4XSHA 4M9SA 2GVDC 2VHQA 2QORA 3WHKA 2D2EA 4GMDA 1QDEA 3FVQA 4PZZA 1E2FA 2V55B 1R5NA 4RD6A 5J47A 2WV9A 4LV8B 4ESHA 4UJ5A 3CB4A 3N2IA 3VFDA 3Q5EA 1IN7A 2FF7A 4RFSA 4YLGA 1KI4A 1AZSC 4BLOA 1E2NA 5C2JB 2FJUA 4MRPA 2A3RA 2B92A 2RGAA 1AM4D 1JPNA 4JJZA 1XF9A 4URXR 4FIDA 1XTJA 2ZITA 1Q57A 3SR0A 2BM1A 1SXJA 5J4KA 1OV4A 1YKSA 2EU8A 4ARZA 1TUIA 2PL3A 4S35A 2OLKA 1OLOA 4AY2A 1KK0A 5BXQC 4LDJA 1II8A 3LVRE 2O0JA 1S4QA 4DSTA 1ZD9A 2UVQA 3U7HB 2O8FA 4QHYA 1BMFA 2P67A 1D9XA 3SHFA 2OO7A 4WZ6A 4EPRA 3KJIA 4S2EA 4K81B 3EW9A 2C98A 2R62A 4M53A 2IXFA 1R8SA 3HDTA 5EP1A 3DOEA 2V6IA 3GPLA 2H57A 4M1OA 2WKRA 3IO5A 1OH6A 1RC8A 2ATVA 2GA8A 2IEZA 1E0JA 3VHXA 4P4TA 3ZVNA 2K5UA 421PA 3RC8A 2DBYA 3B13B 3W3AA 5B64A 4AKEA 3IGFA 4JT2A 5CM8B 3UIEA 4PAQA 4DDWA 3I73A 3EIHA 5B30A 4LPKA 2Q21A 4A8JA 1U8AA 1FX0B 2WMNB 2R6FA 3UMFA 1UEJA 4LPSA 1Z2AA 2W6ID 2FX3A 1XFAA 3I3SR 1WCV1 2VSXA 1NLYA 4B48A 2ZU0C 4BLRA 3IEVA 3CNNA 5L8VA 1TADA 1XWIA 1M74A 4BZPA 4YQFA 2Q6TA 4HSEA 1E2MA 2B6HA 3IHWA 2XZPA 4BFYA 3IIKA 3PUWA 4AG5A 5K8IA 2ZJ5A 3I4LA 4CF7A 3U7FB 3EASA 5FTMA 1DARA 4A8JC 3GJ5A 1HE8B 2X77A 4EJSA 1OH5A 3OAAA 3B5JA 5BWMA 1OFUX 5DSZA 1P75A 5JS8A 1N6PA 3IIJA 2WJVA 3IBGA 1N6RA 1YZUA 4C7OA 2FOLA 4K8OA 1U0LA 5JSZA 4Q03A 4M0LA 2IWRA 1BYIA 4PPFA 621PA 4RVCA 4B34A 1E4YA 1IHUA 1SGWA 3SFVA 2JJ1D 2OFOA 3KX2A 3FHOA 2OUKA 1ZAKA 1S2MA 1LTQA 1CF4A 2ERYA 4PR0A 5BW8A 4A2PA 4MKFA 4IFEA 1EFCA 2A78A 2MSEB 4TWZA 2FMXA 2HT1A 3W5IA 1XEXA 2Z43A 2FFBA 1Z0DA 2UZIR 3LRPA 1NSTA 3I8XA 4KJZA 1FQJA 3MRSA 3SFZA 5J4VA 2OCPA 4DDTA 2BEKA 3NH6A 2IS1A 4E22A 2OEPA 5IRCD 1F3OA 3JZMA 3HYRA 5FOXA 3AVTA 4Z51A 2F9MA 2O8CB 5E3HA 1XEWY 4OI2A 4GDFA 5KSPA 3AVPA 1G4AE 5C1BA 3S1AB 4RZ2A 2VBCA 4FWIB 1JEEA 5A5GA 4FW9A 2ZI4A 1AK2A 4Q9LA 1HY3A 5HR5A 5F3WB 1EESA 1B0UA 1CJUC 2AXPA 2N42A 1MOZA 3FMIA 4KFTA 2W0SA 1ZC4A 1YR8A 2EVWX 2KB0A 4O0MA 1G8FA 1KI6A 4UXIA 1QF9A 3AF1A 2D7CA 3WMFA 2BCGY 4KLZA 3CF0A 3ASZA 3TMKA 5CB6A 2Z6VA 3CF2A 3REFA 1H8HA 2BJVA 1NJGA 1YVDA 3EG5A 4DCVA 1SXJB 2ZVQX 5FPKA 3I72A 1SHKA 4FMCF 2V1XA 3RRMA 2IBMA 4P3YA 2VP2A 1II8B 1AGPA 2FWRA 3RVBA 4IOJA 3RWOA 4NYIQ 1MABB 4BFWA 3NHAA 2O8FB 1VHTA 3H86A 3WYFA 3WMEA 2Q3HA 2QM7A 2LCFA 3OFNA 2JLRA 1DAEA 1K8RA 1ZIPA 4V0LA 3ETLA 4M1SA 1YZQA 2WICA 4YMTA 1ESNA 1KAOA 3SQXA 3QKSA 3OIWA 2ANBA 4R71A 4IVQA 1VPLA 1NVUQ 3P27A 3GEHA 3QF4A 3MMPA 2C2HA 2R65A 3T1QA 2DCUA 2FSFA 4LC1A 2HJVA 1Z0KA 2JJ8A 2VP6A 3DKPA 4BRUA 3FHTA 1LFDB 1Q3TA 1OXVA 4IRUB 2HXYA 1ONBA 1NMXA 1YU9A 3B1XA 1KHTA 1E9DA 3ASYA 3TKLA 2C9YA 1N25A 5A0FA 4TMVA 3JZAA 1K5DA 1NMZA 3LY5A 3VR4A 3HU2A 4L4UA 1PLJA 5FI0B 4LOAA 3W8NA 1OKKD 2IYXA 4TMKA 1P9WA 1SVMA 2QENA 4LV5B 4DT1B 1Z6AA 3EZ2A 4I1VA 3AVUA 2GK7A 2IYWA 3KL4A 1G64A 4EFMA 2ZJBA 4XD7D 4CEJB 1R8QA 1E69A 1JJVA 3IPYA 1ZM4A 1RE0A 3TGPA 5IF9A 1D2MA 1G9XA 4QOSA 2Z0MA 4EJSB 3DPUA 3AM1A 2FZ4A 3VKHA 2OG2A 3P32A 2N1BA 4ZO4A 2C78A 5JMTA 3QE0A 4NCHA 3VU9B 5D3QA 2ZI3A 3QXSA 1SKYB 2KBFA 1ZUHA 3AF0A 5AJWA 3VTKA 1RRCA 1GRNA 3I8SA 3D8BA 3GJ7A 3VR6A 3K1JA 4KVAA 4LJYA 2KJQA 5SZJA 3B9PA 4QGAA 2O52A 1XD8A 1U0HC 3SC3A 4HAUA 3TUZC 3LV8A 1WF3A 2JLSA 2QNRA 4TTPA 4RY2A 1NN3A 2EFHB 3WMGA 821PA 1SULA 2CJWA 1JI0A 4EKDA 3BFVA 4C0QC 1COWD 1BKDR 2XJ4A 1SKYE 3OEHA 4DCNA 2ZRPA 4JVMA 5HTKA 3NTUA 2XOKA 5BQ5A 3K70C 1Z08A 1ZM2A 4Q21A 1CR0A 1P5ZB 1E32A 2EFGA 4YDHB 3LX5A 1IAQA 4KODA 1NMYA 4LJAA 2DY1A 3CPEA 2WWXA 5AUQA 4YDSA 2QBYB 4A6PA 2CCJA 1LS6A 2ZRGA 4OQLA 4WA7A 3B1VA 1ZU5A 1KDOA 1CXZA 3D31A 1N6HA 5IHPA 5KSOA 3Q72A 2RGCA 5FTNA 2HCJB 1VG0B 3X1XA 1NBMD 1JB1A 1RRFA 1ZJ6A 2H92A 2W2VA 3VQTA 3IILA 1A2KC 2D3WA 2Z5FA 3NEJA 4P0TA 4BASA 5KTYA 3B82A 1IBRA 3K9LA 3GJ8A 3LLUA 4LSGA 2ODEA 5EE9A 4QGHA 4M1TA 5DGXA 4D6PA 4L9SA 4F93B 3DHWC 4Z54A 4D4KA 4RD1A 4HZIA 3JVVA 3UATA 3TNFA 1E1QA 1XPOA 3LBHA 1J90A 1E96A 3TBKA 4OK3A 4LWZA 4Q66C 3FPAA 1RPZA 2IYLD 2GILA 3THWB 5GJCA 3OESA 4G5RA 4JL5A 2Q9BA 3GJ3A 1W36D 2Q0HA 1RRGA 3MGCA 4JLVA 1E2DA 2AWNA 3QVUA 4DB2A 4N0EA 1EFRD 1A1VA 1E2JA 2FGKA 3TRFA 1XDBA 1A82A 3T15A 1T3HA 2YZ2A 1MO6A 1HQYE 1D2NA 1WE2A 1XD2B 5KU1A 1PZNA 1GNPA 3QKSB 1OB2A 3PUYA 3GMTA 1OFHA 3H4MA 1UAAA 2HF8A 4B44A 2C77A 5CIQA 2ZIAA 4KFUA 3AKEA 1GSIA 4PC7A 3BBPA 4OHZA 4C0HA 1US8A 3U44A 1E0KA 4WVFA 2PMDA 4JT4A 4GNKA 5H70A 4ASUA 1G6OA 4DUGA 5K8UA 3B85A 3LWNA 4G5QA 5M04A 1ZVQA 5DISB 4C2TA 4I1UA 1TTTA 3FOZA 4AI6A 4HZUB 3UXMA 4DDUA 4LJ6A 2NO1A 3OE7D 3QPWA 4G1UC 4Q1BA 3TSWA 3SS8A 3L2OB 4F7WA 3VX3A 4PHTA 5JWHA 1ELOA 2QA5A 8OHMA 1QHNA 4II7A 3DL0A 1KSHA 2BIFA 1EX6A 5JJIA 3VNVA 1E9EA 1JQLB 2PMKA 3GQBA 1DG3A 2ZAOA 4HAWA 2QMUA 1SVOA 5FPHA 1LF0A 2FEOA 4EPYA 1ZIOA 1YRAA 2GNOA 2XSZD 3K9GA 1PV4A 2HXSA 3KFVA 4UNNA 1BH2A 2GEUA 3DM5A 4LJ5A 4A2QA 4DLTA 4US2R 2Q9CA 2PEYA 1DAFA 2ZR7A 2P6NA 2QAGB 1FP6A 1KI8A 5G3ZA 3CKLA 2GF0A 4OK5A 5CITA 3KXIA 2GESA 2ECKA 3CO5A 1Z0IA 3HR7A 2AHOA 3B60A 4PHGA 3BFKA 3P20A 5JEEA 2QTVB 1GFIA 1NKSA 1U9IC 5TB5A 3BS4A 2GJKA 4KLNA 4LHVA 3K0AA 1SVSA 3ZZ0A 4B2PA 4RD3A 2G88A 3QENA 3OZXA 4IDNA 1J7KA 3F0TA 1XCGB 4GOJA 1C9KA 3C5HA 1R0WA 3T35A 4KI0A 4LYFA 1OE0A 3UWKA 3K70D 3QI2A 4XIGS 4MITA 2IT1A 2F9LA 3H2YA 2VLIA 3CNOA 3ZGXA 4Q4LA 4JLMA 1FNMA 2ZYTX 4YC7A 1QHGA 2AFHE 1KOFA 5CB8A 3KQUA 1P6XA 3E2IA 3UMRA 2YOGA 4A9AA 1TQDA 1T5LA 2XXAB 2GRJA 4US0R 3GEIA 1VKJA 5AJYA 1E9SA 3T1OA 1E1RA 1J8MF 2VF7A 3BFXA 1R5BA 1XJQA 2X8AA 1W49A 4PC1A 4RZ3A 2QRNA 4DCUA 2JJ2D 1NY5A 3MG9A 3WRYC 1G4UR 1ZINA 3BXZA 3I92A 4JVNA 4LCBA 2IHYA 1G20E 1S8FA 2WSMA 3BGWA 3Q5DA 4IVRA 1VHLA 3TJZA 1ZM7A 1KK2A 4L8GA 2KBEA 1JQJC 1F5NA 4BLPA 2GJ9A 3ICQB 4US1R 1XZQA 4P4SB 1H8ED 4AYTA 3KZ1E 4O2LA 1P2SA 1DVRA 3K0FA 3R7WB 2JA1A 2HT6A 2C03A 1KZ7B 1U8ZA 2CNWA 3C16C 3GFOA 3AVVA 3SYKA 3HR8A 3RSLA 1OIXA 3IHLA 2XNDD 4PZLA 5B2ZA 2QQEA 4BWYA 2OHFA 1FP7A 3B2EA 1XU4A 1G3QA 2HJGA 2J87A 2ZE7A 4JS0A 4Q5IA 4EPTA 4Q19A 4KBGA 3I5XA 2PJRA 1ZNZA 3ZLJA 4TQAA 3GLHA 1JXMA 2OBMA 1LY1A 2H18A 5BN3A 4ZDIA 1XTSA 3EXAA 3RAPR 3ZDQA 4M9ZA 5CK5A 2GAAA 2P3SA 3JVUA 4UXHA 4EPVA 4WXPA 4QGGA 2A9KA 1HUQA 2OILA 4A15A 3SJBA 1XTQA 2BMDA 2QMEA 3TE6A 4XVUA 4O3MA 1E9RA 2BBSA 2ZE6A 2OBLA 5B58C 1XCMA 3RS3A 5G41A 1ZM3A 2WWHA 2J0VA 2PT5A 3A36A 5KDDA 4D0GA 5D3MA 2Q3MA 3VKWA 4MA4A 1IN5A 1FUUA 4GP7A 3L0PA 4CIDA 1Q1BA 4PC3A 2VA8A 4PFSA 4WZBE 5AK0A 4OQNA 4CYMA 3IBYA 2JDID 2RCNA 3PEUA 3TQCA 3P4YA 4NH0A 2TMKA 3LNCA 2GEDA 4BPBA 2Q9AA 3TQFA 2OV2A 2WPDD 2W58A 3A58B 4FD2A 2YYZA 3AP3A 2EFDB 1CR4A 1FMJA 1KNQA 1UFQA 1KI7A 2FE4A 5KNDA 3I5YA 3F5FA 2ZJAA 3OIYA 4XWOA 2OBNA 2RGXA 2ZJYA 2XB2A 1UPTA 5FPYA 4B6FA 3X1WA 1U90A 3RLFA 4MDFA 2OLJA 1TQ2A 3TR5A 5JHHB 5LD2B 1T5IA 1W4RA 3SQWA 1TEXA 1X3SA 3QY0A 1X8LA 2YINC 2FPKA 2IA5A 2ZE5A 2ZRIA 4AYXA 4Q7JB 121PA 5EXTA 2NMVA 3K0CC 2BMJA 3WP1B 5JCPA 4TMZA 3PVSA 3CR8A 2HLDD 2W6IA 5FL3A 2VPPA 4LJ7A 3MJRA 2ANCA 3B1ZA 4DLUA 1NN5A 3IDQA 3NH9A 3W6NA 1NVXQ 3CX6A 2BDTA 2GJSA 3ICEA 3AH8A 4B35A 4UXJA 3T1VA 3O8CA 1ZD1A 1XMVA 1RW4A 3RC3A 2C96A 1D2EA 4B71A 1CJMA 4EIWA 1ANKA 2EYQA 2J46A 3GLIB 2AKAB 3SNHA 3DO6A 3KXKA 1G3IA 4BLTA 1BS1A 1EX7A 1R0XA 2FFAA 2Z4RA 3H1TA 4W9MC 3B1WA 4NDZA 4LJ9A 3PQCA 2OM2A 3L8ZA 5EUMA 1FMLA 2IYTA 2OCYC 4TLCA 4EUNA 1SVLA 1M2OB 2JJ1A 3K0SA 1T4GA 3A4MA 2IC5A 4RZXA 4PAOA 721PA 1WBBA 1QZXA 2ORWA 4BGDA 1TF7A 3EA0A 2OE2A 3EPJA 3TUIC 4BECA 2AL7A 2X1VA 1Z83A 4F4CA 2DB3A 2H7VA 1QRAA 2O8BA 3LH5A 2MSDB 1EFHA 4DRZA 3PFIA 3EWSA 2W6JD 3ONWA 2GZDA 1KO5A 2ZRCA 3CPHA 2JATA 1EFTA 2QTFA 3K53A 3FKSD 1N6IA 2ZVPX 3U61B 3AUXA 2C9CA 5FR1A 2QGNA 1E6CA 4K46A 5H1YA 3RSOA 2F55A 1N5JA 4QXAA 3SI7A 3KJEA 1DTSA 4I99A 3KKNA 3ZS9A 2F6RA 2PEZA 1JR3D 2E1RA 3PR1A 2OAQ1 3R8CA 3GLFA 3KFXA 1SKQA 1VG1A 1Q44A 1OW3B 3FKQA 3GLHE 3PUXA 1OYYA 2ASEA 2ONKA 4ON9A 4RD4A 1J70A 2NO6A 5EP2A 3CRVA 3WNBA 5B57C 1S0UA 1RFLA 4TYQA 2HEIA 3PITA 5LBIA 1HTWA 3U6KA 4D26A 4LY6A 4ZDJA 3GJ4A 5SZIA 3FMFA 3IEUA 3RS4A 4TN1A 2AKYA 1FZQA 4LYAA 5K8LA 5JJKA 1U2RA 3MJHA 1J8YF 3LDAA 4URUR 1W5SA 3HYTA 4GMXA 4OK6A 4QM6A 1G7SA 1QHIA 3KUDA 4HB2A 4KSBA 4UNSA 1F2TA 4AG6A 2YC4C 4D4MA 5IT5A 1D8TA 2GK6A 3U2QA 5IK2D 2XZOA 4HB3A 5EJEA 3SE0A 5JCZA 1TF5A 4BFVA 1KK1A 1S9DA 4C0LA 4JSYA 3VMFA 4WOPA 4ERNA 2BCJQ 1D6JA 3OHMA 4QHSA 1FW6A 2C5LA 4F4IA 3HU1A 3CLVA 1VIAA 3TK1A 3LD9A 3CRQA 2C8VA 2ZI6A 2F43B 4TQ9A 3ZH9B 1HV8A 3T06B 1QG2A 3U4QA 1O87A 4DXAA 4D0NA 1DEKA 1YZLA 1LF5A 4QNRA 2R6CA 2J1LA 4F91B 2WWFA 1E0SA 1HE1C 4Q1EA 3U5ZB 2ZRHA 1G1MA 4Q4HB 1WMSA 3QBTA 2GBLC 2NPIA 2VF8A 2IHBA 1Z2CA 4PQFA 1Q12A 1OKKA 3TUJC 4Z1MD 3EWAA 2OCBA 3SZRA 2DPXA 2O8DB 2YWGA 4JLAA 2ATXA 2WTUA 2ZXUA 3RS7A 3VR2A 1E3MA 4A82A 2GVZC 2ZSEA 4NONA 4KSCA 1R0ZA 1NVVQ 2J7KA 2REXB 2R6DA 1XNJA 4KBFA 5HKKD 2ZS8A 2ZI5A 3FFAA 1GKYA 1GG2A 1BO6A 1BYUA 4QJ3A 3NDBB 3KDSE 4B75A 3EIEA 4JMPA 2BOVA 4H9GA 1Z47A 5DYGA 4FCVA 4R9UC 5TDHA 1FNNA 3ZS8A 3X2SA 4URWR 1L4YA 3QF7A 3TAHA 3OEED 1X8KA 4TYWA 1KO8A 1GAJA 1L7VC 5GJWC 1NY6A 5EE5B 4HDCA 1AIPA 4KHZA 4N3NA 5FPTA 2O8BB 1COWA 3A1VA 4AKGA 2XGJA 1KDPA 5DO9A 1M7GA 2FA9A 1W48A 5C18A 2HUPA 1U94A 2F1JA 3Q7QA 1TU3A 4M9XA 5JLJA 5KNCA 4IDHA 1KJYA 1IXRC 1N6NA 2AX4A 4JJKA 4P32A 1GL6A 4A6XA 2JLWA 4XVQA 2NZ8A 1U98A 1W0KD 1CP2A 2C04A 2IW3A 2V4ZA 3M6AA 5CYPA 1NBMA 4M2LA 1WB9A 2V3CC 4LBZA 4F4JA 2ZEJA 3DKVA 4RFVA 5JBQA 4JLBA 4TSFD 2J0SA 3KB1A 3QEOA 3TR0A 5EXXA 5H8WA 3P1JA 4KAXA 1M1YE 5DH9A 4HAYA 4WAUA 3ND8A 1N2CE 5AJVB 1G17A 3HPQA 3QG5A 4W5JA 3L0SA 5FOUA 2OAP1 2WKQA 3AUYA 5FFMA 3RNLA 4JVLA 5LB4A 1VYUA 1YR9A 4RD0A 4RFSB 4D4LA 3I32A 1FFHA 2DWQA 4JYBA 2CL0X 1CS4C 4ZI3A 1E2IA 3B6EA 2PT7A 3GLFE 2JAQA 2QPAA 1AQYA 1UM8A 3ZD7A 1E9AA 4G0NA 4BFUA 4C0BA 1Y3AA 1EFRA 3WRXC 1HYQA 2OT3B 1P9NA 5TXGA 4ARZB 5E7IA 1XEWX 2Y8EA 2DR3A 4B47A 4ACBA 2ZSBA 4NU0A 3KKQA 5DN6D 4UKDA 5JHGB 1S9HA 1N3BA 4IOLA 1AA9A 5KSZA 3B9QA 3J81k 3D3QA 3A1SA 4B3FX 1W36C 1XXHA 2R2AA 2NGRA 1MH1A 2OFXA 4GZMA 1S1MA 1F2UA 5SZKB 2BC9A 3U7EB 1GKUB 1Z0JA 4E09A 3BORA 3THYA 2VHTA 1WQ1R 4U02A 2AK2A 3BB3A 1M7HA 1VYTA 3VKGA 4YMSA 2O5VA 3RHFA 4CRWB 3FGNA 3OE7A 4DZZA 1AS0A 4OL0A 4UNPA 3U3KA 1BOFA 1NVWQ 1UBFA 1VG8A 3RS2A 1Z0FA 3UKDA 1SXJD 1VECA 1LB1B 4HYYA 1ZU4A 3AP1A 4A8JB 4DKXA 1W2HA 2ZI9A 3HJNA 1ZBDA 2XSZA 3KKPA 3QXHA 1R5OA 5FUYA 4EQ6A 1CR2A 5EP4A 5DNYB 2DFKB 4TMWA 4YMUA 4B6EA 4LYJA 1OT3A 1BMFD 1ZYUA 1VG9B 3O8DA 1VCMA 4DLYA 4TT3D 4JLJA 3ADKA 1I2DA 4BRWA 4FWTA 4C0SA 2JLVA 2CHVA 3PUZA 5GVRA 5FUVA 3THXA 2REOA 1P62B 2W2TA 3U3MA 3EARA 1G3RA 2WIAA 4PANA 4EPXA 4HLUA 4OHYA 1X1RA 2V54A 4C7OB 1E0AA 1R6BX 3QKRA 3CM0A 1FTSA 2A5GA 2CL7X 4RKEA 5JSZB 4MKIA 3HU3A 4QNMA 4AKIA 5FTKA 3EIQA 1VMAA 2D7DA 5HZHA 2PH1A 2AWOA 5FBWB 3GLGA 4MYCA 1A5TA 2PCJA 5KUTA 5H68A 5A4JA 4NMMA 4B2IA 4Q7KA 3OF5A 2YWFA 1VTKA 4GT1A 2IWHA 3ZVRA 5AUOB 4HLUC 1PLLA 1XEXB 2WSSA 2FFHA 2RGDA 2FFQA 3AV0B 3H84A 2ONJA 3V00A 4JBXA 5BN4A 1IXSB 1KKLA 4G3XA 5F9HA 2WZQA 5FBQB 4HI0E 1C1YA 1GILA 2BKEA 2IS2A 3B7GA 1W4CA 4OQMA 1RYFA 2JJ2A 1I4LD 3OAAD 4CEHA 4DEYA 2NQ2C 2BMEA 2IYYA 3A8TA 3NBFA 1NIPA 2QAGC 5FBLB 1NBME 4DLSA 4MYHA 4TLDA 1KY2A 1NF3A 4Q1FA 3THOA 1N6LA 4MRSA 3WBKA 1QHYA 3X1YA 1P2VA 2ZJ2A 1HT1E 1KI6B 2BM0A 4LBWA 2V7QD 2ZANA 4XTRA 4CVNA 2XNDA 1KSJA 2DFNA 4IOKA 2G9NA 3PV0A 1MV5A 2JGNA 3QOFA 1E9FA 2VTKA 4TMXA 4C30A 2P5SA 4XJXA 2ZRKA 2ERXA 1N0VC 1GNQA 1Z6GA 2VSOA 2ZRAA 1Z6TA 3TVDA 4PHHA 3TW8B 3WNDA 2QROA 3AP2A 4A0GA 4R2HA 5L3SA 2DWOA 4NZYA 2XX3A 4Y0VA 2BV3A 4PAMA 2NPFA 2DHRA 5F9FA 3IO3A 4P33A 1R2QA 1F6BA 2J7PD 3MWKA 4OHVA 1E94E 4QJ4A 1NLFA 1F2UB 2FSHA 3MAAC 4MRVA 4LUCA 4OKSA 4TTRA 4Q9KA 4X8LA 3PXGA 2XTNA 1ZRHA 3UMSA 2ZS9A 2JIZD 3QF4B 1DBSA 4ZIRA 4M1WA 3IQWA 1XXHE 4DEXA 2MSCB 2DYKA 5ANRB 2A5FA 1AKEA 1GITA 2VP9A 2LWIA 2JDIA 4X8HA 5HE8A 2AD5A 2QSYA 3G82C 4A0RA 4TLBA 3FDIA 3VR1A 1UADA 1ZC3A 4B3DA 4DSUA 1XP8A 4JL6A 1CU1A 3W6OA 2J5XA 1RJ9A 2WPDA 1XX6A 4NL4H 4Y0AA 2ZE8A 4HUQA 1ZNYA 4O2RA 2QU8A 4IOMA 4DHEA 3KJHA 1AS2A 3CX7A 3VR3A 1KTVA 2FSGA 4HDOB 4CEIA 1DELA 3UK6A 4B33A 2IYQA 1I4TD 2CHGA 1WRBA 4HAZA 3I61A 1AKYA 1G7TA 4OI1A 1U9IA 4ESVA 3FB4A 1E2EA 2ZJZA 4GFDA 4JL8A 4BFXA 2VHJA 4HLQB 2HCBA 2HF9A 1S3GA 2ZUDA 3EAQA 3SU8A 3FE2A 3IPXA 2LKCA 3DEFA 3QSYA 3N5CA 1U81A 4RCZA 1CTQA 1QHHA 2HLDA 5CM9C 4BEBA 2V6JA 4DLRA 5FOSA 4ZCLA 5C4MA 5KNBA 3GLGB 5JRJA 4BFTA 3CR7A 4JSTA 2FV8A 4TMTA 4NE2A 1NVVR 3IKJA 4EAQA 4P31A 4PPQA 4NYMQ 3A4LA 3GFPA 4Q4JA 2GF9A 2CJWB 1FTNA 5DE3A 4NCKA 2QAJA 3GD7A 2ZUBA 1W0JD 2BWJA 5KSYA 1N0UA 4V0OA 2P0EA 2B7CA 3BH6A 1P61B 2DWPA 1IN8A 4TYNA 1D5CA 1G7RA 2ZJOA 2I1QA 3QPUA 3GLGE 221PA 4Q48A 2ZI7A 3NBXX 3NVAA 2GZHA 1KMHA 2PLFA 4QGFA 1NNEA 4B76A 4QL3A 5AR1A 4G5SA 2NO7A 3NC1C 1CJKC 3CNLA 6Q21A 1M6NA 2H8KA 5SZHB 2YV5A 2J0UA 2YWEA 1PUJA 2VQSA 4IDQA 4L16A 4ZCIA 4C4PA 2FPLA 2QM8A 3EZ6A 2QMOA 5JI2E 5TARA 4MYUA 2P6RA 1SVIA 1ZNXA 3Q3JB 2CL6X 1WXQA 2ZRFA 1E98A 3D7MA 4TL6A 1CJVC 5LD2C 4CDGA 1CLUA 3ZQJA 1IN6A 2W6JA 2FDCA 3FMPB 4D82A 2NIPA 3FKSA 3MWLA 2CMKA 1HURA 2WWYA 2J0QA 3SJCA 2GAOA 2V8OA 3W9YA 1OHHD 4HLCA 4M1YA 1W2GA 3LAWA 5FL7D 1MO3A 1ZP6A 4AK9A 1T9HA 3L0IB 3KQLA 1AN0A 1NRJB 3A37A 1UJ2A 1OFTA 2G1KA 3M4YA 4DB4A 4PTLA 3CZPA 1ESMA 2HV8A 4QFMA 1BIFA 1CBUA 4OHWA 1JR3A 4U7DA 1UBGA 1GRQA 2OCAA 2L0XA 2GETA 4LHYA 3R9IA 1DAGA 4GL2A 1NKTA 2XTMA 2FSIA 2O0HA 3WNCA 3KXLA 1E2KA 3KQNA 3SHWA 2ODWA 5EE3A 1DE0A 1OXTA 3KTAA 3L0OA 4KFSA 1E99A 2GWHA 1G5PA 1OSNA 3FYHA 4POAA 3VR5A 4LHXA 4QM7A 3U44B 1YZKA 1US8B 2QSZA 4F92B 1YZTA 3NIBA 3FMOB 4MQBA 3QVVA 4IKEA 4PC6A 3ZVLA 4WW0A 1Z29A 4HAVA 1D9ZA 3U3OA 1GVNB 1CKEA 3CW2A 4PXAA 1HQCA 3PCRB 4EFNA 1NG1A 4GSYA 2V1UA 1VCOA 4DVGA 2GCPA 1XB2A 2EQBA 5IK2A 3EC1A 2GDJA 3RYTC 3Q7PA 1II9A 1FQKA 1G19A 1LNZA 4OJQA 5EXPA 2VP5A 1LV7A 4CEIB 3LA6A 3ZZTA 4PO9A 1ZUIA 4TTQA 5FTJA 5BN5A 1JNYA 1T3SA 2QT0A 1I4DD 2P6UA 3CRMA 1TX4B 4RD2A 5L3RA 3RDPA 2H17A 1YJ5A 521PA 4DIEA 4DSNA 1KI3A 3E1SA 3K0CA 3NHBA 4W5WA 5CK4A 1C4OA 4AURA 4LHWA 2B8TA 1L8QA 1TF2A 4AC9A 3RS5A 2VRWA 4JLKA 1QHHB 3MWJA 3WXMA 3M0EA 3W8RA 3LXRA 1YRBA 3K0AB 4Z1MA 2H1LA 4DLXA 4XOIA 3LLMA 1JECA 2BHRA
chains in the Genus database with same CATH superfamily
3A04A 5E7MA 3EK2A 1NLZA 4P7FA 3ROZA 3PUVA 1ZISA 1KOGA 2CMHA 3KWFA 4QNNA 1K9VF 1PS8A 3K16A 3NDPA 4IDPA 4MDHA 4RMGA 2B21A 1XMQB 4ZGBA 4XWKA 3VXKA 2LBPA 4Q1AA 3TLZA 4CT4B 2ETVA 4GS5A 4M89A 2PKRA 5C7LO 4B7ZA 4EUFA 1EQAA 1HDIA 5AVOA 1P9RA 2ZKIA 1UCFA 1EVJA 5K3SA 2O5RA 4IJUA 4KDCA 3A0UA 3W05A 3RHTA 2HWKA 3I12A 2N3ZA 2NO0A 4Z0TA 3CUKA 2CXRA 1ND5A 3OEEA 3DO8A 1CZHA 2HWWA 1V6AA 5E9QA 4LYYA 1XPRA 1J99A 3BQ9A 1MX5A 4NV1A 5D3KA 1H3EA 3FLEA 3I2IA 4KZKA 1ZX1A 4KAJA 3V97A 1E79D 1RJEA 2ZJ1A 3AW9A 4UCWA 3ETHA 1FUKA 1GY8A 2HSZA 4MGHA 5AO9A 4YR9A 3HZHA 1D1SA 3BUSA 2DJIA 1EAMA 3CQ9A 1RPJA 1DDIA 3LNTA 3AVWA 1REQB 5DHFA 4V0MA 4J75A 1JR4A 3ZK9A 2ZYSA 5ERYA 1JEYB 2ZR9A 1OTHA 4JLDA 1XNGA 3K1AA 3WY9A 1VRWA 4EF5A 1CVIA 1R0BA 4J2HA 3VJKA 1DFIA 2DFLA 1WCIA 1P2GA 3PYXA 1IN4A 3U9SA 1Y7IA 3NV7A 4EB3A 4OYHA 4TSFA 5FPSA 4QPJC 3PC8A 1TMKA 1FTYA 1BWPA 5K4AA 3PD1A 3T7RA 1D8AA 1XLUA 3WIOA 3GH3A 5TPZD 1XA4A 3H8VA 2E82A 2HA5A 3AB3A 1GRRA 3GLHB 4Q9IA 1CEEA 4ZN6A 1QLJA 2WG0A 1TLLA 3FYDA 2W6QA 1M0EA 1SQ5A 3E58A 5TQJA 2R1VA 3RUHA 5K3EA 2Q1WA 3UWOA 4E88A 3DB2A 5MN6A 4NESA 1UL1X 4X6LA 4RJLA 3ZXIA 1GLVA 3WGYA 1J20A 2ZZNA 3NOVA 4OX9Y 1IZ7A 4LGYA 5HZKA 4Q3AA 3AEQB 2HA7A 4AKGA 1F17A 1JXOA 1BHSA 3ZWPA 3CT4A 1C1DA 5FJIA 3R6GA 2H1CA 3HL0A 4E32A 1NJ8A 2QVXX 1VPWA 3BJIC 4W8OA 5D3MB 3HBMA 5DFAA 3ZY3A 2XB9A 4BU0A 4L95C 5H9WA 5HCNA 4IG4A 3F1KA 5IP5A 3TXXA 3M6MD 1F8UA 4ERXA 1IOZA 4UNQA 1G21E 2CWDA 5T4FA 4KDEA 5HM6A 1ONPA 1M34E 4MWGA 1YNSA 3GROA 3SC4A 3N2GA 5DN6A 1N2ZA 3T5GA 2HMYB 5IPFA 4WRRA 4LJ4A 2KSQA 1SCNE 4I1RA 5HP4A 1AGRA 2PL1A 3JD1A 1V6SA 3R20A 4M9QA 3BC1A 1OV6A 2RJ3A 1A8SA 3HP1A 2QL7A 3V8VA 1XA3A 4E03A 4QLBA 4M0DA 4NENA 3L8MA 2R00C 3OQNA 4E33A 1S8AA 3UKOA 2I6QA 1V7PC 1UMCA 3PQ6A 3V7UA 2AXNA 3DA8A 4L4XA 3ZHOA 2XJ9A 4QFDA 2X3FA 3AI1A 4UDYX 3EGVA 4W9NA 1R9NA 4YMHA 3K9NA 4TMFA 3CHYA 4EL0A 5T5QA 1RWWA 4ND2A 4UHDA 2ZYAA 2XD9A 1RBZA 4FI3C 2EZ9A 4JLOA 1Z8NA 3V42A 5I7UA 4C0JA 3GUZA 3FLMA 2DBRA 1OWPA 3S2ZA 2DECA 2QDXA 3EXFA 2OK7A 2PX5A 2ZUUA 1Y4UA 3LF2A 4HPXB 3FNGA 4NCAA 2XMRA 3ZN2A 5LSAA 5GMOA 1YBFA 4HTFA 2ESRA 4BN5A 5BNZA 3L8EA 4TWRA 1XTPA 2CN1A 4QQKA 3DMRA 3K8ZA 2PXAA 5ADVA 5JD6A 3BMNB 1JZQA 1FP4B 4F60A 5KHOC 1U8CB 3BWYA 2RJOA 3BSFA 1UKEA 4HXYA 1UDWA 3TMYA 4MVCA 3NHZA 5A7GA 4IM7A 1RTKA 4HD8A 3IR6A 4X0EA 4TT3A 1RJGA 4KIUA 5TX7A 3BK2A 2JLBA 2QSJA 3U1TA 3WZMA 4X41A 3G0HA 2WQZA 2PQ0A 2WWGA 4WXHA 4EYSA 4ZV4A 2W2MA 4PLTA 2R6AA 2FUG6 2W83A 3C8ZA 4D80A 1QK5A 4GP6A 1KPGA 2XNJA 1EKXA 1UBEA 1WD5A 4MCIA 4YRCA 4NFYA 1XTKA 4HMQA 3FN4A 2GZAA 1FS4A 3R7FA 1OWOA 1P0PA 3PGMA 3QOWA 3TSCA 4QOGA 3H0KA 4U4AA 3UK7A 5C7OO 1GZSA 2OPBA 2FMUA 2XUZA 3DFZA 5LOVF 4NYMR 4DABA 5C1PA 2BFCB 2B82A 4DA8A 2GXUA 4F9EA 1OLUB 5B6IA 2FUEA 4A7PA 3JYQA 4WY2A 2QP4A 2JHCA 4LK2A 4EG4A 5FD8A 3G79A 1SKUA 1QYRA 2QLTA 1TM5E 1R8XA 3OT1A 4NIMA 4L5JA 3TTXA 3IP5A 4D9CA 5U9CA 2PA3A 1UOQA 2W90A 3NTVA 5LCXA 3R0VA 4RV9A 1JG7A 2G1UA 3W90A 2BMFA 1BXRB 4NSNA 2NT4A 4H15A 2G76A 2R6GA 1IN1A 3QFFA 1OH7A 3LL7A 4A36A 4C2UA 1K7FB 1SQ6A 2C9OA 4DT1A 2I4IA 3WKCA 4DRXB 5CRIA 4C21A 3HDVA 4CEJA 3TPCA 2DPGA 1LXCA 1CEQA 1G291 2J67A 3BM5A 4UVIA 3ADCA 3L6BA 2H2AA 2AF3C 1UIRA 1E1CA 4FNMA 4K3UA 1V45E 5HGXA 1DAHA 4TVKA 1ZKDA 2SHKA 2VCEA 2QRVB 4UUBA 2AOUB 1U0OC 4O02B 5CH5A 1RM5A 2ZAGA 3DMNA 4JROA 1AQLA 4KVGA 3BG5A 2E9SA 3VU9A 5BO5A 4Y67A 1W5TA 4ACAA 2CEKA 3Q85A 1G60A 1TMYA 3HJHA 4AZ3B 1I94B 5D6OA 1YR6A 1L5WA 2M1XA 3GLFB 4M86A 1THTA 1XROA 2G3YA 1ZD5A 4YRAA 2V7QA 1TPYA 3ESRA 1KY3A 4M7WA 2BHTA 4ZDKA 2QT1A 4MQLA 4O5OA 3ZZUA 2C3YA 2R4QA 1G0OA 4MWEA 1ECFA 3WICA 1DG1G 1TD1A 1QMGA 3HL4A 3I2HA 4U0KA 4CCYB 4KX5A 1PEDA 4NCXA 1Z75A 5ALEA 2H51A 2Q50A 4NCIA 4RYDA 3NORA 3TZQA 1C2YA 2ZBVA 4YAKA 1QVZA 1IEXA 1AZWA 1WSBA 3WK6A 4CUJA 3BIWA 1W4BA 2VHUA 3WLHA 1AN9A 1N1GA 3O73A 4PSAA 3VMMA 3R9XA 5LMZA 1W8DA 2PWPA 4UM8B 4ABTA 1AZTA 1F2TB 1VYVA 4IIJA 3R5SA 3RQIA 1X7HA 4GRAA 2R9VA 4XWTA 2FW8A 4IZOA 5DXAA 4EHLA 3OLYA 5HG0A 5IVIA 1ZGGA 1ULTA 1X7DA 2PRJA 4FMBB 4YAWA 3S2UA 4CLXA 4XWWA 3A9RA 4OJKA 4B80A 5AKEA 4CPDA 1H1LA 2V7XA 3ISTA 4EEZA 1U7HA 3FUWA 3HCAA 3VYWA 1U02A 3N70A 1USVA 4NU6A 2DU8A 3TLYA 1G8PA 3O7MA 3UUFA 2EZ4A 4KO4S 4LV6A 4MGIR 1QGYA 3C3CA 4I50A 4PSDA 4B32A 3EY4A 2P8SA 1WW8A 3TQRA 1ULHA 2PGXA 4ALNA 3R23A 5JALA 1UDCA 7ABPA 5JI3E 1B26A 3EIOA 1RKUA 2VSNA 3CKMA 5E0OA 2QTBA 3T3HA 3F90A 3D8RA 3DSRA 1FYWA 2VP4A 1KYIA 2VIIA 2QZSA 4NJMB 8GPBA 2FPOA 3RV3A 5FNZA 1T2AA 2H16A 5B1DA 3THWA 5EIOA 1JALA 2XUJA 3G1TA 3I1FA 2QYHA 1NN0A 1AK1A 2VTDA 2GD6A 5LXTA 3WZLA 4KO8A 2GVNA 1DOAA 1UQTA 2DE0X 1JA1A 3OLVA 3HGTA 1QQ5A 3K4PA 4EG0A 2Q3EA 3TDNA 4RTOA 4QBHA 2OHVA 4YRKA 1CP3A 2GM9A 3MFYA 3T34A 3D4NA 1YZYA 4D0SA 4JAVC 5JCJD 4Z4QA 2A1UA 1UEIA 4RF2A 3DP7A 2YC2C 4OIMA 3N8GA 2WQ6A 2CCGA 3C6YA 4FXPA 4L8YA 2H1RA 4BOYA 1GKLA 4RKQA 2ILTA 2E4XA 3RBXA 5DM60 4GLFA 5B4TA 1MO4A 3R7AA 4FHCA 3I1JA 4FR0A 2CWWA 4RXTA 5LKAA 4GOLD 3L0BA 3SYNA 3OHSX 4MWDA 4F1WA 5IT0A 2M6KA 2CXQA 1WLSA 5HJ5A 4LMAA 1VI6A 3L1JA 5IEBA 3WRWA 2IK8A 1CUVA 1MRNA 1S96A 5DIFA 4YPOA 2PSSA 1JTEA 5EEGA 3K0HA 4XIYA 2PWBA 3K0BA 3NAQA 1GWNA 1PGPA 3MINA 2WWRA 3DTTA 2IDZA 3ZJ5A 4QDTA 1MJHA 4RIGA 1N6KA 4LZJA 4UU1A 3DEJA 1WX1A 4C0AC 1E7SA 3QPVA 2B9VA 1JL3A 1KO7A 1RZ3A 2VOEA 4FDTA 4QDUA 3QXXA 4F2HA 2A2ZA 2P9HA 2NX2A 3KJXA 5DGHA 4R40A 3D6TB 4TYYA 1EEXB 3KAJA 4JGGA 2FG6C 3BWDD 3GPBA 2R60A 3HCCA 2DQYA 1MZPA 3ILHA 3L8FA 4BO2A 1GQQA 3SNKA 2P4UA 3RWMB 2AEFA 3OZRA 1EG7A 4DKJA 2QPLA 2VT2A 1A4RA 3T4UA 2QVCA 1P0IA 3MS7A 4KCGA 3E3MA 4PLHA 4TRJA 4ZO6A 1TQ6A 1PW5A 4IXNA 1HYGA 5C1DA 1SR8A 2PV0A 3R7SA 1B00A 4KXYA 2B78A 3A1WA 4LF8B 1MQ9A 3RR2A 4DCGA 1DCKA 1MKYA 3A6FA 2H5EA 1CJCA 1J97A 1G66A 2UYQA 4H4CA 1G98A 4IEEA 3T4XA 2D54A 5IWAB 4ZPXA 3GVPA 5FL7A 1OIWA 5MDHA 1Z3IX 2DFTA 4YJFB 3WKEA 5CBPB 2ARKA 2YVUA 1MAAA 3UXHA 3QVLA 4B7CA 1P18A 1PJQA 3PXCX 3WGGA 5LP6B 4AUNA 4Y6PA 1KJJA 4IXMA 2XT6A 3W4KA 2ZS7A 1Q14A 2BBTA 2R7LA 2WIBA 4GBMA 1PUIA 5K0ZA 2QP3A 4OGGA 1EVZA 4EEXA 3UHPA 4TXHA 2H5LA 1IPHA 1M1UA 1P7YA 2GH1A 2PX8A 3AR5A 1JHQA 1HQKA 3EXHC 4KLAA 1M1ZA 1FFYA 3EPPA 3GCWA 3B6JA 2HW8A 2JFOA 2VJPA 1EU1A 4RA6A 3CFYA 5EQTA 1XZGA 4RNCA 5JAQA 1ATIA 1JHPA 3BWMA 1A8HA 5KNLA 1T0JB 4P7JA 5T6BA 4IYRA 1WD7A 2WWWA 2NZVG 2ZB3A 3H4TA 4Q1DA 2ZSIA 1JLLA 3WZ2A 2C5HA 1OILA 4JLNA 4NVRA 1M6VA 5IYZB 3B7PA 4P4SA 3O6VA 4Y6SA 1I7QB 5C53B 4C89A 3R7BA 1AZLA 1OLSA 3NHJA 1BZYA 1GG9A 3ENWA 1GCUA 3H6KA 1OA1A 3PRHA 5ICFA 3MIZA 3LW8A 5BYKA 4NTZA 5F78A 1MO5A 2ZYIA 4LRXA 1UINA 2LD4A 4MO9A 5DHSA 1PK9A 2H9YA 2WAXA 4YJ2A 2HDNB 3OIVA 5GVSA 1C0LA 4IO0A 4O2AB 3VPAA 2WYVA 3NFRA 4OH7A 4HRYA 2H52A 3D59A 1HH4A 3BERA 4D0LB 1B3RA 2NO9A 1KEPA 3AUUA 1C9JA 5DHPA 5GGYA 1Z39A 4LYHA 2ZRJA 5FV4A 1XPUA 3L7DA 5F2EA 1I7SB 5AVZA 4V02A 4EQ6B 4YA6A 2HMWA 3ZQ6A 1ZZGA 1SVKA 1TDJA 2BTOA 2XUFA 1KQGA 3GCGA 4F5WA 4YUYA 2PVSA 2VXBA 5HQ3A 1YQEA 4TGLA 3KQQA 3H5LA 3M4XA 4MRAA 9ABPA 1EXMA 1H1TA 3O0DA 1D1TA 1I32A 1YJBA 3L7YA 4HMPA 3RYHB 1Q74A 3IAS1 4GBJA 1VL2A 2LE0A 3P94A 1KK3A 1YL6A 4TS9A 4UVEA 5JSHA 3EQ6A 1OIVA 4FCTA 4H7DA 3W34A 1FQWA 3MSCA 5ALNA 1B6SA 5JFGA 1N5OX 3QKRB 1T24A 4BCCA 5C8DA 1JAXA 3N9IA 2X58A 4ZJYA 5F98A 4WK4B 4XSGA 5T8KA 4IIEA 1T1GA 2XCUA 3MBIA 3RFTA 4JR1A 1RPAA 4L5IA 5BSWA 2NTYC 4L78A 2O6LA 3RVOA 3KQOA 3U7QB 2QW0X 1JGTA 2GD1O 4TYPA 1P72A 2H4ZA 3GLSA 3DLAA 3JPYA 3CLHA 4J0QA 1GCIA 2JLQA 2JKVA 3LUJA 4U5XA 5E6RA 1P77A 3W6PA 3W5SA 2WNHA 1W47A 3MS2A 5DM4A 4U6NA 4PHFA 2W6ZA 3LRTA 1PT5A 4KEAA 4WN3A 3TD6A 1R37A 2UXCB 3DGEC 2JLYA 5C81A 4TLMB 4ND8A 4ZWNA 3F9IA 1EP9A 2RGNA 4NKRA 4LYEA 1CQIA 1DKNA 1W44A 4QLOA 2ORVA 4MA0A 5B7NA 5AVYA 3V9PA 1W87A 3I58A 1WDTA 3LBIA 3OZSA 1JKMA 3QUSA 1KVRA 3L6CA 4L73A 1SUDA 2IEAA 4L74A 1N9ZA 1D09A 2G09A 1EVQA 2PCLA 3GJRA 3HVHA 4E7OA 3LFUA 5I3ZA 3BSSA 4U00A 4MV5A 2I76A 2V5VA 1OH8A 2YFYA 2H6EA 3KLNA 3JX9A 4O25A 1P1IA 1U99A 4LX0A 5I7EA 3OIUA 4EG7A 1K6IA 1W85B 4J90A 4EI7A 1V8ZA 1R27A 5AKKA 2VOJA 1EJBA 1G6KA 3O8OB 4PYKA 4ITRC 1NUUA 4QU8A 3WNZA 4CQMA 1PDVA 4CU2A 3N2KB 4JXJA 4Q01A 3JWHA 4FFRA 2JD2A 3OZUA 4ZVLA 3RIMA 4GMFA 2WD8A 2C92A 4E2YA 4Z86A 1O4VA 1NJ2A 3ROQA 1QGED 3OM9A 3ED1A 4FFBB 5JNRA 1AHHA 5A6VA 5KOJA 4M4SA 1YBAA 3EZFA 4WXEA 4J1TC 1AV6A 3PA8A 1S1CA 1SMKA 2DFPA 3FPLA 3B6IA 4WKPA 1UKVY 4TMYA 2ZUCA 3USCS 5KZMB 1N32B 3T12A 3JD2A 1B74A 5TQVA 2DUNA 2BM8A 1PLKA 3C8UA 1Z0AA 4L0CA 1NVFA 4LNUB 4BNIA 2XR1A 1GM5A 2J48A 1TKAA 2VH2A 1D5WA 4JJ6A 4TQGA 1U2QA 1JJBA 1FTGA 1WHTA 2HO5A 2WU4A 3GCZA 5AJZA 1KFEB 2HCRA 5HUJA 1EP2B 4CGYA 1G5HA 4P0QB 3FG9A 2FN4A 4AYWA 1XPJA 2O06A 1AB5A 1OPXA 1XYVA 2PZ8A 3DAOA 4OJNA 4PLYA 4XB6B 2UUOA 4D9IA 1ZN9A 1UOPA 5FYDA 1YKGA 2RGGA 2XNKA 1U7TA 3G7UA 1VE9A 1DPFA 4HQOA 1R18A 4PF1A 1GV1A 4PIVA 5ILQA 5KX5F 3BB4A 3TRJA 1L1EA 1YI0A 5DRTA 3OT5A 1CJTC 5JBIA 4O4LA 2WAMA 3HP7A 4FX2A 4PPNA 4L51A 4ZIRB 1EINA 4Q9HA 1OCEA 3CUEF 3I8OA 1DAIA 2ZRNA 4I81A 4IIDA 1B23P 1FDWA 5ALDA 1WXHA 1MC5A 2AE1A 2EW1A 2ZJ8A 3KJFA 4IIGA 3DZFA 2IEBA 1JSCA 2IYZA 1QHXA 2XF2A 4NRDA 4XFDA 4D4JA 1L3BA 1NP6A 2NSLA 2ODNA 2GS9A 1V41E 1YNOA 3CA8A 3CWQA 4HUQB 4OQ4A 3PDCA 3P26A 1K8YB 4QO7A 3FIUA 2FR8A 4E1BA 4ES6A 4ARUA 4JBNA 4LFCB 1DIGA 1Y8ZA 1H2XA 1KO1A 3QFCA 4OXIA 5EFZA 5MGBA 3ICVA 3UAYA 1STOA 5D5HA 3GFGA 4EG1A 3W3ZB 1N33B 4ZEWA 4JXZA 3DAGA 3G49A 3IVGA 4LRYA 2VT3A 4DYVA 4F4FA 2A5DA 4OB7A 5CNMA 3SK0A 4F5DA 3QXGA 4HH3C 4CLDA 5KC9A 1HETA 3O8BA 4JUCA 2I6XA 2P0YA 3BOSA 4LXGA 3JALA 3FNEA 2J09A 3LQQA 3PHCA 4AJ1A 2R8OA 1PJ3A 2MYNA 2VSYA 1X94A 1IFXA 2ZSDA 3OPYI 4NYIR 1CPYA 1I6LA 2YXNA 1PD0A 4P08A 5KWJA 1YIAA 3RK4A 3IURA 3O03A 4ASUD 2Q5EA 4G25A 1XVIA 1RXSA 5ALPA 2CE7A 3I01M 4CQLB 3F74A 1L8OA 1SUCA 4CMEC 3TXYA 1U5BB 3PEVA 3V7WA 5IYZA 1L5RA 2HGSA 2D0DA 5F3RA 1AUPA 1BHO1 2YV2A 3DMDA 3JSXA 1G6HA 1ZCBA 3KSDO 5M5BA 4D9EA 1DWPA 1NWCA 3FROA 4LE0A 4F0JA 4PIPA 3GGSA 3PNBA 2YV1A 2XQFA 3JYOA 1NQOA 4ZPJA 1ONNA 4DDKA 3VR3D 5B36A 4Z5XA 4HNUA 3PA6A 4GBED 4EDHA 3LUHA 2J6BA 1B6RA 3PE4A 3ME5A 2XZTA 3HY6A 1ODTC 4E51A 2JGIA 2PO5A 1JIQA 4PX9A 4PN3A 3RSHA 2Y93A 4AD8A 2C1XA 4UBNA 2Q4DA 4PSKA 4TROA 3W4JA 4E3ZA 1S89A 1EGHA 1OBFO 2RH5A 3EZ7A 5J2TA 5KO2A 4I55B 2NG1A 4A6DA 3OQMA 1QDLB 3RAGA 2A5JA 5CLJA 3AX6A 4B6GA 1AE1A 2RHTA 5I4BA 1TJNA 1CRPA 1QS0B 3PXEA 1XQ9A 1CY2A 2X1MA 3E8SA 4IUDS 4PM4A 5KQPA 1SC1A 2WTXA 5JRZA 1XNHA 2O0KA 4W5RA 2QRGA 3T9DA 2AZDA 2CNOA 2XE4A 1IB6A 4KRGA 1YBVA 5JTTA 2HU5A 4XLZA 1NYTA 3HB4X 3VNAA 5DM70 3AL3A 1QBGA 3K35A 2GRUA 4R8MA 3L0YA 4EUEA 1KRXA 1Y3CE 5D86A 3I62A 1MOPA 3P9YA 4EY4A 2VL7A 3K5PA 3WBJA 1NKVA 1T8TA 3LK7A 3RE1A 4JWKA 1ESEA 2G0TA 4JGIA 4ZOEA 3BMCB 4ZZ2A 4PFQA 1F0NA 3M5DA 4C9BA 1JWAB 4XQEA 5DRYA 1OB5A 1LQUA 2ZR0A 1DZ3A 3LKVA 1X80A 3CWZA 1BXZA 4RTSA 3H97A 3TRIA 1WVIA 3RAEC 1SWVA 3FD8A 4GGPA 4HGNA 4BO8A 5KJCA 1NBOA 3QE4A 4OYLA 3X44A 4EGSA 1ZICA 4U7FA 2RIPA 2YWHA 4GECA 4B79A 2BP7B 3L02A 1X86B 1O95D 2HU7A 2FETA 3SG0A 3SR3A 4JBGA 2GJAA 4C3ZA 5JJLA 4PQYA 1E2QA 2FSUA 2WDZA 2XTZA 2ZYUX 4EHJA 5AWFC 1TB4A 1BQEA 3KR1A 1CULC 1MA0A 2FEMA 2V9PA 4OBXA 4MEAA 5FOTA 3FWYA 4BAGA 4DLAA 1WZ2A 3NC0C 5TT1A 2N46A 2FMFA 3JRNA 2PKEA 3KTAB 3MSXA 1MP0A 4BFLA 2NM0A 4CG1A 3AKDA 1GSOA 1GR1A 1Z7WA 1VZ2A 1BVUA 1PWEA 3EOBI 3MK31 4GD3Q 3W06A 2CXTA 4GX0A 5CJJA 1FA9A 4Q02A 4WZAB 2IF0A 4BFSA 3ORFA 1KIFA 2CK3A 2C58A 4TQUS 3GRFA 3H2IA 4KUGA 3ZY5A 4AY3A 4B6PA 4EPWA 4YHHB 1AS3A 2OWEA 1KVUA 4BHTA 2FG5A 1BRTA 4TUYA 1E2PA 3CWCA 4MI3A 5DASA 1L8AA 1GPH1 2JIQA 1YR1A 3K0EA 4JQSA 4FTWA 4CMBA 4II3A 1NVAA 2B4KA 5IXJA 2A5YB 1SC9A 2K4MA 2R00A 2XNHA 1YHNA 3GW8A 3G88A 3NGMA 4XX0B 3RPEA 5LDHA 1A71A 4BUJA 1M8PA 4F2DA 5KNDH 3F9RA 3AUKA 4W1SA 4AJNA 2I67A 4M9SA 4W8HA 2XMBA 2GVDC 3DDHA 4RFLA 2D2EA 2RK6A 2XWQA 3SQMA 2CV2A 1Y37A 1KBZA 4PZZA 3QMVA 1E2FA 1GRCA 3CF4A 1LEHA 3LY7A 2A88A 2PTHA 4LV8B 3ZWYA 3ENQA 1YS9A 3U17A 5A9SB 2YR0A 2F8LA 2YWDA 3A3OA 5C5IA 1ZZEA 3FPHA 2A35A 4M98A 1S2IA 4KNYA 3NTXA 1GCOA 4NG5A 4D8VA 4C1NA 4BLOA 4MR9A 1LZKA 4KQGA 4N40A 1RTTA 2KPOA 4MUEA 1XNRB 2FJUA 4MRPA 4MUHA 4B3TB 4ZCQA 4TV8F 1U9CA 2RGAA 4JP3A 1WPRA 3W5UA 5BR7A 1CUIA 3JQEA 2GKGA 5BMVF 3BJZA 2QW8A 2FPGB 2AGVA 4E08A 4I2VA 3BL5A 3IDZA 3H5IA 4Z9FA 3SR0A 2BM1A 3KEQA 4WN9B 4EO7A 1YKSA 1VI2A 1JIKA 1NZFA 2XMGA 4PLGA 1SQ0A 4S35A 1OLOA 4IDCA 3OOYA 2ZYHA 5BXQC 1LSSA 2ACEA 2CYAA 2VYVD 3VV2A 3G6KA 4XXHA 2YFKA 4IICA 3J7AC 1GPYA 1S4QA 4DSTA 5EC8A 3HACA 2UVQA 4HS4A 2X5OA 5EUCA 3ZXYA 5L4NA 2O8FA 1BMFA 2EHJA 1BWRA 1CUWA 2YZNA 1LBTA 1ZFNA 3I37X 5DCLA 1SEVA 3SX4A 3ZGLA 4X65B 5IXYA 1D9XA 4NU5A 1YD7A 3SHFA 4YMLA 1L8LA 5F3DA 1NTOA 3PNQA 2A1TS 4ZQFA 2NV0A 3EW9A 4HVTA 5KNDD 1X87A 1YMUA 1UPXA 3EVCA 3Q11A 3E3OA 5EP1A 1E5QA 1JLRA 1RC1A 1UFRA 3DOEA 4QDJA 3V8QA 5FADA 4DANA 1LVUA 3GZTB 2HBQA 2H57A 1KZHA 1YB6A 4LMPA 5CPBA 5A06A 3IO5A 3CW8X 5B2FA 3VHXA 5HEKA 1CY6A 5KVCA 3BX1A 2CDRA 2K5UA 3MEQA 2GCEA 2R6HA 5DNDA 1W59A 421PA 3RC8A 4D9NA 4YN3A 4NPAA 4B4OA 3DVRX 2QRUA 3B13B 4BQNA 2JCXA 2XKKA 4MAAA 4DDWA 2AVNA 3DEYX 4IV8A 3GXOA 4DM4A 3FRHA 2HCFA 2Q21A 4A8JA 1U8AA 2YDXA 2Z58A 3GJSA 1RI1A 3UO8B 2WQ7A 2XQVA 4YRJA 2A9QA 1R4NA 3O31A 1XFAA 2HFKA 3ZCQA 1UKBA 1VJ0A 3WLJA 1NLYA 4B48A 3K1AB 1W88B 4L6CA 3BCUA 3MQ4A 2E89A 4QSMA 4BQQA 3IEVA 1XWIA 1QV7A 1Q3KA 2O2HA 4QULA 4JELA 3TQSA 3BXHA 1WCIB 3MXOA 4JQOA 1NU8A 1B73A 1UDAA 1XJWA 4X61A 1WQ4A 3PUWA 4NABA 2ZJ5A 3A4VA 1E3EA 4H0NA 2LTAA 4K6FA 1LPAB 3T5MA 5ALQA 3VNRA 4UBOA 4CR7A 1DARA 3CC8A 1JKFA 4F6CA 3H9QA 3U37A 1YUNA 3UCFA 4HDSA 1OH5A 3D7KA 5CCBA 3OAAA 1E2BA 4LHEA 1P75A 1V1MA 4Z9YA 2GAFA 3RFUA 1U6IA 2R1VB 1XZ8A 1N6RA 1NRIA 4K8OA 1U0LA 3Q2IA 2P1DA 5JSZA 1BYIA 1RHUA 4PPFA 4RVCA 2JJ1D 3H8SA 1WIWA 2OFOA 4PLPA 4WNIA 3LA8A 3ERCA 3FHOA 3LM8A 1S8NA 3FUCA 3L4EA 3OTQA 1E0DA 1LTQA 2WSIA 5JFOA 1JEJA 2ERYA 1Q0RA 4PR0A 5BW8A 1H0HA 2E4UA 4TWZA 4XIFA 1M8KA 1VKOA 2VZLA 3W5IA 2FFBA 2UZIR 4FYXA 5CX1A 4BVKA 3KU4A 3LWBA 5J4VA 1H2FA 1U0GA 5D85A 4XQGA 1YFZA 2BHNA 1IJKA 1L6RA 4MPDA 5IRCD 3L77A 1XRSB 3LPNA 3PYMA 2F9MA 4G0QA 3MWEA 3R6TA 2EGGA 5EIEA 1ODSA 4GDFA 1TC2A 1TFRA 3U3ZA 1PFUA 5C1BA 1BA2A 3TMAA 3SM9A 2ZUWA 2VBCA 3HCEA 1JEEA 1XQXA 1KQ3A 3JWEA 3N75A 2ZI4A 4M1EA 2A0YA 5HR5A 5IC4A 5F3WB 4NENB 1B0UA 3L6EA 2ZTMA 3O94A 4NBWA 1NHWA 1R0RE 1XZDA 4WUVA 2N42A 1MOZA 1SG0A 3ZWAA 4KFTA 1EJ6A 3G68A 1HE4A 1U7UA 2RHRA 4IIUA 4UC0A 3UAWA 4B81A 3PRKE 4DARA 2R8ZA 1YR8A 2EVWX 4IS2A 3ZE7A 1KI6A 1RMYA 3UF0A 3KKKA 5JNSA 4D96A 1IQ0A 4GOMD 2AG0A 4KGDA 3WMFA 3ASZA 3EGDA 2Z6VA 2XB6A 2V58A 3A2MA 2P3OA 4WDRA 5LIRA 1U3DA 4Y18A 3HJTA 4DCVA 1A2QA 2VF2A 4H4DA 4AMUA 2GRAA 4ECEA 3LY9A 5AKZA 3ESAA 2V1XA 1GN8A 1ACLA 3EXFB 4JU8A 3RD5A 3ICPA 1Q7RA 2R48A 3DKRA 3STXA 3DDUA 4CL2A 1SHLA 1QIFA 3CJTA 5ALTA 2PHZA 3TW8A 3ZHVA 2VP2A 3MCTA 1II8B 1AGPA 2NYRA 1JKJA 3LYHA 4HTFB 3HKBA 1T1EA 1J2YA 1C29B 2HB6A 4R1LA 4X1IA 2VVTA 4YYZA 1ENPA 1VHTA 2VHEA 3FM9A 5BWCA 4GRIA 1LC3A 2PX4A 2WLSA 1I6KA 1Y1KE 5ALGA 1I51A 1UIMA 3OFNA 2FOIA 3L93A 4AUEA 1DAEA 1VXOA 4WV3A 1JH9A 5CEEA 1NM5C 1YZQA 3AEUA 4FB5A 4NOJA 5C5CA 1I6WA 1KAOA 2QLBA 3C6BA 1DBPA 1ZMOA 2WINI 4JC0A 2FJPA 1P5JA 3U39A 4F3RA 3GEHA 3QF4A 4LDQA 3ROEA 3VC2A 2EF1A 4ZVNA 3T1QA 1MT3A 5B12A 1CEYA 3GIDA 13PKA 1PT6A 2M32A 1NDQA 3G8AA 1VPEA 3LRXA 1Z0KA 2VP6A 1NVKA 3H99A 1J8VA 1Q7GA 2F1KA 3O4FA 2G72A 4UUPA 5E7QA 5G0TA 1LFDB 3VHRA 1UXJA 4AAYA 1OXVA 4IRUB 3UXEA 1ONBA 1Q7EA 3U4HA 1JFVA 1ZHFA 4Y6OA 3FCEA 3C1UA 2HTEA 3L06A 3ZY4A 1JJFA 2D4AA 3N0RA 5T4EA 1YU9A 3ND7A 4E2ZA 5LQMA 1IOLA 2YJNA 3OT1B 1HDRA 2C9YA 3RVNA 2ZT5A 3SZOA 3P0JA 3EVEA 2KS6A 4EA6A 1K5DA 1NMZA 1W4LA 2VZ0A 3BGSA 3LY5A 3OMLA 3THRA 5FI0B 1LNSA 4LOAA 4YAJA 1IQUA 1CCWA 1OKKD 2HADA 4BNZA 2UXDB 4FZJA 2ID8A 3DONA 2RH4A 5SV2A 4DT1B 2BSAA 3EZ2A 4WCDA 3AVUA 3KL4A 3HCBA 4CEJB 2ZJBA 1T1SA 2R5FA 4XD7D 1UOOA 3BIXA 3DQQA 1UWKA 2WHEA 3LGAA 4XDHA 3G1WA 4E2FA 5A4DA 3EA4A 1ESDA 1RE0A 2PZBA 4B0OA 4QOSA 5A5FA 1SJ9A 4ZHQF 3DPUA 1KYZA 1UC5B 3S99A 1DINA 4C7KA 3EVGA 3P32A 2DWCA 3RBZA 2N1BA 4NC9A 4AS2A 4J0HA 1BXKA 3VU9B 1SCQA 3V8RA 2Q2QA 1SKYB 3TB4A 1ZUHA 4U8HA 2HWUA 2GD0A 3GJ7A 2XUOA 1VSVA 5AHWA 1T9CA 3VHQA 3RTGA 2PM8A 1YCFA 3C6KA 1AKWA 4E0BA 4WZAE 4OH1A 3LV8A 5FA5A 4TTPA 4N3CA 4RY2A 2EFHB 2KYRA 1RAGA 4PGGA 1J09A 1FUIA 4E7PA 3P0HA 1QK3A 5AKJA 4C4AA 2VQFB 4MVWA 2XJ4A 4HNSA 3HDHA 1T6BY 4M37A 1GA6A 4FGUA 4UTPA 4JVMA 3S8MA 2YUIA 3NTUA 5TR9A 2FZWA 3EB9A 1Z08A 3EXHA 4HN4B 3SEFA 1GN9A 4W63A 2AJTA 4CKBA 4P4NA 2ISSD 3KIPA 2NUAA 4EG5A 1ZD4A 2ZIEA 1LCIA 3QYAA 2V7EA 3CPEA 4H3KB 4E11A 4CTMA 1T36B 3DWEX 4A6PA 5CW1A 4YRZA 1LS6A 4Z3OA 1CFJA 3R9XB 5AHKA 1OVGA 4XVHA 1N6HA 4BAZA 3FFWA 3BE5A 3Q72A 4IIJB 1Z25A 3NTQA 4ZXPA 2HCJB 3X1XA 4RZHA 3GDFA 4CR6A 1K4KA 1QE3A 4CM9D 2X9QA 3D2LA 4K2AA 4XQ9A 4H3HB 1UR5A 3JQ6A 4O1IA 1H1LB 4P0TA 4GXRA 2VJMB 4G4GA 1PR3A 3LE8A 5DWVA 1N9GA 3K9LA 1HR0B 4G41A 3GJ8A 3LLUA 1SB9A 1IMJA 1WEKA 2EX1A 3ACDA 2WTMA 1ID1A 4PO3X 4I50B 2ODEA 4A26A 1KFJB 5IM4A 4M1TA 5DKFA 4D6PA 2P4QA 3E27A 5EMHA 4F93B 5FCDA 4I9UA 5HM8A 3D0KA 1MW9X 3DHYA 5FYQA 3OTOB 3OO1A 4RD1A 3TLGA 5EVJA 2Q2WA 3JVVA 4G23A 4P3PA 3LBHA 3DUFA 4QPNA 5LQJA 5CDHA 1PDOA 4Q66C 2QRHA 3UY4A 5BR1A 1H3FA 3THWB 4RS4A 5GJCA 1U7PA 4FC7A 1MQ8B 4X6YA 3NIDB 3HI6A 4B7UA 5KINB 5LXTB 1GXSA 4JLVA 5JDCC 3S5JA 3TBHA 4MR8A 1EFRD 1QZ3A 4XDGA 3K20A 3NCTA 3LDUA 4LS3A 4GI2A 2YZ2A 2DG2A 1EGQA 1MO6A 4RELA 1D2NA 1WE2A 1Y7PA 2GX6A 3IOMA 5KU1A 1JHAA 3OX3A 3VI3B 3EDYA 2HRZA 1OB2A 1DP4A 3GMTA 4EY6A 2BTQA 5K6RA 1OFHA 5BQOA 1BE1A 2HF8A 1PK8A 3AIOA 4QDXA 4H27A 4DNFA 1DZIA 1E0KA 3LVBA 2HJHA 3L0DA 4JT4A 4QPDA 1T5DX 4GNKA 4I5EA 4X7BA 3B85A 4AS1A 4EHAA 2W6CX 3QNWA 1XTVA 5J9FA 1ZVQA 6ADHA 4GMGA 4OU5A 1O97C 4E1VA 1M2HA 1TTTA 3L79A 1K7XB 2Y99A 3OE7D 1LJLA 2R84A 4F2GA 2ZIVB 3SLRA 3SS8A 2QTTA 2IODA 2EZ8A 4F7WA 2AOTA 4PHTA 3IJRA 1ELOA 3MINB 4WCFC 5JWHA 4ETNA 3FYUB 1SIWA 3RM3A 3QX3A 2O3JA 1QGUA 1Y98A 4N9QA 1RWVA 2ZG6A 3H2GA 4HAWA 1SVOA 4WJLA 4AZTA 1HC7A 1YRAA 4PQEA 4YRQA 5KTTA 3K9GA 4MARA 1TZ2A 3K6SA 2GEUA 2BYTA 2PEYA 2JGDA 1HTTA 1KJ9A 2ZR7A 3JQRA 5ADHA 1K5HA 2BZ0A 2JS7A 2GF0A 3NEPX 4DJ5X 4EVQA 5KIAA 5EGSA 3KXIA 3VOSA 3HR7A 3SIWA 3A4YA 3I9JA 5CT4A 2AHOA