2C2HA

Crystal structure of the human rac3 in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
168
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
publication title Crystal Structure of the Human Rac3 in Complex with Gdp
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 168
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c2hA00
4GP6A 3H0KA 1Z0JA 2Z4RA 2ZRLA 3QQ5A 1XEXB 3QKRA 4NYJR 3H1TA 2GBLA 4QJ4A 2X8AA 3TJZA 3BH0A 1RFLA 3IIJA 4WZ6A 4E09A 2PCLA 3BFKA 1IN4A 2IWRA 3B7GA 4ZCIA 2ZI7A 1Q3HA 2ZRFA 4KJZA 5DI3A 3OIUA 1Z6XA 1AK2A 2ZETA 3RC3A 2ZXUA 2I1QA 1E2FA 3IGFA 3QJYA 3T5GA 1FMJA 4G5GA 2QQEA 4LYFA 4IVRA 1H65A 4A0HA 1PVOA 2GAAA 2J0SA 3HU3A 2H17A 4HZUB 1XTKA 5L3VA 3A1UA 1NVWQ 2W6ID 4MKFA 3NBYC 4GI7A 4HLUA 5BN5A 1T3SA 4FMCB 4R2HA 3SYKA 2FWRA 4NYMQ 3AKCA 4HYYA 5E7IA 3TNFA 1AN0A 4L8GA 4OI0A 2ZE7A 1QHXA 3AP1A 3TAUA 4Q03A 2GBLC 1P6XA 3W34A 2JLZA 1Z22A 3EC1A 4MDFA 1VPLA 4D2IA 4OJQA 4BLTA 3K0EA 1NVUQ 1S1MA 2VP4A 2H16A 1EX7A 2VP5A 4HAUA 4IDPA 1KHTA 2QRNA 3QKTA 1P9WA 1YZGA 2WWXA 2XNSA 1J2JA 3T34A 4QBGB 5SZHB 4CEHB 4UKDA 1X8JA 2EFGA 2QA5A 3HPRA 3L0PA 3PG5A 3P4XA 2QMUA 4B48A 2DYKA 3HP1A 2HYDA 1QF9A 4JBYA 3O8CA 2HJGA 4ABYA 2QMOA 2WIAA 3TRFA 4ESVA 1UBFA 1NRJB 2WPDD 3AVVA 1A82A 3R9WA 2GJKA 2XZLA 3FMOB 1GSIA 2OBLA 3PUZA 2ODNA 4Q1EA 4QRHA 2NOAA 1XF9A 1NY5A 4PPFA 1RJ9A 1IQPA 3LAWA 4HLUC 5KDLA 4CT4B 3T1QA 4DHEA 5DHFA 4NYIR 4F91B 2ZJOA 4DT1A 1IY0A 4LZZA 4IOKA 3NEYA 5FBWB 3LQQA 1Q44A 1U2RA 1SHZA 2IYSA 1CTQA 2QQ0A 4AIIA 2GETA 5FBVB 2OESA 1NG9A 2OLKA 3PITA 3U3MA 3HJNA 2D06A 1ODFA 3EIQA 2C03A 3X1WA 2GF9A 1XZQA 3A4LA 4OJKA 2YKGA 2REXB 4CYMA 1F2UB 1VYUA 4K8OA 3CPJB 3T12A 3GLIB 3TVTA 2ZJ8A 1FTSA 1DAIA 3R20A 4JJKA 4MRNA 4Q4LA 3EC2A 4KFUA 2Y8EA 3AB3A 2QE7D 3I62A 2FFAA 2F1HA 4NMMA 2QMEA 2JLQA 4JVMA 1AQYA 1KDOA 2FA9A 2Q0HA 3D6TB 3T1OA 2JLWA 2RGEA 5BYJA 4L4UA 2BBSA 2IXGA 3QXHA 2BJVA 4LWZA 1PV4A 3TE6A 1R5NA 4TLBA 2BIFA 4QBIA 1V5WA 1XJQA 3RRYA 3DMDA 1TF7A 4FWIB 5KSYA 4JZKA 5EP2A 3GLFE 2O8BA 4M0LA 4DZZA 1OXTA 4KXFB 3I92A 3MMPA 1BO6A 3U7FB 3E5HA 2Q9BA 3KL4A 3NC1C 5KPDA 1JPJA 3NWJA 4C0HA 1E0AA 1EFCA 4PR0A 4RFSA 3SBEA 3X1XA 2RGNA 2O8FA 2OBNA 2AWNA 1XP8A 4EPYA 5L3SA 4KBGA 2AFIE 2RGAA 1TQ2A 1KY3A 5DE3A 1E2NA 3MG9A 3ICEA 2FEOA 4JKIA 4WZBE 3LQRA 4HAVA 3CZPA 4IOMA 4LV8B 2YC2C 1AS0A 3CNLA 4HB3A 4XWKA 3ZZUA 2CMKA 1IJFA 3EZFA 3QPWA 1ZC3A 4MGYR 5FFMA 1NKSA 1S2MA 3VHXA 5A5GA 3GJXC 2RGCA 3FPAA 3GEIA 4LJYA 2HLDA 2Q9CA 1EFUA 3EPJA 5HE9A 3C41J 2KSQA 1NVVR 2FEMA 4QM6A 4Q4JB 4BZQA 4CGZA 4C4PA 2QY9A 4RD2A 1GIAA 3W90A 1T3LA 4BLQA 1YE8A 4JS0A 2CXXA 2DWOA 2QM8A 3D8BA 3LW7A 4TLAA 1E2QA 3P32A 4BFYA 4BEBA 2O0JA 2QU8A 4MRRA 2QORA 1II8A 3FMFA 2PEZA 4EDHA 4M1YA 2FE4A 4JLMA 4XSHA 3W6PA 3CO5A 1KK3A 3VNVA 2FSFA 3DM5A 4EAQA 5CJPA 4FIDA 1DAMA 4JL8A 4KI0A 3GPLA 2J9RA 2QP3A 1XTIA 1US8B 2RGNC 1SKQA 4JBXA 1UEIA 2OZEA 1B23P 3UIEA 4RD6A 4Q7JB 2W00A 3T35A 2CCJA 2YYZA 1P9NA 3I32A 3K70B 1L2TA 2ZQ5A 4MKHA 2GVDC 2WWYA 1WBDA 1GRNA 3CR8A 1HYQA 3I8XA 3GEHA 4MYTA 4OHWA 1XCPA 4I1VA 2Q21A 5FTMA 2Q3FA 3QBTA 4NBSA 3IUYA 5SZIA 4YMTA 4ZIRA 3KQNA 1YZLA 3U61B 3BAFA 2JJ8A 3SNHA 4XD7A 1XNJA 2J45A 2XOKA 2FSGA 1KMHB 4OBEA 1LW7A 1TF2A 4TMZA 4ZI2A 2IF0A 3QF4B 1KI8A 1VHTA 5J40A 4DSUA 4JKYA 1CLUA 1UDXA 4C2TA 4V0ME 2Z4SA 2JLSA 4BUJA 5AJYA 5J4VA 1L7VC 2L0XA 3QXXA 4HUQB 1UM8A 2PZEA 2Z0MA 3CM0A 3ZZ0A 3A6PC 2FU5C 2YWFA 2NMVA 3WBJA 2QSYA 4L5BA 4LSGA 1VKJA 2PT5A 3A1VA 4YDHB 3KTAB 4TLDA 5EXTA 1G8GA 1QZXA 3M0EA 4ZKDA 4IRUB 1I4LD 1N6KA 4HB2A 2ONKA 2ZR0A 3A37A 4PHGA 1KSHA 1YHNA 4KYIB 2EWWA 2CLSA 4FN5A 1MV5A 4O25A 1LS6A 3SJAA 4LHZA 4PSKA 3AUYA 3SC3A 1D2EA 2GAOA 4S2EA 3K9LA 2GCPA 4KO8A 2JLUA 3BFVA 4FI3C 3LBHA 2ZANA 421PA 2JIZA 1Z83A 5IF9A 5KO2A 2KB0A 2OXCA 2FSHA 2W6JA 3GQBA 4O3MA 3TLXA 2A9KA 2F9LA 4BFUA 1N3BA 3TUZC 5FR1A 3WBKA 3C16C 4LRWA 2HLDD 1SVSA 5GJWC 4HLCA 1KAOA 2ZYUX 5JS7A 1OH6A 1M2OB 1UKEA 1VIYA 2ERYA 4A6XA 1TL7C 3PJRA 1KZGB 2AKAB 4EFLA 2JLYA 4G5OA 1DAFA 1G8YA 3U3JA 1R2QA 3OEEA 2XB4A 2ZAMA 2F3RA 2IYVA 2J3EA 2D74A 4UXHA 1VDZA 2VHUA 4ITRC 3FKQA 3OHMA 3ND8A 4BEJA 3GJ6A 3T1TA 4Q9KA 4CVNA 4AKIA 5JJIA 4PPGA 2QMHA 3LH5A 2VP9A 2A3RA 2WWHA 2QPAA 2BEJA 5FI0B 2CK3D 4F7WA 2X2FA 1JR3A 5B2ZA 2FJUA 1BKDR 1T3HA 1KK1A 1XZPA 4PQYA 3U2QA 4TWZA 1YQTA 1YVDA 2BBWA 2QGZA 3IEUA 2Q3MA 2RKOA 2IT1A 2UZ3A 4BFWA 4P4TA 4BLPA 2GCNA 3BOSA 1W36B 4PAOA 4JLVA 3IIMA 1OH8A 4XD7D 2XOKD 4KVGA 4NCIA 2XGJA 3WP0A 1PLLA 1RRFA 2GJAA 1P5ZB 1NLYA 3B1XA 4DLWA 2WKQA 4JLBA 4AKEA 4F4CA 4RJLA 5C4MA 4PZLA 1W0KD 4D6PA 2ZJ2A 2QAGA 1W47A 5K8UA 3QUSA 1OV4A 3BC1A 3EA5A 2Z6VA 4RD4A 3LBNA 1YRBA 4L9WA 4LC1A 4MUAA 4V0NA 3TSWA 1E32A 3VX4A 4A2WA 1SVKA 2OAP1 2ZJZA 1GL9B 3UG7A 1H8HA 221PA 5BWMA 3RABA 1Z2CA 3PR1A 4V0OA 4TMKA 3E1SA 4RZUA 4NYMR 3SBDA 2AXNA 1FTNA 5CLQA 2DB3A 3IBGA 2XX3A 2OILA 1SKYB 2BMDA 3C4JA 5HZHA 3QBVA 4PTLA 3GEEA 4AURA 2FX3A 4FINA 2J7KA 2P5SA 1MT0A 2YVUA 1W4BA 3GLGA 4BZXA 2J59A 1IOZA 1S1CA 2HCJB 4B43A 2NO6A 2GJSA 4DSTA 5IHPA 4H1VA 2C96A 2RHMA 4US1R 2HYIC 2HF8A 3FB4A 4F93B 2CL6X 4TTPA 4UQOA 1OYWA 3K09A 2J46A 4RD0A 3EPHA 3V9PA 3BE4A 1HV8A 2J41A 1J8MF 2GDJA 4I1OA 4OHXA 5JI2E 4M1WA 4B3XA 2A5JA 4C7OA 2PX0A 4XVUA 1Z63A 1IXSB 1XU4A 3ND9A 3AGPA 5UKDA 3JVUA 5EE1A 3ECCA 4CF7A 4X8MA 2WOOA 4QNMA 3U3KA 4TYNA 1NBMD 4N0DA 3DKVA 5EP1A 1X86B 5EE3A 4DLVA 4TZ6A 2CHVA 4B71A 1CJKC 1NG1A 5BN4A 3B60A 2VRWA 1OFHA 2VA8A 5IK2A 1GRQA 1Q1ZA 3LLMA 1D2NA 1GILA 2C8VA 2CE7A 4NKRA 2GJ9A 4XIGS 2B92A 1VHLA 3G5UA 1RRGA 3A1TA 1W49A 3O8DA 3SN6A 2RH5A 5CK5A 3K9NA 4M4SA 4NONA 2YJTD 4QNRA 1JBKA 2WBLC 2IYUA 2ORWA 2I4IA 2QRZA 3WHKA 4BRWA 1JR3D 1OT3A 4YONB 4P4UA 4B35A 3IHLA 1YZKA 4LHXA 4PAQA 2P6UA 3K09C 1G8PA 1EX6A 3UATA 1HT1E 3IPXA 5GJVC 3BWDD 1HURA 4PHTA 3FYHA 3CX8A 2CLCX 4MUBA 3T06B 1KI6B 2WAYA 2WJJA 4QOSA 4UXIA 4A6PA 3OIWA 3RS2A 4X8LA 2R6AA 2ZRDA 1L8QA 4YMSA 4WOPA 4YC7A 3SU8A 1OB5A 4ARZB 4B3CA 1U90A 3EASA 4Z8XA 5BXQC 2SHKA 2XTZA 3KQLA 4KHZA 1FUKA 3UG6A 3GFPA 4DLRA 1G3QA 3SR0A 3LXRA 2DBYA 5AJXA 4XTRA 2C9OA 5ANRB 1WBBA 1R5BA 2RMKA 2ZRBA 4TLEA 5J4HA 2EYUA 1CJUC 1H8HD 1E0KA 1ZIPA 2AHOA 2ZI6A 4OK5A 4OQXA 1KYIA 2O5VA 2VF8A 3G0HA 4KODA 2ODEA 4P0TA 1JXMA 1ZNXA 4Q9LA 3KKQA 2V6IA 1QHGA 1AZSC 3CBQA 2CCKA 3HDTA 4JVNA 3LY5A 4P4SB 4FMDB 5G40A 4TSFA 2RHDA 4Q00A 5KPJA 2QTVB 3OE7D 4B6EA 1RVDA 5JSZB 1CEEA 2J0QA 121PA 5JWHA 4Q4AA 2ZS9A 2WWFA 1R6BX 2ZRAA 3TIFA 3NKVA 2C04A 3UMFA 4B75A 5EXPA 2F3TA 2GEUA 2ASEA 4KV9A 2WMNB 4TL8A 3ZGXA 2ZI9A 4F4IA 1JECA 1Z6YA 1XPOA 1N0UA 3KQHA 4L16A 3MLEA 2ONJA 2QZ4A 6Q21A 4DC9A 3LBIA 3U44A 2X19A 2W58A 1K6MA 5G53C 2D7DA 1FP6A 1GNPA 1D9ZA 2HF9A 4LPKA 1OW3B 3CX7A 1JALA 2REOA 3AP3A 1XEXA 4RCYA 1NBME 3D31A 3U6KA 2FZLA 4PQRA 1G16A 5CIQA 3SFVA 1RYHA 2OCBA 1ZU5A 4U5XA 4XWAA 5JFGA 1GDDA 3VHLB 2G88A 3A58B 4TL7A 4QL3A 2MSDB 5FL3A 3RS4A 3X1YA 4OKSA 1G3RA 5JZVA 3VQTA 4DIEA 1ZD9A 2ZI4A 4N1AA 4MITA 4BFXA 3RNLA 3CPEA 1A2BA 2E1RA 3AKEA 4EJSC 3BFXA 2IA5A 2K5UA 3EW9A 1AJEA 4IEIA 4RFVA 2A2ZA 1GOTA 3WYGA 4UJ5A 3H4MA 5B57C 1NN1A 2CE2X 2ZTSA 1JR3E 3PEUA 3CONA 4Q1CA 4X8HA 1NF3A 1ZU4A 5EE5B 4NE2A 3B78A 4LHWA 1KSJA 3A4MA 3BIFA 4HZUA 5EXSA 5LD2B 3OZXA 2LKDA 4D0NA 4O2LA 3TK1A 3CRVA 5DI9A 4EQ6B 3VU9A 1F3OA 1NN0A 3CX6A 2ZVQX 2IS4A 1TF5A 2WICA 1YR8A 1IONA 1ZUNB 2G1KA 2QAJA 4HZIA 4PHHA 1MO3A 4Z1MA 3TKLA 1W7AA 3P26A 5DGXA 2WIBA 3FVQA 2F1RA 4C0JA 4ZDKA 5EXXA 1UBCA 1FX0A 1XMIA 3QIAA 2IS2A 3LNCA 4HEJA 2D62A 1OB2A 3U7HB 2O52A 1F48A 2AD5A 5FOWA 1WRBA 1D2MA 3VR1A 5H8WA 3L0OA 1BYUA 1PZNA 2J0VA 5F9HA 3LLUA 3B6EA 4CEIA 1U8ZA 2BV3A 4ON9A 3L0SA 4CEHA 3FMIA 2JAQA 1IXZA 3X2SA 4TSFD 5FOXA 5IDVA 3THWB 3RS5A 1CRPA 4Q01A 4HAYA 1TX4B 1RPZA 1G8HA 3CNOA 3VR4A 2WKRA 1IN5A 5CYOA 4UNPA 2J7PA 1NSFA 4IDOA 4C0QC 4KSBA 1OJLA 1PJRA 2QBYB 1KOFA 3NHBA 4AC9A 2FFQA 3KXLA 1SVOA 2BOVA 2VHQA 1Q20A 2IX3A 1S3GA 3AVWA 1CULC 2XZOA 1WQ1R 1ZM9A 3ZVLA 4TMVA 2IF2A 3FDIA 4C0AC 4C0SA 1YZNA 4URXR 4IEEA 1XD8A 4QGFA 4CDGA 1F2UA 1JNYA 1KTVA 5JRZA 4XSGA 1JXOA 1Z08A 2V55B 1OXSC 3GLFB 3KDSE 3H84A 3K0CA 1OF1A 2IYLD 3UPUA 1SXJC 1G7TA 2JGNA 4IVPA 1NI3A 1ONBA 4YLGA 3OFNA 5KHOC 4G5SA 2OFXA 1NMYA 4BGDA 1AGRA 1SVWA 3PENA 2QPTA 1P7CA 1S8FA 2N1BA 2O8CA 1Z0DA 2CNWD 3CRRA 4PAMA 3W3AA 4KU4A 1YZQA 1ZINA 2NZJA 5BQ5A 1D8TA 3AF1A 4V0KA 4D80A 2IBMA 3CF0A 3U7GA 2R62A 1XRJA 1YR9A 3ASZA 3HWSA 3ZQ6A 4GDFA 4WAUA 1Q1BA 4LYHA 4URYR 1E1RA 4NCNA 1OXXK 1Q12A 4J0QA 2H92A 3CR7A 4LK2A 4TL6A 3FHTA 3F5FA 4Z1MD 2CBZA 1KGDA 2JA1A 3B82A 2R9VA 3Q7PA 5TY0A 3LDAA 5JJKA 4EPVA 5F2EA 2BVNA 1FZQA 1CP2A 2F1JA 1CR2A 1G9XA 2P5TB 3KXIA 4TQAA 3TW8B 3K0CC 3CF2A 2B8TA 3LX5A 3TUIC 1LB1B 2F6RA 3Q3JB 1AKYA 4E07A 4AYXA 4JL5A 2F43B 3AVYA 1UBGA 2A78A 4QBFA 4DLSA 2BMEA 1MOZA 3IO5A 4DEXA 4RY2A 1W2GA 4JJZA 2GF0A 1KNQA 1FPMA 3RSOA 4GMDA 4ZPXA 4EPRA 1T5IA 2BJWA 2EQBA 3M1IA 4MRPA 1MABA 5KYKA 2ZM5A 4Z54A 5AR1A 1GVNB 1SXJD 5EZ6B 4KFSA 3QG1A 3SHFA 1RW4A 3DM9B 4B73A 4D4JA 4TTRA 2OG2A 4NL4H 3U60B 1HE1C 1UKYA 1KNXA 2YWEA 1US8A 5DIFA 2J7PD 3THOA 1E2PA 4Q1AA 5GVSA 4L9SA 5FOSA 4OYHA 2OEPA 2B6HA 3R8CA 2AXPA 1M34E 1KZ7B 1TADA 4PPQA 2WSSA 1P62B 3PEVA 2EYQA 2QTFA 4C2UA 2C95A 1NJGA 3AKDA 1KDRA 1N5LA 5G3ZA 1DARA 3CB4A 3VFDA 4GL2A 4QGAA 2BMJA 1IJEA 1QVAA 1XJ0A 1Z29A 3L43A 2GXSA 3CWZA 3B2EA 3RWOA 1CF4A 3AH8A 1N5KA 3NC0C 3ZYCA 4P31A 4IXMA 1YR6A 4BLRA 2QENA 1XJCA 4HUQA 1ESNA 4MGIR 3SDZA 1XXHE 2IYQA 3QENA 4NCJA 2ZSDA 4M1OA 3TBKA 5IRCD 3AVTA 1G5PA 1E94E 4YMUA 5B64A 3Q5DA 1NLFA 4URWR 1E2EA 3KTAA 4LDJA 4JIMA 1CJVC 1E0JA 2P6NA 1JI0A 5TARA 1KO8A 3ADKA 3THYB 2IXFA 1IBRA 1Z07A 4M2LA 2AK3A 3WYAA 1ELOA 4KFTA 3RDPA 3ZDQA 4B2PA 4G5RA 1FNMA 3RHFA 2VHJA 1G3UA 2X77A 2EFDB 3DZDA 4GNKA 1P3JA 4MH0R 5C18A 5LDDC 4BZPA 1NL3A 1Q22A 3QKSB 4GOXA 1KAGA 5E7JA 1G291 3K9HA 4Q4HA 3T1VA 3K0FB 3PUXA 3SQXA 3MJHA 1GKUB 4JYCA 4Q1DA 2VSFA 3WRYC 2A5YB 3L8YA 1QG2A 4UNNA 3U4QB 2F55A 3AF4A 1MRSA 4MRVA 4OHZA 4KCGA 3WMGA 4DCTA 4FCWA 3EG5A 1S96A 4HDOB 2MSEB 2IEZA 3NEJA 2B21A 1XD2B 2IEYA 1JB1A 1ZD8A 3ZH9B 1MH1A 1UDWA 2N42A 3GJ7A 3I4LA 1SVLA 1VYTA 1XEWX 4AG5A 1KI7A 5D3MB 4DDVA 4C30A 5BYKA 1IXRC 1M7HA 1N6IA 2FPMA 2CJWB 5TDHA 4TT3A 3CLVA 4HUTA 1P2SA 1KSGA 2BM0A 4DUGA 3M6AA 1DOAA 1W5SA 1X8LA 3NIBA 4Z51A 4IHQA 3QG5A 3KFVA 2ZYTX 2JATA 3B1YA 3Q85A 3RRNA 4A15A 4DT1B 4GT1A 3WYFA 3LX8A 1SXJE 4B3GA 3BB4A 1Y3AA 2J0UA 3RRZA 1WCV1 2G3YA 2OE2A 5J47A 5CDFA 5TB5A 4DDTA 4IDNA 4TZ0A 2QI9C 4IFEA 3I73A 4IOLA 1EESA 1VMAA 2WSSD 2BDTA 1DO0A 2REBA 2OLJA 3GJ4A 2FV8A 2ZE6A 1E9DA 4X8OA 1ANKA 2QSZA 3RRMA 4E5UA 2YZ2A 2Z43A 3IO3A 5D3QA 4Q7KA 1C9KA 4TQUS 2DWPA 4KSCA 2G77B 3PFIA 3SFZA 4Q47A 3RYTC 1R7RA 3FKSA 2C5LA 1ETUA 1GKYA 3KKNA 4RD1A 1E9AA 1P4SA 1ZJ6A 2VH5R 5E3HA 1CKEA 2A5DA 2QTHA 2VIIA 4WBSA 3QXCA 2QT0A 2ZRIA 2RB4A 4FXPA 1R8SA 5KOYA 4AY2A 1I2MA 1ZAKA 4PC7A 3KJHA 1OYYA 1VG0B 2PJZA 4ZV4A 1E4VA 3VKGA 2FDCA 3D7MA 4HAWA 3PVSA 1G5RA 4GMXA 1YJ5A 4DIDA 4DLTA 3C15C 3TQFA 1FW6A 2EFHB 3HR7A 5JRJA 5KU1A 2NTYC 1IM2A 3IIKA 4TYPA 2D2FA 3W8NA 4B2IA 4KVAA 4Z8YA 3ZJYA 5L3SB 2E9SA 2GXUA 2WKPA 1GUAA 3SHWA 1COWA 1CXZA 2BEKA 2QG6A 3FTQA 4NTZA 1PUJA 3MWLA 1E69A 4XTCS 4US2R 5LPNA 5C46F 4LBVA 2Q6TA 4D26A 5JHGB 4B3DA 4B3BA 5FUVA 2DHRA 3EZ9A 2IUUA 5B30A 1F6BA 3PUWA 2FSIA 5GJCA 2JCSA 3TUJC 3RS0A 621PA 1DE0A 2KI5A 3CRMA 2JDIA 3UK6A 3E2IA 3EZ2A 2GCOB 4CEJB 1ZCAA 2P0EA 5HTKA 4XVQA 1KJZA 4MGKR 4DCNA 3WMEA 5JLJA 1U8AA 5FL7A 1KI9A 5FPHA 1GTVA 4Y0VA 2WJYA 3AUXA 1HTWA 5EQTA 1CIPA 4B47A 4ESHA 2PH1A 2DCUA 1EWQA 1GG2A 1SULA 1FL9A 3NBXX 4DLZA 5F9FA 3LD9A 4RZXA 1Z6AA 1W48A 1XB2A 1GZSA 3SYLA 4TT3D 4DUGD 5A4JA 2AX4A 2CHQA 1TEVA 1H8EA 2IYTA 2PLFA 3MGCA 1VECA 2IS1A 1XCMA 2C78A 2OFWA 3IILA 5K8IA 5HE8A 1ZM2A 3NDBB 4A8JA 2GXQA 4NH0A 3FFAA 1ZW6A 1TNDA 1LF0A 3A36A 4F4JA 2JASA 2ZS7A 2P3SA 2EFCB 3KJGA 2IUSA 4URVR 2BMFA 1GWNA 3MRSA 4E03A 2QM7A 1KI6A 2YWHA 4RVCA 3V4FA 5FTJA 2WJGA 4WVFA 1OKKA 2AR7A 2R44A 4GZLA 1KY2A 4DDUA 1QHSA 1OXUA 2CL7X 4BE7B 4RKEA 1G3MA 2V6JA 4D0LB 2W0MA 2ZIAA 3GLHA 2W2VA 5CB6A 4MYUA 4XOIA 2RCNA 5J4YA 4FCTA 1WE2A 3EZ7A 4WW0A 3VMFA 3ZD6A 5GJBA 4FMDF 2G6BA 1CS4C 2V9PA 1HY3A 2ZYVX 3AVQA 3ZIAA 1ZNWA 1DADA 1OIXA 2JIZD 4A8JC 2DPXA 1Z6GA 3A1SA 5FH9A 4AKGA 3MWKA 1U98A 2W6JD 4D82A 4CIDA 2PMDA 4M8NE 2QP4A 4PHFA 4P4SA 1COWD 4C0LA 1E6CA 2IK8A 1FQJA 5JMTA 1Z0AA 2YV5A 1A7JA 1LTQA 2HXYA 5JBQA 5FBQB 5JSZA 5L3QB 2QAGC 1NIPA 3AGQA 1R0YA 3P27A 1TTTA 4B74A 1P2VA 4MQBA 2ZE8A 2ZPTX 4B6FA 1XTQA 2OCPA 1IY2A 2BCGY 3ASYA 4AG6A 4AWXA 2NIPA 1R0ZA 1ZM4A 4LI0A 4JVLA 2CVHA 5DYGA 3KXKA 1N6PA 2JLVA 5FPKA 5KSZA 1U99A 3Q9LA 1OFIA 3OEED 1G7RA 1U94A 1PUIA 1ZCBA 4EPTA 3CH5A 5DISB 5TMPA 4LBYA 2EU8A 1N6OA 5HKKA 1E0SA 4NDZA 4DLYA 5EJEA 5FOUA 1QRAA 2PBRA 4N0EA 2C9YA 4ACBA 4YMVA 1T0JB 4RZ2A 3R8FA 1LVGA 1N6HA 1J99A 3HU2A 1XEFA 2PMKA 5JWOA 3L82B 1W1WA 3SEAA 4QBHA 3KUDA 3HYRA 2QPOA 3K53A 3QEJA 1E9FA 1M6NA 1Q1EA 1JPNA 3TR5A 2H57A 4BRUA 3ZVRA 5DHAA 4B44A 3BERA 3S1AB 2GJ8A 4KLZA 1KKMA 4Q7MB 3ADCA 3FHCB 3F3YA 5L3RA 3THXB 3HYTA 2ZI5A 3LWNA 5AUNB 2QUZA 4ASUA 4DSNA 3P1JA 3GMTA 4M53A 5FBLB 4BFVA 2UZIR 1XTJA 1A2KC 3KUCA 1Z0KA 1DO2A 1QHYA 2ZROA 3AV0B 3W8RA 2ZAOA 2C77A 1SQ5A 3EARA 3R9IA 3VX3A 3EWSA 5CDFE 5M04A 3O47A 3GFTA 4JLPA 2JEOA 4S35A 4B76A 1ZM3A 3VTKA 2FMXA 1N6LA 1CR1A 1MR3F 1OKKD 1QHHA 4GP7A 3DOFA 3C5HA 4KLNA 1IHUA 1QVRA 2NPIA 1N5JA 3UANA 2XNDA 3NG1A 1KDTA 4D4KA 4TMXA 2OO7A 4B34A 1T6NA 4D0GA 3R7WA 4QKQA 1W5TA 5KDDA 3BH7A 3CKLA 1XD9A 2A5FA 4HAXA 5J4LA 4NCKA 3RWMB 3VR3A 1LS1A 4JLJA 4OL0A 4DLUA 2VP0A 4V03A 5FBRB 4JBWA 2QT1A 1GKIA 1NJFA 1W4CA 2IL1A 4M21A 5DSZA 3X1DA 1JEDA 4LJ8A 1GNQA 1UADA 3HU1A 4V02A 1TMKA 3ZIAD 2GZHA 3OIVA 3QI2A 1G3IA 1E96A 5BN3A 4PC6A 5DN6A 2CHGA 3T5DA 1E9RA 3DMNA 3ZQJA 4EFMA 1SHKA 5GADl 4M1MA 1G21E 1O87A 4LBWA 3F8TA 3GLGB 3VAAA 1ZYUA 3BH6A 4TYQA 3MFYA 3U6BA 3EIHA 1MO6A 2D7CA 4FMBB 5KTYA 5FUXA 2QROA 2O8DA 1CR0A 1AIPA 4CW7A 2OT3B 1YR7A 2ZJBA 4Q1BA 5FPYA 2A7QA 2ANBA 4HB4A 3DEFA 4LYAA 4Q66C 4YXWA 3MUFA 8OHMA 4AKHA 3I8SA 4MYHA 1E2JA 2XXAA 1KO5A 1WMSA 2VLIA 4JMPA 5CK4A 3W9YA 1BOFA 1KK0A 2XTNA 3PUYA 3K1JA 1KIMA 2D3WA 2NO7A 5EE9A 2QBYA 5JJLA 1BMFA 2GXAA 1HQYE 4JSTA 4HSEA 2QNRA 3IBYA 2OUKA 1G6OA 4PO1A 2HT6A 1PLJA 4WXRA 1T9HA 4EFNA 1ZC4A 5IK2D 1II9A 5HZKA 1AA9A 4HAZA 4ZCLA 2RGBA 2OHFA 3BORA 5AK0A 1R0WA 4EPXA 5HKKD 3ZD7A 3DKPA 2CL0X 2Z83A 4A92A 5CLLA 1U0JA 1L4YA 3K0SA 3Q7QA 2QN6A 2ZSBA 5AJVB 1RC8A 3QNUA 4LV6A 1KI3A 1NIJA 3GLFA 3E70C 4DXAA 3ADDA 3L8ZA 1N6RA 4BECA 4JVSB 4TLCA 2NO9A 1JQJC 2Z5FA 2DFTA 1E2HA 3OEHA 4FMCF 4LPSA 4NHOA 2GESA 4A2PA 2XB2A 4ASUD 4B3FX 2ODWA 2KBEA 4Q9JA 2G0TA 4PO8A 2ZREA 5LB2A 1TAGA 3GJ0A 3EPKA 2VQSA 1EGAA 2R6DA 4GRAA 1NMZA 4Y0AA 2V7QA 3V00A 5KDOA 2W6IA 1QHIA 2O0HA 5EP4A 1P61B 1NN5A 3GP8A 1UEJA 4G0NA 4G3XA 4MA4A 5SZJA 4UNRA 3AEZA 4R98A 3WMFA 1HE8B 4OQLA 4MDEA 1HUQA 3PCRB 4RKFA 1FQKA 4W5JA 4A0GA 2J1LA 2XNDD 3TVDA 2MMGA 4POAA 4Q21A 4QHSA 1AZTA 2JLRA 4Q7LA 1UAAA 1M1YE 1VCMA 3SI7A 1Z8FA 1HEIA 1TEXA 4UNQA 2V8OA 4LJAA 2ANCA 5JCZA 2CEAA 1KO7A 2KWIA 2OM2A 2VP6A 4PZYA 3PEWA 1AQUA 1G7CA 1ZNYA 1D5CA 1N0WA 1NY6A 4LGMA 3GLHE 5KSPA 4HATA 5CITA 4OQMA 4KYUA 2F43A 2FNAA 5EE0A 4M22A 2VP2A 3DO6A 5DN6D 4KITB 4IJMA 1C1YA 4NU0A 1F60A 1DPFA 2ATVA 1S4QA 4H9GA 4Q4AB 3GLGE 1P75A 3NHAA 4KAXA 4JL6A 3TAHA 1MO4A 3B9QA 3DPUA 2R6FA 3JVVA 2N46A 4MYCA 3VKWA 2R6CA 3CWQA 3N5CA 2VTKA 1WDTA 1F2TB 4EJSB 4I99A 4PFSA 2V1XA 2ZRHA 4YXWD 1IN7A 2XZPA 3FE2A 1G4UR 1QHNA 1GRRA 1ZVQA 2FFHA 4LJ5A 3SJZA 1DAKA 4MRSA 2YHSA 2FF7A 1P2TA 2G83A 1NMXA 1W2HA 5K8LA 3EA0A 3CW2A 4ZCMA 1UF9A 2IS6A 2O8EB 5J5CA 4R2IA 3GLIA 3QEOA 2C9CA 4XJXA 4JLDA 4A4DA 4LBZA 1E2IA 3KKMA 1N0VC 3B5JA 2ZR9A 1XXHB 4Q5IA 5JECA 2UVQA 4YMWA 3VNUA 2P6RA 5JCPA 3B13B 5JHHB 3K0AB 2QE7A 5H68A 2D2EA 5FPTA 3RS7A 3SOPA 4MKGA 2GRJA 1TPZA 3LW8A 2XSZA 2ZR7A 3ZVNA 1UFQA 4I1UA 2CDNA 1UKZA 4DEYA 4URUR 1WF3A 1X1RA 3OEHD 1N5IA 1HQCA 2PCJA 3TMKA 3QOFA 5CIWA 4RSGA 3VR5A 1XBTA 1E99A 1OHHA 1Z0IA 2W0SA 5TXGA 1G1MA 3THYA 1S0UA 3ADBA 4TQ9A 4QHYA 2V7QD 3I1FA 1XMSA 5B58C 1GITA 3VU9B 3W3ZB 1Z2AA 3GD7A 3MWYW 5DNYB 2RGXA 5G3YA 1KI4A 4XWOA 1VG8A 1XDBA 4ZDJA 5KNCA 4JYBA 4M9ZA 2JLXA 1Z06A 3QKSA 4LHVA 1QG4A 5GVRA 2NG1A 2IYZA 1X1SA 1W0JA 1S9HA 2V4ZA 1E9SA 2YC4C 1G19A 2RAPA 3IDQA 3F0TA 3K0FA 4Q4JA 821PA 1J90A 4TYWA 4BFTA 1P73A 1FX0B 1Y63A 1G5TA 2F9MA 2JJ2A 3C14C 3GCGA 2W2XA 4U7DA 3U4QA 1GM5A 4IOJA 2DFNA 2XEXA 1ZRHA 3ETLA 2BC9A 3VR2A 2VEDA 4B32A 3I3SR 3P20A 1KJYA 4BQSA 1Q1QA 1XD2A 2XJ9A 3R9XA 3AF0A 4ZKEA 4CEIB 2FZ4A 4LJ6A 5FTKA 4BPBA 3UKDA 2QP9X 4TMWA 1JQLB 4DSOA 1BIFA 3KX2A 3D3QA 5D3MA 4DVGA 5JEDA 2GHIA 2LKCA 2R6GA 4P3YA 1SXJB 1XTRA 3WNBA 2VPPA 3QSYA 1VIAA 2X1VA 4TYYA 1OIVA 1OPXA 4ZDIA 2GK7A 1QBKC 2CJWA 4R71A 2ZUDA 3EX7C 1AM4D 1G17A 1TQ4A 4DRZA 2YOFA 2ZRJA 4EPWA 721PA 3C7KA 3UWKA 1WB9A 2GEDA 3BBPA 5TVKA 1IN8A 1M74A 1D6JA 1R5OA 3EWAA 4GZMA 5CJ2A 1NLZA 2VHTA 3ZS9A 2GNOA 1CU1A 3AP2A 3LVQE 4Q1FA 1FOEB 3QKRB 2P65A 4U00A 1G64A 3RS3A 3IQXA 2ODBA 2WZQA 4UNSA 1KMHA 2IUTA 4ACAA 4B33A 1E79A 4QG7A 3BS4A 3QF4A 3RANA 4TN1A 1HA3A 3B1VA 3Q5EA 1LV7A 2WWIA 1GNRA 1AS2A 2DR3A 1IAQA 2H7VA 1LY1A 4IVQA 5DI3B 3MJRA 4IW3B 1OSNA 2IHYA 3OAAA 2ZU6A 2ZSEA 1G41A 3LRPA 4GSYA 2OV2A 1FUUA 2ATXA 3OFND 4NP6A 3EIEA 4LCBA 3EXAA 4C0KA 3LVRE 2XSZD 4G01B 3ZZTA 3Q8XB 4OK6A 2V1UA 2BWJA 4NCHA 2BBOA 2DY1A 2IW3A 1U81A 1EFHA 1RRPA 2CCGA 4BFZA 1EK0A 3K70C 4AYTA 2DWQA 2GILA 5F3WB 4AK9A 2O8CB 4M9SA 5FUWA 5DH9A 4IDHA 1OHHD 3WP1B 4QFMA 2NGRA 3TSOA 4D4LA 3QE0A 1FP7A 2XAUA 1E1RD 4Q18A 2VF7A 2HT1A 3NVAA 4XVRA 2R8RA 1E4YA 4L15A 2V54A 2B8WA 4A9AA 2VL7A 1ZIOA 4LX0A 4P33A 2GVZC 3FOZA 1NKTA 4FW9A 1WXQA 1J8YF 1YZTA 2CLDX 3PIRA 4M9QA 4Q02A 5A0FA 4PC2A 4QHTA 1W0JD 2IYXA 2XJ4A 1K5GA 4MKIA 4Q9HA 4QJ3A 1WA5A 1ZD1A 2P2LA 2ZS8A 3BXZA 4PZZA 3RLFA 3QXJA 1T8TA 1RE0A 2FG5A 2JJ2D 3I5YA 4OI4A 1TUEA 2OFOA 3VKHA 3MCAA 1E3MA 3QY0A 2ZUBA 2KJQA 3KFXA 4QM7A 2PT7A 3FGNA 1DBSA 2GCOA 3H86A 5FOVA 4CEJA 4NZYA 3UMRA 2GTPA 2OAQ1 3CRQA 4D4MA 3PEYA 4AI6A 4OI2A 1XEWY 2VYFA 3L2OB 3I72A 1GAJA 3FWYA 1E2LA 1N2CE 4R7ZA 1RJ9B 1A1VA 1T5LA 1D9XA 3AVXA 1MABB 1DAGA 1P2UA 3DOEA 1NP6A 1ZMXA 4OQNA 2RGGA 3ZVMA 1W4RA 4HI0E 1B0UA 3K70D 4JLKA 2H8KA 4EUNA 3LV8A 2AD1A 2WJHA 1EWRA 3QXSA 2CK3A 2IYYA 4LHYA 5HR5A 2WMOB 3QKUA 3NBZC 3SYNA 4A36A 4O2RA 4JLOA 2OXRA 3NBFA 1T91A 1ZUHA 4P32A 2ORVA 4I81A 5E7MA 2FGKA 3DDCA 1E79D 3EPLA 4IFBA 3KKPA 4LYJA 2HDNB 3LO5A 2H1LA 3DZ8A 2DFLA 4K81B 2IXEA 5JWRA 1U0LA 3AVPA 3SJCA 1E1QA 3TGPA 5DYIA 3KQKA 2YOGA 4I1SA 3GLIE 2WTUA 1Z47A 2EWVA 2FPLA 1DAEA 1BH2A 1J7KA 4DWJA 1W0KA 1Z3IX 1I4TD 2C99A 3OAAD 5FPSA 1EFRA 2ZE5A 1DAHA 3M4YA 1XX6A 2F7SA 2YWGA 3REGA 1XWIA 2O8BB 5FTNA 1U0HC 4Q48A 1MRNA 1R8QA 1M7GA 2HEIA 1KSFX 3T61A 3X1ZA 5FI1B 3N2IA 2ZRNA 3GFOA 4RFSB 2HUPA 3AKYA 4URZR 2O8FB 4LUCA 3O8BA 2IWHA 2BBTA 4PSAA 2ECKA 4C3ZA 4GPTA 3FMPB 2WWGA 3QVUA 4IKEA 3KB1A 4II7A 4PO9A 1FFHA 1CJTC 3FHOA 2R65A 3MD0A 3NH6A 3DL0A 1N6NA 1Z28A 4N3NA 1E2KA 4JT2A 1W36C 4PPNA 1G20E 1NNEA 4LJ9A 3T15A 4FCVA 1E9BA 4IDQA 4Q4HB 5EUQB 3I61A 2Q3HA 4QC2A 3NXSA 3UMSA 2HV8A 1R4AA 3OIYA 5L3QA 4OHYA 3IPYA 3NDPA 3SZRA 2G9NA 1G7SA 2C2HA 2ZJ5A 1II0A 4BLSA 3SJBA 2W2TA 1XFAA 1VCOA 4IXNA 1II8B 3O8RA 4TTQA 1XPUA 3UXMA 4A0RA 1KI1A 3CH4B 3W5JA 1SGWA 1OXVA 2XTMA 2ZVPX 3W6NA 2GWHA 4PC3A 5CYPA 3B8HA 1NBMA 1T4GA 1Z0FA 2IYRA 4BWYA 3SE0A 4A82A 2AN9A 3QF7A 3GJ3A 1ZBDA 4HLQB 1FNNA 1XMVA 1P72A 3PV0A 5SZKB 1SVIA 1JAHA 1UBEA 3BGWA 2GK6A 2WWWA 2PZGA 2AK2A 3V4RA 4C0BA 3C5CA 1JR6A 1DG1G 4NYJQ 2FPKA 3OF5A 4LY6A 4UJ3A 5FTLA 5DLQC 2J0UB 4TL9A 4ZIRB 5C2JB 1G6HA 2WVJA 1UKVY 3CNNA 1CJMA 1Q3TA 4JT4A 3LFUA 3S1AA 5KNBA 3B85A 4ERNA 2GZAA 4WIAA 3A4NA 2PJRA 2NO0A 1A4RA 4JSYA 1EFTA 4DKXA 3TR0A 2G1JA 2GA8A 3THXA 1W36D 1XCGB 2GKSA 3GJ8A 4ARZA 1X3SA 1G8FA 3MSXA 2FN4A 1VG9B 2VSOA 5AJWA 3FKSD 5HCNA 2PLRA 2BKEA 1KDPA 3RAPR 2OCYC 1OFTA 3BJIC 3CF6R 3RSLA 1E1QD 2ZJYA 5AUQA 2MSCB 4B2LA 1XMJA 4XH9B 1T0HB 4ILEA 2C98A 2ZRCA 5FOTA 5CB8A 2A30A 3QPVA 4A0FA 4Q9IA 1EFRD 3AF2A 1X8KA 1F5NA 1DVRA 1VCIA 1VG1A 1KJWA 1I2DA 1M8PA 2QEQA 3CUEF 1U8YA 1JEEA 4DLXA 4UXJA 2IC5A 1M7BA 2ZU0C 5F98A 1PLKA 2VBCA 5E4FA 2A5GA 1Q0UA 3JZAA 1GL6A 2W83A 4GBMA 2QL6A 1NVXQ 4OI1A 1LNZA 4YQFA 2AFHE 1C4OA 3K8YA 2QGNA 4OK3A 1Z5ZA 4CZ2A 4DCVA 1EXMA 4DDWA 3CRW1 1OH5A 1BYIA 3OE7A 4WA7A 3G82C 3LXXA 3VR6A 2OSBA 2MMCA 3IEVA 2WSMA 4DB2A 3KQUA 3TQCA 2JDID 3W6OA 4KBFA 2KBFA 4QGHA 4I4LA 1U9IA 5CM9C 5H70A 4W9MC 2JJ1A 4A2QA 4F92B 2WAXA 4M1KA 4DCSA 3AQ4A 4PSVA 2XITA 3DVLA 5G41A 1P60A 2LCFA 5FL7D 5AWFC 521PA 2G0NA 4ZI3A 3AF3A 1RZ3A 3GJ5A 2NPFA 1HT2E 1ZUIA 2J87A 2ZI3A 4NYIQ 2PX3A 3WY9A 4GFDA 1K8RA 3CIOA 1FMLA 1V43A 3KB2A 4AD8A 4PQFA 1N25A 3ZS8A 2PL3A 2WJVA 1LFDB 1H8ED 2ZITA 4WXPA 1IN6A 1KO4A 1VCNA 1XTSA 2FGJA 2ZEJA 4GOJA 1AS3A 5FR2A 5AUOB 3FFBA 1OH7A 3KKOA 3TSZA 3WXMA 4DJTA 4A8JB 5H1YA 4M1SA 1YZUA 1S9DA 3IQWA 1KK2A 3UWOA 2IHBA 4QJ5A 4EIWA 3SS8A 1E2MA 2R2AA 4V0MA 1U9IC 3ZLJA 3EZ6A 1XPRA 1R0XA 2VO1A 2YINC 4YDSA 2GZDA 2E87A 1OIWA 1G4AE 2BM1A 2ORIA 2QAGB 1WP9A 2PEYA 1I4DD 4A1FA 4LJ4A 4RCZA 5BW8A 1AKEA 1GFIA 4EQ6A 1W4AA 2ZSFA 3AVUA 2WM9B 2D4HA 5K8TA 5HPYB 1NN3A 3HR8A 2LWIA 3RC8A 1HH4A 3BK7A 2EVWX 2H18A 4BASA 2HXSA 5AUPB 3WNDA 1GL7A 4LJ7A 3GLHB 5C4GB 3IHWA 4WZAE 4M1TA 2WV9A 1E2GA 4D25A 4EKDA 2EW1A 3W5IA 4DBLC 1TUIA 4HDCA 2YNMA 3B9PA 5IT5A 2NQ2C 4NPHA 3I5XA 3A8TA 3CZQA 4HLDA 2FH5B 4KFRA 1KO1A 4JLAA 4U02A 4DCUA 4H1UA 2CVFA 3WHLA 1NVVQ 3N70A 5JEEA 1X6VA 2ZRMA 3THWA 5DO9A 4MGZR 1S3SA 3BRWD 3AVOA 1O3YA 2BHRA 2H5EA 2ZJAA 1SKYE 3SQWA 2OCAA 5L8VA 4US0R 4F38A 1TU4A 2O0KA 3BB3A 3TH5A 2ZUCA 3B1ZA 4W5HA 2PZFA 5LD2C 4C7OB 4PX9A 3ICQB 4CRWB 2FOLA 1DTSA 1NSTA 2OBMA 4W7SA 1BS1A 1E9CA 1UPTA 4OHVA 3P4YA 2B7CA 3QVVA 3J81k 3MWJA 1DELA 4FD2A 3DHWC 1F2TA 4EJSA 1CRQA 2EFEB 2AWOA 1G18A 1QDEA 2JJ1D 1A5TA 4QXAA 4OQFA 2AL7A 3KJEA 5EUMA 4G1UC 3BD9A 3QPUA 3CPHA 4Q19A 3PQCA 5EZ5A 1DEKA 4E22A 1KKLA 2IYWA 2J5XA 2WJIA 5KNDA 2O8EA 1JJ7A 3JZMA 5J4KA 4JLNA 4AYWA 2I1VB 1TQDA 1ESMA 2HCBA 5JI3E 3AM1A 3HPQA 1E98A 2DFKB 1W46A 3BB1A 3PXGA 5KSOA 1XXHA 1K5DA 3A1WA 1RIFA 3U5ZB 2FFBA 3K0AA 4D81A 2BKUA 1KMQA 4ZDWA 1CR4A 1RRCA 3KJIA 5E95A 4PXAA 5LBIA 2WHXA 4RZ3A 3NH9A 3K9GA 2WOJA 3ONWA 5C1BA 2ZYWX 3U3OA 5LB4A 2YOHA 3LA6A 1UJ2A 5HCIA 1GP2A 3MAAC 4BFSA 3WRXC 2NZ8A 3RVBA 1R10A 2VHCA 2CNWA 5EP3A 5AJZA 1DG3A 1MO5A 3Q72A 3NTUA 4CT5A 2ERXA 4RD3A 4W5WA 1QHHB 3WNCA 3N2EA 5P21A 2F1IA 1P9RA 4TMTA 1RKBA 4G5QA 1VTKA 3EAQA 4PANA 3REFA 1E9EA 1YKSA 3B1WA 1Q21A 1TQ6A 2Q9AA 4ZO4A 1DS6A 1EG7A 3L0IB 4V0LA 1VYVA 2V3CC 1JAIA 1SVMA 1OE0A 2I3BA 3R7WB 5KUTA 4DB4A 1CBUA 1AGPA 2ZRKA 1E2DA 1TU3A 3PUVA 1YU9A 2TMKA 4LV5B 4LOAA 5TV2A 2ZRGA 2BCJQ 1JJVA 4M9XA 4K46A 1Q57A 4R9UC 4O0MA 1SZPA 1LF5A 2NO1A 3TW4A 1ZM7A 4LC0A 2AKYA 2HJVA 2WPDA 3KZ1E 2ZSAA 4GOKA 4FWTA 2B7BA 1OFUX 5FUYA 1OLOA 2RGDA 3C8UA 2GEVA 1KI2A 5ELXA 3U7EB 1T8UA 3IKJA 1W44A 2O8DB 2UKDA 3H2YA 5CM8B 2ZRPA 1ZP6A 1SXJA 1Z6TA 2KE5A 1YRAA 1ZNZA 4HB0A 4QGGA 2P67A 2VSXA 3OESA 4BLOA 1MKYA 1J70A 1BMFD 4C9BA 3U3RA 3U44B 2X2EA 1RYFA 2XXAB 5JS8A 4PC1A 4HDQB 1IY1A 1L4UA
chains in the Genus database with same CATH superfamily
4PS0A 1TZJA 1P6QA 3H0KA 4Q1VA 3FCEA 2ZRLA 3VO1A 1J9EA 1CUHA 2GBLA 2K2WA 3LU1A 4ZCTA 5KNDD 3DDOA 1SEPA 3C7DB 2FPRA 1QPZA 2XWSA 5CH3A 5FUBA 1NJ8A 2I34A 2Y2VA 2ZIFA 4HDAA 5ALWA 2GDZA 3HVUA 1Z7YA 3CJRA 1E4EA 2I8LA 4BRSA 1DAOA 3L0ZA 1H5UA 1QQTA 3BFKA 4CFSA 4RK6A 5BT8A 1PNTA 4MR9A 4MWBA 3NT2A 4KJXA 3JQ8B 1Z7GA 2PWAA 4OYYA 2ZRFA 1GQFA 2GAIA 3TXXA 3HVJA 5JASA 2ZXUA 2ZT6A 2R8OA 3G9ZA 1U0GA 3P0FA 3IGFA 4CT0A 1JMYA 4BLWA 3T5GA 4BL5A 3T7EA 4HGZA 1EK6A 5DBHX 1S8AA 3OETA 2QQEA 2FUKA 4IVRA 4A0HA 4ALNA 2GEBA 3ELBA 4YAJA 2KM1A 4FFRA 5JQGF 2CYBA 4N8EA 4YP5A 1NSYA 1KOGA 1BHJA 2H17A 2QQFA 1C7FA 3IELA 4G56A 4HZUB 3J80A 2BGLA 3N8IA 2DUJA 3A1UA 4P7GA 1QP0A 3FUUA 2GD1O 2AG1A 2RB5A 5FO0A 3NBYC 1NNUA 4GI7A 4HLUA 4J76A 4FMCB 3MHTA 1IJKA 5BNZA 3GIDA 2QVBA 2FWRA 2XWPA 4P1ZA 4HYYA 4K40A 5AOBA 2HU8A 2ZE7A 1GNTA 1GARA 1ZRNA 2BHSA 2CXHA 1V3QE 2Z2YA 1C8KA 2BMAA 2GBLC 2MDTA 4Q03A 2LCQA 4R1SA 1DT5A 3SIPA 1RAHA 1JKFA 2EERA 3MUOA 2GBGA 5BQOA 4D3SA 4NAHA 5KI6A 3RO7A 4LXTA 1NVUQ 2Y67A 5AHRA 3PQDA 4BLTA 4AKSA 1J6UA 3A2NA 1Q14A 2VP5A 3N8GA 2O3RA 4KQXA 4RENA 3CJQA 1RYYA 2EGUA 4UE3S 3RFTA 3F3KA 4DM3A 4EP1A 2HO5A 4QXQA 1MJ5A 4JI8B 1ZOPA 1CG6A 2XNSA 3V8BA 3TN7A 4BV9A 4UKDA 1UT6A 1X8JA 2QA5A 2ZBQA 3PG5A 5DM1A 3AETA 5BQ3A 3U4HA 2QMUA 3EF3A 4KMMA 5T7BA 1QX3A 2DYKA 4B3SB 4JBYA 3DB2A 2D0OB 5JPDA 3SQLA 2HZ7A 1QF7A 2HJGA 5MFPA 1POWA 2WIAA 1I3NA 4ESVA 1C50A 1NRJB 5BN1A 4HRYA 1A82A 2BMWA 5J2TF 1KDZA 4AAYA 3R9WA 2BP7A 5ESXA 4IZ6A 2BGRA 3RT7A 5KYVA 1O08A 1KJQA 3PUZA 5DBEX 3A25A 3EGEA 1MIHA 1G98A 1TECE 1BN6A 4HLUC 1YFKA 1M9NA 2EEPA 2JGLA 3JAKA 1YRHA 1LJLA 2I4RA 2Y92A 4M0CA 4ND4A 4ODIA 3UWSA 4GC5A 4H3HB 2ZJOA 4MW5A 4HVLA 4OATA 2WJZB 3ETGA 2PSDA 3IKLA 4Y6LA 3UV6A 5GTDA 5FBWB 3LQQA 3M6MD 2QQ0A 1DCTA 1NG9A 3L6BA 3KTDA 1ISRA 3HKCB 3HJNA 3EAGA 3VPXA 1QJCA 1ODFA 3JY6A 2QTBA 5DX0A 2C03A 3LT0A 1U7UA 4OJKA 4NOMA 2BZGA 2REXB 2YKGA 1QIHA 3CPJB 1FLVA 1VMKA 2DBZA 2OXIA 4O4IF 5ITVA 1UZAA 4TKVB 2ZJ8A 2GH1A 2M6RA 5LM3A 2YIMA 4JSRA 1DAIA 1Q0SA 1I5RA 2XY4A 4JJKA 4AP5A 2IHTA 4FM9A 3EC2A 5HOEA 3AXSA 4F4FA 4E5DA 2QE7D 1J1IA 3UAZA 1UMCB 3JU3A 2UUPA 3NP7A 3BSFA 4A8TA 3I2JA 3SIWA 3AWIA 4JVMA 2HLNA 3A28A 2ZJFA 1X14A 4QT4A 1AQYA 4GWKA 1SCUB 2DQKA 2LPMA 3D6TB 3FFTA 4YR7A 4RY8A 5BV7A 2V03A 4L1KA 4XYEA 2BBSA 3QXHA 4EUSA 2OBXA 2OV1A 2FZEA 4XGRA 4LZAA 2GPWA 4EG8A 4QFDA 4TLBA 4YQEA 3PQ6A 5F33A 4BKRA 3SMVA 1U3UA 3NTQA 1NLUA 4D8YA 4LA4A 3P9CA 3AT1A 3CVOA 1OXTA 4KXFB 1AKQA 3I92A 3TL2A 1OLXB 1QR6A 3PX7A 3HL0A 3KKZA 1R4NB 1K8ZB 3KL4A 4GXNA 1RACA 1FB5A 2WHPA 5IBQA 2F8TA 2I7XA 1RI5A 1M0WA 3NETA 4DRYA 1ZJZA 4YRKA 2Y93A 2EL9A 2OBNA 1C1DA 4LCEA 4ZARA 4BDSA 3H5LA 3KZMA 4LZOA 1P17A 5L3SA 4D9FA 2AFIE 2RGAA 3VH1A 1AMOA 1TQ2A 3ONEA 2GN0A 1KBOA 1ORTA 3VKFA 4GGOA 2WTAA 3G2HA 3LQRA 3KLBA 1Q1AA 1M8JA 3RVPA 3VYRB 2WQ7A 2QI9F 3EZFA 3RTDA 1ZC3A 5BV1A 1NKSA 3FPSA 5A5GA 2PH3A 4YPFA 1FS5A 3GEIA 4LJYA 3FYUC 4L8WB 2HLDA 1R66A 4F46A 1U0TA 2WM8A 3DE0X 2KSQA 1NVVR 2FEMA 3G9QA 2O2JA 5THXA 1DOZA 4FKZA 3MVEA 3ZY2A 5GV8A 4ML3A 5CNJA 1FLAA 3W90A 1CS0B 1N9GB 2WPNA 2VBFA 2YV1A 1WAMA 3QW2A 2CXXA 3BF7A 2ZRQA 3OSUA 4QDTA 5CDUA 2J9FB 1E2BA 3NOQA 3ZDCA 1OU0A 4MQEB 4MRRA 1II8A 3FMFA 2DG2A 5AVRA 1D2GA 3LZDA 1SUFA 5H59A 2AEJA 4QUDA 1ZSYA 1NW7A 5TQ2A 2VOEA 3DM5A 1XPJA 5MGNA 3KYDA 5CJPA 1DBRA 3RUIA 2J9RA 2QP3A 2F67A 3WTBA 1US8B 1GXSA 1X1EA 4XPIA 3IQEA 3HH8A 1U3TA 4FI3F 3RC9A 1XWWA 3H6GA 3PYXA 1KARA 2W00A 2OORA 4UC0A 3T35A 2PKXA 2H1SA 3ZCSA 1E3QA 3I32A 3WB2A 2VDUE 2X4IA 3VBEA 4B4WA 1A5AB 2B4KA 3W7AA 1GRNA 2F62A 3DBRA 1PFQA 5BMVA 3P9YA 4MYTA 2GBFA 4TWIA 1OI2A 3DOOA 3I6QA 3ZTTA 5IXSA 4I1VA 5FTMA 2PQ0A 3E0XA 2LTAA 2XZDA 2JJ8A 1XNJA 2KMLA 2FSGA 2VDOB 2IIVA 4FFPA 1DCMA 1ZH6A 3O8LA 4QPDA 2FFJA 4L07A 4ZI2A 3HADA 1N2SA 5HSGA 3S81A 3N87A 1UDXA 1V8ZA 2QR5A 1GPYA 1QFXA 2JLSA 2Z4SA 3G23A 4RHUA 4XJTA 1XZHA 3NHYA 3QXXA 1HM5A 1IM5A 3Q7IA 2Z0MA 4FZ3A 3MT7A 3A6PC 1XAHA 1HR0B 5TGDA 1X1QA 3FYUB 3COZA 4OG2A 2QSYA 3GVHA 1JZSA 2DQSA 1QQ5A 3W4IA 4DLNA 1HDRA 4YDHB 3H1AA 3KTAB 3HGTA 4CMKA 3PDJA 1LDMA 1T6XA 2YRXA 1NDHA 2XLCA 2D13A 3M0EA 4EGQA 1U2TA 2FKNA 1WCWA 1BWSA 4R01A 2Y0CA 3DTVB 4R7TA 4WY2A 3TX6A 2AFHB 4IS2A 1JLKA 4GMKA 2ZR0A 3KP1A 2RGRA 4LC9A 3N2YA 3AFGA 1I7SB 1U6KA 1L1EA 1ZVJA 2XNKA 3HB0A 3NWBA 4KYIB 4L73A 3AX6A 3A1FA 3GZNA 1LS6A 1OBHA 1AGYA 4JQCA 3CVYA 3AUYA 5AXCA 2ZSIA 1D2EA 1BS2A 2GAOA 16PKA 2XQFA 4KO8A 3DP9A 3LBHA 1ULUA 3U13A 1XSEA 2JIZA 1ONSA 3CZRA 4QTXA 1T6BY 4HNAA 2VPWA 4EW2A 2FSHA 3GQBA 3SXUB 1YCDA 3STWA 2P9ZA 1GPLA 1P1RA 1IMOA 3ZUPA 3HKBA 3TSCA 4AO8A 1KJIA 3IUMA 3TUZC 2C0QA 3F3MA 2GI4A 1ZCZA 1QRDA 3MMXA 3FCUB 5KYXB 1XNHA 3LY7A 5DHPA 3DOCA 3MK31 4YA6A 1YL5A 4HLCA 5GJWC 4C7XA 2H1IA 2ZYUX 1KFKB 1E6WA 3ZHYA 3O2NA 5JS7A 1THMA 1LI4A 1QUFA 1TQHA 2ERYA 3PX3A 4A6XA 2AKAB 1Y8QB 1GPNA 4CM8B 3DHEA 1A8HA 1IUKA 3DXZA 1KEWA 2W2LD 4L02A 5K0GA 1YK0A 1SH7A 5JANA 1RABA 1N78A 3LYLA 3U3JA 3L4BA 3TINA 2EG5A 3OEEA 4C03A 3CUUA 2XB4A 2ZAMA 3L7MA 5M7EA 2FQYA 1EP3B 2J3EA 5CLFA 4D3YA 5EY5B 1NBWB 4QTUB 4ND8B 4KR9A 3JTEA 4HL6A 4S1VA 1XMPA 3QLUC 4TSKA 1QH1B 3FOFC 2OTCA 4DWOA 4Q9KA 1CZRA 4DA9A 4CVNA 1Z5NA 3U40A 2JZOA 3NWEA 1X7WB 3LH5A 3PC2A 4XUEA 3EXG1 4YCCA 3TQRA 2WWHA 4R5MA 4AX8A 2HBZA 2Q8QA 3KSAC 4UVDA 1L3IA 1CFJA 3HY3A 4Y18A 4XIJA 2X2FA 3TECE 2FJUA 4XWTA 1BKDR 4NBRA 1KK1A 4KMRA 5KMGA 2QRKA 2IH4A 1GZ3A 3FUTA 2QGZA 1B73A 1N2OA 3H97A 1B42A 3WGTA 4AS2A 1DCKA 5KJFA 2IT1A 1P7PA 4BFWA 1NJ5A 1VL2A 2ZIZA 1E66A 3WRWA 5C32A 2N0SA 2GCNA 2OCKA 3MJSA 1HQDA 4JA0A 1W36B 4PAOA 2W98A 1AVTA 2VPYA 4JLVA 1U0FA 4L5JA 2XE4A 1E3SA 4JMLA 1KFEB 4Y1GA 1ZVMA 3EQZA 3K32A 4MZXA 2H1RA 5J2UA 2Y6VA 5ECDA 3DYIA 1MDBA 4P7JA 2XODA 3L5OA 1P77A 4AKEA 3HN6A 4BUCA 1SBHA 4G36A 4D6PA 4DMUB 3ENNA 3L4BC 1LLQA 1OV4A 3M6XA 1EVJA 4L9WA 1YRBA 4MUAA 1SKAA 3FYSA 4OF4A 3TSWA 1M1YA 2X1MA 3ABIA 2XVMA 2ZJZA 4FC7A 4J1TC 2GD6A 1AX9A 1GL9B 5TF4A 3DV9A 2Y4NA 4KACA 4OP1A 3WSTA 4TXNA 3RABA 3ZLUA 4JK3A 5BWMA 1Z2CA 3PR1A 1YOBA 4HV4A 1NXWA 3E1SA 4RZUA 1R12A 2D2XA 1RRMA 1WDMA 1FQOA 3AF5A 1EFVB 3ED5A 1RZRD 1T36A 1FTNA 2IVFA 5KOIA 2Q3BA 3IBGA 4DMKA 1QQ6A 4HQOA 1Y33E 3AZQA 1C80A 3DT6A 3RGGA 4EYSA 3ZJUA 2DHCA 5KYYB 3ZHUA 4CLOA 4W5OA 4W9RA 3N58A 2BM9A 4NFSA 2VZEA 5HZHA 2DWUA 3GEEA 5EZSA 3WHIA 8GPBA 4L75A 3DV2A 3GLGA 3AESB 4H3KB 3O83A 2I78A 1IOZA 1S1CA 2IZOA 3OQIB 4B43A 1FJXA 2NO6A 2REQB 1AC5A 3R5TA 3IE2A 5IHPA 4M0MA 3VBCA 4F93B 5JZMA 1KPIA 3CS3A 5EQDA 3UY4A 5C7YA 4UM8B 3V9PA 4H27A 3G5MA 3M6IA 3UC5A 3GLRA 1P5FA 4R81A 2H2FA 1VE3A 1DV2A 1RXYA 2IHVA 5FXMA 3WIEA 5JI2E 1EP2B 1X2BA 4B3XA 2A5JA 2VXOA 3M6VA 4XVUA 1JBQA 3GNLA 4RMJA 1S5PA 4PLYA 3BQNB 4CLDA 5IKEA 1K7FB 1MJHA 5EE1A 4RNCA 2XPCA 4NZOA 1SU6A 4Q3DA 2JLAA 4D8UA 1RT9A 2Z56A 1NBMD 3KCQA 3DKVA 2VDVE 1X86B 4DLVA 3WK8A 4TZ6A 2CHVA 1Z2OX 1GKLA 4JJIA 3TQIA 1OFHA 3NYRA 1GRQA 1JE0A 3FR8A 2CE7A 3RFCA 1Y37A 3ZU5A 5IBCA 4MAMA 4CQLA 4YAGA 3ZWXA 3A1TA 4C14A 1W49A 3N0TA 1T8WA 3ZCUA 2P9JA 1DI0A 3TL6A 1DJOA 1WUJS 1CFZA 3JZDA 4MCJA 2WV7A 4M4SA 2PY6A 2YJTD 5CW2A 3NORA 2FW9A 5ALKA 3ZU4A 5HWSA 3N7TA 4L27A 2M2IA 2ON6A 1K2WA 5DJ5A 2HPHA 1QIEA 3GPIA 3ONDA 4ZD6A 4WESB 4HRVA 2HHHB 2VTBA 1JR3D 1M10A 5JDIC 4XXHA 3RUPA 1R5JA 3WGOA 1EX6A 1BE0A 2W6ZA 3AIKA 2YY5A 2AQHA 3MGGA 2Q99A 3PNQA 4KRXA 3P19A 5EERA 4ZOLA 3CX8A 4I9NA 3D8RA 5B12A 4MUFA 2R00A 2QUKA 2WJJA 4LWOA 5KCMA 3FWZA 3RS2A 1FVXA 1E7YA 4BVHA 4NBWA 4YMSA 1AKRA 5DTIA 5AW6A 2EIHA 3BDVA 3DS8A 3HA5A 1BXZA 2P8SA 3O4RA 2VJQA 4QD3A 2X14A 2QUIA 4WOPA 5FCDA 3BM5A 3UICA 4ARZB 5COQA 4B3CA 3IVAA 1CNEA 4BCBA 4DMCA 5ICGA 3V7NA 1Z3CA 2E5FA 5LBTA 4UCXA 4KHZA 1JAXA 2IY8A 3GFPA 2FZWA 1MV8A 4JUFA 3FI0A 4DLRA 3OO1A 4ARBA 3J7TA 4NESA 5K8CA 5B6IA 3NVKI 3LXRA 1UZLA 2DBYA 5IABA 4RGVA 4XTRA 4PAWA 5ANRB 3WK6A 4BP1A 1WBBA 5C8VA 2RMKA 5J4HA 2EYUA 1CJUC 1H8HD 1E0KA 1WHSB 2AHOA 2ZI6A 4OQXA 4PHGA 1WZNA 3UM9A 1J22A 2WNSA 1RWKA 4HN9A 5CXXA 3G0HA 2CXTA 5JXGA 4L2IB 4EEXA 4D9IA 1B8PA 2DVMA 1QHGA 4GR9A 3RUDA 1GQSA 4G0ZA 1L4KA 4PCLA 4NZNA 3U3XA 4JVNA 3JASB 1GNVA 5G40A 4O2BA 3VPFA 1L7MA 2RHDA 1XL0A 1U0OC 1WDWB 2FQXA 2J07A 1UINA 2GPSA 3CNQS 4WT7A 1RVDA 4MKZA 2CJXA 4B6EA 4R05A 5JSZB 2R00C 3CLSC 1CEEA 1RAFA 121PA 1XT6A 2JAWA 2DFPA 1YC2A 3I6ZA 3FPGA 3K2QA 3KKLA 3GC6A 4MR8A 3ZNOA 1KP2A 1R6BX 1VL5A 1EGVB 3I9KA 3TIFA 4TOIA 4YV7A 1PFWA 2RJNA 1I33A 2C04A 2QN9A 1LJUA 1M34A 2PNFA 4LXIA 4MV0A 4ZU1X 3K9BA 5ELLA 4DCJA 5C8YA 3ET5A 3GG9A 2GEUA 2ASEA 3GJRA 4ZCSA 2QXYA 1I2CA 1P2DA 3T3HA 2WMNB 3CUVA 2B30A 3Q8WA 3SM3A 1Z4IA 3K96A 1IJBA 4RDIA 4F4IA 1C8LA 3MC1A 4GKAA 2YW9A 3D59A 4C2BA 3ANXA 2A1IA 3MLEA 4K88A 9ATCA 1PT5A 3HLTA 6Q21A 4YO7A 3OTGA 3LBIA 3U44A 2X19A 2W58A 5FNZA 4BVEA 4X6UA 1RYMA 5CEFA 1NPTO 1YS1X 4BVBA 1FP6A 3AF6A 4UATA 1FPQA 1QH8A 3U7IA 2PS9A 2XWJI 4CMJA 3CX7A 3G0IA 2VZLA 2WYWA 2YWXA 2REOA 2AYYA 3JRWA 3QHQA 4FGZA 4JGIA 4TV9A 1Q16A 3SY8A 2N75A 4RCYA 3VTFA 1P29A 2WF5A 3WISA 4F11A 3D31A 4Y0NA 1QAOA 1K0UA 3H1FA 5CTAA 2AOWA 4GYJA 2GPJA 4CR7A 1QVZA 1MAUA 2H2DA 3AWDA 1G16A 1ZZEA 2R8YA 1ORIA 3WWEA 2OCBA 1NUAA 1ZU5A 4U5XA 4XWAA 5DX1A 5BOVA 4EY6A 1IBKB 1GDDA 3VHLB 1KORA 2G88A 4IUYA 3GBPA 4TL7A 4PNEA 4FGSA 2XADA 1G3RA 2HJ9A 3QOXA 4YRNA 3VQTA 1DKLA 1F8XA 1ZONA 3I30X 3JATB 4N1AA 3GH3A 4BFXA 4CHTA 2E4UA 2QQ5A 1SBTA 4ICIA 4PLZA 3UGJA 3A2LA 3AKEA 3BJRA 4QU0A 4EJSC 4WKNA 4D8WA 4P58A 3HFGA 1TUBA 3DB1A 1T5SA 2R60A 1FA9A 4IEIA 5B7NA 2RKBA 2VDMB 1NN1A 3G7UA 2ZTSA 4N39A 3ZS9A 3BD6A 4ENQA 2YZGA 4OGKA 3RKUA 4Q1CA 2ZKLA 1QONA 1UBJS 3QX7A 2HY7A 4IV5A 4AW9A 5ALZA 3LY9A 1I24A 2LKDA 4N5HX 3CRVA 4P22A 2NTVA 1NN0A 2FW6A 2KQUA 2G5CA 2QF7A 5JCJA 1ZUNB 2NYRA 2QAJA 3OJXA 5JMOA 4PX2A 3P26A 5DT2A 3WFIA 1Z6ZA 5CJJA 4CM7A 5JXIA 4FOSA 1IWOA 2XCOA 3L41A 2OBYA 3QIAA 5AKIA 2YNMD 3LNCA 4HEJA 5G0TA 2D62A 3W0LB 1OB2A 3DZHA 2XYVA 1H0KA 1N7JA 6YASA 1KTIA 3ADOA 2AD5A 4BNTA 4EF6A 3WGVA 1WRBA 3BEOA 3L0OA 1BYUA 4P82A 2ENWA 5C8XA 3DWFA 5CG1A 1LQ2A 2J0VA 1SQFA 2OO3A 3LLUA 3T3IA 1JDPA 1N0IA 1ISHA 1ZN2A 2DPYA 1RXCA 3EDYA 3NNSA 4OUDA 4FFDA 4CFZA 3L0SA 1ISJA 2JAQA 3LC7O 3RR2A 4TSFD 1GL3A 4G89A 2PRJA 4N5MA 3KOZA 3ERCA 5HKAA 5HDQA 1DXQA 3N6RA 4CM6A 4HAYA 3I76A 4PWZA 1R6VA 4DTIA 2JD0A 1P3DA 2P3QA 4G4IA 4ENTA 1WXDA 3PJGA 4OLAA 4R54A 2J7PA 4FILA 4IMIB 1DX4A 5BW6B 3PL5A 2OHVA 1KOFA 2XDAA 1QHEA 3ELUA 2GFHA 4YYEA 4OSEA 1KJNA 3NHBA 1CX9B 1ESDA 2FFQA 3KXLA 1SVOA 5LA6A 2G8LA 4V24A 1Q20A 1S3GA 2IP4A 3AVWA 2WUEA 2IY7A 4AIRA 4Y6GB 5B3JA 4BQEA 4RK1A 3H19A 4YBRA 2WHEA 4INZA 5K0JA 4YLEA 1S2NA 2ODQA 3ZVLA 4TMVA 3P0EA 1PW5A 4QQNA 4C0AC 4C0SA 1YZNA 4B4OA 3OZUA 4LTMA 1C9NA 2FK7A 1Y8RB 3C4QA 1K0FA 4IEEA 1F2UA 3P97A 4JY7A 5L4LA 4UUOA 1LD3A 4ER6A 3NS7A 4BATA 5E9WA 1VL0A 3MWEB 2O19A 1E2UA 3RB8A 3GLFB 1PF7E 1QE0A 3OU6A 3Q3VA 3LOUA 3F5QA 4N3CA 4BNYA 4DNOA 2IHJA 1IQ0A 4IIJB 4C07A 2OVBA 2AQKA 3G17A 3I1YA 1SXJC 4BXOA 2W4QA 4EB6A 4OQZA 1GU0A 3W4JA 4Z2YA 4BAUA 1H6AA 1HDEA 2G4VA 4KQMA 3O4JA 4CF6A 2VF5X 5KHOC 1ADCA 1JLLB 4BGDA 4L6CA 1AGRA 4WNAB 2D0IA 3DLPX 4M1EA 4B6SA 4UM9D 5HRAA 1ZMRA 4WZBB 2H2WA 3TGLA 1X7YA 2O8CA 4J1QA 4MB0A 3CKMA 4GNRA 3QFHA 3W3AA 4KU4A 4QA9A 3VYSB 1ZINA 3S4YA 5BQ5A 1FFDA 4IIHA 4D80A 5A6VA 3DZBA 5B3JC 1UM9A 2R62A 2XT6A 5MN4A 4ZQGA 3HWSA 5IT0A 3H65A 1OA1A 4HMOA 3PC4A 3L5KA 1EP9A 2X3YA 3MINA 3EH1A 3JWPA 3WE7A 4QFCA 1PL8A 1KGSA 1F9AA 2R9VA 2NO4A 2YZ7A 5JJKA 3OQPA 2G70A 2ZAGA 3NEPX 1PKEA 4B3TB 2F1JA 1CP2A 2XVAA 1CR2A 1I3LA 1IK4A 1OZGA 3NR2A 5DEOA 5BOSA 4K0RA 3UAGA 1B0PA 2HLHA 3PUJA 2AHRA 3I6BA 5BV0A 2FR8A 5C8ZA 2WJWA 2O2IA 4AYXA 1N3YA 3DW1X 2XBUA 4JL5A 2F43B 3VDMA 3DT9A 1ZISA 3OMWA 3P0JA 2ZBRA 1IQRA 1Z2PX 2Z2KA 3KOUA 3LX6A 3NDIA 3AFNA 1EYZA 1MOZA 4LW8A 1USVA 2LZ0A 3H75A 1W2GA 3FPBA 4JJZA 2CFOA 1GUBA 1TMOA 3Q12A 1XUOA 1KNQA 2VNJA 4FP9A 1FPMA 4IJ5A 4EPRA 2ZWPA 5CTJA 2BH2A 3O7MA 1GTRA 3T4EA 1MABA 1Y1QA 3FZYA 3IAS1 4KN9S 4D02A 4KFSA 2QL9A 3QG1A 1RW4A 2VJMB 2A1TS 4C6HA 3VR4H 4D4JA 4DSZA 3RSFA 2POQX 3A3KA 2I2XB 3PEEA 5KAMA 3U60B 3AEYA 1YOVB 1IXKA 3CURA 3DP7A 2G9QA 1AO3A 2VQDA 3QLVA 2JGEA 2PKQO 1E2PA 2AVDA 3G79A 1FEZA 3N8HA 2EW2A 3Q0IA 4OB7A 1E3JA 4NENA 4U2BA 3RSQA 3GNTA 1SHJA 2J9ZB 5A4AA 4OYHA 5GVSA 5LZ2A 2Q3CA 1NXQA 4I4CA 4ZAXA 3OC0A 4O4JA 3CXRA 2IH5A 3ZWWA 4UD2A 4MV8A 1BZYA 4Z9YA 1KZ7B 4FOTA 3CISA 3S40A 4B81A 1E1KA 2QUAA 2EYQA 4KLCA 2QTFA 5A5VA 3REOA 2C95A 3VVBA 4BNUA 4KLRA 1HPLA 3PZRA 1Y1PA 4G1VA 1KDRA 1N5LA 3VGJA 4L57A 3UH1A 3GRCA 4WGGA 1WXIA 4ZAGA 3IE1A 4QU8A 1QVAA 2GXSA 3Q2KA 5K2MA 3WLNA 4BQPA 2FPPB 3W1VA 3OQNA 2GM4A 2PUJA 2XYQA 2JK0A 3AH8A 3M7IA 1JYEA 3NBUA 4E32A 3L77A 1T3TA 1A76A 2NT4A 4QYMA 5DNWA 3LHFA 2XF8A 3KQQA 3O84A 4WKGA 3AU9A 3SDZA 1XXHE 2A4KA 1RRVA 4CU5A 4EH1A 4P2GA 4YMUA 5SY6A 1JLHA 1ZA2A 2H9AA 5E6RA 4ZT7A 1NLFA 4G4SO 3JQRA 3IAHA 2X2OA 1QGOA 1CJVC 1PX0A 3D0QA 2P6NA 2CJYA 1XC7A 3IB3A 5ICEA 3QLVC 3P8ZA 4F3TA 5B3LA 1KO8A 3ADKA 3THYB 1B1CA 5KYUA 3WYAA 1IBRA 1Z07A 4M2LA 4M1QA 5K3DA 3UCXA 5EMNA 4D99A 4OX9Y 3RDPA 3DPIA 4ETIA 1FNMA 5BN5B 2M9MA 4CTNA 2HA0A 2Q6VA 3WIOA 2GN8A 2QVLA 3IMFA 5B1DA 5LDDC 1K4KA 1E7WA 4QSHA 3CINA 3WJ1A 3QKSB 2IU0A 4N41A 1CEYA 1YS9A 1T1IA 1MCZA 2A92A 3VSAA 5A3QA 2ZBUA 3GGCA 3OFSA 5JYEA 3K0FB 1ZK1A 3PUXA 4D8XA 3C6QA 1ABBA 3E8SA 3FZNA 1DQZA 4UNNA 1I5EA 2E49A 2NO5A 4ZYZA 2H1VA 3U4QB 2F55A 1SJ9A 1O97D 2ONCA 4HDMB 4PX5A 1NWCA 3FF4A 3PVZA 1Y9AA 3PF9A 4I9HA 4YRIA 1T9GS 1UJ5A 4HDOB 4AICA 4CIYA 3NT4A 2MSEB 4HJXA 1S02A 2IEZA 1R4MA 2O4UX 4CF5A 1XD2B 1JB1A 4Q15A 5JQWA 1MH1A 3I4LA 4QARA 3R9XB 4R8SA 5FLYA 2OYCA 1CZKA 1SVLA 1XEWX 4FFVA 4GDMA 1QZUA 5A7GA 3EFEA 3NC4A 4C21A 4RJIA 3HDJA 5TVGA 1GYRA 3KL2A 4D1YA 1IXRC 3L3BA 4G8CA 4B6JA 2VHYA 3RODA 1TZBA 1M8KA 3R3UA 5DP1A 2DQYA 3L6DA 4FQ7A 3SR3A 5FBKA 3M6AA 3UA3A 1BG6A 1O77A 2JCVA 3FCCA 1X8LA 3NIBA 4HPWA 4I8IA 5D7NA 2FWBA 2F1KA 3CHYA 3PC8C 3TPZA 2VG8A 4OMDA 1MTOA 4B3JA 3WL6A 4AZ3B 2C59A 4ZO9A 4NZZA 5AI9A 1A8UA 3ZV4A 5LDHA 4W5RA 5AW5A 2AS0A 4INOA 2NSDA 3WYFA 4NNOA 3LX8A 3PFNA 3BB4A 5A9SB 2J0UA 3AUTA 3RRZA 4CIWA 1TFRA 1DRVA 1WCV1 5H4HA 4IJ6A 3TI7A 2P1ZA 1T1GA 4QUIA 5T4HA 3TJRA 3WDMA 5JNRA 4TZ0A 4ILKA 3OCJA 5I48A 1ZD4A 4MQFA 3SWWA 1IBSA 2JCYA 3I73A 4RTRA 2O8BB 1HQKA 5LDGA 3GP3A 1O94A 2C97A 2OLJA 3PA6A 2C82A 1E9DA 2IZ5A 3N7UA 4TUYF 3GJQA 2G9ZA 3ESXA 3IMCA 3TZBA 2BDEA 1NXVA 3QVWA 4K9RA 1I4WA 3OFKA 3D0KA 2QVXX 4MP3A 3RU2A 2JANA 3RUFA 3WJ7A 3AKZA 1YB7A 5T4FA 2JL1A 3SFZA 2DERA 4Q47A 1J8VA 3FKSA 3I2KA 2WHYA 3O4HA 2YWBA 1L1FA 3RYTC 4I4TB 1E9AA 1CUXA 3A4VA 2I1LA 2A5DA 1OC4A 2QTHA 2VIIA 4WBSA 3QXCA 2G07A 2XMPA 4NPCA 2Y66A 4EHNA 3HM9A 4GMHA 3CN9A 3LT5A 3TIIA 3TZQA 5KOHB 2VF4X 1J4AA 1GT6A 4RIFA 1LPNA 3NUQA 1YULA 3DNFA 1OYYA 2ZUUA 3DXYA 3E9YA 4LZLA 3S2GA 4BBJA 3H16A 1NHGA 3P2YA 4FHGA 5DBOA 3WLLA 1SUSA 1DWQA 3Q2OA 4PLCA 2R8BA 3KQMA 1SOWA 3C15C 3KLOA 1WOMA 4GX1A 4CMEA 5JRJA 3R5HA 2DULA 1JQ3A 3N0VA 3YASA 2FG6C 4MVJA 3AHGA 3D6HA 2OSVA 3LOPA 3NTOA 2CV0A 2A9RA 2E9SA 4YCDA 1RIIA 4BO3A 3W1EA 3SHWA 1Z6QA 4OLBA 4ZVVA 1GFSA 3SXJA 1E18A 3HV2A 3GRKA 2PXHA 1LVUA 3MWLA 4JBNA 4DA8A 1IXYA 3EVEA 1JHMA 5JHGB 4B3DA 1OLUA 3CEMA 1L5HA 3RV4A 4RJTA 5LP6B 2OB2A 4C08A 3HDHA 2DHRA 3EZ9A 2ZG6A 4LYYA 3LCJA 4YAFA 3EGOA 4ZI7A 1DFGA 621PA 3D2CA 1DE0A 1PT8A 2JDIA 1KEZA 2JBWA 1WSWA 2JNWA 4J43A 3IQDB 1WF6A 2CFSA 4MJLA 4OX9B 1GPWB 2GCOB 3EZ2A 1NW6A 5BSEA 5BV8A 3CVVA 4CEJB 4CLEA 3AJ8A 3D6FA 3WIVA 4MGKR 4RXMA 3WMEA 5CA1A 1C0KA 3L7AA 4M83A 1U8AA 1WMFA 3I4CA 2R4UA 5FL7A 5FPHA 4DIFA 5IJWA 4ZZIA 4Y0VA 1GYQA 2WJYA 1HTWA 2OV3A 1CIPA 5EQTA 1WQ4A 4B47A 2PH1A 4O6VA 1GG2A 3CNBA 3CTMA 2GBIA 1J49A 1QXSA 3NBXX 1A9ZA 5F9FA 2B4RO 3KUXA 5EHGA 4TT3D 3WWZA 4AO6A 2YHBA 4C4RA 5M34A 3MAJA 1DIAA 4DUGD 4MRMA 1VSQA 3SZ3A 1FQWA 5LP1A 1GJRA 4BNXA 3ET4A 1T24A 1UK6A 1ECGA 2VWPA 1H8EA 1P1JA 2PLFA 3OP4A 1QC5B 1E1CB 2IS1A 1XCMA 2OFWA 2YJ4A 3IILA 1MAVA 2VQ3A 2FPIA 3PRJA 1FNDA 3FPHA 3QEMB 4RQBA 4IUBS 3HZHA 4FFBA 1JH9A 2AN1A 4XQ9A 2GXQA 5FWAA 3M34A 4TRMA 1FRQA 1C29B 1TE2A 3OWHA 3K0KA 3BXHA 3A36A 4LIPD 1T2EA 1ZN8A 2UVDA 3FRJA 2WMDA 3S8MA 4ES6A 2X8JB 5IW8A 1QLJA 2HCRA 2P3SA 1NQVA 2EFCB 5KQSA 2R79A 3KJGA 4U7JA 5J1SB 2IUSA 3KYJB 3PSHA 5ADWA 3MRSA 4S2UA 2YWHA 2A0FA 4F3YA 2EX0A 3QU7A 3PXEA 2IQIA 4P4LA 4WVFA 4CLXA 3NPMA 3EVGA 1F1JA 1L7QA 1QM5A 3O9ZA 1E7RA 2AR7A 3RW9A 1M0SA 1GGKA 3K0HA 2R44A 3B3AA 4YASA 4DDUA 3QFTA 5ESWA 5ADVA 2JARA 1OXUA 2FY8A 4QATA 3B2NA 2NYVA 2Z6AA 4MWTA 2SKCA 2CL7X 3E81A 4OHCA 4RKEA 2X23A 1FLDA 5AQ1A 2V6JA 2VSQA 2W2VA 5EI5A 1IDN1 5CB6A 1QV6A 2R4TA 1Q2UA 4MYUA 2V59A 2FQ1A 1CNMA 1CQJB 1PO7A 4JV5B 5DHTA 3OIGA 4ID9A 3QE2A 4QOJA 1WVIA 4U7TB 4Z7OB 1KP9A 2Q7DA 2IQ5A 3ZD6A 3KV1A 3KQOA 3Q87B 3G2NA 4H3SA 2X0IA 3CW9A 2HSDA 3G9XA 5AVQA 2OKCA 4ZHQF 2DPXA 5IN5A 3IUQA 1Z6GA 4DV0B 5L9AA 5FH9A 1X2EA 3VAYA 4R0VA 2AFRA 2PMDA 4M8NE 5D51S 4YUVA 1MFPA 3RSGA 2QTVA 3BWCA 3FNEA 1GSAA 1Z0AA 2F00A 2MWMA 3OPYB 2HXYA 5JBQA 5FBQB 2QAGC 1NIPA 3BRWA 1R0YA 2POCA 4GUAA 3WTCA 5EUCA 3DVSX 4GHWA 2XCIA 5EZQA 5KSWB 1D4FA 1XDDA 1P2VA 1Q17A 3WGYA 4N6NA 1J33A 4IO0A 2OCPA 5CEJA 2BCGY 1ZM4A 4PZ9A 3E1GA 1JFFA 5HJEA 3I9OA 1A3CA 3OKPA 4JP2A 1VKNA 1N6PA 4LNUB 4DGQA 3EFHA 4DIBA 2Y27A 5HEKA 1U99A 3Q9LA 4P54A 1A5ZA 2DQ4A 2FUG6 1D4OA 2J85A 3EXHA 1JFLA 1ZCBA 2MINB 4EPTA 4XQGA 5D86A 3HO1A 3WB1A 1MIOB 4LBYA 2NTEA 4KIFA 3WOHA 2JG3A 1ECJA 2XKKA 3TJMA 1FXSA 5FOUA 1QRAA 4N0EA 5FX2A 1J25A 2RI6A 4JX9A 4ZOQI 3V1MA 1N6HA 3HU2A 3QK7A 1JXQA 4ZCQA 1M67A 1XTTA 5F5LA 3G6WA 1JQDA 3A9RA 3HYRA 4KQHA 4RYLA 1WCYA 1M6NA 1Q1EA 3FD8A 3RUEA 2ECQA 4HO1X 3V4SA 1NVAA 1R8XA 2FMUA 4HXGA 1HZJA 4M9RA 4REQB 2ZBDA 3BERA 1FVFA 4OOFA 4UUAA 1TW3A 1I10A 4XPZA 3ADCA 2AZMA 3PUHA 5HG0A 3F3YA 1ZI9A 2C2MA 5AUNB 2WW8A 1M6HA 2E21A 3D6JA 4ASUA 1XCLA 2O6LA 5AVJA 2WFLB 1JQAA 3P1JA 1PDVA 2XI4A 3ZH2A 1NRWA 3GMTA 4EABA 4EO9A 4RY9A 5FBLB 4BFVA 3PL1A 3P2EA 4G0YA 4IDBA 1HE2A 4RPCA 1L4LA 1J56A 5H3LA 1WW3A 2C88A 2ZROA 2OBBA 4WX2B 4RTOA 1RLUA 3VU0A 3CVJA 3R9IA 3EWSA 3VX3A 2MR5A 3O47A 4JLPA 2P79A 1YUMA 2R1VB 3EXHC 4QICA 5IX8A 3QMMA 1Y5LA 2R66A 5AJHA 3K4QA 4UE2A 4NCXA 3C5HA 2JCBA 4XYLA 5IKMA 1JPUA 1QWSA 2LIVA 4B5KA 1IHUA 3ANLA 4ZAYA 1TJ4A 2IY9A 3FA2A