2C2HA

Crystal structure of the human rac3 in complex with gdp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
175
structure length
168
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPGDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Rac3 in Complex with Gdp
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 3
total genus 58
structure length 168
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2c2hA00
4RJLA 4B76A 5JSZA 4B44A 4EJSB 1KJWA 2X2FA 2CL7X 2QROA 1SXJE 4PAOA 1WBDA 3SR0A 3TMKA 2IWHA 1IQPA 3UWOA 4LJ6A 3ZZTA 4MKIA 2JCSA 4KJZA 3VR3A 3PEYA 3L0OA 4MGYR 4PR0A 1GL9B 2NTYC 5B64A 1JI0A 4JZKA 4NCIA 4KITB 4H1VA 1CTQA 2AKYA 1NBME 2HJGA 3BERA 3BFXA 4DLVA 4W9MC 5H68A 5HTKA 3KFVA 5JRZA 2WJHA 1OH5A 1JECA 3WBJA 3AF4A 1IXRC 4I1OA 3KJHA 2IUSA 2PJZA 4G1UC 2GJ9A 2OBLA 3CF2A 2B8TA 4LZZA 2VYFA 4OHWA 2JDID 3WHLA 3LW8A 2WPDA 4IJMA 1N2CE 4LHZA 4NHOA 4V0OA 1ZNZA 3LA6A 3IPYA 1NG9A 221PA 2QT1A 5H70A 1IN7A 1TQ2A 1U0LA 1BMFA 2J7PD 1ZIOA 2VHCA 1XCGB 3LLUA 3RRNA 3IQWA 4DBLC 4EPYA 2AXPA 2GAOA 1PLJA 2W2TA 3O47A 1Q0UA 5FTNA 2Y8EA 1SKYB 2H8KA 1TQ6A 1PUJA 2Z43A 4Y0AA 3SEAA 2ZUCA 3THWB 5LB2A 4YMSA 3RYTC 3NHAA 4QBFA 2PZFA 1E2HA 3B2EA 5EE1A 4Q1AA 4B47A 4DC9A 2I4IA 4URWR 2PCLA 1BYUA 3THYA 1P61B 3KKQA 2QBYB 4JL8A 2GVDC 3H1TA 1JR3E 3HR7A 5K8IA 4XJXA 2ZYUX 4DLWA 3SDZA 1MO5A 4OQMA 1IONA 1K6MA 1J99A 3L0SA 5JWOA 3ZVNA 2R6AA 4YC7A 4PO9A 2D74A 4CW7A 1CXZA 4ZO4A 3C14C 2QP3A 1P2SA 2V7QD 2GK6A 2YWEA 5GADl 1Q1QA 1ESMA 2ZPTX 1R5BA 2J59A 1GSIA 1DELA 2CXXA 4DXAA 1XX6A 721PA 1KGDA 3O8RA 4PFSA 2Q6TA 1K8RA 3GEHA 4BECA 3V00A 4A82A 3AVWA 3U44B 2VTKA 3Q5DA 3W34A 2DWPA 4B3FX 3U60B 2NZ8A 4B3GA 1KMHA 1E4VA 4WOPA 4Z8YA 4BLRA 2X2EA 2ZJBA 4UNSA 2ZQ5A 3EG5A 4Q03A 1XJCA 2CL0X 4GNKA 1NL3A 2IYYA 4KVGA 2IEZA 1G7RA 2A78A 2JATA 2OFXA 2XTMA 3F8TA 3RS4A 2UKDA 2Q3MA 1EK0A 2BMFA 1JQLB 2PBRA 4D80A 5IHPA 4FIDA 3I5XA 1WA5A 5AWFC 1XTRA 1HE8B 4B35A 1DO2A 4P4TA 3AVTA 3RS3A 5C4GB 4Q1EA 5CIWA 2XTZA 2AD1A 4L4UA 1PLLA 2DYKA 2IT1A 1CR0A 2PEYA 5EE9A 4MRSA 2IXGA 2QI9C 3CNLA 3KJGA 3GLFA 2AWNA 1GG2A 3P1JA 4MDFA 2IA5A 4ITRC 2FH5B 2KWIA 4GFDA 1GWNA 1PZNA 2PMDA 3NIBA 4JLPA 4JJZA 1AS0A 5TV2A 4O2LA 3GLIE 1YE8A 2VP2A 2YOHA 3ADBA 2HUPA 2W00A 4GOJA 2FMXA 1R10A 1TX4B 1G1MA 3ZS8A 2CLCX 1GP2A 3ZVLA 1GILA 1DPFA 2ZI6A 2FSGA 1U90A 1B0UA 3DPUA 3DL0A 4JT4A 2HXYA 2JIZA 4RFSB 2D2EA 2VPPA 2VQSA 2W6IA 2ZR9A 3GLHE 3PR1A 4G01B 3TW8B 3K53A 2JLVA 1DG3A 2BCJQ 1KJYA 1N0UA 3AVUA 1AGPA 1ZNXA 1W36B 4V0KA 3VKGA 1MABB 3W6OA 3LBNA 1ZM7A 3R8CA 3TQCA 1UKZA 1TU4A 4IDPA 5J4HA 4PO8A 1N0VC 3QUSA 1KI9A 2OCAA 4DIDA 1P9RA 1Z06A 4C0SA 4EPRA 2BVNA 3GJ4A 2YWFA 3DM5A 4YXWA 3MAAC 2BDTA 3AQ4A 1LS6A 4LC0A 2ATXA 3H2YA 3CIOA 1P3JA 4RD0A 2JDIA 1UM8A 2OBMA 1E9SA 3N2IA 1Z08A 5GJCA 1IJFA 3D6TB 2ZYVX 4EIWA 1Q3TA 2N1BA 1OF1A 3AM1A 1P9NA 4A4DA 4P4SB 3DZDA 1G4UR 5FPKA 3C7KA 1GAJA 2QPTA 3LWNA 1OSNA 3WY9A 1VKJA 3A1WA 5FFMA 1W2GA 1AJEA 3FTQA 3MUFA 4A15A 1RZ3A 4OI4A 4B74A 3LVQE 4UJ5A 5KO2A 5C18A 1IY0A 2B8WA 4YLGA 1X3SA 3KZ1E 4Q5IA 4V03A 1P60A 1H8HD 1QHGA 4JBWA 4LGMA 1KY2A 2HLDD 2JJ1A 4L15A 4C0HA 4H1UA 2ZR0A 4M8NE 3B1WA 3LXXA 1GKYA 1H8HA 5B58C 3B5JA 1M7BA 4EDHA 5JI2E 1LV7A 3RRZA 2QPOA 1G18A 4B43A 5FOTA 1U2RA 4CEHA 3U61B 4ZDJA 2W6ID 1M6NA 4B71A 4KV9A 1KY3A 1LY1A 3WNDA 2ZS7A 2GJAA 2ODEA 2BWJA 2F1IA 1J70A 3B8HA 4AWXA 2BV3A 3AEZA 2BIFA 4G5RA 3GP8A 1Z29A 3ADDA 1G8GA 3W90A 1E2JA 1KMQA 4Q9KA 1GOTA 1DS6A 3Q3JB 5BN5A 3KDSE 2OESA 3CX7A 2DFKB 1UFQA 2F1JA 3PITA 2V54A 3TKLA 1HEIA 5TDHA 1I2DA 1Q20A 2D3WA 1E0AA 3TVDA 2CMKA 3UG6A 4C0BA 2F9LA 4GDFA 4XIGS 2FU5C 4CT4B 4U00A 3W3AA 3AP2A 2H18A 4JLOA 1ZJ6A 1ZM9A 2DWQA 3I1FA 1SVIA 2NO1A 5EZ5A 3UMSA 4ZI2A 1M8PA 2AK2A 1NKSA 3KJEA 4A2QA 5KOYA 2PCJA 2GVZC 4MGKR 4TTQA 2QG6A 2IWRA 3I5YA 4TSFD 4D82A 4XVUA 2SHKA 2FDCA 4JVMA 3T15A 1A7JA 2CEAA 5KSOA 4HAZA 4Z51A 4GP6A 4QNRA 2OG2A 1KK0A 2IXEA 1VG8A 4K46A 4ZV4A 4L9WA 4M9QA 1XMIA 1VHTA 3NBZC 1SXJA 2VP5A 3KKMA 1E9DA 1AQYA 1EFUA 3R8FA 3FMOB 2WZQA 4ARZB 2PEZA 4A8JB 2QGNA 4EKDA 1L4YA 2FZ4A 2ZSBA 1TEVA 2ZE8A 1G8FA 4ZDWA 4E22A 1F3OA 2G83A 4AKGA 1N6PA 1LB1B 1MOZA 1E69A 3QIAA 4URXR 2NO0A 5LPNA 3GJ5A 2REOA 3TNFA 3GJ3A 1QHHB 4QJ4A 4LBZA 1R7RA 2XSZA 1YR7A 2IYVA 4RD2A 2BBTA 2ZRBA 3JZMA 3MJHA 2YOFA 2GJ8A 3AVXA 2RAPA 2Q0HA 4QGFA 1P7CA 4O2RA 3B1YA 4D6PA 3ZQJA 1UBGA 4TMTA 2HJVA 2WKRA 1NN3A 4JIMA 1ZU4A 1E2KA 1NVUQ 3NH9A 4PC1A 4CEHB 5HR5A 3K09A 1BH2A 4PPQA 4AI6A 3WMFA 1SGWA 1FQKA 4PZZA 1WB9A 1F2UB 3U7EB 1CR2A 2HLDA 3CPHA 1DAKA 1IJEA 3R9IA 1JPNA 1KI8A 4EPXA 2D62A 2DBYA 3WNCA 2ZRFA 4QL3A 1KO4A 1OKKA 5GVRA 2DFNA 1IHUA 2HXSA 2DFLA 1RVDA 1XB2A 4JLKA 1Z28A 3S1AB 4PHGA 1IN4A 2QMEA 4OYHA 2AKAB 4LOAA 5EXPA 4YDSA 2UZ3A 1W36C 2O8BB 3GLFB 1ZVQA 3IPXA 4FCTA 1CLUA 2GJSA 3FKSA 2QQ0A 3QXCA 2FGKA 4HLDA 2GF9A 4JVLA 4AC9A 3ECCA 3QPUA 1G6HA 2A5JA 2ZTSA 4D4MA 2BKUA 4URYR 1NLFA 2GKSA 4E09A 2JIZD 2PZEA 1NN5A 2OEPA 5L3RA 3BB3A 2LCFA 3IKJA 2O0JA 1PLKA 3GFPA 1N6KA 2ZE5A 3K70D 2JLXA 3M4YA 1GNQA 1T8TA 2C04A 2NIPA 3DOFA 2JLUA 2CK3D 4TQUS 1XU4A 2ZU6A 1H8EA 2H92A 1XD2B 4TTRA 4CIDA 1JB1A 2FG5A 4BE7B 2R6GA 1SHKA 1GRNA 2VHTA 1EFHA 2FSFA 4JVSB 4PPGA 4TYYA 2ZI4A 4PAQA 5DLQC 3IEVA 1SULA 4V0NA 2O8CA 3NVAA 1AZSC 2GBLA 2FZLA 1YKSA 2C77A 3GJ0A 3KFXA 3QPVA 2OAQ1 3TR0A 1KYIA 4B75A 3CO5A 4B3DA 2WJJA 2G3YA 1DAGA 4Q02A 1R4AA 2R8RA 3K70C 1ZUHA 4Q1CA 1WMSA 3VR5A 1XPUA 1Z0KA 4C3ZA 1JPJA 3ND8A 4Q4AA 4D0NA 1NBMA 1R5OA 2XGJA 4DEXA 1N5JA 5FI1B 1Q1BA 1GNRA 5JECA 4UNPA 5FL7A 3IO3A 3CNOA 3A4NA 3AGQA 4UXIA 4XWKA 1OXVA 4FMBB 1KO1A 5JJLA 3LXRA 4YDHB 5JS7A 1JXOA 2IK8A 1E94E 2HT1A 1VIAA 4C2UA 4PTLA 3RDPA 1OXXK 1Z5ZA 2WWXA 3OIWA 5FL7D 4E03A 3PCRB 2XX3A 1CF4A 4ACAA 4HZUA 1NJGA 3O8CA 3QJYA 3TE6A 1E2DA 2OUKA 1W4RA 3CRMA 4QHTA 3V4FA 1UEIA 2ZREA 5DGXA 4AYXA 1UKEA 1N6LA 1NRJB 1OFIA 1RKBA 3UK6A 3ZH9B 5DI3A 1J7KA 4TZ0A 2IYTA 4HAXA 3AV0B 1NY6A 5SZKB 3TUZC 3CRRA 2Z5FA 3WMGA 1W44A 2RKOA 1JNYA 3U3KA 1N6IA 3VFDA 3PFIA 3PUWA 5KHOC 4JL6A 2FSHA 1D9XA 4QM7A 3ASYA 4NTZA 3NBFA 1JQJC 1U98A 2WV9A 3HPQA 4DCSA 5JI3E 2Z6VA 3B9PA 1TU3A 4MQBA 1E1RD 5G53C 3TJZA 1CJTC 2VP0A 4IFBA 4DSOA 4DSNA 5F3WB 3GLHA 5F98A 2R65A 1KK2A 2J3EA 2BMDA 2RHMA 4QBGB 4C0LA 1XZPA 5H8WA 2F1HA 1Z8FA 2C9OA 5L3QA 4M1KA 1SVMA 3NC1C 2E1RA 2AR7A 2QN6A 1DAMA 1TMKA 3MJRA 3G82C 1LNZA 1ZCBA 5GJVC 3ZD7A 1U0JA 2ERYA 4NMMA 1G8HA 5UKDA 4YMVA 4HYYA 4OK3A 2WTUA 2REBA 5E7IA 1EESA 3E1SA 2C8VA 1TUEA 3U4QA 2CBZA 5KPDA 3AP3A 1YU9A 3B82A 3NWJA 4OHXA 1VG0B 4RFVA 3VX3A 3EPLA 1KI2A 1OIWA 4Q7KA 1G6OA 1EFTA 2EFHB 1FOEB 4C30A 4BGDA 1JEEA 1T3HA 4MUBA 4KHZA 1RRFA 1R0WA 1SHZA 5L3VA 1X8JA 3PIRA 1NIPA 3SHFA 3VNUA 3GD7A 4UNQA 2Q3HA 5AJWA 2QAJA 1GFIA 2VL7A 4M9ZA 3NEYA 2GZAA 5JHHB 4HAUA 2X77A 2UVQA 2X1VA 2AWOA 4QJ3A 2FE4A 5FTJA 5C1BA 1OXSC 4Q66C 4S35A 1E0JA 4P0TA 2BC9A 1FP7A 1J2JA 2CK3A 3PQCA 5TY0A 4CT5A 4NL4H 1H65A 1Q22A 1WRBA 2EQBA 1QG2A 2OE2A 3UMFA 3MMPA 3ASZA 1T6NA 3K0CC 3BOSA 2REXB 3NHBA 3EIHA 1T9HA 4PQYA 4TMVA 5FOUA 1RE0A 1IN8A 3T1VA 3VU9B 1M1YE 4FXPA 1GKIA 4DLZA 2H5EA 2GXUA 3HJNA 4ARZA 4B2PA 2O8DA 3TSZA 2A5YB 1M2OB 1C4OA 2O8EA 1XJ0A 4ON9A 1F2TA 2AHOA 3FYHA 4KYUA 1ANKA 3KTAB 4AKHA 2J9RA 5FTLA 4QFMA 2EWWA 2B21A 1XNJA 2GA8A 4FMDF 4C0AC 2NO7A 2ODWA 2X19A 1KSJA 3B1VA 5IK2A 1L4UA 1ZAKA 4LHWA 4AG6A 3CONA 4L5BA 3U7FB 1VECA 2E9SA 4B33A 1UDXA 4HATA 4PHFA 4QOSA 2V55B 1KZ7B 4KBFA 3QXHA 5J4LA 1MT0A 3N70A 5FUYA 4FCWA 1YR6A 4M22A 3HU3A 1IBRA 4JLJA 2JASA 1A2BA 1ODFA 2FFAA 2ZRCA 4P33A 3T5DA 4CF7A 4M1MA 1KNQA 3SZRA 3KQLA 2F9MA 4MYTA 3D3QA 2CDNA 4Q47A 5J47A 5CM9C 1X6VA 4LBYA 2WMNB 4KSBA 2ZJ8A 4NCHA 5G40A 5KSPA 4WA7A 2O0KA 2J5XA 1U8ZA 2V1UA 1T0JB 2ZS9A 1GITA 1P2VA 4V02A 3OAAD 1DO0A 1XEFA 3DKPA 5DYIA 3C15C 4PX9A 3W6NA 3U5ZB 2GBLC 4HDOB 3I72A 1OFHA 2G0TA 4BFWA 4DJTA 1P73A 1ZD1A 2WJYA 1ZW6A 4D2IA 4DB2A 4DDUA 4P32A 4RKFA 4AKIA 5KYKA 1N5LA 4LWZA 5SZHB 1E0KA 4BRUA 1EX7A 4LDJA 1CBUA 2HT6A 3GJ7A 5DIFA 5FBQB 4BLTA 1VIYA 4LSGA 5FH9A 3EC2A 3WYFA 3R9XA 3HP1A 1JAHA 1XD8A 1WP9A 3CX8A 2J7KA 4DSUA 4DCNA 4HAWA 1CJKC 3P20A 4Z8XA 2RGEA 2BMEA 1FUUA 3EW9A 5CJ2A 1FNMA 1NLYA 3TVTA 4ESHA 1VYVA 1NVXQ 1X8KA 5FR2A 5L8VA 3GLGE 4GL2A 4UJ3A 3OIYA 2LWIA 4ESVA 2F1RA 2YC2C 3WMEA 2Z0MA 4UNNA 2ZETA 3FVQA 2Q9BA 3K0FB 3SJCA 3DMNA 3WYAA 2ZI9A 1E32A 2R6CA 1G4AE 1G7SA 4D4LA 5C4MA 3A6PC 1DE0A 1P4SA 1DADA 2C99A 3AKYA 2HEIA 1UBCA 4NPHA 2QE7D 2F3TA 2QT0A 4URUR 5D3MB 5EE3A 4I81A 1XEWX 1ZM3A 1UEJA 4QHSA 4RD6A 5CJPA 2LKCA 5JBQA 4RY2A 2PX0A 1UDWA 1G64A 1I4TD 2WHXA 5EE5B 5FOSA 2DPXA 2W6JD 1QDEA 5AJVB 2CLSA 2ZYTX 3QF4B 421PA 1YJ5A 4EAQA 2GDJA 3CBQA 2CCKA 3P4XA 3AVYA 4IFEA 1TUIA 3CZPA 3VR4A 4LYFA 4A6XA 5BXQC 2ZRPA 1T3SA 4NCNA 2A5GA 4CRWB 3BIFA 2ASEA 2IYUA 4IOKA 3V9PA 3A36A 1NMZA 3FDIA 2CCGA 2QZ4A 5BYKA 4KSCA 2BKEA 1KHTA 1ZU5A 1YZQA 5BW8A 1AIPA 2WWGA 2QRNA 3OIVA 2ZRAA 5SZIA 1G41A 4JVNA 2EWVA 1AS2A 2XJ4A 2IXFA 3BFKA 2QSZA 3EARA 2G9NA 1XDBA 3A1TA 3KKOA 4LJ9A 2JJ2D 3S1AA 4I4LA 2ZJ2A 4JLDA 2IW3A 1XP8A 2PLRA 3HU2A 5IF9A 1OH8A 4P3YA 5D3QA 2QP4A 5TARA 4TMZA 2ZUDA 2KBFA 5CYPA 1E2QA 3SN6A 1ELOA 1U0HC 4LJ5A 3I61A 3OHMA 3AKDA 4C0QC 2D06A 3BS4A 1WF3A 2C2HA 1V43A 1W5SA 2FA9A 1E2MA 1L2TA 4ZIRB 4J0QA 2VEDA 1TF2A 2ZUBA 4D4JA 1UAAA 1FFHA 5DI3B 1CP2A 1HA3A 1MABA 1X8LA 4D0GA 4R2HA 1XMSA 3THWA 2ORWA 2ZE7A 3M1IA 4WAUA 1PV4A 2AX4A 5B2ZA 2QGZA 3RWMB 1UF9A 4QG7A 5JZVA 1S9HA 1F6BA 3B1ZA 1SQ5A 1XFAA 2WMOB 1F2UA 4NCJA 4DUGA 4YMTA 3AF3A 4O0MA 4ZDIA 4RD1A 5G3YA 2VO1A 2ERXA 4F91B 2IL1A 3FMPB 3EPKA 5K8LA 1ESNA 5IRCD 1DAFA 2FFQA 3D7MA 2R6DA 5KNCA 2K5UA 1XXHB 3CKLA 3CRVA 2GHIA 5DI9A 3LQQA 5HZKA 5J4YA 1NN1A 3MCAA 1NN0A 3D8BA 2WIAA 3MLEA 4DLYA 8OHMA 1QHIA 1TEXA 5L3SB 3KQUA 4FMCF 3X1WA 3SU8A 1E2NA 4HEJA 5DN6A 3HDTA 3CWQA 2CJWA 3EAQA 4NYIR 4QNMA 3VKHA 5E4FA 2MMGA 4EFMA 2EU8A 4M1TA 4OHZA 4KLNA 1JR6A 3U4QB 4L8GA 4NKRA 3KB2A 2ZSAA 2O8DB 1FX0A 2HDNB 5JLJA 5LD2C 2PX3A 2WBLC 1G19A 1Q21A 2VBCA 3KL4A 5DNYB 3QKRA 2HYIC 3OE7A 4XVQA 3I92A 4LRWA 5EP2A 4BLSA 1HT1E 4JMPA 2J0SA 3BWDD 2XNDA 3JZAA 1OJLA 3VQTA 1FMJA 3KQNA 3ONWA 2GRJA 5HE8A 3PV0A 2EYUA 2OHFA 1GZSA 2YNMA 2G88A 3BFVA 1ZM2A 3U3OA 3GLGB 3QQ5A 2ZSDA 4Q1DA 3X1YA 4WW0A 4LHXA 1UJ2A 4O3MA 3SYLA 1TAGA 2PJRA 1S3GA 2C96A 1G5PA 1DEKA 3NH6A 2IHYA 4ILEA 4ASUA 4M1WA 2V6JA 2J7PA 1A2KC 1BMFD 1FTNA 1LTQA 5A4JA 1W2HA 2DR3A 5HCIA 4EJSA 3OFND 1G3RA 3I32A 2XXAB 2J1LA 1G21E 2W6JA 1XJQA 3OFNA 3THXB 3MGCA 4DKXA 4R98A 5K8TA 2ONJA 4QGHA 4YMUA 2ZXUA 1OFUX 1XMVA 4IXMA 1E6CA 4Q7LA 4BASA 1US8A 2MSCB 4TL7A 1KTVA 3U6BA 4LYAA 3W6PA 2WM9B 1N6HA 2ZVQX 2FV8A 3W5IA 4LBVA 1DARA 3P32A 3QVVA 4DEYA 3X1DA 3BRWD 5DN6D 1VPLA 5JJIA 4TT3A 5H1YA 1ZNWA 4AK9A 4PQFA 2J87A 4GI7A 2DY1A 4BFXA 2ORIA 621PA 3ZYCA 2Q9CA 5CK4A 5JJKA 2D2FA 1IY1A 4NDZA 1Z6XA 1FUKA 1ZMXA 4B3CA 1D2MA 2EFDB 3A4LA 4OL0A 4HUTA 4FD2A 5CDFE 4Q00A 3E70C 3VAAA 1JBKA 1CULC 3AUYA 3OEHA 1KZGB 3ZQ6A 1EWRA 2ZJZA 4DCVA 1T8UA 5GVSA 4C0KA 2IX3A 1XEXB 4AY2A 2WSSA 2AN9A 2YHSA 5DE3A 4TL6A 1PVOA 5FI0B 1NNEA 1D6JA 4QGGA 3KUDA 3QPWA 4QGAA 5BQ5A 2Z83A 4C2TA 4LX0A 2C9YA 3IHWA 2D7CA 4QRHA 4G5OA 2G77B 5JS8A 3U3RA 3IHLA 1YZKA 2ZANA 1RYFA 2WWWA 3DVLA 5CYOA 3BD9A 3BORA 4TL8A 2W2VA 1YRAA 3HPRA 4FINA 3RS7A 3OEEA 3E5HA 2BM0A 2VHUA 3P4YA 3TRFA 3OIUA 4JLMA 5J40A 2H16A 3FHOA 4NU0A 4BQSA 1S3SA 4WXRA 3CB4A 1KAGA 1ZRHA 3LBIA 4DDWA 3UATA 2FJUA 1BS1A 2XITA 1W4AA 4MRVA 3RSOA 1AKYA 3QF4A 4LJAA 1VTKA 3CX6A 1W46A 3KQKA 3SBDA 1JALA 3GQBA 2EFGA 2ZYWX 4HAYA 1V5WA 2QY9A 3K9NA 5CLQA 2J0UB 4FN5A 3R7WB 3K0CA 3AVQA 1N6NA 2XXAA 2ECKA 2WOOA 3VHLB 1JAIA 2RGDA 3SQWA 3BBPA 4ZDKA 1FQJA 5EXXA 2EFEB 2IUTA 5EQTA 4X8OA 3W9YA 4DLTA 1Z22A 1CRPA 2QQEA 1VYUA 4JBYA 4E5UA 2BBWA 1T5LA 2IEYA 3N5CA 3U3MA 2A5DA 4DWJA 2GJKA 3AF0A 4BFTA 3L0IB 3T1QA 3Q7QA 2CVFA 2G6BA 2OILA 1AQUA 4D26A 4JLNA 4XVRA 3AGPA 5CITA 1QHSA 1XTQA 1YR9A 3Q85A 1OV4A 2P6RA 3Q5EA 2NPFA 3OEED 3SJAA 2OM2A 4M0LA 3A1UA 3QG1A 3NKVA 3QKRB 3GLFE 1Z83A 2V9PA 3EZ6A 4MGZR 2OLKA 5ELXA 4CEIB 3T1TA 1YVDA 1Z6AA 3B13B 2FN4A 3GJ6A 3IO5A 1NVVQ 3BB1A 2ZRLA 2P2LA 2GXAA 4UQOA 5DHFA 1GRRA 3L2OB 1S1CA 3GFOA 4BLQA 2JGNA 4Z54A 4A0GA 1T0HB 1NVVR 3GLIA 1JEDA 1Y3AA 3RVBA 1TF5A 2D4HA 4JSTA 4Y0VA 5BWMA 1TL7C 2YWHA 3A8TA 3AH8A 1OT3A 4GMDA 3KX2A 2AL7A 4HDQB 1UBFA 4YMWA 3QSYA 4RZ2A 2GCOA 5A0FA 1TTTA 4BUJA 3JVUA 521PA 3AVPA 1E9BA 3NC0C 3QXXA 4M1OA 1NMXA 2D7DA 1TNDA 1QZXA 2ODNA 4QKQA 3M6AA 2PT7A 4PC2A 4UXHA 3B1XA 1KDRA 1LFDB 4Q19A 1PUIA 2HF8A 3BE4A 4E07A 4IDHA 4HZIA 4RVCA 2CHQA 4XWOA 2WWIA 3KXKA 2AFIE 4IVRA 1YZGA 4MITA 1GRQA 1P9WA 4PQRA 5LBIA 1E3MA 4DUGD 4OQLA 1OXTA 1ZD8A 1F48A 1F60A 2OFOA 4M9SA 4LJ8A 5AUOB 2EW1A 2GEVA 1VCNA 4RKEA 3EZFA 2WSSD 1OB2A 1NLZA 3CNNA 1ETUA 4DT1B 1YZLA 2HF9A 3KXLA 4FWTA 4PC3A 2ZS8A 1JJVA 4IOJA 2GZDA 1AN0A 5JWHA 2NZJA 4BFUA 1XD2A 3B78A 3K0SA 4KVAA 1G7TA 4OJQA 1P2UA 1Z0DA 3GLGA 1GNPA 4BWYA 3ICQB 1VCOA 2CVHA 1SXJB 1II0A 1KSHA 4QXAA 2ZE6A 3X2SA 2W83A 3A58B 4OHYA 2QEQA 1Z6GA 4JT2A 3REGA 3WYGA 4AIIA 3SC3A 1SVOA 2C5LA 4L9SA 3LDAA 5AR1A 4F4IA 4TYPA 3EWAA 1HQYE 4R9UC 1VG1A 4EPTA 3LY5A 5C2JB 2GXSA 3BC1A 3T5GA 4PSAA 1N5IA 2YV5A 3SOPA 1G3UA 1BKDR 5AK0A 4GRAA 1D5CA 2ZIAA 3T06B 1BO6A 1NJFA 4EPVA 2V6IA 1M74A 1WCV1 1GDDA 2HCBA 2VF8A 3FMIA 3TBKA 4BZXA 1F2TB 1M7HA 3LFUA 4CVNA 4CZ2A 1G5TA 3TR5A 1QBKC 2J45A 1VCMA 5CLLA 3CR8A 3FGNA 3ZD6A 1WQ1R 1AKEA 1DAIA 1P75A 2IYSA 3LO5A 5CDFA 3EWSA 4GZMA 4DIEA 3FWYA 3O8BA 2V4ZA 4RZUA 4LHVA 4PPFA 3ND9A 1OIVA 1QHNA 3SJZA 4EFLA 1QF9A 4DDVA 4FMDB 2WOJA 2N42A 2GTPA 1FNNA 3L43A 4Q4HB 5AUQA 1ZM4A 1TQ4A 3RRYA 3JVVA 2O0HA 2J0UA 2JAQA 1QVAA 4DHEA 1MO6A 1SKYE 2QTHA 4DCTA 2YWGA 3QKUA 4NONA 2CHVA 2OV2A 1YZTA 2WWFA 3RS0A 3EC1A 4Q9IA 3TUIC 2BHRA 2DB3A 2O8EB 4KI0A 4MYHA 3CPJB 4A92A 3V4RA 5IT5A 3CM0A 2RHDA 2BMJA 2AD5A 2RGBA 2VHQA 3SYNA 4TYWA 1DG1G 2RB4A 1E79D 1S96A 1W4CA 5FPYA 3AUXA 1KO5A 3RLFA 4A2PA 3C5HA 4V0MA 1ZP6A 3U44A 1OB5A 4G5GA 1XXHE 5JHGB 3T1OA 1CJMA 2RGCA 1TF7A 4EQ6A 1G8PA 4GZLA 1UADA 2VF7A 2GEDA 3C16C 4YONB 1G16A 2ZRGA 1HURA 1OYWA 1E9FA 1YQTA 2KJQA 2QNRA 4KBGA 1KK1A 2BJWA 1Z07A 5KDOA 2JLZA 4N0DA 2ZVPX 2WJIA 1NG1A 1ONBA 5FBLB 4B32A 3PEVA 5E3HA 4LUCA 2BBSA 4JKIA 1NMYA 1R0ZA 3OE7D 1WXQA 4W5HA 3EZ9A 4AG5A 4ZKDA 2VH5R 6Q21A 3U3JA 4HB0A 2ZRIA 1S8FA 4M1YA 5CB8A 4TLDA 2ZI5A 5TXGA 5EUMA 2QL6A 1Z0IA 3SFZA 1KKMA 1XEXA 2PL3A 4IEIA 3TLXA 4IOMA 1VG9B 4QHYA 1EGAA 3C8UA 4MRRA 4NYMQ 4YXWD 2GETA 4US0R 3WP1B 5L3QB 1XRJA 4A36A 4TMWA 1GVNB 1SVKA 1HTWA 3Q7PA 2GCOB 5FOWA 3T12A 1P62B 3GMTA 4F4JA 2W0SA 2XEXA 4DB4A 2RGXA 4FW9A 4N1AA 5GJWC 4O25A 3GLHB 1YHNA 3TAHA 1ZUIA 1N6OA 1RIFA 3WP0A 3X1XA 3CZQA 5SZJA 4JLVA 3FKQA 1HYQA 4PO1A 4LV5B 5C46F 2C95A 4IDQA 3BH0A 2V1XA 3ZJYA 1YZNA 4N3NA 3ICEA 2LKDA 2ZRMA 1E99A 4PHHA 4B48A 1E79A 1U81A 1E9EA 1KAOA 1Z0JA 1E1QD 4CEJB 3I62A 4CEIA 1RJ9A 1EG7A 1M7GA 2QAGC 2IYWA 5G3ZA 4TSFA 4CDGA 3L8ZA 3KTAA 2VSFA 1KJZA 3A1VA 3QI2A 3W5JA 4BFSA 5KU1A 4D81A 4JL5A 1QHYA 4R2IA 3K09C 1IY2A 3G0HA 3ADCA 4US1R 3GEIA 1C9KA 2NG1A 3WXMA 3HWSA 2Q3FA 1TADA 3K0AA 4BZPA 2W58A 4WZBE 5CK5A 2RGGA 4HAVA 2XB2A 1MV5A 4Q7MB 3RC8A 1I2MA 4DCUA 2FGJA 2F55A 1OXUA 3PXGA 1E2GA 1E9AA 2QSYA 4OI1A 4S2EA 2H1LA 2FOLA 2ZROA 2A2ZA 1UKYA 3LLMA 4KFRA 4PC6A 4Q9LA 5FTMA 3I4LA 3PVSA 2O8FB 1AA9A 821PA 2XZPA 1E2FA 4RD4A 4Q7JB 5GJBA 3RAPR 3KB1A 2F43B 3THXA 1CIPA 4Q4JB 4ZCLA 2H7VA 2XNSA 4ZPXA 5TVKA 2NMVA 1W48A 3LBHA 2IBMA 2XJ9A 2WPDD 1KIMA 4RZXA 5D3MA 1OH7A 1LS1A 2YINC 3M0EA 4IKEA 2CLDX 3SQXA 3IDQA 4NE2A 2E87A 4GOKA 4M1SA 3ETLA 3Q72A 3IIKA 4WZ6A 4DSTA 4ZCIA 4IOLA 1KMHB 1YZUA 1GTVA 1MH1A 2YOGA 4M9XA 4JYBA 1W4BA 1XEWY 4HDCA 5F2EA 2KBEA 4DVGA 3ZZUA 1CU1A 3TIFA 3OESA 2QMHA 2ZJOA 2JLYA 3GJXC 1KI3A 3A37A 1Z47A 2JLSA 3IIJA 1OIXA 4FWIB 4G0NA 4HLUA 4OI2A 1OLOA 4QJ5A 1E9RA 5EP3A 3RWOA 2VSOA 3PEWA 1FW6A 1XMJA 2ZRHA 4BPBA 4MDEA 3N2EA 3BH6A 3UG7A 4A1FA 1E2PA 2IS6A 1U8YA 1E9CA 4HSEA 1SVSA 4C9BA 5IK2D 3NDPA 1G5RA 3FB4A 4NH0A 5E95A 2HCJB 1IXSB 1XTJA 5EXSA 5P21A 2C03A 2KSQA 3RHFA 4Q48A 3FKSD 4MRPA 3PUZA 3NTUA 2ZM5A 1WDTA 3ADKA 1OYYA 5JCPA 1II8A 5LD2B 3R20A 5DISB 3WNBA 4MYUA 4BRWA 4JBXA 3VR6A 2ZRJA 3UPUA 2Z4RA 3SFVA 3CRQA 1OFTA 3HYTA 2FPLA 4F4CA 5E7JA 4R71A 3PJRA 4ZCMA 4U7DA 2P67A 5KNDA 4I1UA 4OBEA 3RRMA 4NBSA 3RABA 3LX5A 1TQDA 3I3SR 1N6RA 4A0RA 4FMCB 2AK3A 4B6FA 2IHBA 2IYZA 2J46A 4M4SA 3TUJC 1OE0A 4ZKEA 2V3CC 3SE0A 1TPZA 2JA1A 5FUWA 2BEJA 4DLUA 1U9IA 4DZZA 4EFNA 1E1RA 1J8YF 1MO4A 1PJRA 1Z0FA 4TN1A 5EUQB 4F7WA 5FPHA 1EFRA 2ATVA 5EJEA 2WWHA 2GK7A 4UNRA 2CL6X 1OHHA 3VR1A 1AZTA 2I3BA 4C4PA 1GL6A 2J0VA 1KI6A 1NIJA 1Q12A 1MRNA 2JJ8A 5KDDA 3MWLA 1ZUNB 2IF0A 2YVUA 3G5UA 4LV6A 5AJYA 2VP4A 3FOZA 3EX7C 2ZSEA 3VNVA 4Q1BA 3MFYA 1EFCA 3ZDQA 2CE7A 4Q4HA 1Q1ZA 1Y63A 2Q9AA 5FUVA 1S4QA 4TMXA 3F3YA 4A9AA 3K70B 1R8SA 1W1WA 3E2IA 3REFA 1RFLA 1HQCA 3RS2A 1L7VC 1XTIA 4LY6A 1SKQA 3WRYC 2J0QA 1D9ZA 4EPWA 1T3LA 3MRSA 3VU9A 2VIIA 4BEJA 4TZ6A 3LAWA 2ORVA 4YQFA 2XNDD 5AUNB 5AJZA 4LJYA 3GEEA 4RCZA 2YZ2A 2FFBA 4LI0A 1A4RA 4HB2A 3KKPA 2V7QA 1KSFX 4XD7A 1KKLA 4IEEA 1N25A 1YR8A 5JEDA 1KDPA 2IC5A 3HU1A 1IOZA 1IN6A 4U5XA 1A1VA 1R5NA 4B3XA 4TLAA 1ZC4A 1XWIA 1SXJD 1G8YA 4G3XA 4Q21A 1W0JA 3TW4A 1Q3HA 2A7QA 4IHQA 4MA4A 5HKKA 3NEJA 1Z6TA 1H8ED 1GKUB 3BB4A 3KJIA 3PUXA 3MWJA 3THYB 5FR1A 5JWRA 1P2TA 3CF0A 3L8YA 1J8MF 1KDOA 2QPAA 2ZI3A 2IYLD 3QKSA 4G5SA 3W3ZB 5HKKD 3ZVMA 1FZQA 1Q44A 2ANCA 3O8DA 3QXJA 5EXTA 5FPTA 5FPSA 2JLQA 5AJXA 3CLVA 3QKTA 4PZLA 1XCPA 4KFTA 2FEMA 1HH4A 1LW7A 2ZAMA 3LW7A 3KKNA 3QBTA 4TL9A 3PUVA 1T5IA 5DYGA 3ZGXA 4C0JA 4LK2A 3K0EA 3X1ZA 1MR3F 3K9HA 2C98A 3LQRA 5DHAA 3B7GA 4LBWA 1BYIA 2BJVA 1XTKA 1A5TA 2A5FA 2C78A 1VCIA 4PXAA 4WBSA 3LX8A 4IXNA 1ZBDA 5IDVA 4Q4JA 3B9QA 1US8B 4W5WA 1XD9A 2P6NA 3OZXA 4US2R 5HPYB 5BYJA 4GOXA 4LYHA 5EP1A 3WRXC 5KSZA 3TK1A 1J90A 1NY5A 5DSZA 5M04A 2P5SA 2ZRDA 4NYIQ 4PHTA 1FTSA 3RANA 4KODA 2QA5A 4II7A 2GNOA 3IQXA 2P5TB 1RYHA 1ZIPA 4QBIA 4BZQA 4CYMA 2NGRA 2OO7A 3BJIC 4PSKA 1S1MA 1S9DA 1AK2A 1DBSA 2DWOA 2QM7A 3DO6A 4P4UA 4RFSA 3KUCA 3TH5A 2XOKD 4M2LA 2FNAA 4OI0A 1E2LA 4AYTA 1E2EA 3QY0A 5G41A 1XCMA 2QP9X 4H9GA 4G5QA 4HB3A 3CUEF 1CRQA 3RSLA 4A2WA 4KU4A 2O8FA 3ZIAD 1KOFA 2NO6A 3K0AB 4PAMA 5AUPB 2FEOA 2HV8A 4U02A 3T35A 1EFRD 1E2IA 1W0JD 4QC2A 3NBYC 3DHWC 3Q8XB 3SYKA 5CM8B 1LF0A 1T4GA 4OK5A 5KUTA 2YC4C 1LVGA 4P31A 5ANRB 1DTSA 1T91A 3TSOA 3C41J 2NOAA 2OCPA 4XTCS 4NP6A 4MRNA 3CRW1 4MUAA 1Q1EA 3EA0A 2F43A 4F92B 3U2QA 2XZLA 4DLSA 5B57C 3UMRA 2OLJA 4W5JA 3T34A 3U7HB 1N0WA 1NBMD 4MKGA 3RC3A 4JYCA 3SJBA 1G7CA 2CE2X 1E4YA 1OHHD 1DAHA 1JJ7A 4KFSA 4ERNA 4BLPA 4CGZA 1S2MA 2VP6A 1DVRA 1FX0B 4XH9B 5EP4A 2N46A 4NZYA 4URZR 2GEUA 4BEBA 3NBXX 4IVPA 4WVFA 2QTFA 1CJUC 1G3QA 2O52A 2A30A 5CB6A 5KPJA 1YRBA 2QMOA 3DMDA 1CR1A 3AVOA 3BGWA 3AB3A 4R7ZA 2QTVB 3MD0A 4Z1MD 4LC1A 5BN3A 2XTNA 4B2IA 4DRZA 2OT3B 4W7SA 2YYZA 1XPOA 2B92A 2FF7A 2PLFA 1Z2CA 1G17A 2C9CA 4Z1MA 1LF5A 2O8CB 3UIEA 3UKDA 1Z63A 1KI7A 4TLEA 1MRSA 2G1JA 3IBGA 4HLQB 1JR3A 2HYDA 2FWRA 5E7MA 4K81B 2IYQA 2OFWA 2PH1A 4C7OB 3Q9LA 4RD3A 4PZYA 1XPRA 4MKFA 1G9XA 1RRCA 2FFHA 3LNCA 4M53A 3RNLA 2XSZD 2WJGA 5EZ6B 2WJVA 4B6EA 2Z4SA 3VX4A 2XB4A 4KAXA 4I1SA 1CKEA 1W0KD 2B7BA 2PMKA 5DO9A 1JXMA 1VYTA 3W8NA 4X8MA 2AFHE 2MSDB 2GCNA 2DCUA 2R9VA 4TLBA 1E98A 2AXNA 4ABYA 5KTYA 1IAQA 3K1JA 4B2LA 2KB0A 5FOXA 4K8OA 2PZGA 3EPHA 2EYQA 3K8YA 4GT1A 1K5GA 3BXZA 4LHYA 2QORA 3IIMA 2FX3A 4HLCA 1U9IC 1W49A 3MSXA 1L8QA 4GSYA 5FBRB 3AP1A 3ZS9A 2A9KA 3PUYA 1SXJC 3BK7A 4JLBA 4Q1FA 4Q9HA 3GLIB 2QRZA 5B30A 1KI6B 4DLRA 2OXRA 2XZOA 3ZLJA 4RCYA 2ZRNA 5F9HA 2OXCA 5KSYA 3K9LA 4Q18A 1W36D 2GXQA 4Q4AB 4A6PA 2P6UA 2WAXA 3ZZ0A 4V0LA 1U99A 2G1KA 3PG5A 5JSZB 3R7WA 2CNWD 5K8UA 4OJKA 4XWAA 3DM9B 1KO8A 3L82B 3SBEA 3EIEA 1X1SA 2NPIA 4N0EA 1G20E 3SI7A 4JJKA 1SVWA 1S0UA 1X1RA 1HY3A 2CNWA 4TQ9A 2GILA 4XD7D 1II9A 1EX6A 5A5GA 4I1VA 3CH4B 2RGAA 1VHLA 3CPEA 2OZEA 4JS0A 4IDOA 5JMTA 1Q57A 3KQHA 1D2NA 3AF1A 1W0KA 3LH5A 5J4KA 2QE7A 4A8JC 2WIBA 1UBEA 3AKCA 1UPTA 3ZIAA 3L0PA 3MG9A 4M21A 4HLUC 2F6RA 2ONKA 2ZI7A 1RRPA 2FPMA 2FPKA 1O87A 4ASUD 3EA5A 3QOFA 2TMKA 3IUYA 2OSBA 1E0SA 3W8RA 2RGNA 4HB4A 3QXSA 1HT2E 4KLZA 4B3BA 1SZPA 4UKDA 4Q4LA 4TTPA 5JEEA 4NYJQ 1N5KA 3BH7A 1G3IA 4V0ME 1K5DA 1XXHA 1ZCAA 1NI3A 3LD9A 1OW3B 3CWZA 1CJVC 1RW4A 4MH0R 2W0MA 1MO3A 3FHCB 2WAYA 3THOA 1I4DD 3I8XA 4KO8A 2EVWX 1CR4A 5L3SA 2WSMA 3H86A 2P0EA 4AYWA 1O3YA 4D25A 1FP6A 4LJ4A 5FBWB 2V8OA 1IN5A 4D0LB 1ZD9A 4I99A 2WVJA 2WICA 3IGFA 2MSEB 2A3RA 2VA8A 3CF6R 4B34A 1WBBA 2R6FA 2CCJA 3QEJA 1BIFA 1EXMA 1KO7A 1ZYUA 3CR7A 4WXPA 1D8TA 3TQFA 1GUAA 2OCYC 1OKKD 1SVLA 2ZRKA 4X8LA 5FOVA 1FMLA 1NSFA 1QHHA 4JLAA 1A82A 4KCGA 3C4JA 3EASA 2PT5A 5J5CA 4PANA 3B60A 4WZAE 3U7GA 4AURA 4EJSC 4IVQA 1R6BX 5BN4A 2CHGA 5FTKA 1R8QA 3F5FA 1P72A 3LV8A 3IBYA 3FMFA 4LCBA 1NF3A 1XZQA 2R2AA 2FSIA 3VMFA 2ZEJA 3EZ7A 3CH5A 5KNBA 1W5TA 1JR3D 5F9FA 4TYQA 4HI0E 1Z6YA 3P26A 2R44A 5CIQA 1KK3A 1QRAA 2QAGA 3C5CA 4BFVA 2IS4A 3WBKA 3UWKA 2IS2A 2X8AA 2EFCB 3FFBA 5LDDC 4XSGA 4GPTA 1KI1A 3SS8A 4BFZA 1NSTA 1NVWQ 4OQXA 3QBVA 121PA 2XAUA 3CW2A 4FI3C 4DLXA 2WKQA 3OAAA 2L0XA 2OAP1 4TWZA 4URVR 2UZIR 1ZINA 4KFUA 3FFAA 2GESA 2IYXA 1Z0AA 4HUQB 4KYIB 2ANBA 1II8B 4BLOA 2QBYA 3QF7A 3J81k 5JRJA 4DDTA 1DAEA 1QHXA 2KE5A 2QENA 4LJ7A 4Q9JA 3VHXA 4A0HA 4TT3D 3QEOA 4FCVA 3GCGA 4C7OA 2H17A 1DOAA 4TQAA 1ZNYA 4XOIA 2ZR7A 2RMKA 2ZAOA 5TB5A 3I8SA 1U8AA 3TGPA 4F93B 2ZJYA 3IEUA 3DZ8A 1XBTA 4Q01A 4ACBA 2OBNA 3A4MA 3AF2A 1XTSA 3P27A 4OK6A 4EUNA 2XOKA 2JJ2A 3D31A 4TMKA 2QU8A 3NDBB 3TAUA 3NG1A 2GZHA 4IRUB 1E96A 4ZIRA 1GIAA 3EPJA 2VRWA 4LPSA 3B6EA 4CEJA 2YJTD 1VMAA 2H57A 3HR8A 1AS3A 3I73A 3UANA 3EXAA 3MWKA 1ZC3A 4OKSA 2ODBA 1AGRA 5KDLA 4MKHA 2I1VB 2ZSFA 4IW3B 4XTRA 3QG5A 1MKYA 2O5VA 3VR2A 3IILA 3MWYW 3TSWA 1FPMA 3DDCA 3QENA 4ZI3A 1IM2A 1P5ZB 5HE9A 3OF5A 3QKSB 5HCNA 4LV8B 3PENA 1AM4D 1OH6A 1D2EA 1R2QA 5EE0A 4MGIR 4TYNA 2DHRA 4OQFA 1HV8A 1G291 2YKGA 3H0KA 1G3MA 3K9GA 1CS4C 1OPXA 1E1QA 3F0TA 1KSGA 1GL7A 4JSYA 4RSGA 4KXFB 3KXIA 4HZUB 1RRGA 3T61A 2JLWA 2R62A 2CJWB 3LVRE 1N3BA 2QUZA 1RJ9B 3U6KA 1BOFA 1HUQA 4TLCA 1RPZA 4QM6A 3DOEA 5DH9A 2OCBA 3DEFA 3GJ8A 3FHTA 2VLIA 2NQ2C 4PC7A 2F3RA 3GPLA 2J41A 1NP6A 1KDTA 4D4KA 2BM1A 4XSHA 2P65A 1RC8A 2QAGB 4EQ6B 1R0XA 4BFYA 4L16A 1HE1C 2I1QA 2ZU0C 1C1YA 3A1SA 5HZHA 2VHJA 1VDZA 3H84A 5JFGA 2ZITA 4LYJA 3QNUA 5FUXA 4A0FA 3QE0A 2DFTA 2RGNC 4GP7A 2Q21A 2GAAA 2ZJ5A 1P6XA 1UKVY 3VTKA 3EIQA 3BAFA 2JJ1D 4HUQA 2B6HA 2VSXA 3AVVA 3QVUA 5LB4A 2GWHA 1KI4A 4PSVA 1KNXA 3SNHA 4IDNA 3WHKA 4QBHA 4A8JA 4LPKA 1CEEA 3NXSA 4UXJA 3OEHD 2WWYA 2QM8A 2GF0A 4P4SA 2BCGY 2IUUA 1F5NA 3FPAA 3R9WA 1R0YA 4JKYA 5TMPA 4NCKA 5J4VA 1QG4A 1XF9A 4AKEA 4GMXA 4OQNA 4B73A 3LRPA 1W7AA 1GM5A 3VKWA 4POAA 1QVRA 3K0FA 1COWA 2NO9A 3DKVA 2O8BA 1Z2AA 2QMUA 2WKPA 2JLRA 2KI5A 1FL9A 2RCNA 3FE2A 3H4MA 4OHVA 2IS1A 1COWD 2BOVA 1Z3IX 3EZ2A 4GBMA 2BEKA 2P3SA 3B85A 4MYCA 1NKTA 1EWQA 5FBVB 2MMCA 1W47A 4WIAA 5JCZA 1X86B 2G0NA 3AKEA 2IF2A 3PEUA 2GCPA 2B7CA 1U94A 3GFTA 4NYJR 4X8HA 2ZJAA 3RS5A 1B23P 2F7SA 3SHWA 3ZVRA 3UXMA 5FL3A 1M34E 1WE2A 2W2XA 1I4LD 2VP9A 4AD8A 2JEOA 4RZ3A 1IXZA 4DT1A 2BBOA 3HYRA 4PPNA 4F38A 2IYRA 2RH5A 4NYMR
chains in the Genus database with same CATH superfamily
1WX1A 4CHTA 3HLYA 4LJKA 3G2JA 4QTXA 2CL7X 3VZSA 1ADBA 4HR7A 5J58A 2WVAA 3LCRA 1O97D 4TKVB 3H5OA 2IWHA 4IRMA 2B69A 4LJ6A 2ZUFA 4IX1A 4GE3A 3H7AA 1JHUA 3K31A 2V97A 2NTYC 3KUXA 5B64A 3I42A 3COWA 4KITB 4H1VA 3CZCA 1SUPA 3BFXA 1TO6A 5IX8A 1G55A 5HTKA 1Q83A 4JYMA 1EBBA 2WJHA 3GGDA 1PYDA 3L5OA 4R9NA 3M9WA 1OH5A 2O9JA 3WBJA 3OZTA 1WUKS 3SC2B 3WQBA 2OO3A 3IAS6 3JAKB 4J7AA 4RDXA 3W05A 3KJHA 2G1AA 2VFAA 3MTQA 1CUHA 1JIIA 2OBLA 1J2TA 5GY7A 4WZBA 2OZLA 4D9NA 4HDKA 1GPDG 3KSDO 1UINA 2FCAA 4ESEA 1P31A 3FETA 3NDRA 5TJHA 5I9SA 2UZ1B 4LYEA 5F1YA 4B7AA 2B8EA 2WPDA 3PF9A 4HX2A 1N2CE 2E1PA 3JAWB 1FUIA 1L1RA 1OWNA 2B82A 3EG9B 3WGVA 1TQ2A 3EN0A 3HN6A 3WGYA 1ECJA 3NOQA 1CQWA 1DB3A 3IQWA 3C6YA 4EPYA 3VA7A 1QGED 2GAOA 3D3NA 4IVNA 4QTZA 5FTNA 1PYGA 2GN4A 1GDTA 2H8KA 4E31A 1ZSVA 5JH7B 4TROA 1F0PA 3RTBA 1JIKA 5LM3A 3RT7A 1V39A 2JI8A 3E9EA 4HNAA 4LRSB 3THWB 3WLLA 2QZ9A 5BMVF 3DV0B 3RYTC 3NHAA 4Q16A 3UGJA 3S5JA 3HB5X 1YT5A 3ZUPA 5HJ7A 1UQUA 4YRNA 3T7TA 1B0AA 1E2HA 3B2EA 1Z25A 4DC9A 3FRHA 2I4IA 3HV0A 4URWR 3RC7A 1BYUA 2W6CX 3E9ZA 3KKQA 5EIXA 2CF6A 3DLCA 2G36A 4JL8A 3GVPA 1TM2A 3I1IA 4MVJA 3K2IA 1GZ5A 1WSBA 2C07A 1QMGA 2ZT7A 4XJXA 2ZYUX 5KAPA 2TMGA 1QS0B 3EIUA 1Z0ZA 1QPBA 2XUFA 4QUBA 3KAQA 4AS1A 1K6MA 3HKEB 5INTA 3C7AA 5FYQA 4DIBA 5BORA 3N75A 3DE3X 1QF7A 2VXCA 5JWOA 4BXOB 1WD7A 3T54A 4YC7A 1R1DA 3BCRA 4PO9A 1F8GA 1CXZA 4UBOA 1H9BA 3WL8A 1N5OX 3FCSB 2NV0A 4J4TA 5JQGA 4G36A 2AR9A 3K7EA 3PDHA 4RFLA 1IQRA 4KDCA 4PXSA 3L79A 5TQ2A 1O95D 4DV4B 3ZEIA 4ARUA 4XJSA 4KGDA 5T41A 1XX6A 1KGDA 4YJHB 5IAAA 1M1NA 3U44B 2JL1A 4LXYA 3W34A 3P9SA 5JZMA 3Q88A 4MR7B 3MXOA 4ZJZA 1RXVA 1NX6A 1JHVA 1KMHA 2HD4A 2I99A 4WOPA 3NAMA 4LY9A 3IQIX 4P4GA 4DADA 4P98A 5EFZA 2W5UA 2ZQ5A 2BMVA 2I6XA 2C9BA 3AC0A 5I7AA 3W9BA 4GNKA 1F8XA 4RSMA 1IEQA 3PJEA 2E85A 3K6KA 3USCS 5I4IA 5F23A 1RWOA 1PHPA 2FEXA 3GEGA 2PBRA 4D80A 3I2KA 2UU9B 3LHFA 3V7NA 2QTBA 2JJMA 4J7CA 4YWHA 3WIOA 1DO2A 3KAJA 1YF3A 3RS3A 4JOCA 5C51B 3IQEA 4IIYA 5A02A 1ZMOA 4L4UA 5JO0A 2FQ1A 3CG4A 3PC8C 1CR0A 3GB9A 3N59A 2I03A 5EGSA 2W11A 4MRSA 5C32A 5ECYA 1CPYA 1ZSYA 3WTBA 5KHLB 3T5AA 4Y2SA 5I8WA 2C9MA 4PZAA 2EKDA 3GLFA 2Y2UA 3WRXA 4FOPA 2G67A 3CEHA 5JSFA 1WZCA 4ITRC 5GM1A 2A3NA 2OK7A 2FPGA 3KZCA 1ADJA 4YJFB 4PZUA 2PMDA 3NIBA 4HS4A 4JLPA 4HADA 1CUAA 4WLFA 5TV2A 1HORA 2I71A 2VRCA 2VXYA 3GC6A 1UODA 4GAEA 2HU8A 4NS1A 5ALJA 3QPAA 1G1MA 1FSPA 4KXUA 1Q3KA 1DMSA 3ORHA 4CL8A 1JKJA 3WTCA 1J09A 4OSOA 3S8MA 2B25A 2GHRA 2FSVA 3EIFA 2PLWA 2ZI6A 2FSGA 4JT4A 2WIKA 3ROZA 2FLVA 4Y98A 4HFRA 3TFQA 2JIZA 3R3UA 4FP9A 3LU1A 4K6OA 2YWBA 4RBNA 4G01B 5M7EA 3DDUA 1GPH1 2W6OA 3K53A 4JELA 3TTXA 4TTAA 1DG3A 1N0UA 4EM6A 3RVKA 5BY2A 1ONOA 2D59A 1W36B 3VKGA 5HMLA 4R8KA 2Q2OA 4WBNA 3PHHA 3R8CA 1ZM7A 2XT9A 1NW9B 1OAOA 3FOBA 3IJPA 4IDPA 5J4HA 2L69A 5KKNB 4HCJA 1BEZA 1I0IA 2OHVA 5BO5A 2AFIA 3AFHA 4HD8A 1P9RA 1N2CB 2E82A 2YWFA 1GEEA 3MAAC 1J0CA 4LC0A 1NWHA 1AGXA 3OZAA 4C01A 1HETA 1WSAA 4NMHA 4R7GA 3KIPA 2YXDA 4IIJB 4JEIA 4RD0A 2JDIA 3C45A 1K5PA 4IJUA 1GPYA 1OU0A 3PGXA 1Z08A 3REQB 2FWAA 3ZDFA 1FA9A 1Q0HA 1UZMA 4LJSA 5BVHB 3N1UA 1N8KA 3K9QO 1H66A 4P4SB 4F7DA 5FPKA 3C7KA 1GAJA 4MMZB 5HCUA 1OSNA 5IULC 4TV8A 4YAEA 3LSYA 1ZMTA 1AJEA 2YZMA 1IEXA 2AJLI 3BFJA 1E64A 3RUEA 3HJBA 1RZ3A 4OI4A 3AUFA 3G8CA 4B74A 5CBPB 5EWMA 1NFFA 2AI1A 4UJ5A 5KO2A 1IY0A 3JSAA 1MG0A 4UHFA 3KDAA 2CXSA 1DEXA 1K63A 2B8WA 2RG1A 3VV2A 4CCAA 4YLGA 2H00A 1LC0A 1X3SA 3E58A 3KZ1E 4HS9A 5BUZA 5CVUA 1V11B 3GDWA 4JBWA 4YP9A 3N2KA 4X66B 2VDUE 2Q8NA 1UUFA 2HLDD 3KCQA 2IQ5A 3M5PA 1MFZA 1KFBB 1SG0A 2P91A 3B1WA 4N39A 5IPFA 2Q0XA 2DM6A 4JIGA 1T25A 3B5JA 1QF6A 1LDEA 5KTSA 1CZUA 3L7BA 2BGIA 1ZDMA 4XWKA 5IDQA 2AC7A 3KRTA 1G18A 1Z4OA 2XNCA 3K9BA 5F1PA 3P8ZA 1O7JA 1Z4JA 2ZK7A 1MNQA 4BO4A 4ZDJA 2W6ID 2WNIA 2ZUWA 1M6NA 1U0BB 3FDJA 3Q9SA 4HDRA 1KPIA 1KY3A 1UBKS 1TVCA 3VPHA 3WNDA 1L5HB 1G8JA 3GELA 4J1TC 2BWJA 5TLSA 1BROA 4G6ZA 4XJTA 4AWXA 3KYJB 4G5RA 4I46A 5L7YA 1GFWA 5KX5A 1AA6A 2YVAA 1KMQA 3BRSA 3OTQA 2V7VA 3KDSE 2XQGA 5CA0A 1SQFA 1MC5A 2FK8A 3CX7A 2PMEA 5IJ0A 2IIBA 4EH1A 3WV5A 3LDFA 3PWKA 5I4BA 2DTEA 1HEIA 2OO5C 3S27A 1I2DA 3TKLA 5C37A 3BJEA 5B36A 1EXDA 5L9AA 3K6JA 2F9LA 4C0BA 5C8XA 3RB8A 4XIGS 5T4HA 3AR3A 3X3HA 4EQZA 4GDFA 4CT4B 2FW8A 2WHYA 2C61A 3EQZA 3W3AA 1K7SN 1V9SA 2JI6A 4XEHA 1ZM9A 3UMSA 1P74A 3M4ZA 5D6OA 1AMUA 1M8PA 3UHOA 1M1NB 3NKLA 3KJEA 5LYYA 3UC9A 3FR7A 1JJBA 3QWAA 1TIPA 4WJZA 1FSSA 5AK4A 4AP5A 3UXHA 2IWRA 4B3MB 1UJ4A 5DYTA 3W9SA 1LWNA 2WPNA 1X42A 4TSFD 3S3TA 4XVUA 1BWSA 1RQ7A 4GM4A 4RANA 4BFCA 2FDCA 3ONFA 1LSUA 1KOGA 1A7JA 4QUGA 3L7MA 1Q7CA 5EQDA 1R74A 3M1LA 2R4UA 4YRKA 2OG2A 3L6RA 2IXAA 1Q7TA 1KIAA 2IXEA 2XCUA 4BNGA 3PX2A 4P22A 3X43A 3UUGA 1ICIA 1N0IA 2G04A 5KJEA 3T0IA 3N05A 3EIXA 5KVAA 4H2DA 3I4CA 3D1JA 1BRMA 3P9KA 2JIDA 3NBZC 1SXJA 4BX2A 5JD5A 5JTUA 4OHUA 2JLAA 1E9DA 1T34A 3QFSA 1JBQA 1W5BA 9LDTA 1QK5A 3L6DA 1T9CA 1M0TA 1UAYA 2IEGA 1LPSA 4ETIA 2ZSBA 2VDOB 4L5JA 1IEWA 1CE8A 2ZE8A 5AD1A 4ZDWA 5C8YA 1QWOA 2UYOA 1A4UA 1U0SY 5FPPA 1MOZA 3V8NA 1VPWA 1J5PA 4LS3A 4URXR 2GX6A 2NO0A 4ZGWA 4WI1A 1Y7LA 3O73A 1CQJB 4N7RA 5EJ8A 4AO6A 3EW7A 2FPRA 4OEHA 1K89A 3PS9A 3TNFA 3MSCA 1R7RA 3GDGA 4CLRB 5FUBA 2BBTA 2ZRBA 3JZMA 2YOFA 1W96A 1YI0A 3AVXA 3BBLA 3DVQX 4MOWA 4QGFA 1P7CA 5DCYA 1Y8ZA 4O2RA 3OTIA 5HBGA 3V7YA 2EQAA 4LI3X 3EQ8A 5TJ9A 5KB3A 4UEWA 3T7DA 1BGVA 1UBGA 2HA2A 2HJVA 2PT9A 2WKRA 4JGBA 4PC1A 3PKJA 3K0HA 1BH2A 3OCUA 2PA0A 2R00A 4PPQA 3KQSA 3WMFA 3EB9A 1FYXA 3HKBB 4KG7A 1CR2A 2HLDA 2NZYA 4TRJA 2JAPA 1JPNA 1S8OA 3EFOB 2D62A 2F3QA 1R6UA 2QIPA 3R3JA 4JP3A 4KWTA 1CETA 1KO4A 2P9GA 2QI9F 3E7FA 1SBTA 4HP8A 5GVRA 2HXSA 2DFLA 3DHYA 4LMRA 4F3KA 1QGDA 4OYHA 1HFWA 3EMDA 3G8AA 2JBAB 4FGZA 4YDSA 5C1DA 1WY5A 1G9SA 3O3NB 4N8SA 5I7UA 5EERA 1S7CA 5TGZA 1CLUA 2O2HA 2X1LA 1LJLA 1TYAE 3SLGA 4Z99A 4KXLA 4BUZA 3ECCA 3QPUA 1NDQA 3V2GA 3AHDA 4KK3A 4CMJA 2A5JA 1C0PA 2ZTSA 3Q87B 1R8XA 2BKUA 4URYR 1NLFA 1Q5PA 5HFJA 4RNCA 1NN5A 2OEPA 2VHVA 4F72A 2VPQA 1PLKA 2NZ2A 3GFPA 5JYCA 1N6KA 4KIGA 4EK9A 4F3NA 3ISJA 4FFBB 3HE3A 3QV1A 5DPMA 1SH7A 1L7DA 4MMXB 3KHSA 2Q8QA 5L95A 4JJEA 1XU7A 4UTOA 4D43A 1UPCA 3AR5A 5IDWA 3G3EA 4PFQA 1ECBA 1P5RA 4YAIA 5U1PA 4C7MA 1FFEA 1SQGA 4HNRA 1XU4A 2ZU6A 1H8EA 3RGGA 2H1FA 1N77A 1G20A 2FG5A 2HK9A 4LKOA 1SHKA 4PCVA 3IAFA 4RPJA 2FN9A 3WQHA 4E3ZA 3S2IA 4MCAA 2I6UA 1A88A 1ADFA 3FDZB 3MJSA 2IODA 1GTJ1 3PP8A 5DLEA 3GJ0A 2C77A 1JWAB 5TQ0B 4ND6A 3B7WA 1DX4A 2YW2A 2ZOSA 3CO5A 3D2LA 3F3MA 3I9MA 1EA5A 2WJJA 1T9ZA 3JASB 1OREA 3K15A 5EXEA 3INYA 2HHJA 4OUKX 5JQWA 3LUPA 4O8CA 2NXJA 3VR5A 1WMSA 1XPUA 3A28A 2JB9A 4FQ7A 2FPIB 4C3ZA 1Q77A 3ND8A 3V8RA 1SA0A 2AN5A 2VDPB 1NBMA 2ZWPA 3QQPA 1R9MA 1R5OA 1JB9A 1HYHA 1RSZA 2A1IA 2EJBA 1H6DA 2ZTMA 4UBKA 3V48A 1GNRA 4Y1RA 1J39A 3BL8A 3ORSA 5JO9A 1PR9A 1V35A 1NXWA 3CNOA 3G9QA 3IO3A 4RYDA 4MUNA 3HCRA 2VWQA 3JATA 5BWBA 4WNCA 1JXOA 2XGSA 4QYIA 3ZNNA 1L7NA 4C6HA 3NC4A 5JS7A 3FDXA 2JD2A 3RDPA 4GZ6A 3KYDB 4IWXA 2JIOA 4WK6A 4ACAA 4ZYWA 1NVMB 1Q84A 1CF4A 4P83A 4FYJA 3O8CA 1JU4A 2OECA 1XSEA 3CBGA 5FD8A 4YCCA 1W4RA 1MBZA 1QKKA 1IUNA 3CRMA 4M8IA 4ENWA 3Q6MA 2H1IA 4DVJA 2H4HA 3ED1A 5BUCA 2QUJA 1F2VA 2O2EA 4HL6A 3UK6A 1Q17A 1WM1A 2PK3A 4ZO9A 3ST7A 3VPDA 1ZL2A 2QXTA 3O4FA 3AINA 4TZ0A 4QXPA 2HOQA 2PRKA 5E2IA 1NY6A 3BM5A 3RHSA 3CRRA 1V6CA 3HR4A 3IUBA 4A0SA 4UOZA 3GVXA 1M2KA 3VFDA 1VBNA 3GR6A 1EM6A 1DKRA 4QM7A 2BEWA 1M1XB 4PYQA 3ASYA 1PTJC 3AJAA 3P19A 3HPQA 2WV9A 2XTAA 4DCSA 1THMA 1QB8A 4DIOA 4E1BA 3EZXA 3EC7A 3B9PA 2CJPA 4G8CA 2ZYAA 1A69A 3JQAB 1P3DA 1ZESA 3OQVA 4KUEA 4UAJA 5EINA 1N1DA 1K06A 5G53C 3ZR4B 5B1YA 5A3RA 5F3WB 5FQOA 4ZOLB 5IZCC 1WLSA 1M6VB 1VLLA 2G25A 2H31A 2RHMA 2XYRA 4F85A 1F9EA 1XZPA 4YO7A 1A9XA 2VI5A 1Y8QA 2C9OA 2PM8A 3VVLA 3P2EA 3NC1C 2AR7A 1GT91 2HFKA 3CINA 3ER9A 3S44A 1C41A 1QYVA 3G82C 1LNZA 3AMVA 3KWJA 1JZQA 3NNNA 4KP7A 4RTPA 2MDTA 3N8NA 4MUXA 4PYJA 3VC3A 1W75A 4C07A 1OTYA 1U04A 5DM1A 4A91A 2WTUA 1RYMA 4JU9A 4XGKA 3B3FA 4ALJA 3OX4A 1EESA 2Q2NA 1C2YA 2Q1TA 1ZLYA 2D54A 3O94A 5LVAA 3WB2A 1YU9A 2BRUA 2Q3DA 3B82A 4KQ1A 3WSWA 3ZU6A 1YB2A 2JVIA 2X8JB 3LY7A 1HDXA 1EFTA 1KP9A 1FOEB 4RIEA 1JEEA 4EBFA 1RRFA 2O05A 5F52A 1HTBA 4BBPA 2F4VB 4LFAB 1R0WA 1PYOA 1SC3A 4FQ5A 1L7QA 3GD7A 1S02A 2Q3HA 4HN9A 1IPFA 1RI5A 4MV8A 2AOXA 4MWSA 4CM6A 3TZLA 4MRMB 3VDRA 4DC0A 5JHHB 1PT9A 3IXMA 3B3GA 5B1HA 1AV6A 4HAUA 3TL2A 1QQ6A 1UFVA 4MS4B 2XUHA 4OGGA 3EDRA 4F9FA 2MCFA 3ZY2A 2FE4A 4RZHA 1EGQA 1OXSC 4Q66C 4S35A 5FTJA 4ZCTA 2XA1A 3OZVA 2BC9A 1FP7A 1J2JA 1X1BA 1U9ZA 3I9LA 3I9FA 3B70A 1RRVA 3LF1A 3PQCA 4YLYA 4RIGA 1ZCFA 3ZHQA 1PEYA 1WRBA 1Z6PA 1QG2A 5CVVA 4CWAA 1XMOB 3UMFA 3VYSB 3A6JA 3DWEX 2GPTA 2BHSA 4L9AA 4XQCA 3RIXA 4NS4A 1CY1A 2UZ0A 4PQYA 4MHOA 3C8MA 3LHSA 1C30B 1E3WA 2P4HX 1J42A 2XY4A 3ORFA 1IN8A 5CA0B 4NK4A 4YRBA 4ZHQF 3F8SA 3I04M 3O0DA 4MQFA 4DLZA 5A4DA 2H5EA 4DOMA 4LFBB 4G81A 2DEUA 3VJRA 1I2CA 2GXUA 1E1KA 1KGSA 1PQYA 3TSZA 2ACKA 2J5KA 2LV8A 2WU1A 5HBRA 4DREA 5KVSA 3K4PA 4ON9A 1F4LA 2GJ4A 2PQ0A 2XUGA 3B5EA 2GDZA 2B0JA 4I6GA 3ZHOA 4EHLA 1TQ8A 3OLQA 4Y6LA 4Z4IA 3DLAA 5DHSA 3KTAB 4AKHA 1DRVA 2PMBA 3ZJ4A 3QY9A 4FMDF 4LZJA 4C6RA 1I6LA 1YJ8A 3U0VA 2H7YA 3JQBA 3WYDA 5J2TB 1PX2A 2EBWA 1FMFA 1Q0SA 3D6HA 3ZJTA 1MAAA 4H7HA 1H3NA 1QRDA 4HFNA 5L6LB 1L4UA 3TOSA 4AG6A 2EHJA 1PBNA 1RPAA 1I7NA 5AM5A 3U7FB 3CVJA 3FBWA 3OOHA 1YS1X 4HATA 2XA2A 3DTYA 1Z0UA 2AXQA 2OLEA 2QZPA 2PYDA 2V55B 3KCNA 4R1QA 4UMFA 4M54A 1Z74A 1KVQA 2GB4A 4W1RA 3NBAA 1OX5A 1T3GA 5FNZA 5LWHA 1A2BA 2FFAA 1STOA 1KY4A 4DLPA 1TD1A 3T5DA 5HIKA 4CQMA 4M1MA 1KNQA 1BJTA 1ZOPA 4H35A 5JATA 2QMQA 3KQLA 1H05A 5K0NA 4RA6B 4ND8A 3D3QA 1JAZA 1H2HA 4NZZA 4XYGA 1PJAA 3LKZA 5CH3A 4WNYA 4FB5A 1K75A 2IHJA 1ZHHA 1Q0RA 2WMNB 4CMCA 1UPBA 1YDEA 1N57A 4NCHA 5G40A 3I52A 3AEKB 4KQFA 4WA7A 1SQSA 2YHBA 4RIFA 1U8ZA 2ZWOA 5TS2A 2ZS9A 3AG6A 3C5EA 3OJCA 1P2VA 4TUYF 4V02A 1DO0A 2DC1A 3DKPA 1VJRA 5DYIA 1SCIA 4EA8A 3RRXA 3HNRA 2FP4B 3V1MA 4HDOB 3SXUB 3RVJA 3U5ZB 1BVRA 4BFWA 3I61A 1SOVA 2XIQA 3QUTA 3OSZA 2PNFA 1ZW6A 4D2IA 1DXHA 4J2OA 3NM5A 2W2KB 2ZDHA 4RKFA 5JAQA 4L78A 1N7IA 3U40A 3AEUB 3MRTA 4DPKA 1U2ZA 1I7SB 1N2HA 2P11A 3PWSA 3JZFA 3I2FA 2V6BA 4LWZA 2QAIA 4AJIA 3TIVA 4KHPB 4C4ZA 2WLTA 2GARA 1E0KA 5AW7A 1EX7A 5F35A 2DUUA 1CBUA 4KN6A 2X2OA 3VAZA 4LSGA 3OPXA 5FH9A 3QMWA 4W1QA 2BELA 4LIPD 4AKIA 4GRIA 1JAHA 1M2EA 1WP9A 2AE1A 4MV1A 5CEFA 3FIUA 1M72A 4W6ZA 4Z8XA 5JD3A 3D6VA 1FNMA 1YJXA 1AUPA 1XF1A 4WKCA 4DV5B 3UJ9A 2W4MA 4F86A 3LCJA 1TO2E 1X8KA 5L8VA 4UJ3A 2L42A 3AFGA 5TE9A 1TLTA 4LSZA 3RYCA 2Z0MA 1UIMA 4MEBA 3PGA1 2C8KA 3VO2A 3WOVA 4GLOA 3FVQA 2DXIA 5IM5A 3WYAA 4X71A 3DMNA 3KHKA 4Z0NA 4DY6A 1E32A 3ZDBA 1VB5A 1BEEA 1WXHA 4UUAA 1IUOA 2H2WA 2YZKA 4R3WA 3ZC3A 1K3UB 2C99A 4RGVA 4CF4A 2PXXA 4NPHA 3CVVA 2QE7D 2CUZA 3MGBA 4YALA 2TRSB 2AZMA 1W85A 5KOJB 3G1UA 4I81A 5I5GA 1UBMS 4DGQA 2Y93A 4FKMA 4JEUA 1WVIA 1F7VA 2PUVA 2PX0A 1UDWA 1T1SA 2WTBA 4KAFA 4U3JB 1GQSA 1O9HA 2DPXA 4Y2VA 2W6JD 1QDEA 2PAAA 3KOWA 4RMJA 3QEBZ 3U80A 3HCNA 2HMWA 3F6PA 421PA 1J8DA 2GDJA 3W6ZA 2XBMA 3QU7A 4KGVA 4I08A 2EBHX 5TQVA 1AB5A 4IFEA 4A27A 3CZPA 5IXYA 1P1BA 3DV2A 5L3ZA 4XPIA 3A6KA 4BU0A 2PSEA 1OMOA 1TJ5A 3FBGA 3CUUA 1W9MA 5KYYA 3DL2A 1TXGA 1NW7A 3NTVA 1DV1A 4AAYA 3EH1A 2J9GA 3ZXXA 3A36A 4HJXA 1E8NA 4JGIA 1QM5A 1SHTX 2IYNA 3OCCA 5B1SA 2ZZNA 4BVJA 1PS9A 4MVXA 3ZJVA 4IV5A 1Y7TA 1DEAA 1KHTA 3DNPA 4QVIA 1ZU5A 3EBOA 4HQFA 3H05A 3OQPA 3WLTA 2B2NA 4YTEA 1DKOA 1LZLA 2ZRAA 1HLFA 2AG1A 2PD3A 4AJ2A 3KT8A 2CFTA 2JKVA 2VAXA 4COKA 4Y8VA 1AS2A 2B8JA 5DCWA 1FLDA 1MX3A 2HBQA 2J3MA 2WFAA 1RXWA 2IXFA 3DVSX 3GEBA 2GH1A 5FIUA 3R8XA 2QDKA 5FFFA 3WGUA 2G9NA 5A3JA 4ZVUA 1P81A 3GRFA 3B48A 3F5MA 5K0ZA 3A14A 4L28A 2EX1A 3D4BA 5E0OA 2IW3A 2IIVA 3QLVC 1K7YA 5IF9A 5JY6A 4P3YA 4UM8B 1BSVA 5TARA 2LXNA 4EL0A 1C14A 1E2QA 2YXBA 4LJ5A 1Q15A 1QK4A 3OHMA 3QKIA 3NEAA 2IOHA 5AHOA 4BO1A 4Z7JA 4PS0A 3VYUB 2D06A 1FUEA 3DQQA 3HBLA 1BQ3A 2C42A 4O4HB 5A3QA 2FA9A 4OTZA 4U4AA 5BSWA 4DNOA 3TFWA 2JG3A 3M6VA 1Y3FE 5FFNA 1PJTA 2WG2A 1U8EA 5DRYA 3T9CA 3W3AH 1UAAA 2DF8A 4KQ2A 3NETA 4M0CA 1TO1E 3G9XA 2BUAA 5K6RA 2PGOA 2OZPA 3JRXA 4R2HA 2GD0A 5TIIA 1RQGA 1ORIA 1RI3A 1Y4UA 2ORWA 4TS3A 1KTIA 1PV4A 2AX4A 4DR2B 4QOJA 1ENYA 4LYYA 2V5UA 3LK6A 3H5AA 3M6FA 1F6BA 3B1ZA 1SQ5A 3D7SA 1E7WA 4Y30A 5IEBA 1N92A 2HHLA 3AF3A 2GZRA 4MUMA 4O0MA 5H82A 4ZDIA 1F17A 1H1LB 3H0EA 2VO1A 3HYNA 2N47A 3LT1A 5EY5B 5G3YA 2AOUA 4EG7A 5K8LA 1ESNA 2R7KA 5IRCD 1DAFA 4YMHA 1T3ZA 1DGQA 2FFQA 2FMIA 2K5UA 3A3NA 3DEIA 5ICEA 4NZMA 3MT8A 5DI9A 2FMHA 3LQQA 4CMAA 4ER3A 3TDKA 2EFJA 4YX9A 3GP3A 1NN0A 3ETCA 3MLEA 4QXRA 5GGYA 3KEGA 1TEXA 5ALRA 5IW8A 1DINA 1SUBA 3RF6A 1OWLA 2QTTA 1QSGA 3RUDA 4Z4CA 4WLUA 4HEJA 5E6UB 1FLAA 1JRLA 3JQ9A 2WW8A 2PO7A 1THTA 4L3VA 5E4FA 4U8GA 1AU9A 3JS5A 4EFMA 2EU8A 4M1TA 4O4IB 4XGIA 4OHZA 3SX0A 1RHMA 5EVCA 3WJ7A 1XKTA 1YUNA 4AZ0A 4L8GA 3M7IA 5JW6A 5D2CA 1FX0A 2HDNB 3PWZA 3Q7SA 3EDOA 2ECOA 3LPNA 2DETA 5G1NA 4UBLA 4YUVA 2R68A 1G19A 2VBCA 3TG2A 2O3SA 1N5RA 3QKRA 1Z5NA 1TVKA 2WF7A 3CF4A 3OE7A 4WERA 3IX7A 4XVQA 5E7QA 1GGMA 4YUZA 4K7JA 1HT1E 4B2YA 4E2FA 4JMPA 4XQ0A 1OZFA 4Q15A 5HW0A 4GDMA 4CKBA 2QTZA 2EFYA 3ONWA 1ZVVA 2X1HA 4RCVA 8AT1A 2F8SA 2ZUUA 5K3EA 3GZTB 3OLZA 4BU1A 1PNOA 4ER0A 4MI3A 1FP1D 2EYUA 4M89A 2YNMA 3BDAA 3OECA 1ZM2A 3DMYA 2FZKA 3GLGB 2ZSDA 3BMNA 3P9YA 1E1MA 1DZIA 1JHDA 5EHQA 3PPIA 4WW0A 3X1YA 5C81A 3BA6A 1UJ2A 3GG9A 4WZZA 5H02A 4O3MA 3QPBA 1DV2A 1XRQA 1O95C 1TAGA 3NYIA 2C96A 1G5PA 2VVTA 4ILEA 2IHYA 1GCIA 1A2KC 1BMFD 1BD3A 2R25B 3PTZA 4RPHA 1U6JA 2N9UA 1XTTA 4UUNA 3KSAC 3DPSA 4EJSA 1I0ZA 1KR5A 1NBEA 3ZY3A 5ICMA 4ER7A 3OM8A 3P45A 4J9UE 3S28A 5KWJA 1LLQA 3CVYA 3PRJA 3WL7A 4FBMA 3ODGA 1QFSA 3Q1LA 4ZAGA 3RNOA 4Y6OA 1DC6A 3IYLW 4OX9B 4FEYA 1EVJA 2GFIA 3MGCA 4R98A 1H2XA 4DSAA 4QULA 2XBLA 1PU2A 3DD5A 2QN2A 5K8TA 1HPLA 3CLTC 1DTWB 4QGHA 3LGSA 1OFUX 2C2YA 5AM0A 3R7FA 4WNAA 4Q7LA 1R5JA 1AKQA 3PYLA 4BASA 4TL7A 2G63A 1N6HA 1IZ8A 3HDHA 4DBZA 3JCZA 2A8YA 2JAHA 3P32A 4HDKB 4R69A 1QH8A 1UOEA 3O4VA 3T4PA 3WL3A 3WYCA 4C3VA 4X1IA 4H0CA 2EP5A 5E0KB 2I7XA 1LSJA 2DY1A 1N9KA 2ORIA 2ZJ3A 4HNGA 2MTBA 4L6CA 4YJ2F 4IJ5A 2Q9CA 4M9UA 5HGJA 3ZYCA 4J91A 4DJEC 1ND5A 3G59A 4EKIA 2D2FA 4LF4B 3K6SA 2FPXA 1UDBA 2CD7A 3G49A 2POCA 3IBCA 2GBPA 3WIVA 2JIRA 3E48A 1D2GA 2I55A 4ISCA 1LDYA 4JWTA 4GSLA 4MEAA 4OL0A 4Y9SA 1NBIA 3RARA 4O4JB 4B3CA 2FVYA 3BMQA 5B3LA 5JH7A 1C0LA 1YZ3A 4DCGA 4F12A 1CULC 4K9LA 3CSSA 3AUYA 5J5AA 2ATCA 4JI0B 4A7PA 2AJDA 1MQSA 1EB8A 5JXWA 1MFPA 2H2DA 5D00A 2ZJZA 4RVFA 6CHYA 5CHEA 2D1RA 1NUPA 2FUNB 3CXUA 4MS3A 2WSSA 3VHXB 2QLLA 2YHSA 4DCCA 4DA9A 2AN4A 2RH9B 2AC2A 3WLRA 1NNEA 1F7UA 4QGGA 1LDMA 4K9OA 3V9AA 4CDRA 2WIJA 1JPVA 2Z2JA 1EIWA 2BFNA 2RI1A 4LX0A 2PL9A 4X6XA 2D1FA 4QRHA 1N9GA 2G77B 4E08A 1YZKA 2H48A 2ZANA 5AW9A 3DAYA 4JI8B 2CFRA 3DUWA 4EEKA 2WB4A 1BHJA 3LDGA 1FSFA 4B45A 3F97A 4FR0A 4R05A 4RHCA 5DHQA 3F9RA 1WXGA 2IYOA 3FTEA 2C54A 1FBNA 1VP9A 2DERA 2ZVJA 1KOLA 3OEEA 5HIJA 3E5HA 4II3A 1XQXA 3P4YA 4E15A 2DQ4A 4GKBA 2H16A 4JLMA 3FHOA 4NU0A 4BQSA 4P34A 1S3SA 2ZTLA 3AJDA 1FFXA 4FS3A 3TTVA 1UBOS 4KDEA 4I55F 2ECFA 4YYZA 1M6EX 3OG9A 3TG8A 3GRKA 2BDUA 2XITA 1W4AA 3DV0A 2HWUA 3LXMA 4MRVA 3VC2A 3RSOA 3E82A 1VTKA 5BMVB 4D9IA 2F1KA 2QVCA 1V7CA 2DBVO 4NESA 2PE5A 2PX6A 1PP4A 2VQDA 3H4IA 3IP9A 4D41A 1O8CA 1P0FA 1YI8A 3EXFB 2FPSA 3HJCA 4GI5A 4FGUA 4P80A 4BBAA 1F4VA 2ZYWX 2KLHA 2ZB2A 3HB4X 5EJ4A 2BTOA 3U39A 3B9RA 1CY8A 4P7GA 4LSMA 2YUTA 3BKXA 5CLQA 3VYVA 4E88A 3KJZA 4KR2A 3VZRA 2ZSUA 3FTPA 2XXAA 4O33A 4B81A 1Y9JA 1JLMA 2WOOA 1A8PA 2ZYGA 1POXA 3VHLB 2UYCA 3ONNA 3ICCA 3NHUA 1R4ZA 3BBPA 1W8DA 1USGA 1XK6A 2WE7A 1JV2B 2WWVD 3JZIA 3BWVA 3W9YA 4R83A 4D4KA 1HNZB 3ER8A 2CNNA 2HXGA 3L6OO 3OLWA 5CCDA 4BQIA 4K86A 2FN3A 2TMYA 4HWPA 4MW5A 3CEPB 4BJ3A 2WA1A 5EUCA 1RVV1 1IN1A 1WUTA 1R88A 3H1EA 3U3MA 1ISRA 1YC2A 2IXDA 3V6LA 4AMUA 1WLYA 2Q4TA 4DV6B 3L0IB 3UICA 3PR2B 2OILA 4EW1A 1AQUA 2VPIA 3D7KA 4V3CA 2GZSA 2REQB 3PSAA 3AGPA 3O38A 1XC7A 1QHSA 1XTQA 4EGFA 5CITA 2FZ5A 1SVNA 1UDAA 4S0XA 5HIAA 5ED4A 3OEED 3SJAA 4R8SA 2OM2A 2G9ZA 3LXUX 4XPIB 1DQNA 2WJAA 3GLKA 3LF2A 3QG1A 4RENA 3SIRA 1Z83A 5DBFA 4CEIB 1A97A 1T9KA 4PIVA 2FN4A 3H18A 3IO5A 4CN8A 4MW0A 4N9WA 5EHZA 5LL6P 4UQOA 1GRRA 2BFMA 2GZ3A 3K8OE 3VR5D 5CUQA 4D92A 2VDWB 2PR7A 4HWGA 4JCCA 1T0HB 1L3IA 4OVKA 1Y3AA 2WI8A 1TF5A 3FRJA 4JSTA 4Y0VA 4JFAA 3VNQA 4K9MA 4Y9TA 1QC5A 4UE2A 3IOCA 3L3BA 5A05A 4I1PA 4YMWA 3PLAE 3BF7A 2E21A 3QSYA 3ZQKA 2NSLA 1BGWA 4Z4FA 4BUJA 5IC6A 1PVVA 1A7KA 2VF4X 1MCZA 1Z7GA 3PNVA 1P33A 1V9CA 1D5WA 1ATZA 1Y9ZA 2NPOA 3FNRA 5I7SA 1AT1A 4UFPA 2D7DA 1V8ZA 2BY4A 4I55A 1TNDA 5SYNA 3TWOA 3KSRA 3ZHBA 4EHFA 1GO2A 1PZMA 4U7TB 5BWCA 4ZTUB 3MMSA 3B1XA 3LA8A 3PXCX 4Q19A 5I9NA 1JH9A 3UBMA 1NV9A 3GJQA 1I32A 4JXJA 4DHWA 5K8JB 1AGNA 1JA9A 5AXDA 2I2FA 1SO8A 4IDHA 4RVCA 3D59A 2FDXA 1ZY2A 4J3NA 5LP6A 2KYRA 1GD1O 1EZ4A 2QJRA 3PGMA 2I8AA 4MITA 1N1EA 1S6YA 1JTVA 1JHXA 1SC9A 2A9QA 3GNTA 3NIDB 2XNKA 3PNOA 4D0RA 4DFDA 3VR6D 4YUAA 4I6EA 1O9GA 2WFZA 4CMIB 1M8KA 2NUTB 4OQLA 2Q46A 3LDHA 4DUGD 1Z7EA 5IS2A 1IYZA 4NJEA 3D54D 3OY7A 1F60A 2OFOA 4M9SA 2IOYA 4LJ8A 4EHDA 1VCNA 4C03A 2EP8A 1J2YA 4N49A 2ONCA 3VR2D 5I48A 3WK4A 4XUGB 1OB2A 1GQFA 1NLZA 2AF3C 3CNNA 3NIFB 4BQRA 2HF9A 1HI9A 1NF8A 1AN0A 1LH0A 3OUUA 5IMBA 1XD2A 3WWZA 4CODB 2UXCB 4KVAA 1G7TA 5ITZA 2VPYA 3IKVA 1TJ4A 2HO4A 2CVHA 3PIIA 1U5BB 4FONA 4GG1A 3WDMA 4DV0B 3ROMA 3ZHRA 3BMQB 2W83A 2JKZA 2YFHA 3H2GA 3OM1A 4RE6A 3A58B 2QSJA 4ZYLA 4YHHB 2BISA 1UK8A 5EWJA 1DBRA 1SU4A 2YJ3A 3B7PA 3L0DA 2JRLA 4INJA 4AIIA 2C5LA 1RRKA 4WD3A 1JZSA 4IBOA 4ARVA 5AR1A 1C7QA 4TYPA 1DWQA 1V8BA 4K0RA 1L4MA 4X90A 3HVIA 3LY5A 5C2JB 2AQHA 2GCIA 3BC1A 5LQAA 1HGXA 4DMRA 2PY6A 1N5IA 2YV5A 5FWYB 5H83A 1G3UA 3RVOA 5AK0A 1D5CA 1WUHS 4FUQA 3K6RA 3C1AA 4O63O 1KS2A 1QONA 1NJFA 1FTYA 3D2CA 5IYZF 5COBA 5LZ5A 1WCV1 1R0BA 4DV7B 1M5RA 4AJ9A 1M7HA 1Q7EA 4CVNA 3AKZA 3IV7A 3TR5A 1KQ3A 4ZYTA 4X41A 1VCMA 4WLVA 3CLUC 2Q5FA 3HH8A 1XCOA 4N0QA 2ABWA 3TLBA 1AKEA 1XZLA 1MH9A 2GLXA