2C2KA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
b'SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2kA00
2XYHA 3DEIA 3V6MA 2HBQA 2H48A 4ZVQA 1QX3A 3NS7A 2NN3C 3V4OA 2C2KA 3SIRA 4IYRA 4AW9A 2XZTA 5K20A 3GJTA 4NBLA 3R6GA 4M9RA 1I4OA 4NOKA 4ZVTA 3H13A 4QUGA 1JXQA 2HBZA 4FDLA 1IBCA 3DEHA 4QUIA 4QU9A 4EHKA 1RHMA 1RWMA 3V6LA 3P45A 4HQRA 4EHLA 1QDUA 5IBPA 3KJFA 3ITNA 1RWPA 2H51A 3H11A 1RWWA 2XYGA 4NOLA 4QULA 3V3KA 3H0EA 4EHFA 5IANA 4I1PA 1I51A 4JQZA 2FUNB 1RHKA 1F9EA 5JFTA 3EDQA 4N7MA 4AWBA 2CNLA 1CVRA 4JR2A 1K88A 3V4LA 4D3XA 4DCJA 5I9TA 4JJ8A 1RE1A 4PS1A 4QUBA 3P4UA 5IAJA 3EDRA 1PYOA 4EHHA 3NKFA 5IABA 3UOAB 4DCOA 2C2OA 5LUBA 2XYPA 2H4YA 2J30A 3GJSA 2CDRA 2H4WA 4PRYA 5IAGA 4EHNA 3PCXA 3K7EA 1PAUA 2J32A 3R7SA 1ICEA 3OD5A 3SIPA 3UO8B 3S8EA 3H1PA 2DKOA 4IEFB 3E4CA 3H11B 4PRZA 2P2CA 4D3YA 2QLBA 3PD0A 3QNWA 2C2MA 1SC4A 2CJXA 4I1RA 3R5KA 3BIJA 3RJMA 5IBCA 2HBYA 4ZVRA 3GJRA 3KJNA 5IC6A 2CNOA 1RWXA 2H54A 2J31A 4NOMA 4QTYA 1M72A 1K86A 1NMSA 1RWVA 1SHJA 2C2ZA 1RHQA 4PS0A 4QUDA 1RWKA 4LSZA 5IAEA 4D3ZA 5LU9A 4QU8A 4ZVOA 1RHUA 2QLJA 2WDPA 5LU8A 1QTNA 2K7ZA 2CJYA 2XZDA 1KMCA 1RHJA 1RHRA 4N6NA 2FP3A 1RWOA 5IAKA 4JB8A 2QL9A 4ZVUA 5I9BA 3R5JA 3DEJA 4QUEA 2H5JA 1I4EB 4QTXA 4QUHA 4DCPA 2QL5A 1CP3A 2QL7A 3NR2A 4JR0A 4AWAA 2Y0BA 4EHAA 2C1EA 3DEKA 4QUJA 2J33A 1GQFA 4QUAA 3GJQA 1SHLA 3R7NA 3IBFA 1NMEA 1SC1A 4JJ7A 1NW9B 4NBKA 4NBNA 2AR9A 4JR1A 1F1JA 2HBRA 1GFWA 2CNKA 4N5DA 4FEAA 2Y1LA 3D6HA 5IASA 3D6MA 4N6OA 3R7BA 1I3OA 4N7JA 4FXOA 2H65A 4NOJA 1SC3A 4EJFA 4ZVSA 2FQQA 1NMQA 1RWNA 4HQ0A 3S70A 2H5IA 3V55A 5IC4A 2CNNA 2QLFA 4N6GA 4ZVPA 1BMQA 4JJEA 4QU0A 4EHDA 3IBCA 3R6LA 5LUAA 4JQYA 4QU5A 5H0IA 4HVAA 5IBRA 3KJQA 5IARA 3PD1A 3D6FA 4FGUA
chains in the Genus database with same CATH superfamily
2KBEA 1QKKA 2YY6A 3SC3A 5TGTA 2ZIZA 4IIYA 2QGZA 3GLTA 1ZZEA 2PS1A 2W6JA 5M2QA 3GT4A 4YEDA 2EF0A 2PT9A 2WV7A 1I4LD 5G53C 5B12A 3WLQA 1SWVA 1VFPA 5IPFA 3JRXA 4DVJA 1MDBA 3FWKA 5A7HA 1T4CB 3IO5A 4AF8A 5JJ5A 2EG5A 4HZGA 3PK0A 3N53A 5KNBD 1PJAA 1QP0A 1UBJS 4Q3LA 4XUCA 4Z9YA 2O7VA 4COOA 1EJ0A 5FLYA 1FZTA 1PQUA 2Z9CA 3PRHA 3KQNA 5E1BA 2BBTA 3BB4A 5GVSA 4H15A 4XA8A 1DRJA 4F9TA 5E1DA 4JITA 1K5HA 3PGLA 3T0FA 3V7WA 1N8KA 5KWJA 1LC0A 4FHDA 4Z4FA 3LUAA 4GLJA 2AXQA 3G2NA 5EXSA 3OJLA 1DQNA 4Y1FA 5JAIA 3HA2A 4RD6A 1EWRA 3BORA 4DCOA 3D1VA 4TV9F 4YAUA 1YQTA 2F7SA 3HLKA 3U3DA 3JSAA 2VYND 2OAGA 2SICE 3G23A 4X1KA 2YS7A 4DQUA 3GHHA 1NUPA 1JYSA 1PAUA 2P65A 1ICEA 1P0IA 1E6UA 1H2XA 2OG1A 4GOND 2R1ZA 4CLHA 4E15A 2W4QA 3T3IA 1Y8AA 1M54A 3P27A 4EX7A 3SJAA 3ZWMA 4MIKA 3ZK7A 5EXEA 3TI9A 3VKWA 4CLDA 1D4FA 1E2IA 3CLUC 3OFJA 5CLIA 3GAFA 1SBIA 3WGLA 4AROA 5HKKD 4ZANA 1Z2CA 3CF4G 2E5LB 1JQ3A 1O7JA 1TCAA 1WCIB 1OIXA 5AW1A 1U7TA 2VXOA 1LFAA 3AOEA 3N2LA 3WIBA 3TR6A 3HNOA 3AFHA 1GHTA 1M1YE 1VHWA 1EFTA 4A0FA 4BNNA 2QTNA 4F9EA 2QOEA 2IA5A 3WQSB 2IUSA 2ZYHA 1RM0A 2GJ9A 3GD5A 1IQUA 1T9GS 2CJYA 1J9EA 5CLHA 1YKSA 2QZPA 2V96A 1G3IA 1GTMA 1J24A 1D2CA 3CX3A 5FV4A 2A8YA 5LDDC 3HVRA 2AZ4A 4COKA 2QMOA 3TW0A 2P1ZA 4PAWA 2XNSA 1OI2A 5H3CA 5F9FA 1XZPA 3T7IA 4GM0A 2NSHA 2Q8NA 3IAEA 2OGUA 4MVJD 3PEUA 3E2MA 4OV6B 5J2UF 3ZD7A 1M2VA 2NUTA 1WB6A 2Q21A 5ADUS 4JODA 2I65A 2QRVA 3WV4A 2PGAA 5JZOA 2V7XA 1B8PA 1N2HA 1U3DA 2BBWA 3NH6A 4L4ZA 3P7MA 4NBKA 3CZCA 3QZUA 4E1BA 4DIDA 1A71A 1C1DB 4RZ2A 5IYZA 4R3WA 2FSVC 5CM9C 2UYHA 4K9SA 1CJTC 1JQKA 2Q4DA 4KVFA 5SYAA 1K06A 4URUR 5LQAA 1XDZA 2G9QA 2VR1A 3BWMA 3EG9B 4NY1A 2DSNA 3PX2A 3R9WA 1TW3A 2BY4A 3OZDA 4ZXPA 1XN1A 1W2GA 4P4LA 1WKVA 1YL5A 2V8OA 1T13A 3UB2A 2WHYA 4QT0A 3OQBA 2AZMA 5SY4A 2I6GA 3AEKA 4O59O 3LCVB 1LU9A 4DY4A 5JZSA 4EUKA 3TD9A 4KSCA 3RJ5A 4X66B 3L07A 2PUEA 1QC5B 1R3UA 1CZHA 2OV2A 4JSYA 5TT1A 1QYCA 2BE7A 1DRUA 2VKQA 1Z2OX 3B3QA 4CR6A 4F1KA 2A9PA 4FFWA 5DSZA 5EXTA 2H4XA 1DLIA 1XQYA 1A95A 2FJUA 3F46A 3A3PA 3OOJA 4IUCS 4KR9A 3ED1A 2YN0A 4OHKA 3PXDA 3FN4A 2FJPA 1GZ3A 5DNEA 3AI1A 3INTA 4GVPA 5EJIA 3TLAA 4HV4A 3E18A 2VHUA 3RCBA 3RYHA 3AYZB 1JEOA 1F0YA 2XVYA 3MRXA 3KV1A 2QRUA 4BX2A 1ULUA 1B7GO 1E6KA 2DHDA 1SJ9A 3VO1A 3QG1A 4XGRA 3QTBA 1GTL1 3H4IA 1T1GA 5K9ZA 1O95C 5YASA 2KYRA 4NATA 1N6NA 2Z4RA 3BBLA 1SY7A 1CT9A 4HQNA 5FULA 1ZXBA 1G7CA 1E3TA 1DXYA 1I01A 1QORA 3LVFO 2XB9A 4Y2UA 1VMIA 2OHVA 4L50A 2ZZKA 2H1CA 1KIAA 5BWOA 4QYMA 3CO5A 3EG5A 5U4QA 2PGNA 3CTPA 4YRTA 4AY4A 2PUBA 5BR1A 4I1YA 3DMTA 2YJZA 4WBNB 1UPFA 2WOOA 3WJAA 5HJ5A 2FQYA 4BMXA 1M34B 3NNDA 1LBHA 4KQCA 4RKRA 4B6RA 1VGQA 3P19A 3CH4B 3CIFA 1BCSA 1XSEA 2HQSA 3W2IA 2YN2A 3DF7A 4YUYA 4RPLA 3RTCA 5E7QA 3F1LA 3HPRA 3ZQUA 2UUBB 1CDOA 2J3IA 5AK5A 3N5KA 2B25A 1P2BA 1V43A 2OBNA 1O6ZA 2VDOB 1OU4A 2X9GA 1NQWA 3TOCA 4LCBA 1A0OA 3FZGA 1QS0A 1YR7A 2BUAA 1N32B 2YN4A 2IXDA 3D4LA 4LPKA 2OCGA 3QU2A 16PKA 2BFDB 3KUCA 4V3BA 1IHOA 3VU9A 1PIWA 1BH2A 3L8FA 3DAOA 3OY7A 4MULA 3B6IA 3SN6A 2CLOB 3IA2A 3UOGA 1FJHA 4A2WA 1MPTA 3THWA 4EG3A 2HNAA 2ISQA 5CBKA 4ZI3A 5LXTA 3TRJA 1OLOA 1W9MA 3M49A 4YRCA 4O2AA 4FVTA 4UTOA 1FJXA 4OG2A 1RHRA 1RMQA 1C30A 4E3ZA 2EFEB 4AIRA 1FFXB 4AJOA 2IKSA 1KQFA 3LY9A 1GZUA 1RWQA 4HS9A 4DMUB 3MGCA 2Q2QA 4XUDA 1MRSA 2RGYA 3LPCA 3Q5EA 3ZGLA 4UOZA 4G4SP 1UBMS 4JUBA 5KYUB 1B0AA 1WDLA 1U2TA 1QPZA 3BBPA 3MK31 1Z28A 1QQAA 3KXDA 4GOJA 4C5CA 3M34A 4PG7A 2WFAA 3HCOA 3NWPA 3AEQB 3QITA 1IDOA 2JFPA 4BCCA 1CR0A 1GGEA 4RF3A 4ZYTA 621PA 3GLHA 5AJYA 4OBWA 3TM5A 4B34A 2LDBA 3C41J 4D9FA 4S1VA 4DZZA 1I1NA 1U6JA 3DL2A 4Y2JA 1FNCA 2JB9A 3QLTA 2DY1A 1C4KA 1PL6A 2JFXA 1UANA 3VUEA 3ZUPA 3C85A 5DI3A 5LBTA 1O6BA 1PHRA 4HDNA 2IYWA 1PS8A 1KPGA 4U7GA 2C77A 2J6CA 3V80A 4ENRA 4B32A 1EH5A 5CB8A 2HJSA 2VNHA 1KTIA 4BKOA 1XQXA 2D1FA 2QW1A 1N3YA 3Q6NA 3EQZA 4Y6RA 5HR5A 3T9EA 2N3ZA 2HA0A 3K0EA 5FNVA 4YYZA 2PLWA 4DR2B 1K7FB 3H1FA 1M10A 1P4HA 3QK7A 1TQ8A 2AGVA 2IHYA 2R65A 2G5GX 1QLJA 1R6TA 1PWXA 1TJPB 5D51S 1A82A 5DVZA 4A16A 2Q1SA 3QXGA 1JW9B 2Q5CA 1X19A 4WSOA 2FEPA 4ME6A 4NV3A 5IG2A 1ZNXA 3FYDA 3U4IA 1W52X 3B6MA 4MO2A 5K8TA 3VKGA 4HDOB 1F5NA 3GU3A 3PGMA 1WNTA 4CEJB 4FYPA 1GKIA 4GPTA 4N0QA 4WINA 2AMJA 1NC1A 5CLJA 2ZTHA 1MIOB 2XB4A 4LTDA 3HSKA 1E5DA 4Q12A 5JD5A 4FC6A 1U3VA 3G6KA 3VSCA 4NFYA 3O1IC 5GM1A 4IZOA 2X2EA 2RAUA 5H8WA 3IQHX 1M7BA 1SIOA 2AKAB 2AUNA 1P77A 3NAGA 1XHFA 1YQXA 4JR2A 3V4LA 3BWXA 4E08A 4JEHA 3RK1A 3WLOA 3ZX4A 4BGEA 1QJ4A 2C5GA 1TEXA 2BSXA 3PX3A 5A2GA 4BNDA 2IXEA 4WLEA 1RYHA 2G63A 5HFNA 2QMZA 4IXWA 4ZAXA 1VLJA 3A6GA 4BE9A 2H2FA 2W9XA 2F1OA 3NALA 4QEZA 4RAOA 4OJQA 5TJ9A 3DCJA 3CZ4A 1PR2A 4IFBA 3FKJA 4IWXA 1XMVA 3IVGA 1XA4A 2AXPA 4CYMA 4GAEA 1EWYA 5J9FA 4RPIA 1H1LB 1AQJA 4BLWA 2ZIAA 2B78A 2FW0A 2YXEA 4M1TA 4GS5A 4PAGA 5FOSA 5CG2A 4BZWA 2XZLA 1EGHA 2UYOA 3AH8A 3VDRA 1VHTA 3DV9A 3T06B 1VKZA 3S68A 3S4YA 2GK3A 1BJKA 5LOVA 4DV1B 2VHEA 3EXEA 1A5TA 1HL3A 2BLLA 2Q2WA 4E88A 4QUDA 4ARVA 5LQUA 2CMKA 1N8SA 2IYRA 2VS1A 4F84A 2X4GA 4HDKA 4TYYA 1C7JA 4MHSA 3Q7EA 3SC2A 2UV8A 1RI3A 2X1VA 2JC3A 4FD3A 1ADGA 1KETA 1X7ZA 2EKZA 4TZKA 5HRAA 3H8VA 2OO5C 3MJEA 4MVJI 4NJEA 1SKMA 2P9QA 2ZJFA 3B5IA 1CVIA 5AR1A 1MN6A 3LBAA 3Q3EA 3L7LA 1UPAA 3S1AB 2C5LA 2XCOA 4F7WA 4UOEA 4DILA 1NLYA 4DMLA 1SPXA 2BEUB 2YWEA 1W1IA 4QXQA 3PCRB 4X95A 3WLLA 2ZXUA 3JRWA 3ZVKA 4ND3A 4ETWA 3W5UA 5BWLA 5EMMA 3NGMA 1FFBA 1Z4JA 3KQSA 3LNCA 4ID3A 4QFDA 3ZZTA 4J49A 3NNNA 4EZBA 3HCNA 1JEAA 3KO8A 5CVJA 1O94C 1YZ3A 3OMXA 2OLJA 4CLEA 4J94A 5AHRA 4B3BA 4J4HA 2WMYA 1JVBA 3ZHRA 3EPHA 3IUMA 4D57A 4RETA 2GJ8A 4F7DA 5IF3A 2HDWA 2G70A 5IUKC 1JSZA 2BJHA 2A9OA 5DX1A 1GRNA 4KXQA 2COUA 4LVCA 3E9EA 1E2EA 3NTVA 4N65A 1PO7A 2AC7A 3L8EA 4M0LA 4L78A 3N6RA 4YGYA 4K86A 4B87A 3ER9A 2PWZA 1A5AB 1OXSC 4IHQA 4C7OA 3LVRE 3KETA 3QPBA 4XCXA 5F7JA 2KLHA 2LCQA 1NNEA 3UC5A 3KOZA 2JEOA 2FFQA 2ZJ8A 3GMDA 4PHFA 1TVKB 3UFXB 1SURA 4FNOA 4D5GA 1YJ8A 2ZRMA 5LBUA 1PL7A 4BMSA 1RBMA 1S2IA 1DG1G 1VSBA 2WILA 2WYVA 3MJFA 3DW1X 1J56A 3NTOA 5TPWB 3D7NA 1ZAKA 1EXWA 2ERYA 3M4XA 3UAZA 3WSTA 1KY3A 4TLBA 2WHEA 5C1DA 1IL0A 4DV7B 1OB5A 1SELA 1SXJE 4UHEA 4A26A 4CTNA 5A5DA 121PA 2PX3A 3TLGB 1Z6TA 2CNWD 2E5WA 2O2HA 5B3LA 4J0EA 2YY5A 3OZFA 1CF2O 4CTOA 5EIWA 3SMVA 4DBVO 1UT5A 1FP4A 1EUQA 3ZXUB 2XB8A 3ZY2A 3HJGA 1EB9A 1XHLA 3RANA 3ETHA 3NZEA 4L4RA 1WMDA 1V5GA 5HZKA 2P2YA 3AEXA 3TMAA 2B94A 1GUBA 4L74A 4FWTA 1Y3FE 1ORTA 2HCBA 1TJ4A 1KDTA 2PGJA 3SPXA 2XUGA 3HXKA 2M1ZA 3V9AA 3BGSA 1VCIA 3AXTA 2BI4A 2HHHB 2ATXA 5JMWA 2BFEB 1E7SA 3IFSA 2C8KA 4DIOA 2PT5A 4HUQB 1EFPA 2WW8A 3FDZB 3GJSA 2BI8A 4O4HB 1GFZA 2ZAGA 1K7CA 3MWDA 1NY6A 2GKGA 5B5SA 1IFXA 3ZWPA 2I29A 2DPMA 4WBNF 1CY7A 1C1XA 3AKDA 4B4DA 4MV6A 5J59A 3VUFA 3WHLA 2DBRA 3ZBPA 3D02A 3STUA 4A8HA 3UH0A 2ZAOA 5DW0A 4I8DA 4JXJA 4P82A 1P39A 4IS3A 4YMSA 2RHWA 3VVCA 2YWRA 2B4RO 5ARBA 5CPBA 3WX0A 3CCCA 3KPUA 4XARA 1CZKA 1NZJA 2ZUDA 1ZNZA 3NM5A 4KTVE 4LYHA 2AMLA 4Y6GB 4DQXA 2WG0A 1Y9AA 4UBOA 2VP9A 4RE5A 3KSBC 3GLUA 1DPGA 3G2LA 3JYOA 5IMBA 1LDGA 1IVNA 1GAQA 1NAHA 3OJ0A 2J3LA 2NTJA 4KQJA 1MOPA 1Y9DA 5JDCC 3T7DA 1PW7A 1E0AA 1VI2A 3GZ4A 4R9NA 1DAOA 4ETMA 2X0RA 3WGTA 2WMDA 1IEWA 3R4CA 5A06A 1JXAA 2WPDA 4URVR 2GVNA 4O08A 4PIMA 2QZZA 1EUCB 1VE3A 1Z08A 2D8AA 2BMDA 3DEJA 3N86A 4YY3B 4MWGA 1PQYA 4P34A 3DLAA 1PJ4A 2R96A 3KXIA 3FHLA 1I14A 1EM8A 2HCTA 3BPSA 4MH0R 3CGWA 2PRKA 4V0MA 1FLNA 3JAKB 1GNPA 4EG8A 1AC5A 5TDHA 2G72A 3LG2A 1RIIA 3T7KA 2ZT6A 3KJHA 1AKVA 2NXCA 3D43A 3P9XA 3PENA 4BNKA 2XNKA 4IHKA 4NBNA 2RHCA 3PDIB 3HCAA 2ZVPX 4FWIB 4M8LA 2X1MA 3DC2A 2C9OA 1KO8A 1ZIPA 2PKCA 4HNGA 4IIJA 2J41A 3MMXA 1A5ZA 4KK3A 1G60A 4XYGA 2OP1A 2DG2A 3LRPA 4BFYA 1V1MA 1XZAA 1W2HA 4JBHA 4D92A 4YMGA 1N0UA 2I6FA 2B8WA 1WABA 4JENA 3CUUA 5FPSA 5FR2A 4LWPA 1GPAA 3UWDA 2R6DA 3ROKA 4TLCA 4TT3D 3L8MA 1UXHA 2YYSA 3QKRA 3VO2A 2EAUA 1GZDA 3WMRA 4RTKA 4TV8B 4IZHA 2G9NA 1GQRA 3K71B 4CDRA 2FFBA 5KYVA 1P9OA 5CA1B 2HGSA 4CIAA 1VRCA 1O6CA 5KNCH 1C9EA 1E9BA 4FR5A 4LZLA 4F21A 3UQZA 3NPAA 4O3FA 5HPYB 3HR4A 1PD1A 5LL6P 2AOTA 3LXXA 4RSHA 3L79A 1SIBE 2KS6A 4MAFA 2IW1A 1A9RA 3B1XA 5H1YA 4AJPA 1D7AA 2H00A 4Y9DA 2AJTA 4OJMX 4R1QA 1U5BA 1JKJB 3SSMA 1T26A 3E7DA 1E2JA 4EHLA 4QFBA 2NVWA 2WIKA 4TWAA 1BXRA 4G1UC 5CB4A 2W2MA 2UVPA 4AP9A 5JJLA 4EPRA 3LK7A 1OOEA 1OC2A 4RMJA 1M74A 4D56A 3B8EA 2VIIA 3T54A 4WXEA 2W83A 1LSUA 2Z6QA 1AA6A 4LKOA 3RG2A 4CM4B 2VNAA 3AUTA 3ZCVA 4MW6A 3K09A 3W2GA 2G0AA 2X22A 3RQSA 3OT1B 4PANA 3GLIB 1ZOSA 5C5DA 2QRPA 3LQ1A 2J0EA 2BBOA 4R05A 2D06A 1UJMA 1YDMA 2I6SA 4K2HA 3TI7A 1E4EA 1RW4A 1H66A 2C9CA 3FNGA 3P9IA 5EE9A 4HXYA 3I8SA 2PS9A 1TA0A 4YP7A 5FUWA 4ZQFA 2R8PA 1HYHA 4NYJR 4JI1B 3SHWA 3SFTA 2DKOA 3LC2O 1QWOA 3LYUA 2ORVA 3JY6A 4YECA 5K4AA 5THXA 2BGGA 3GJ7A 3MBOA 3QOYA 4BV9A 1VYHA 1K2VN 4NMHA 1EVIA 3D81A 2EL9A 3QNWA 2C1ZA 1Z4IA 5F7ZA 4C6SA 1RD4A 1VL0A 1R10A 3OWOA 3G8DA 2DX7A 4DDVA 1CQPA 2VDUE 3B1YA 3M2TA 2NMVA 1FFAA 4MW4A 3B36A 2EV9A 3GA5A 2FN4A 1BD3A 1Y3CE 4J75A 4EDHA 1WF3A 4Y9SA 1SXQA 1T1RA 3K92A 5JROA 1QAMA 2GTIA 4QU8A 3UK2A 2JLBA 4LE2A 1ONNA 2QUAA 2OYCA 3DZJA 3EVFA 3K31A 3ASYA 1TE2A 3JQQA 5LU8A 3EGVA 1GU0A 1W5FA 5LLTA 1DQZA 3N2IA 4P3YA 4R1UA 3OX2A 3FBWA 3R44A 1HV8A 4N5IX 2PZEA 4OM7A 2C3UA 4F9GA 4NU6A 4AZ0A 4Z1OA 1HG1A 4M7RA 1KO4A 3AX6A 4EKYA 2WSSD 3LQ2A 1RRMA 2WM9B 3A1DA 1WD7A 1T36B 5DGXA 5K3AA 5C0OE 1GDTA 2G77B 2NV0A 1MV5A 2BUCA 2P4UA 3A4IA 4L02A 4NE9A 4UCXA 3VR1A 2YQ4A 3L1JA 2IU3A 3TQCA 1FVHA 1PFQA 2D2EA 2WP0A 3MRVA 5DLEA 3JZMA 4N49A 3KZMA 2FUKA 2LBPA 2J6BA 2ASVA 2OCAA 3A11A 1N5MA 3DB2A 3HBAA 3KSRA 4HB4A 4TSKA 4EFLA 1ZBDA 1R0XA 4PAMA 4EQZA 3EH2A 3SE0A 4LHXA 4HGNA 4PYNA 4X1KB 1JEYB 1I10A 1Q6YA 3H3FA 3THYA 2CXNA 3T3NA 4IO0A 3NEPX 1AKNA 4Y1GA 5CT9A 1P1KA 1NDQA 4F5WA 3JYNA 1KI6A 3DM5A 3BGDA 3NDJA 4HGRA 1TI7A 4UHFA 2OFPA 1O08A 1MB4A 4ND2A 1DJMA 4ROTA 1XKQA 2PWYA 3H2BA 4IEIA 2JAWA 1P1FA 3D64A 4NDAA 4ZT5A 1WD5A 3W8DA 1KEPA 3RSGA 5J58A 1MKYA 2VA8A 2VBCA 3K8OE 4KE8A 1LA2A 2XYHA 5KDDA 3KDSE 2NZYA 3FB4A 3LP6A 3B60A 1Z88A 1MNQA 2HBQA 3OZSA 4FS8A 1E7RA 2FCRA 4I3GA 1C3EA 4L08A 4OQNA 2OZVA 3PDUA 5A9RA 1JPNA 2JASA 2VRCD 1CIJA 3GA0A 2IVZA 3LT4A 4HN4B 1UUFA 4XOUA 3T5CA 4AYWA 4RVNA 5IUJC 1CJSA 2W2LA 1II8A 3EGWA 4XSHA 4GI7A 1QYXA 4BDTA 3TUJC 3LI2A 3MCTA 3ROXA 1KI1A 4UBKA 1KZ9A 4B6SA 2FOLA 1CR2A 3BKXA 3N76A 1ZAYA 3CUYA 3C15C 2YWHA 2AN4A 3V6LA 2ILVA 1XTKA 1N8NA 1E2FA 1U0RA 5ALUA 5EUQB 3FM9A 4KJXA 5GMOA 1JMKC 4Q01A 1SCBA 3BXOA 4IOKA 4RCYA 2YXBA 4ZOLB 5E0KB 4POOA 3L46A 2X2PA 1ADCA 1UFRA 1H5UA 1V95A 1Q83A 1YS6A 2OV4A 1B3RA 2PKRA 3HY3A 4U7JA 1EG7A 1Z16A 2AOWA 1ZH0A 3C6KA 4HH0A 3UJ6A 3ZLTA 4DLNA 5IYZB 2KB0A 2OWDA 5HRCA 3QVUA 1C7EA 1XKLA 2FZGA 1W93A 3T6KA 3EYWA 1TYAE 5FO0A 3IEKA 5FPPA 2JBHA 2X77A 2WNHA 4UASA 4OFWA 5COBA 4NK5A 1NQAO 4PRYA 2FZEA 1DTEA 3A1CA 4MOWA 3ICEA 3AERB 1ZKMA 3OQOA 2JNWA 3CH6A 3H84A 3QI7A 2PXXA 4FFRA 2HJ9A 2QNIA 2RHGB 4GZLA 4O4HF 4X3CA 3RLFA 4YRZA 1E6LA 1H85A 4B43A 1XCMA 3VNAA 3LTNC 2L2QA 4DR1B 1ABBA 1VJCA 4IICA 1NVUQ 3O7MA 2WTEA 3KEOA 3LCUA 4EO9A 1AN0A 1QIMA 5DM2A 1SQFA 5F52A 1GPDG 1QHXA 3ZYZA 2AQKA 5FP0A 1M5RA 4MARA 2Z2KA 1LX7A 4DAEA 1AB6A 1QE0A 1P6UA 1G7SA 4QXAA 3P20A 3I5YA 3DE7X 4YN3A 3SU8A 3SHFA 3RRFA 3RYHB 1ZQ9A 1XZQA 2DE0X 3NI2A 1NL3A 1U0BB 4K81B 1NYQA 2YV1A 4WLVA 1ZH4A 3OECA 1DQYA 1ZJJA 3WNDA 5EXXA 5K0GA 4BNUA 3NDPA 1GLVA 1BWQA 1JLRA 1MVNA 2E4VA 3ESAA 4PBRA 1NIJA 4WXYB 5T4BA 5C53B 1DAIA 3R3VA 4MQ4A 1WQ4A 5AKHA 1CKEA 1EBFA 3O9ZA 4QZVA 2V5AA 5JXHA 2EKQA 5L6MB 2CVFA 3V8PA 1R0RE 3VR5H 3W2EA 4A1OA 4L5CA 3SR3A 1IBLB 4UUPA 1YQ9A 1HETA 1G8AA 4U7WA 3CO0S 2RHBA 2HX1A 3QHAA 1A4IA 1D5WA 1HDCA 2AR9A 3UMMA 1R74A 1I2ZA 1B0PA 1QKJA 4RTMA 2L17A 3K0CA 1EWTA 4YQFA 1SC6A 4C0AC 1E2LA 1TC1A 2NU9A 2NZ8A 3ELDA 4J16A 4B3XA 3GK3A 3V1LA 1Y6QA 3E23A 4AZTA 4C6HA 4EYQA 1XZBA 3AOEC 2A33A 4M22A 3ZXXA 4EHJA 2AOXA 3RFUA 4DHEA 1XZMA 1SK9A 3UUFA 4KPYA 1TXGA 3S70A 4ZALA 3ZKWA 5BQXA 3BEOA 1WL8A 3I05A 1NNUA 3QXCA 4MUXA 1S3IA 4CMKA 2E6KA 4EH1A 2BYTA 4X1YB 3PR1A 3B70A 1MEOA 4P38A 3VU9B 1A9ZA 3EZXA 2GSWA 1YNSA 3BSFA 3RKRA 4DM7A 5IHPA 2I6QA 1VHJA 4F93B 1K9SA 4I46A 4ARAA 4QICA 4FYKA 3WHKA 2A86A 5EQDA 3ZE1B 1FSPA 4X97A 5J3JA 3THWB 1LNQA 3DV0A 3FMVA 5ENZA 4TV8F 1IHXA 3B3GA 1A97A 1JALA 1MXHA 3WDLA 4PFJA 1Z0DA 3CEHA 4L8YA 5IZCC 4BB5A 1RM4A 5CA1F 3PIRA 1FC0A 4JSTA 4O2AB 4EG6A 1ZGHA 5JO0A 1C30B 3OM9A 4UMFA 1ZI8A 4F5EA 3W5DA 4BVKA 4UQLA 3N8HA 3L1VA 3Q5GA 4LX0A 4GG1A 3I45A 4AMZA 4QASA 4EPTA 5FTNA 4BXOA 1KIFA 3NYIA 5KYYA 2FMTA 1L5MA 1RWPA 4F8JA 5DJ5A 721PA 3SHQA 4RANA 2IRWA 4NC9A 3RPEA 5EKUA 4BNGA 4JQZA 3REGA 1MC1A 3E5NA 3GLHB 2EW2A 3T5PA 2HWXA 1JWAB 3Q3JB 3HLTA 3U1TA 2E5FA 1C7FA 2FV8A 1RE1A 2PD3A 3FPSA 4IUYA 1QCCA 3UMRA 3KQYA 1E2HA 3TPCA 5JCJD 5IABA 1PGOA 2MSEB 3ORRA 8ABPA 2QX6A 2C2OA 3CWQA 3D8HA 1AOXA 2VF7A 3DZBA 3KSZO 1K6XA 4IM7A 1ZMOA 3DVRX 5DI3B 4HDNB 5JCPA 1B6TA 4FYWA 5EP1A 1E96A 2CL6X 4KXVA 4BP1A 3X43A 4XYMA 2DUWA 4QSHA 3EHEA 2B9VA 2XBMA 1ATIA 2OK8A 3GAMA 3PNMA 4JT4A 4MUJA 4RVSA 5IVIA 2DR3A 1NRIA 4FDMA 3E53A 1P60A 4QOSA 4YUWA 2V7TA 3SQXA 1RLOA 1H5NA 1U0EA 4J91A 3MTQA 4GP9A 4Y98A 5FNVB 1CY8A 2WE7A 2JCGA 1BIFA 4F96A 5K4HA 4YUXA 3KB1A 2F3UA 3EOBI 3RS4A 3KJNA 1FW8A 2PRSA 3HKDA 3ZV3A 2B1QA 1ZA1A 1FS6A 1XD9A 4OMDA 4DJ5X 1N3IA 3VR4D 1R8XA 3L6OO 4P3XA 3HMKA 5A4MS 2AG0A 3BERA 5LMUB 1KQOA 1VE9A 2FP4A 5F4ZA 2IUYA 5AQEA 2FWPA 1NXWA 2YNMD 1EWKA 1SVKA 1TD1A 1NVBA 2YJ4A 3DZIA 3NC1C 5BYBA 5H59A 3ZE6A 2WAXA 4HT3B 1W5SA 2FE4A 3UAVA 4B47A 4YV7A 1CUGA 1OFIA 2W2KA 1PT9A 4PAOA 1YS2X 4MA5A 1YQEA 1MC4A 4EKGA 5CW1A 2I2FA 3OHPA 3M4NA 3UTDA 2GLTA 2JFVA 3BJZA 1PBNA 1D6SA 4TWBA 4CT0A 5FKJA 4EY8A 3O2SB 3PQ7A 1EZZA 2JARA 3A7EA 4F4DA 3WWDA 3Q2IA 4I1UA 1NN5A 2BRUA 2QN6A 3NBXX 4EF5A 4GGMX 3T5GA 3IA7A 4ZVMA 3WQQA 2IOQA 3AC0A 4MQUA 2VZ0A 2ZBGA 1N4AA 1XLWA 4RORA 1Y48E 4MVJE 5ALFA 2J46A 4TXMA 4BO0A 3LWDA 1GUFA 4OI4A 5MFPA 1ADYA 4KH0A 1R6XA 1KMHB 5ERYA 1Y4DE 3ORHA 4AMGA 2ZCUA 3ZIDA 5IJXA 4BJ3A 3ZCXA 2IZ7A 3NHUA 2R00A 4FHZA 4RHXA 4RKWA 2FF7A 2IHJA 3ZI4A 1XU4A 3IUJA 2QVGA 5LOVB 3EXEB 4XRRA 3HEAA 3RRNA 3SS8A 2C9ZA 3WWOA 3BGVA 3VO8A 5CLQA 3F5SA 1U9JA 5EL0A 3I32A 1ENZA 5DTJA 1P81A 4Q48A 4ZVKA 4HDKB 1A1VA 2UVQA 3C3JA 3SC2B 1XRMA 4RD4A 4C2AA 3FTNA 4NJMB 4EIWA 3CA8A 4P9NA 2BWJA 2G8LA 1ECBA 1HOXA 1TO2E 1X7ZB 2HB6A 3CPSA 4RM2A 5WRFA 1D1SA 5FDFA 1IK6A 1DIAA 2CW5A 4NJEB 5FPKA 4WXMA 2O2IA 1QHEA 1SH7A 4KV9A 3I0MA 2ZIGA 4GI5A 3TQFA 2VDMB 3M1YA 4LVOA 2ETXA 3ZHVA 1Z0IA 5ADWA 1Y1TA 1KXZA 1XMOB 3L82B 4DARA 3IOEA 3X0DA 2DOKA 2EW1A 4I4TA 4PHHA 1F9EA 2FN8A 2ID8A 3G1UA 3ZNQA 4MYRA 3IEMA 2J3DA 5E4YA 1M9NA 2N75A 4ZOLF 4C7MA 2J59A 4JLNA 5AH0A 4GKBA 2JLXA 1Q7BA 4DLZA 4G1FA 4XPIA 4Z0PA 1X8XA 4ER0A 4TLAA 2JG3A 1XCJA 1W0JD 2I3ZA 4RJJA 1P5HA 2QD3A 4HADA 4Z7QB 2PUVA 3CJRA 4J90A 2AI1A 4P31A 2IX9A 4LDQA 4PEVA 3CNNA 2JHCA 1W36B 1A4RA 1G5TA 3K1JA 2O8NA 3VA7A 1YZNA 4DLUA 4WKNA 1WBJB 3C5VA 2QRLA 2WDZA 4IEFB 4MUYA 3NBQA 5JWHA 5JPDA 3SQNA 4MHTA 3N3BC 1EIZA 1AUQA 3GIWA 1E1MA 3RIXA 4CGYA 5KDOA 1U2RA 2QR5A 3F71A 2ZEJA 2VP2A 4R0MA 1U1EA 3UKOA 4ZVRA 5LD2B 3L7KA 1OXTA 1IRIA 3OAAA 2FZLA 3CT4A 4AY5A 4FM9A 2AEMA 3OCXA 5HF6A 5KTNA 4ZI5A 1UDCA 4LY9A 1WMBA 4G23A 5AFSA 3AIMA 1L5LA 1QZTA 1F17A 3CRNA 4LYAA 5AOAA 1CQJA 1PKXA 2A9VA 1SGWA 1NY5A 1WNFA 3NIDB 4Q02A 1NUTA 3URKA 3BILA 4F3CA 5B2FA 4QQRA 2RG1A 3RREA 1FPMA 4J0JA 3GY0A 4E11A 1FP4B 1P61B 4G9EA 4M7PA 7GPBA 4LHSA 4FGKA 3QVOA 2HLDA 3IKMB 1Y1SA 4Y7DA 5B2EA 4D7AA 1HEUA 1N7GA 3HUDA 3ZYCA 1JDPA 4UBLA 3LOQA 4C5AA 4Y1RB 1FXWA 2H1FA 2R8ZA 2EFGA 3A1VA 3G1TA 3PBKA 5JS8A 2XUHA 5HCIA 4H6VA 2JFFA 3CF4A 4JBLA 5JH7B 5AM4A 2XKKA 4PRLA 2HWKA 5FLEX 1QHFA 4KX5A 4RA9A 5DBGA 3HV2A 2YOGA 4AVYA 5ICCA 2Z09A 3QPAA 3UWKA 2CWDA 2OBMA 3F8SA 1WXHA 4W9NA 3ZWNA 3Q10A 5ICMA 4R6WA 3P1JA 4URYR 1UDAA 4ND5A 5TS2A 1HGXA 3H1BA 3DKRA 1C1XB 3DTVA 1WZCA 5DWVA 5H4GA 3OD1A 5KJ6A 4KLRA 5H82A 2WSMA 2V6BA 4IDEA 4Q4JA 4X45A 4GZ3A 2CLMB 5JOQA 1THZA 3T35A 3DVLA 2H9IA 4XCQA 1XQWA 1A9XB 5B6IA 4CNQA 1M6WA 5DPMA 2O8EA 4LQ4A 1GJRA 4HAYA 1QWSA 1S2OA 4DA8A 5C8XA 4LF5B 2PH1A 3ZIAD 3R6DA 4Q4HA 3ZK9A 1LDMA 4OAOA 4KZPA 4MICA 3BA1A 4E03A 1ESMA 3KCQA 1ISFA 3VPXA 4P33A 1Z15A 5HTKA 1OXMA 1CHNA 5KJCA 6Q21A 4JEUA 3U09A 1BGWA 1LPSA 3FAKA 1XEFA 3MB8A 5CK4A 1NVKA 3EWNA 4FEEA 4JZYA 4MW9A 3U4MA 3HO8A 1WPXA 3C0KA 4NRDA 1PFWA 2DGDA 2HT6A 4GWKA 3MUOA 1EZ4A 4JT2A 2HF8A 3PI6A 5DTIA 4CL3A 2YWBA 2R47A 4YMTA 1Q0LA 2W6NA 5L3SA 3K4HA 3E35A 2EEZA 1YBHA 3A2KA 1MABB 4QG3A 5LYJA 2P30A 3S28A 1B00A 1K7SN 1X1SA 3BTSA 1DIOB 4CR8A 4ZTBA 4X41A 2HEIA 3VZRA 2QM0A 3ETGA 4KWTA 4RHEA 1HUQA 5KQLA 1RYDA 1AXGA 4A8PA 5JFGA 4ML3A 3FGZA 1DT3A 4O33A 4IIJB 5DLQC 3VR0A 3HJBA 3HCBA 3AM1A 1ZO8A 5BXYA 2BZSA 1V1MB 1O4WA 2IP4A 5BOSA 1H6DA 2O0JA 2P9JA 2P5SA 3FYUA 4YB8A 2VEOA 5TV2A 5CFMA 5LQCA 1WXFA 2FPPB 3WBKA 3EARA 1WG8A 1NF2A 3U3RA 3VPSA 5IWCA 4AQ7A 5KC8A 1RAEA 2HW8A 2EVWX 2JCSA 4Y9RA 3ONEA 4EITA 5IKXA 2PJZA 5BN4A 1G8PA 3HVHA 3PEYA 1ZDMA 2CXXA 3P5SA 2JGFA 4G65A 4FLFA 1I2MA 2IZ5A 3BVPA 4HDSA 4KI0A 1N9GB 2Q3EA 4ZYLA 3W6UA 4L5JA 4DYDA 4EL5A 4RGYA 4GXRA 2HL6A 3N0VA 2PIDA 2WB4A 1PLJA 3AHEA 3ZHBA 5AVUA 4D26A 1MFZA 2AOTB 3TLBA 3LKBA 1CIPA 4PC6A 4F6CA 4NJOA 5EJAA 4N5MA 2I1WA 3TAUA 1O03A 1U5BB 3KYCA 4PR0A 4WXPA 1SQSA 3EFBA 3WKEA 4CL8A 2IH5A 3ERCA 1COWA 2YHBA 3QELB 4OHZA 2UVPB 5K0TA 1XE3A 3DEKA 1A76A 1I6WA 1OYVA 5D1HA 3Q72A 4X24A 1E66A 1ZCAA 2GT1A 5J5VA 2FEXA 1CQWA 2O20A 2EWVA 3OX3A 1TPZA 3Q7QA 4XJXA 5DNWA 4Q9JA 3EFEA 4HNUA 4V1CA 3QVGA 4KVGA 1AKRA 3AM3A 1WY5A 2QMUA 4MS1A 3LPAA 2D4HA 4RK6A 2NIPA 1R9MA 4A2CA 1XK6A 3U7FB 1E4EB 4TKMA 4ZAYA 5FR1A 4JDUA 1L7EA 2CLEB 1AJEA 4G0UA 4V0OA 3TW6A 4AXXA 1P4JA 2Q8QA 3DHEA 1Z17A 4FOTA 3VKHA 3IDSA 4IV5A 3IEXA 1H4VB 1G18A 1XTSA 3IS3A 1P4AA 3COSA 3H5LA 1GNTA 2G6TA 3KZVA 1XMQB 4EB3A 2XCRB 3BSYA 1RI4A 1TZ2A 3GL9A 3VSEA 2XGSA 1XEWY 1QIKA 1E2UA 2I03A 2N47A 3VBEA 3QP9A 4DREA 1TADA 5LUAA 4ZIRB 4D9GA 3B9BA 4D9KA 4FGUA 1J0DA 4H7HA 4ZZ2A 3TUIC 4BKMA 2UAGA 4Q05A 4MS3A 5BUQA 1JR3A 5DXAA 2WJJA 4AY3A 3BD6A 2Q45A 3FBTA 3NASA 4K3VA 5LOVF 3CURA 2Z08A 4QBHA 3RB8A 1IG0A 1M1UA 3I30X 1YL6A 3C74A 2GPSA 5CJ2A 1DELA 2FE1A 2Y0DA 3T4EA 3ZHCA 4XVUA 4XWTA 2CSXA 2AN3A 5IU6A 3BWDD 2NPFA 4DDUA 4AZ0B 4HRXA 3FSGA 1WCYA 1PL0A 1XR3A 2MR6A 2XCQA 4RKYA 2B82A 4LTMA 5INTA 3GJXC 3GCGA 4LRUA 4JU8A 3Q1LA 3W5AA 4EY7A 1C3JA 2AF4C 1I4DD 2R8YA 2ZBRA 3VH3A 1PSZA 4C0QC 1Y7PA 2GPJA 4D97A 1J5EB 3G0IA 5AKGA 3O8OA 1G3MA 2ZRKA 4TWIA 2KM1A 5D85A 1LJUA 3D3QA 2XA1A 3KEMA 4R41A 3T5AA 4YRSA 1EVYA 2IHNA 3SQLA 2RB5A 1UFVA 3T9AA 5JWOA 2A9JA 3PQ3A 2CD9A 2M6SA 4RIFA 2X41A 2ENUA 2IXTA 4MTLA 5AI9A 1KH2A 1UR5A 5ADHA 3OFSA 3P9RA 2HSWA 4U1RA 3KYBA 1G9SA 1JSCA 3TRIA 1D8TA 2SCUA 4B2PA 3ER8A 4K0KB 2UDPA 3B1ZA 4HI0E 1JHRA 3BCUA 4EMUA 3M6UA 3EY9A 1B26A 2MU1A 2Q4OA 3DZ8A 5FF9A 4OQDA 3H9CA 3D3NA 4CU5A 3EF1A 1G42A 3KBBA 5HKLA 1GFIA 5AW2A 4KJZA 2WF7A 4Y2GA 2OORA 3W8RA 4DQDA 4D43A 2Z1DA 4HSGA 1HDZA 2P3QA 2IS4A 1UDBA 4BZPA 1P2VA 3GHYA 5CT5A 1SQ6A 1IVYA 5FJJA 5TQ2A 1G20E 1T2NA 2R11A 2ZAYA 4MV9A 4P4SA 3WG9A 5AM3A 5TQVA 1IYZA 2L42A 4J7UA 1LI7A 4UDOA 3ICQB 5ERXA 3K09C 5DYGA 4YA6A 4TTQA 3UBTA 1BE1A 3OHMA 3BGWA 4DPKA 1E6CA 1AQYA 3VZBA 4ZDKA 3MQ2A 3QEKA 5K7SA 2V7QD 1J0EA 3KL2A 4UE3S 3WYGA 2EQBA 4JMPA 1SNYA 5DYTA 5K3BA 2HQRA 4GFDA 1R5JA 2F6RA 1KY2A 3SBXA 4NAVA 1OX4B 4K03A 1Z13A 2AK3A 2QLNA 3IKJA 3K0AA 4MUHA 3ASZA 4FQ5A 1O9HA 2GXSA 2QQ0A 3L7MA 1W25A 3FWYA 2PYIA 1KP9A 4O1MA 2NO5A 1KDZA 4E5UA 3CY6A 4EQ6B 4YGXB 2Q4EA 3KPWA 1T1SA 4RMIA 1YZHA 2D2XA 4GZ5A 2XW6A 1M8GA 1YR2A 2QY9A 3LQ4A 1ZGCA 2MSCB 2Y2VA 2WINI 1LSSA 4JKOA 1RYBA 1TECE 2HDOA 4JJFA 1WEHA 2PGDA 1DO2A 2OV3A 1PJZA 1UK7A 2DUUA 4C22A 2C0CA 1XAIA 1ZIDA 4TXNA 1XNJA 4ZPJA 2HMTA 3KM0A 2R6AA 1JIIA 4C0HA 1V3QE 4WKBA 3R6WA 1S02A 3EUAA 4LVUA 3R0XA 4PIPA 3DOJA 4BMDA 2WK1A 1Y81A 1UK6A 1PK9A 4MVYA 3TKAA 4M0MA 2OL4A 2XZOA 2P7IA 3AV0B 3IAHA 4REOA 3W4JA 2QP9X 4MV1A 4AMVA 3INRA 4C01A 5T3YA 1CE8A 4BE7B 1Y6ZA 4OMUA 4Y2VA 1NJSA 3V8EA 4ODIA 1RZRA 4RGQA 4Z4HA 5CJJA 1I80A 5FA5A 1RLTA 4BN0A 4ZGWA 1XZDA 1ZNYA 4XXHA 4CM5A 4F3YA 2JLCA 3OCZA 4KXLA 3U9TA 3M2PA 1LBIA 2C3MA 3CZAA 3EZ9A 4TXHA 2GN6A 3C5EA 2HU7A 5A04A 5C8DA 5H83A 2DHQA 4R1MA 3FOEC 2W58A 1KERA 5CLLA 1BMDA 3GUCA 3R77A 2H51A 1HNZB 1JSXA 4GDFA 2NSDA 1E69A 4NCKA 1UJNA 4RD1A 4XVQA 2YBEA 1AZLA 5JHGB 3TB4A 4AX4A 3BRQA 3DZGA 3IUQA 3RU9A 4L5YA 1JIQA 1ZOPA 3NTLA 4KFRA 1QDLB 3UJPA 3DPIA 4LG1A 2XSZD 1CR6A 1JVNA 1OWPA 4WV3A 3VDXA 3QE2A 5AVZA 2H6EA 4LFBB 1E63A 1JSLA 2C8JA 2QW0X 3O75A 4UC0A 4BRWA 2V4UA 1NJGA 2ZSUA 3D3KA 4Q4AA 5AK4A 1XA0A 3QNUA 4QYIB 1YUMA 1HE5A 3T3GA 5FX2A 5AJTA 4REQA 2Q3BA 1MQAA 1WXEA 2R1UA 3F6SA 1A4XA 3DDCA 3IUYA 1DBSA 3O1LA 4TSFD 5ALTA 2BGJA 3ZKWB 1H4TA 2F3SA 3S27A 4ECAA 1KWGA 2X8AA 3Q1KA 4BLOA 2GXAA 5E1MA 4PO9A 4AS3A 3EGIA 4CFZA 1QZZA 1KZ6A 1UKBA 5JNTA 1KI2A 3PRYA 2JA2A 2NYVA 1QHHA 3ES9A 2D54A 1PSDA 4PLTA 3TZEA 1RWXA 4DV4B 1NONA 4X65B 3BL8A 3LP5A 3TL3A 3DV0B 1CQIA 3CLUD 2B5VA 3PITA 5IJWA 3WBJA 2H07A 2YINC 4KW7A 2ZUTA 1J8VA 1FRFS 4OJNA 3VDNB 4ERXA 4XE5A 1VZ3A 6CHYA 3FZEA 5EEGA 1HPLA 1H4QA 1VCOA 2ZRDA 3KOWA 1M2GA 1V9SA 1NE2A 3VFDA 4WOKA 3WLHA 2ECKA 5JALA 3M9WA 3M33A 2XKJE 3MYRA 4R2WA 4TRJA 1TRHA 5G02A 1UZLA 5LLSA 5AVYA 5KYYB 4P2GA 5DEOA 3QWBA 5AI4A 5LMNB 4TMFA 4INPA 2JATA 2HUPA 3BSWA 2G40A 2ZJ2A 3B2QA 3I2IA 1Q92A 2J33A 5BVGA 4ZYVA 5JYCA 1EE2A 1VMEA 3HKEA 4QDUA 3GLGE 2P67A 5AVTA 2G9ZA 4KE6A 4NZYA 3CUWA 2FB9A 3IRVA 3OJXA 4KFSA 2AYXA 4WUVA 2JLWA 2FPSA 3HWX1 4OFBA 2VWPA 3H04A 1QMGA 3QPWA 1HI9A 1Y33E 3K4QA 2QE7D 1G9TA 4XR4A 4YYEA 3ZHXA 3C6MA 1JIKA 2EWMA 5CH3A 4FB5A 1RJDA 5EPEA 1OW3B 1ZMXA 2FN3A 1F6DA 3EEQA 2HK6A 1XJQA 2EJCA 3VVLA 4YCSA 4WZBE 5IHXA 4HPWA 4EG7A 1NOJA 2ZTVA 3OEED 4RQUA 1LPMA 2QLFA 2HI0A 3EVGA 1N25A 4OKSA 2WD8A 1Y8RA 1DI0A 3ROTA 3GDGA 4Q37A 2X7HA 1QH8B 5AK6A 2PJRA 1GUAA 1GA4A 2PWBA 4RV9A 3HKDB 3PQCA 3IUPA 1X1BA 2IT1A 4FHEA 3MD0A 2B7BA 1FUEA 2XGOA 4MV8A 1GY8A 1AZWA 1KBZA 1YT5A 2PK3A 1ECLA 4GC5A 1P7YA 4KXWA 2E21A 4AXBA 4EZIA 2VBGA 3QSGA 4BPRA 1GNVA 3CVYA 2IYUA 3P5BA 1A04A 1NW6A 2FP4B 4PNHA 1F2DA 2W6OA 4YVFA 2QMQA 3JAMA 4Z1MA 1MIHA 1L7MA 2PUJA 4AUEA 1YZFA 1SCAA 1DKRA 1QVAA 1TDJA 3K0CC 4UEOA 4RXTA 1G38A 3WWPA 2II6A 3ABZA 2B1RA 2SHKA 5IJ0A 1DDOA 1OH7A 1EK1A 2I80A 5D7BA 3C43A 2VZ9A 2WZCA 2MSLA 4K6OA 5K01A 1O95D 1UXKA 1A8QA 3DZCA 1KMQA 1PEAA 1TLTA 1SU7A 2G5TA 2Y1WA 1OXXK 5I7AA 1BOOA 1EUYA 1AVTA 4ZI7B 2A9QA 3MJRA 2QNRA 1JHXA 2QY6A 4ZRNA 2X13A 1N5IA 3ICCA 3JSXA 4BKRA 1E7YA 2ZIWB 4G0PA 4JAVC 1BVHA 1XLVA 1G0OA 2VCEA 2YH2A 2RH8A 4IX9A 3QLVA 1U6IA 1FFHA 1VKJA 4CVNA 1SN7A 3QXJA 3G8BA 4N3AA 2GJSA 3TBHA 4PG5A 3D8SA 5IT4A 1I94B 2C2MA 3AM5A 1YA6A 1RACA 2FR0A 2HIHA 1DQPA 1N92A 1P5ZB 4JZKA 3WOVA 2BEWB 3X2FA 3LHIA 3RBVA 3IKTA 4NCBA 4L07A 1FNSA 3PEWA 4UEWA 3LCCA 5AVVA 3ELBA 3QUQA 5EE3A 3K0FA 5HDBB 4BVFA 7ADHA 4LFAB 1SZCA 2YW2A 1XTIA 1NQUA 4A1FA 5JNLA 3FNIA 1MB2A 1XVLA 1UWKA 1ZGGA 3U5TA 3BM5A 2IE8A 2KI5A 4JASB 2GM5A 3DA8A 4EJMA 5KUTA 4JOQA 1ZK1A 4JI2B 2W6MA 3Q8LA 3C45A 2PVSA 5TVGA 1ISRA 1JIUA 3A04A 4JLPA 4TL8A 4B79A 4DMMA 5GGXA 1T5HX 1G66A 3I1JA 2RI0A 1ID8A 2Q5JA 4JLVA 4I4TB 1QM5A 2HPZA 4MGKR 3FPBA 3JQPA 3O9MA 3E22A 4X93A 1G55A 2H2GA 4Y2QA 1JSRA 3ZJ4A 1TVEA 4UTPA 3WRXC 4C7JA 1N2CE 1I7QB 3KJZA 1AG9A 2AOVA 3W7BA 3QOFA 2WHXA 4BFSA 1VMKA 4B3IA 4BMYA 1L5SA 2B20A 5FPYA 5G0UA 1SKAA 4BWVA 1U1IA 1X80A 5CITA 3ZE2B 3WWCA 3HCEA 4LJ6A 1R5OA 1GAEO 3GUZA 1Y82A 4KO3S 3RTBA 2FHPA 2EBUA 3KAPA 5A6SA 2NNLD 1MG5A 1JA1A 3PR2B 1YS7A 1UZAA 3WLRA 1CY6A 4D9JA 3QRWA 1MHPA 3EFOA 4C05A 2J5KA 5H0IA 1P0FA 4LYGA 5TVKA 1KEUA 2WJIA 3ROFA 1USUA 2AG6A 1ZVJA 1QE5A 3GLKA 4ENTA 1YZYA 5JR3A 4KO4S 1NLFA 2ID9A 4IFTA 2IOYA 2W2OA 4IIBA 1B16A 1U8YA 5FPHA 1Q14A 1CQJB 1LLFA 3F4KA 1BU5A 1QE3A 3OLCX 2CBGA 3GGCA 4KE7A 1NUAA 1C1HA 5L3ZA 4YONB 3MJDA 5T57A 2BGTA 1A9SA 1ULSA 1KSGA 1H0KA 4FS3A 1MUUA 1XRLA 3EDOA 1CZRA 4GEKA 1YDEA 2BRUC 1NAIA 1ZYUA 1VLZA 4DM4A 1PNQA 5JMPA 1KOLA 4HNRA 4W4TA 4H0NA 1QGAA 1F0KA 3DDWA 4I9FA 4MQLA 3R8XA 1CEYA 3ADOA 3OLVA 1GT6A 1IM2A 1FS5A 2BCJQ 3B89A 3CEPB 3GPIA 4NMXB 3KZNA 1V9CA 1TRKA 2ZUBA 4MQEA 5L40A 2XHZA 5REQA 4C3VA 5CCBA 2QUBA 1STOA 3BC1A 3PLRA 1O87A 3HI6A 3KLNA 4OX9B 1NG1A 1LFDB 4HLDA 4RA9B 1FJ2A 1WQ1R 1NE7A 4IO1A 4PTZA 2P9ZA 4DCJA 2XYRA 1R18A 2YZKA 4KBGA 2BM9A 3PWZA 3RLIA 1TKRA 4L8LA 1H93A 1DTSA 4JUCA 2C5EA 4XOIA 5ALDA 4NYIR 4MLCA 3QKSB 2EBWA 4E7PA 4QVIA 1EGVB 1QQ7A 2RAVA 1KAMA 2NZJA 3DTVB 2G7ZA 1PDVA 4RZ3A 4Q4JB 2B2CA 3HYRA 4QATA 4MEJA 5FBKA 1DBPA 4DLWA 1DBIA 4XCVA 5A5FA 2JFZA 3W7AA 3ETLA 5IC5A 2EKPA 3KTAA 2AVDA 5HIMA 1VBFA 4LV6A 2BHNA 5BMVA 1JFRA 2O8EB 2CHUA 3KQMA 3OJEA 4YWHA 5C1PA 3ZBQA 3U3JA 4Q4HB 1D03A 2XE6A 3ZWAA 4C6TB 1JG3A 1UF9A 5B3JC 4BZXA 4CETA 4DR3B 2AN5A 3K6KA 2FPWA 3OIVA 4BS9A 5I7WA 1VZ2A 4UM7A 5JV5A 1YVPA 3V4SA 1E0KA 1LDBA 3EIFA 4R51A 2INGX 3C3XA 4HTAA 4PPFA 3L1UA 1NWCA 4RFLA 2WWVD 1JFFA 3KQWA 4PZ9A 3RRMA 3ZNNA 4JYMA 2CDAA 1Z33A 3LIPA 1IJBA 4XD2A 5GJCA 1Q0HA 3EVDA 3S2IA 4DWJA 2MINA 1DKLA 5G1OA 4G0ZA 5L3SB 4DJJA 1YRBA 2ZJ5A 3KXKA 1PWHA 1JHMA 2JVIA 2WU0A 2R8BA 4OSOA 2WYUA 4ZU3A 5B1IA 3BTUA 1U9CA 1ZL0A 3IJRA 2WP8J 3UG7A 2DSTA 3DM9B 5TPZD 3A1SA 4B80A 1DJPA 3TOXA 1W47A 1RCUA 5FI0B 3I9KA 3R20A 4BTLA 5A4DA 3F9CA 1ZSVA 1E32A 1GYRA 4C89A 1CB7A 1CUZA 1LJ8A 1OSNA 3OPYA 3GVIA 2BKLA 4FSHA 3G7SA 3J7TA 4P08A 4I4LA 4WI1A 3V8VA 1O94D 2EJBA 2HA5A 4KAJA 2AOUA 3J81k 1QB7A 1GUDA 1YULA 2QW8A 1L5YA 3H17A 1VIYA 3L4BA 3ZE0B 4RV5A 4WLFA 1OA0A 4TLEA 5LLDA 1EYZA 1NI4B 1P1RA 1KK2A 1RLIA 1XTTA 5DXJA 5DWQA 4OLHA 5EJ4A 2ORWA 3F47A 2CDNA 4HDSB 4KE9A 4QKQA 4PX3A 3FPFA 5ISMA 4E09A 2XKBA 3LX4A 2P9EA 3E1KA 1O9BA 4ND4A 1IDN1 3QTLA 4C6RA 3R3WA 5JMOA 1NPYA 4WDQA 3CISA 1B6GA 1Y37A 3KYCB 1XRNA 2HQ1A 2HSDA 2JCYA 3FR7A 3H3JA 4IRXA 2JCVA 4CM3A 3O4JA 3L7JA 4W9NC 4P0PB 1CUAA 1QFJA 2FF5A 1GPNA 4BX0A 2IOFK 4JK3A 1UH5A 1Z4MA 1LJLA 4J0CA 1ZGBA 2J3JA 4KH1A 4X90A 2GPTA 1JNXX 2PX4A 2FAXA 1NF3A 3MAJA 4I9GA 3U7JA 4YV2A 3QVGB 2RGRA 4YT2A 3PUWA 4MPRA 4RF4A 3IMFA 3EH1A 3WTBA 4MS1B 1ID1A 2NQTA 3ILSA 4G63A 1FTNA 2I9PA 4XEHA 2J4CA 4GVLA 4PYRA 4Z0TA 1K7YA 1GZ4A 3GFFA 4ZMSA 1YU9A 1P9LA 3NX4A 1TT7A 1XU9A 4JWKA 4ZI7F 4MKIA 1ARZA 2Z5GA 2ZIXA 3L8CA 5B2ZA 1BX3A 2J3HA 3B5JA 1D09A 1BJRE 3EMVA 3IAS6 4GO1A 4LDJA 1BQ3A 3FMOB 3OQVA 4HHEA 3L1HA 2X8BA 1CVLA 3BULA 3H8WA 4A0GA 10MHA 3CNEA 4H17A 4G0MA 1UAAA 4EX6A 2Z4SA 3LXMA 5JNWA 4PRKA 4MS3B 1RAHA 1W4CA 2GO7A 4MYSA 1NXSA 1TZMA 4ISCA 4XDGA 4JI6B 3IVXA 1MDFA 4EVRA 1TQ6A 2NO7A 2ZRQA 4NK4A 1BSVA 2HF2A 5AJWA 1I7PA 5CYGA 5KTOA 3NIGB 2P6MA 5JCOA 4BO7A 4M0UA 3T8YA 1LVGA 2C97A 1XDWA 4JIMA 2ZJOA 2C5AA 3ASUA 3I04A 3LY8A 3NAQA 3PQFA 1N1EA 4DE5A 1UOQA 1AF7A 1FDUA 5K3SA 3PZRA 4QDKA 3JQ8A 5CVEA 1LUAA 3OZIA 3OSZA 5CVDA 4CV0A 3L77A 4LZJA 3G2HA 4TWZA 1U31A 1V96A 3FYTA 1CYEA 3QH4A 2CLSA 4MKZA 1EEXB 1NBOA 5E7MA 5EIFA 3FIUA 1JQLB 2H1RA 4KFUA 5EXPA 2R7NA 4PHCA 5DI9A 4JD5A 5GIOE 2REOA 4NENB 3R7DA 3F5MA 4CTMA 1GFWA 3MWGA 5F7XA 3N6VA 3I61A 5AI8A 2Q7OE 3LGAA 4YRIA 4GPAA 2R66A 2HHJA 1DC5A 3LUBA 5F76A 1P2TA 4S2UA 1T8TA 3ANNA 1DEHA 1R8JA 1U0TA 4KYIB 4M99A 2KLBA 1GTG1 4NOJA 4KR6A 5P21A 6GPBA 1JQEA 1NPDA 3MJSA 3B9PA 3MTAA 5D3KA 1VL1A 5ED0A 3JXEA 2ZVQX 2HF9A 2WD9A 4CLOA 3I9MA 5IXJA 3WB0A 3IAUA 1FU4A 2K2QB 4HJXA 1K8YB 4P86A 4MCIA 1E6WA 1U7XA 4JY7A 5EHIA 4IBOA 4EHNA 3O21A 1CRZA 2QPTA 4JXZA 3OQPA 3UJ8A 3DEIA 3L8HA 1ZICA 1QCZA 3L7AA 4K6GA 1Q84A 2HUNA 4W1RA 4X8LA 2VTBA 1F51E 3D8BA 1S2NA 2LR0A 2WYIA 4Q66C 3WFZA 1Z5VA 1KF0A 1VYVA 3MJCA 3EIUA 3PA8A 4MV0A 4UHJA 5TQ2B 2P2DA 2WJVA 4LXQA 2ZBPA 4P4SB 4FHFA 4OJYA 1QGOA 4DC9A 4A03A 4DRXA 1UFQA 2BTQB 1PZXA 1R3DA 1ZJZA 2DH6A 2XTAA 1KI4A 2O3TA 2IBTA 1ZMTA 1Z47A 2UZ0A 3MWKA 1V3VA 4LJKA 1PJQA 4DCVA 2GAJA 1B6SA 5E4TA 1G59A 1F20A 1WUIS 3B52X 5CM2Z 1ZXLA 1AZTA 1K4MA 3QLEA 2RAFA 3L0OA 1RWWA 3NXKA 5PNTA 2RARA 5NLLA 1NI5A 4ZCQA 1MJHA 4NFHA 3ZDXB 2RSLA 4C3OB 1SD2A 2VPZA 4LOIA 4GBMA 1ZVMA 2IXFA 3PUXA 3VSAA 5JAPA 4JJ8A 3LM8A 4NL4H 3CKKA 3ANLA 3WMWA 1KWKA 3UT6A 3B9RA 1KFEB 4P3KA 4Z99A 4ER6A 4IQGA 3N8NA 3RVLA 4JVMA 4YK7A 5F78A 4PIVA 3HKCA 3D1JA 4QECA 2AFHE 3BMOA 3HKBB 1AZSC 1UK8A 3S8EA 2XUDA 2QKYA 2HD4A 3GCWA 1DOZA 2V9ZA 3ESBA 3FMGA 4R2LA 4U39A 4E5YA 3A4NA 2HTEA 3M7IA 5D7NA 4ATNA 1K27A 1NBWB 2HPVA 4RX1A 4Y67A 2FW9A 4DQVA 3ZY6A 2ONCA 3AI7A 5DCWA 5K3CA 1EFRA 3QE0A 3F2IA 4KPUB 2ONYA 4ZAZA 4WOCA 4MR9B 2VXBA 1HKUA 3WYNA 1JU4A 4OB6A 4ZCLA 2VTDA 1CLUA 3WGUA 5HK9A 1DO8A 3OPNA 4E31A 5EJ6A 1QG2A 4PS0A 3UJ9A 4MGYR 1CE8B 5CH5A 3B85A 1HURA 3H87A 1H05A 3QMWA 5KB3A 1Z62A 5IJZA 2I2DA 4ITUA 2X7XA 3I62A 1XWWA 1PK8A 2GWRA 3TGLA 4Q3BA 3DV2A 1EXDA 4ID9A 4BMVA 2Z2YA 4F46A 1N2GA 4C88A 2NLOA 4FYIA 3ZDZB 2OQIA 3AUSA 3BH0A 3AEUA 3GG9A 2R2AA 3JYHA 4I5DA 1XEAA 2Y0BA 4II3A 4WW0A 5LKAA 5K8CA 2Z3VA 3THXA 2PFGA 1ZCBA 1M7GA 3Q7PA 1AE1A 3E2PA 2VWGA 3ND8A 2WKSA 1DKMA 3B3AA 4QEKA 3TXYA 1KC3A 5JAMA 5BN3B 3LDFA 3JQAA 1PRYA 1Z5WA 3GFTA 4HFJA 4NCHA 2C4MA 3CINA 3N5CA 4IDNA 4Q4AB 2CLLB 4PY2A 1N2BA 2I2XB 4M88A 1UINA 3PTLA 4REQB 2C9MA 5F1PA 4NCAA 2XVZA 1CUBA 2C2HA 2DLCX 3VR6D 5DBEX 2TMKA 2VNSA 1SKBA 3AF5A 4MUBA 4TMVA 3EZLA 4UE2A 5F9MA 2GTHA 3NTRA 5KHOC 1U0LA 4MNTA 1D2RA 1LI4A 1VHQA 2XADA 4TX1A 4I4CA 1DRVA 1TCUA 4S0XA 3VHXA 1ZRHA 1JHPA 5F2NA 1BEZA 3G9TA 3NGXA 4W5JA 4ZYYA 4CWAA 1QHHB 2AF3C 1JJIA 3LO5A 1LBSA 2B9EA 2IPOA 2RCNA 3D3WA 2BFCB 4FZJA 1XQ1A 4L9AA 1XXLA 1J97A 1QX3A 1CQIB 3OTWA 4H0CA 4O1HA 1XKTA 2FYTA 2I2WA 4QEDA 1UQUA 2QZJA 3LPMA 2FEKA 4L51A 4GE3A 5KNDA 1YK1A 1Q21A 5CDGA 2FLVA 4B46A 1CDDA 3FCEA 1QO0D 4ZODA 2RHDA 2QLMA 3WC4A 2NXJA 2WNIA 3ABQB 1CR4A 1E99A 4QUIA 4ESHA 5ES3A 3V7NA 3RU2A 1EP3B 1NGSA 3FFAA 2PRIA 4EHDA 3ZDAA 1P17A 1XTRA 2NPIA 2IDZA 3LDHA 4KREA 2P6UA 2IZ6A 1T9BA 3QVKA 2I8LA 3OE1A 2JZNA 2NU6A 1P1IA 1NRWA 3HKEB 1XL0A 4J4BA 4MVJG 2O8BA 1E8DA 5KYKA 3OPQA 1OKKA 4XFJA 1ZD1A 3HBMA 3NBFA 4M38A 3DMGA 1Q57A 3DMHA 1N2XA 3QQ5A 1GV1A 3Q3CA 2WWHA 1RSZA 5HK8A 5A4IS 4L9RA 2O0MA 2P8JA 1NKTA 2GEDA 2WFLA 3TFQA 3COVA 2CLDX 2DKNA 3U6KA 1K63A 4TQUS 2VHTA 2YJ5A 4Z3KA 3ZWDA 4MJ7A 4R83A 3MWEB 1NUUA 1YZTA 3R7LA 4XIFA 1TGYA 4G0VA 3DXXA 1M2WA 2W6PA 2ZRLA 3DE6X 1ENOA 1OYWA 3QEMA 2NYAA 2OXRA 2WI8A 1TMGE 2Q28A 2DHCA 1VJTA 3LZDA 4KGZA 3RNLA 4IUDS 1W94A 4MS4A 4KHZA 2P9GA 3ZV5A 3VNVA 1J5PA 1W4AA 1YUBA 3WICA 3IQGX 1Z6XA 3X1JA 4F2HA 1E92A 4HMPA 3SLRA 4W5RA 2W6JD 1I30A 3C14C 1ODTC 3INGA 1O54A 3HYCA 5FBHA 3WV5A 3ROQA 2ORYA 2ZT5A 3V8QA 4BVJA 2O3JA 4TMWA 4WBSA 1J99A 5IKOA 1XU7A 4S0ZA 2J8ZA 1JWLA 3F4BA 1Y3HA 1DZ3A 1BROA 3Q6MA 2WWFA 1NXPA 4Q4LA 1ISMA 3OX1A 1FDIA 1Q20A 2VSQA 3C1OA 3LLCA 3S5UA 1MOZA 2GEBA 3L1KA 5TLSA 1OH8A 5IJ0B 1VCMA 3I8XA 3WR5A 3K94A 5IJ9A 1YR6A 2Q6OA 1LLUA 3SBEA 1X1DA 4GMGA 1UJBA 2G9RA 1XZIA 3A2NA 3BWBA 1JAYA 1ZOOA 2WF6A 3LYHA 4G2NA 4OOEA 4PLCA 2IHTA 4Q9DA 4DG9A 1U0GA 1QV6A 4I1SA 2AT1A 3NT2A 4GPZA 3R8CA 3KB6A 3SAJA 4BNXA 4DNPA 1E8MA 2O4UX 2EZ9A 3EOAI 2QTAA 2CXSA 2VJKA 3RWOA 4BO4A 4CCAA 2Q5HA 3EF3A 1D3AA 3Q7SA 3NBKA 4IR7A 4YRFA 3SZOA 4EAQA 4WY5A 1U8XX 4EUSA 1YR1A 3RFFA 1CJVC 1RXIA 3A3NA 3KXPA 4WZAE 3E9NA 4ZOEA 2PUGA 2VHJA 1F9AA 1AN9A 3RTAA 2VQEB 4A15A 1ML3A 3FHOA 1SZDA 3ZNOA 3OWXA 2GH1A 3YASA 1P72A 1VM6A 2H0RA 3IR5A 3C1UA 3Q15C 1R50A 1OX6A 3GDHA 1OFVA 1JDVA 5CAEA 2GRAA 5KTSA 3O4FA 4X62B 2OHXA 1Z2DA 3C8HA 3FUUA 3HJAA 4BO9A 4JYAB 1CJMA 2QTCA 3VC2A 1LTQA 3WLKX 1DWQA 4I2VA 3RVMA 1ULHA 4DIUA 1OJ7A 2IYNA 3A1UA 5AJXA 5CVTA 5DMHA 4AMUA 5UKDA 4AW9A 3Q8WA 4GPBA 1E9CA 1NR1A 3GJTA 5TMBA 5H7XA 4JEMA 4A3SA 3DD5A 3NBUA 3ESYA 3V8MA 4AY6A 2O8CA 2I67A 4TTTS 2O5EA 3VTKA 2EERA 1TUEA 4KXUA 3URMA 3GVHA 2PKQO 1HQYE 1ZUD1 4B3FX 2BR3A 1M1YA 1ACJA 1ZM9A 4GOKA 1TLLA 2QLLA 5IBPA 4R40A 3TFWA 3ESXA 3TEFA 5I01A 1YRWA 3LBYA 3P4XA 1UPXA 2CMGA 1DO0A 2WG1A 2BE9A 2YIJA 3BRWA 4WOJA 3TRHA 2IYZA 5JNRA 4QJ5A 3VJLA 1JJ7A 4YR7A 5CXQA 2B4TO 3OLWA 3SJZA 3GUVA 4JMLA 4R9RA 5JEEA 4ZP1A 3JCZA 4PQYA 1TTPB 2GYVA 3HR8A 1RLMA 5DHPA 5T3UA 5HZGA 3CVXA 3WGMA 3O4RA 4UEQA 3IDFA 2H11A 1RRVA 3HXQA 4GC9A 4BQRA 2RH5A 1TU3A 4HUTA 1NKVA 4GICA 3AT1A 3OZRA 1H65A 4KX3A 4EEXA 1C9YA 3U9LA 1Z68A 1DP4A 3EIWA 2JBAA 3E8SA 4CCWA 1E2KA 1X80B 4LBZA 1Q2UA 1UC5B 2CLKB 3H1PA 2XIJA 4FZVA 3RSQA 2GARA 1GRRA 5CNJA 1GCOA 2HA4A 2I22A 3G59A 3Q7TA 2W2QA 2NU8A 4PGAA 4BBZA 5JI2E 5KSWB 5A6SB 5E1OA 2XB6A 1A9TA 1RXYA 4M3NA 1GCIA 1SC4A 3C7KA 4YRMA 3EFOB 2QYTA 1RTTA 1AUOA 4O1IA 2IW3A 1X39A 5DSXA 5EQFA 5BW8A 1DAMA 5DHTA 1TMOA 1L5NA 2NV6A 3TWOA 3T52A 4CMJA 2DWPA 5BSWA 2H2IA 2OXEA 1LH0A 5FADA 2B99A 2VDKB 2O1WA 3SZLA 4RZHA 3TRDA 1S4QA 2JRCA 2PGLA 1VBNA 1XWFA 2DPLA 2MOKA 1JILA 4KNWA 2UU9B 4NXNB 4IJ5A 4WE3A 5A5EA 1RQ2A 2OXCA 1P0CA 1I32A 4GE0A 1FX0A 1GM5A 2ZU6A 3EXHA 2WIJA 3ZWBA 3K9QO 4PLHA 5CJPA 1E2DA 2QMHA 3L7IA 4NPHA 4ICIA 1XAHA 2JGMA 3LNTA 5DFAA 2XLCA 5REQB 4A9AA 4OGKA 4D8VA 3C4VA 4POAA 4QRIA 5C34B 1EVQA 1S8OA 3WAJA 3QLVC 1T24A 4ZYWA 1P9WA 2Y68A 3M82A 1E7MA 3O84A 1VB5A 1X42A 5LM3A 2AQ8A 1UKYA 2R2GA 4JP5A 1RFGE 1HZJA 2O52A 1OGJA 2GS9A 3R09A 2EKLA 2ISSD 2GQ0A 3GB9A 2HNBA 1Z73A 4JLDA 4M8IA 3KK0A 3UMSA 1J49A 2JLSA 3C16C 4LNAA 1PDWA 1ZIYA 1KA9H 5K0SA 1NN3A 2GD6A 4WVFA 5E6RA 1XOIA 1ILEA 2XWSA 2P77A 5JD3A 3NEAA 4R2HA 3OZUA 1YC2A 3BE6A 4E21A 4HVAA 4EARA 1C7QA 2XQVA 2JVKA 1U9IA 4YP5A 2OFWA 3W4KA 1RTKA 4UXJA 1ISIA 2RI6A 2WT8A 1H2BA 4G5OA 4RHCA 4DSOA 3GRVA 3NHRA 1QGED 1UT6A 5KOHB 1Y4SA 2F55A 1F0NA 1J4AA 1XRPA 2SBTA 2C2KA 3MXOA 1W0CA 4HH1A 4M8NE 4RPHA 4R8LA 5CA0B 4LWOA 1PEYA 1SQ0A 4H7FA 1ZK4A 4LDRA 4YLYA 4KN9S 1AQNA 2XYVA 1BKDR 2PLAA 4J1SA 3EASA 1MC5A 1Z39A 3U7EB 3HXTA 2VVTA 2WG2A 3G2PA 1P5JA 3TRFA 1QUEA 1NF9A 1U28A 2WLTA 1Z4PX 5KKNB 2QJOA 2D8MA 2EJWA 5AM0A 1U0NA 1Y5LA 4P58A 1ZD4A 1X7GA 1KRWA 2YVKA 3WB1A 2NPOA 4IMRA 4X92A 4KHPB 3EODA 2CEKA 1Z0AA 3E6AA 1JG1A 1WVIA 2V55B 3EDQA 4FILA 2CNLA 2I3GA 1Q91A 2B30A 1HYQA 1MT3A 3Q0IA 4JKIA 2P75A 3CUVA 4IHJB 1A7JA 3RS2A 3OE7A 5E4JA 2CF6A 1QDEA 1CUUA 4R2IA 4BBJA 3EA0A 4GGOA 4ZCMA 5DV9A 1Q1ZA 5AP9A 3N0XA 4LW8A 3T9FA 4AX8A 3FETA 3JWGA 4MKGA 1U7PA 4R1SA 3ZY3A 4DC0A 1RZVA 3FI0A 3PD0A 5AOCA 1ZUIA 3NC0C 5ALJA 2XUAA 6ADHA 3WL3A 2Q5FA 3I04M 2GBGA 4P7GA 3OCJA 2DFPA 2VJOA 5EJMA 3ANXA 1ZK2A 1C3VA 3GDFA 2XX3A 3P2EA 3HO6A 5D84A 2WU4A 4P6VF 3MJTA 1SUBA 1QYIA 4LSZA 3FF1A 3RC9A 4BEWA 5IRCD 1ZN9A 4D9CA 3G9XA 2AQHA 5ECWA 2GAFA 3S6JA 3P9CA 4JELA 3FFWA 2O05A 2C92A 1B0UA 3NOOA 1FB5A 2XE7A 3FPAA 3PE6A 3T1NA 4C4YA 4IQ4A 1Y4AE 3KDAA 3WZ2A 4EA7A 4HLUA 2BM0A 5CFNA 2Z5FA 3AKEA 1HFKA 1KE2A 1DAKA 1U7DA 1U8EA 4WEOA 5B4VA 3OU7A 3QYJA 2CL7X 2H1IA 4P4GA 3D6NB 5GP1A 5JAHA 3PKZA 2RHOA 3EFHA 4TT8A 4BGUA 2QP3A 4RTNA 2A0XA 2Q6LA 1NMEA 3F90A 2R5FA 4NVRA 5F21A 2OUKA 2HWUA 3VYUB 1BFDA 3ROMA 2C5HA 2BKXA 1ECFA 3I5MA 4AJIA 2X19A 3ZE7A 4NMWA 1KEZA 3CNQS 4XWYA 3WGOA 4D4IA 4RF2A 2VDRB 4CIVA 4WPGA 1RCTE 4GYYA 1M1ZA 1W1WA 1SQGA 4RELA 2I6XA 1XDBA 3PC7A 2ZIXB 4ISBA 4RD3A 3TZKA 4OP1A 1W88A 4EJFA 3OIYA 3SY8A 2O0HA 3HABA 5JSQA 1AV6A 1NHWA 1N2EA 5AW7A 3AR5A 1O1YA 3BHNA 3WWZA 3ZBUA 5B1EA 1GRQA 4NYIQ 3HU3A 3KVOA 2XGGA 4MB2A 5ALRA 1N4DA 1L8AA 2P1RA 5CVVA 3M3DA 1NVVQ 1ZD2P 1VI5A 3CPEA 3PFCA 3NJ8A 4LQCA 3I9OA 1HX7A 1CYDA 1I3KA 2HYIC 2VT3A 4XSVA 5BV0A 2D7CA 2A1IA 3OKCA 4URHA 1EVKA 1Y7IA 2X2OA 4EO7A 4EB8A 4D3FA 3IERA 3QFFA 2CXTA 2EP5A 3U48A 3GRYA 2YVAA 1QIJA 4XGIA 1Z26A 3RAPR 2QU8A 3GFBA 5AW4A 3AG5A 4ZVTA 4MGIR 1U1DA 4V0SA 2X0EA 4C21A 3VGJA 4NBVA 2FW7A 2GR9A 2OLEA 3HR7A 4FHGA 3NHMA 1NF8A 3OIWA 4LRYA 4UU0A 5B57C 2LDXA 1NOKA 3GMIA 4L75A 1UJ4A 1DHRA 2LXNA 3HACA 3MNFA 1ZRMA 5FO1A 1V8DA 2PEYA 2FXIA 3NIBA 4DIMA 3CPJB 1THMA 4M7OA 4Z9FA 4F4CA 1HE2A 2XAAA 4EL0A 3LUCA 1Y1RA 2XA2A 4KLAA 3G3EA 4YRGA 2G4CA 4J0GA 2B69A 5IAJA 3I8OA 3L4BC 3V32A 3UPDA 3RUFA 1TJ5A 5JVDB 4JI7B 3DLCA 5DM70 1VKNA 2MSNA 5BR7A 1AV7A 1U7UA 2PAAA 2H4YA 5FWNA 5L7TA 2H92A 2WM3A 2HRRA 3L3BA 4R3UC 2VDVE 2VT7A 3JZAA 4LRSB 3K0BA 3B51X 5BW4A 1OIVA 4P8RA 4PLZA 4FR2A 2WIGA 3F2VA 3I3OA 4MVCA 2OLKA 3BE5A 4GGPA 4CLOB 1PR1A 4PRZA 2HR1A 4Q1AA 5K09A 2LKDA 1E20A 2QG4A 3CMCO 2ZAMA 1G5IA 2FCAA 3LSTA 3VR3D 2H1HA 3TJRA 5LNK6 4QTYA 2XXAB 4CL2A 1BDIA 2OYSA 1V7CA 2Z4TA 3ADKA 4F3KA 2O6HA 3ILHA 4FJ2A 5LU9A 5FOUA 3CF6R 4MJLA 4LXIA 4Y30A 4DRXB 5CIQA 3RUIA 1JT9A 2HXSA 4TQ9A 3UJ3X 2IYEA 1A5SB 2AHRA 4QOJA 3IHTA 3RG8A 3TIGA 5KSYA 2QSYA 1KJNA 2J3MA 3GJ3A 1PYDA 1U5AA 3ULKA 2ATVA 3C6QA 2GHTA 2JD2A 4FT2A 4QOHA 3JD0A 1KO7A 4Z0NA 4WEQA 2BTOA 2XV1A 1EEHA 1W48A 3CH7A 1NI3A 1SXJA 1X8KA 4YMIA 4P36A 4ZV9A 3X2EA 1Q0UA 4EI9A 3S2ZA 4U5XA 2D13A 3AUAA 2YASA 2Y92A 1M2HA 4IJKA 1RBQA 3I37X 1PZGA 2JANA 4YT5A 3AUUA 5L3QA 3CZ9A 2XNJA 2Q3DA 1RAAA 5BNTA 1BQEA 3H9JA 5HF5A 3UCEA 3E8XA 4KR3A 2Q5OA 3EQ6A 4O4LA 2VYVA 5K0NA 1ORWA 3RK4A 5EXDA 1QGYA 3UK0A 4FFBA 4K0RA 1JPJA 3HKCB 2O2SA 3BMOB 3G85A 3NP7A 3C97A 1E9RA 1EGMB 2AX3A 2PZBA 4ARZB 1YQQA 3TTSA 1L5VA 4DR6B 1S3SA 3SQDA 2AC2A 3KX2A 3BWEA 3T7SA 1DV2A 3FCYA 3FYCA 4CQJA 3IP3A 1SKYE 3ZWVA 1JUDA 1TUBB 4IL5A 1JGTA 4ZJZA 3UATA 1Q0QA 1OLXA 2CFRA 3RUCA 4EEZA 1GPBA 2Z0MA 3G0HA 1XTVA 2Q2VA 4GNKA 4NR0A 4IXMA 3LLMA 2A5FA 1M6VA 3ZJYA 4OHPA 1JAIA 4ED9A 3ND7A 4QUKA 4UVHA 5E8JA 4ZEXA 4CQMA 1ODIA 3NGLA 2FA9A 4MTCA 3MUNA 3DUFA 3WIUA 2GERA 3II6X 1YVEI 3CUKA 5M34A 5AUPB 3S8YA 1LW6E 3QY9A 4YO8A 4LJ4A 5DBIA 2DUJA 2PJDA 5L51A 3UYLA 2I87A 5JRZA 3WL4A 5CA0F 1U3GA 2QE6A 5DBHX 1NUQA 3TNLA 4Q1DA 3DO5A 2IBSA 3AEUB 3H1TA 1ZUNB 3FRHA 4G0OA 2WU8A 4G2TA 2E4UA 3TVTA 3ZVMA 2IOHA 2A59A 3THXB 1M0EA 1JFVA 2O06A 2CDCA 2PX0A 3MBKA 3X1MA 3DAHA 1GTJ1 4F1JA 1KSJA 4YFYA 2GDZA 2HCJB 3CZMA 3ZQ6A 3JQAB 2ANCA 1EBBA 2QVXX 4HAZA 4MIOA 5HOQA 1WR8A 3FVTA 4PNEA 1AKEA 2ZE8A 3MAGA 2BN4A 2FTKE 5JNVA 4PSAA 4DA6A 1IN5A 2YHIA 3WLAA 2PRJA 5I6DA 2O2YA 4B40A 3OZAA 1MB3A 4QWMA 4WFKA 1E98A 1UP6A 2VNIA 2YWCA 3GLSA 4IHJF 4TUYF 1ZESA 3SEQA 4GX1A 3T38A 1GZ5A 3L0IB 4Y9UA 3N2ZB 3Q3HA 3R3HA 3H11B 1DPFA 2YC4C 4MRNA 5KVQA 1OZGA 4JBYA 4OLJA 3VHXB 3H1GA 1DEOA 1I4WA 4I55A 2V58A 3DT8A 4LDAA 5DCLA 4GQBA 2YJTD 1DOAA 3ROGA 3UGJA 4CKWA 4LJ9A 5IC6A 1U3UA 3VPBA 4OLFA 5E7IA 1G5PA 2QGFA 2B1IA 1X7YA 1HTTA 3OPMA 3TLJA 3OFNA 4UUQA 4NZZA 1YGYA 3DWGA 3GUUA 4GKVA 4ZHQF 5ITZB 2WVJA 5G0VA 4A6DA 1R8QA 4PYMA 3S8MA 3GZTB 1JDTA 2XDQA 5LWHA 1G98A 3TDMA 4LI0A 1QP7A 3RYTC 2GUWA 1K4YA 3Q4GA 3LV8A 4GYKA 4JB8A 5DGHA 3IRUA 5HCUA 1OREA 4JI5B 3ZHOA 4UVIA 1YFLA 4RENA 1PWZA 4KN6A 2OV8A 3GDOA 2NU6B 4CG1A 1R6AA 1YTUA 5B55A 3PHJA 4ROSA 2VFAA 3KQTA 1Q6ZA 4PGHA 2BHRA 3QV2A 1DIRA 2R84A 3BJRA 2C7VA 3HV0A 3MCUA 1F60A 2FW1A 2BD0A 3ZCPA 5BOVA 5HSGA 3GJZA 2WFLB 3VNRA 2OT3B 1ECGA 2JZOA 2JEZA 4WK6A 5G2OA 4D6XA 4E2FA 5EMLA 5JW6A 2WJAA 1WB9A 1VC2A 2OB1A 2PA3A 4Z2AA 3QPDA 4JB0A 3C3CA 4I3FA 1FVXA 1A88A 1BU8A 2OQ2A 5K6RA 5DGIA 5C9ZA 4IMIB 1Q3KA 2IOFA 4S1OA 1A1SA 2XODA 4FDAA 1PJ2A 2VXCA 3NWOA 1QRRA 4EECA 1BZYA 1AXRA 2ZYVX 2H5IA 2PM8A 3PDWA 3QEMB 4OQLA 4MRMB 3NIWA 4JJEA 5TB5A 3DYIA 1WDWB 3KSUA 4MS4B 1SOAA 3DTNA 5KWSA 2PZKA 1C1YA 3TQQA 3IHWA 5IARA 2WHRA 1ORRA 1GGNA 3C7AA 1RMTA 3DB1A 3QVVA 4RM3A 5FJIA 1KYQA 4HXFB 1IHDA 2IU4A 3DBLA 2XTNA 4HUJA 2ERCA 2XT0A 3DKVA 5CT4A 2VLBA 4EGFA 2ZWMA 3A6PC 4YV1A 3ZXSA 1NDHA 3L4KA 3NOQA 2FK7A 3KEFA 1GGFA 3FKSD 1MFPA 3LBFA