2C2KA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2kA00
4N7JA 1BMQA 3V4LA 3V3KA 2J30A 4N6OA 1SHLA 2C2KA 2H65A 1NMSA 1PYOA 4QU0A 3KJQA 5LU8A 3V6MA 4JJ8A 5IBRA 5IC6A 3EDRA 4N5DA 1K86A 4FEAA 2QLBA 4QUIA 2CNNA 4NBNA 5IBPA 5LUBA 4NOMA 5IAGA 2XYPA 3D6MA 3EDQA 4JR2A 2H4YA 1QX3A 2J33A 3DEIA 2XZDA 3R5KA 4DCPA 2NN3C 1F1JA 2H54A 3P4UA 4FDLA 1NW9B 4AWBA 5I9TA 4PS1A 2QL7A 3DEKA 4EHLA 4ZVQA 4NOKA 5IBCA 5IABA 2CNOA 3R6LA 4FGUA 3R5JA 2CNLA 4JQZA 1QDUA 1RWXA 3GJSA 3GJRA 3IBCA 3KJFA 1I51A 3RJMA 1M72A 2Y0BA 2QL5A 3K7EA 4NBLA 4QUDA 3UO8B 4QU5A 3GJQA 4JQYA 3S70A 4EHHA 2C2OA 1JXQA 5K20A 3SIRA 4M9RA 1QTNA 1I3OA 3D6FA 5IASA 3ITNA 1RWVA 1RWKA 2FQQA 2H4WA 2C1EA 2H5JA 1RHRA 2P2CA 2QLFA 4EHFA 4HQRA 2HBYA 1I4EB 3H11B 4N7MA 5H0IA 2K7ZA 1PAUA 3R7NA 4I1RA 1RWWA 1F9EA 2HBRA 4DCJA 1GQFA 3PCXA 4EHDA 4NOJA 3NS7A 1KMCA 2AR9A 4PRYA 1RHJA 3V6LA 3S8EA 1RWNA 2FP3A 2H5IA 3H0EA 4ZVPA 1K88A 4AW9A 2QL9A 1CP3A 2XYGA 4JR0A 4HQ0A 4EHNA 4EJFA 4QUBA 1RWPA 2CNKA 4N6GA 1SC1A 3BIJA 2Y1LA 3GJTA 4QTXA 1RHUA 3V55A 2H48A 4IYRA 4EHKA 2QLJA 5LU9A 3R7BA 1RWOA 5I9BA 1NMQA 4PRZA 1GFWA 4JR1A 4ZVTA 4PS0A 1IBCA 2H51A 5IAKA 1CVRA 5IAJA 1SHJA 2CJXA 3P45A 4DCOA 4JB8A 3NKFA 5LUAA 1RHKA 2J31A 3DEJA 3KJNA 1RHQA 2XZTA 3R6GA 4QULA 5IARA 3H11A 1RE1A 4IEFB 4QUAA 3SIPA 3NR2A 4QU8A 1SC3A 1ICEA 3E4CA 2HBQA 1RHMA 4D3XA 2C2MA 3QNWA 4QUHA 4NBKA 2DKOA 2FUNB 3D6HA 4QUJA 3H13A 4JJ7A 1SC4A 3V4OA 3R7SA 4FXOA 4D3YA 4I1PA 2CDRA 4QU9A 3IBFA 4D3ZA 3PD0A 2HBZA 4ZVRA 4ZVSA 1RWMA 4AWAA 5IANA 4NOLA 1NMEA 4ZVOA 3H1PA 2WDPA 4LSZA 4QUGA 3UOAB 2CJYA 2J32A 3PD1A 4QTYA 3DEHA 5JFTA 4ZVUA 1I4OA 2C2ZA 4QUEA 4EHAA 5IC4A 5IAEA 4N6NA 4HVAA 3OD5A 4JJEA 2XYHA
chains in the Genus database with same CATH superfamily
2Z2KA 4XWTA 3JQEA 3JAKB 4OYLA 5KKNB 1XTUA 4RV5A 2VA9A 3CRQA 1CIJA 3FWHA 1UXOA 4J8PA 5L3SA 2YVQA 4HYYA 1M2OA 4DA8A 2VHJA 4EEKA 1DX9A 1GV0A 3REFA 2GNOA 3DEZA 1G291 3KZ1E 3ZLVA 3LGAA 3TS1A 2EEZA 4BFSA 4BLPA 3D6MA 2VQFB 2OGTA 3F9CA 5JWRA 3AVWA 4TMWA 1Z0ZA 2WFZA 1E61A 3A1TA 4QQKA 1CC1S 1HFWA 2Z04A 1Q57A 3G0CA 2FETA 2JI8A 3AIKA 3ZU3A 4PX5A 1IEWA 3OM8A 4FWIB 4ZXFA 5JQGF 3A9TA 4V0KA 1R5BA 3L1KA 2FZ5A 3QBEA 3IAM1 1QAMA 2W48A 3PXDA 1UUFA 3KNZA 1XDUA 3CXRA 3HM9A 1QQBA 4IG4A 1GR1A 1Z4KA 3DLHA 4TLAA 1EWQA 1XKQA 3EXHB 1NKVA 2HDOA 4UHHA 5B1EA 1PWEA 1SJ9A 4PZYA 3N2IA 5E95A 4KLZA 1P0FA 1JR4A 2PZMA 4AZ3B 3ELUA 2NW6A 3EIHA 3EC1A 3FGNA 4MP6A 1TO1E 4NZOA 5GIOE 3ANLA 3I01M 2O5CA 3A58B 2CWWA 4PXSA 1G64A 1RYHA 5J63A 3PQ7A 5E8RA 1EK5A 1VZ2A 2GEVA 3LUKA 5F64A 3NT4A 3N5KA 3TVTA 1ZOOA 4JLDA 4OFWA 1KBOA 4AF7A 3BMOB 3LC1O 1F9EA 2XQIA 1HE5A 1UADA 2QLMA 3L0YA 4UHDA 4YAFA 1AKNA 2IRWA 4GG1A 5IAAA 1CHDA 4DSNA 3EPHA 4DNXA 1Z07A 2XGSA 4YO7A 3O2JA 1KOLA 5IVHA 4FC7A 4CM7A 5BVHB 3WHIA 1Z8DA 5CT9A 3HBJA 4YCDA 1MNAA 1QMPA 1WBDA 3OFVA 2FQWA 4EJ0A 5MN6A 3U49A 3BWMA 4P38A 4Z7JA 2NYVA 5E0KB 4U7FA 3TL2A 1RE0A 3PHLA 3DMYA 3JR7A 3IP6A 2AD1A 3ZDYB 4N8SA 1XZ8A 4FHGA 4GI2A 1W5EA 1XTZA 1M5RA 4XLLA 2G4LA 2QQEA 2UUAB 2I66A 3BA6A 1OC4A 3I12A 1P73A 1JDPA 3GWZA 3IHWA 2FFRA 3TZQA 3PPWA 1U9ZA 1DQZA 1MQ9A 2DSNA 2GS9A 3BQMB 2V7GA 4R05A 4F6CA 1TT5A 1VGRA 4MV8A 2C2MA 3NGMA 1ICIA 4BP1A 2HSEA 5F33A 2BELA 1C4KA 4RJTA 3R44A 5DHQA 5BR8B 4DV6B 4QX6A 3FETA 2VC2B 4E03A 5ICMA 2OK7A 2O2XA 4IVPA 4YTEA 3ZDEA 4LVNA 4AX4A 2DPGA 2WSBA 1P9LA 2VYVD 3GWGA 2YJZA 1OZHA 4FLEA 3TZHA 1UMCA 2UDPA 1FBNA 3DZ8A 3NU1A 4F4HA 2I91A 5BUZA 3NCTA 1E32A 4D9GA 2NP7A 5D3ZA 3SDBA 1M8GA 3ROKA 1YRYE 4A0FA 4D9HA 3OE7A 2Q1WA 4O0LA 4DZZA 5JS7A 3QEBZ 3ZDDA 4XYEA 5JRZA 1A50B 4DYHA 1PBTA 3SFZA 2XYHA 3AHFA 3FTQA 3MJDA 5BPFA 5LXTA 2B3DA 3IEMA 3FD8A 5BQ3A 1E6MA 1RT9A 3THRA 1GCAA 3D9QX 3HGTA 3VVBA 5AVVA 1JU3A 4EG6A 4U63A 4ILKA 2WY2D 2DPYA 3ZBUA 2BZGA 5FTNA 4B3DA 2Z5VA 1JDBB 5JDIC 4BCBA 4NYMR 1H6DA 2IOHA 2VCEA 3QUTA 2I3AA 3DBVO 3TQHA 2JHCA 4OHRA 2PYZA 3A6LA 4DTCA 1E58A 5DGTA 3MOIA 3UJDA 3BTVA 5AM4A 3MGCA 1UDCA 5AOAA 2PT5A 1NUSA 3WXMA 3ZWOA 1JUDA 3ZV3A 3D0KA 1Q0LA 3WGVA 2H5LA 3UW1A 2DP4E 3KAPA 1PQ4A 2YZKA 2GN4A 1XZQA 3QEMA 4KDRA 4Q1CA 5G4KA 5KZMB 2QL7A 4HAIA 4KX5A 2Q07A 2BGRA 4Z0PA 3JZMA 2LPMA 4NYIR 2C59A 5BPHA 4MRVA 2WUVA 4JT4A 4D8YA 1BH2A 4TN5A 2I4TA 4YP5A 3OAAA 3VVCA 4NBLA 3RJTA 1W0JD 2YWJA 1JDSA 4C88A 2A7XA 4IDEA 3OZVA 3QUAA 2OZLB 4PFSA 4MQBA 2WU3A 2R68A 5THXA 2EJTA 3B53X 5COQA 1NXPA 3MUFA 2VTEA 4GOKA 4TSFA 4YV1A 2AXQA 2XD9A 2V3CC 4R2LA 4BNGA 1U0TA 1FRFS 4BO1A 3MTAA 2PV0A 4H7EA 1VCHA 1NW6A 3AB3A 3KQNA 4JD5A 3T3DA 1W5SA 2HQ1A 2QVXX 4FFNA 5ERXA 1NG1A 2XVZA 1I9CA 2GESA 5DGDA 4NP6A 1E2JA 2C84A 3HP1A 3OM0A 3GJZA 2JLAA 1C1DB 2JAOA 3E8SA 1IUNA 1OUMA 3AW9A 3V1NA 3E8XA 4R0VA 1IM5A 1U0EA 5CLJA 4DC0A 3VKHA 1CJVC 1H2ZA 2QX6A 1XDBA 1ISFA 4JNCA 1XN1A 2YMMA 3WAJA 3ELDA 3K9CA 3NWOA 4FUQA 3F2VA 2DQZA 5D85A 1FFAA 2NVBA 3KL4A 3VNRA 4EKIA 4C6SA 2IELA 2XODA 2JAUA 5IAKA 1VJCA 2DLDA 1CVRA 1YCHA 2Z58A 2IYEA 3DTVA 2JCBA 2I7CA 3C7KA 3H2IA 3JPYA 2KMLA 4U2EA 3SJAA 1E9RA 3LXUX 1HURA 3VSAA 1W35A 3N59A 2XV1A 2P2SA 1U7HA 2ZTLA 4NE7A 5A4IS 2FY8A 2ZYWX 4MOWA 4UMVA 3IPXA 5IEBA 4L5YA 4PSUA 1T43A 4ESVA 2J4FA 5C8ZA 3AVXA 3NO4A 1Y9EA 2JEYA 2PGXA 4IVNA 4JI5B 2VDJA 3UA4A 2PYIA 5BT8A 3H6KA 3ZYZA 4JC0A 4C9BA 3UVEA 1N1EA 3NC1C 3V3TA 4OB6A 2Q5FA 4ZVOA 3DBRB 5JDIA 1TCAA 2P9CA 3FMVA 3S1LA 3PBKA 1P1JA 1ID8A 3WQQA 1PLKA 4EY6A 2W7TA 5E6SA 1YBFA 2OAP1 3Q6MA 3SC6A 2EL7A 4CM4A 4L73A 3ZWMA 4QLBA 5AVQA 2AZTA 1MDFA 2H2DA 1B42A 2V4MA 2ZATA 3FIJA 1PZGA 3JVIA 3JX9A 3LUGA 4HR7A 4KHPB 4XQ9A 4UHJA 3RD5A 4HF7A 4CMBA 3ESDA 3K9NA 4AY6A 3KPJA 1PVDA 2OWEA 3FOAA 4QHTA 5D86A 3LAWA 2D3WA 4GS5A 2D3TA 1I4WA 4KAJA 3GPDG 4A73A 1OXBB 4FKZA 4WXRA 1YQGA 3JW8A 1UPFA 1H2AS 2WJ4A 2ZJZA 1GZ4A 3AEUB 4ND6A 4BQPA 4H08A 3VO1A 4F6RA 2AOWA 3KTFA 4EUHA 1T0BA 3AVVA 1VG8A 2H4YA 3PGA1 3Q9NA 4R68A 5AK6A 2FSGA 1EG7A 3DJFA 3T1NA 5AIBA 4ND7A 2Q9UA 1SBYA 4OQLA 1G98A 3CEHA 2IYZA 2F4VB 2NZ8A 4YAJA 1J97A 4JJ6A 2C4HA 3K2EA 4WEOA 3VR6H 4AMUA 3PWTA 4MV3A 3FZGA 4G37A 3ICQB 5IT4A 4DV2B 3ESRA 5HKOA 2PXCA 1O1YA 4H7JA 4ZZIA 1ATIA 2D2XA 4JVMA 5GJCA 3MJVA 2P9BA 3GGPA 5BSEA 3FROA 1NBIA 3KT3A 3JD4A 4XCQA 5T6BA 3UK2A 1BXGA 4A0RA 3PDWA 4OLBA 5C1PA 1LK0A 5AD1A 2ZI9A 1KJ9A 2QLLA 4W8HA 1TJPB 5FBKA 2B1JA 3AXTA 3QBVA 4S3MA 3W2FA 2XCUA 3CSUA 1ZW1A 3DWGA 1CRLA 5FTWA 1EVEA 1RWNA 2OCBA 3IVMA 4L8WB 4BNUA 1RQXA 1ZOIA 2BY4A 3QFTA 5FXMA 5ARBA 2YKGA 4KXVA 5K99A 1CIPA 2XYGA 3R6TA 1JAIA 4KK3A 4N5HX 1T5IA 4O1HA 4O2LA 4C7MA 4X1KB 4P3KA 2CFRA 3DAGA 3LLUA 2W22A 3MYRA 2GZSA 3D1LA 3Q85A 1BFDA 2ZSIA 4HH0A 5CVDA 5DX0A 2PRJA 1U0FA 2JFZA 2X22A 1Z83A 3HKCB 1MLDA 1OFUX 1XV5A 1WW8A 2SKEA 3SEFA 3BE4A 1RVDA 2YMQA 3SKYA 4AS3A 2ZWVA 2Y0EA 4J9UE 2BKXA 1DRKA 3P5BA 4HDCA 1NQTA 3MMSA 3EPKA 2EWVA 1NMZA 2P69A 4CF3A 4QJ3A 1WCIA 1A77A 3MCWA 3I37X 2C04A 2XKBA 1FTGA 1GQSA 4IOMA 4KQWA 5F1OA 1M2OB 1TZCA 1X7GA 5AUOB 1EP1B 1XDDA 2XIQA 1HMYA 2R6DA 3TI7A 2RK4A 2WHEA 2WYHA 4M1EA 5AW5A 4CG2A 3R5SA 2VHZA 1QZXA 2ZBPA 3QXGA 4P5PA 2C4WA 1IMOA 2NZUG 2ZB4A 4PCLA 4QYSA 4W63A 4DB2A 4LYDA 2BM8A 2X5JO 5LSAA 4Q34A 4XWKA 3FTDA 1WVIA 4Q48A 4S24A 5JWHA 4E11A 1YZNA 1BVUA 2DUUA 4G5SA 3RUAA 5KC9A 5EUCA 6ADHA 3TUJC 5K3EA 4BN0A 2D5BA 1QG4A 5IJAA 4ZC8A 4RQAA 2C2ZA 2AI2A 1L7VC 1LBIA 2NWQA 3E4DA 3E7XA 4YRBA 2TYSB 1RKXA 1PJAA 1ZFNA 2HREA 1T8PA 1MRZA 4B71A 3OHMA 1UZAA 2BFBB 2FWAA 3FMGA 2R6JA 3ZE2B 3L4BC 3AZPA 1NVAA 2WM9B 4DPMA 1HG1A 2C2WA 4AM8A 1YL6A 2VDUE 3LV8A 3ZV7A 3F71A 3TQQA 1ADYA 3BICA 4EI9A 4NFYA 3VOTA 3R5FA 2Z3WA 5A6VA 2QX8A 2C2YA 2C77A 3OOEA 1LQUA 2VYNA 2XA2A 2DQYA 2ZYDA 3BIWA 1DIGA 5LQSA 5U9CA 4UEOA 1XMSA 3DWIA 4P0QB 3PC2A 4AZWA 2R86A 1TNDA 3RW9A 3ZHUA 4DHWA 4HRYA 4ALJA 2GASA 2NUTB 1T9DA 3MBIA 2FEOA 4U2KA 3RU9A 1U90A 3T3GA 1R3UA 2VRCD 4PY2A 4U2FA 1H5QA 3DO5A 3MIZA 2WMOB 3FTCA 1R50A 1J7JA 4BDTA 3L82B 4YONB 2GB4A 3TIIA 2XWBF 1EESA 3NTUA 1D0SA 3K9GA 3GLSA 1RLOA 3DKKA 1UOEA 4YALA 1M2KA 1OIXA 1AM4D 5HFNA 4FLFA 4ID9A 2C8JA 1VM6A 3C8DA 4U3JA 1Z73A 5HKAA 1V2GA 1X77A 5AYVA 1FNNA 1H9AA 3GX1A 5BW6B 3SYLA 3AY0A 1OSNA 1UODA 4YDQA 4UZEA 3MWJA 1JEQA 1LSSA 4N0PA 4UJ3A 2J09A 1FP1D 4QPZA 2WD7A 1Y3DE 1FA9A 1E6CA 1FL9A 1O58A 3A1DA 3IE2A 4RSHA 5ALVA 3ONNA 1ST3A 1J1ZA 3MJRA 1TT5B 3RU2A 2Y1CA 5PGMA 1H93A 1M5UA 4WXPA 3AR9A 1J70A 3INYA 3ROZA 4TKZA 5K8TA 2XGJA 5AT1A 2C98A 2I3ZA 3CVUA 1T4BA 2B7BA 1H8HD 4DQVA 4E3WA 4X0EA 3MT8A 5ECYA 5LP6B 2NU9A 1FLAA 2F9FA 4NDNE 3RKUA 1HEIA 4NIMA 3H7AA 1CDOA 4GI5A 3UT5B 1UMCB 4ZQGA 3I09A 1ZHOA 2EX1A 4MWDA 1AUVA 5CB4F 2H48A 3GVHA 2CVZA 3EMVA 4JIGA 4U9IS 4EBFA 5G4LA 3H9QA 2W93A 5DCYA 4PONA 1PWZA 3BG5A 3G8BA 3V9PA 5LXTB 5IAJA 3W2TA 1EMDA 5LUAA 3NKFA 4OXQA 1SD1A 1C9MA 1BJRE 3C1AA 2H9IA 3P2KA 1AE1A 2OLKA 4HAYA 1CD5A 2ZGVA 3CKKA 4QU8A 3ZQ4A 1IZ9A 4AP6A 4GBGA 5ICGA 4DUGA 5HG0A 1VDZA 4L27A 4URVR 3AETB 3FCCA 5B37A 1C0IA 5HJ2A 5LLTA 2X8JB 5KVQA 4LVUA 3EUFA 3K94A 3L4BA 2LW7A 2ORYA 1IFXA 2Q4OA 4E4TA 4PQRA 2NACA 1A3CA 4H7FA 3NIDB 2C5HA 3IKJA 3PITA 4L4RA 5HQ3B 1RDFA 1D2AA 1N32B 2QT1A 3SPXA 1C7IA 2DUWA 2IYVA 1NUQA 4ND8B 3N7AA 3W4KA 1Y8RA 2FH5B 4BX2A 1Q0TA 2HWKA 3N2EA 2HV9A 4N54A 5K3OA 3M6UA 3NAQA 1X1BA 3WISA 2JZCA 1MHPA 1II8B 1VKHA 4PHGA 5JWOA 2FP4A 1CLEA 3PA8A 1TU0A 3PNOA 3QA9A 4TQAA 3RO7A 3H5IA 3WWCA 5HRAA 3OPVA 3HG7A 3E9EA 3JASA 4MVJD 3EZLA 3TM4A 1DJOA 2D5CA 2DY1A 2C2KA 1YQQA 3QZUA 2PTHA 1I4TD 4PG5A 4WA7A 3UFXB 1NMSA 3BRSA 4C7OA 3L5OA 1G3RA 1T2EA 3LJKA 4CLEA 4Z3KA 3M6FA 1COWA 4M0EA 2I9KA 5ICSA 2HD4A 1YE3A 2ZZNA 3ZEAA 1CG6A 4KQIA 3DE7X 4ZREA 4ZT3A 1M0WA 3L41A 2NO7A 2C78A 2UXDB 3SR0A 2ASEA 3GH3A 4IL5A 3OZTA 5AI5A 1JN0A 2FJPA 3O1IC 3VYWA 4C0KA 2PMKA 4GR5A 1RI2A 4H6XA 1TZ2A 1FP6A 2DBRA 3V5NA 1XTPA 2FEMA 1LC0A 2OM6A 4QOSA 2ZRMA 3L4KA 4RXMA 3VPCA 1GT6A 1ZD5A 3G49A 3IESA 1J0CA 1LEHA 3NOOA 2GUGA 3DFKA 1OOEA 3ANNA 5C1OA 4UNSA 1HLFA 5FFFA 4KOEC 5DP1A 3AEZA 1PFVA 2NT3A 1LNQA 5AI8A 3DP7A 2PVSA 3RC8A 1G41A 5BN3A 1K8RA 3GLQA 4MK4A 4XOIA 4M46A 3RAFC 3CNBA 1TZKA 4J2OA 4KMOA 4QGHA 2XVXA 3MQFA 1JXQA 3KEGA 1H0SA 2Z5FA 4LC9A 1PQYA 2FPPB 4NCIA 1BEEA 3QVMA 5FOXA 2EFDB 2IYLD 3U5TA 2IOFA 2WPDD 1TADA 1O95D 3ZV6A 3LPDA 3AERB 1GQRA 2R6FA 3EC2A 2GF2A 3JYOA 4MW0A 5CK5A 2FWMX 4BNTA 5AUNB 1N8SA 2G7MC 1MAHA 2J5KA 2ZQYA 1VJRA 1X7DA 2FR1A 4P4NA 1Z12A 1LTKA 3LVRE 2BFEA 3N05A 4DUZB 3N70A 2F1JA 1NFQA 3H3JA 3MJCA 3LZCA 3UHFA 1PR5A 3VKVA 2W6PA 1OE0A 2WWFA 2J0QA 3B38A 1A4UA 3DT8A 1OIVA 1T6BY 2Q3JA 3JQAA 5IJ9B 2J67A 1NW8A 5GQSA 4Z7OB 4KPEC 1SU7A 1DAPA 3O3MB 4C78A 3L84A 1U80A 1S0UA 5KNCH 1U7PA 3E1KA 5BT9A 4KVGA 3IV6A 4OH1A 2OQVA 3WE7A 4EHIA 4PSDA 2XT0A 3BFJA 3OLYA 1HO3A 3V55A 3TE6A 3IDQA 1TD1A 2QLJA 4KN5A 5H70A 1IEQA 4IO0A 1G6KA 1XZMA 4BMDA 3ZZ1A 1ZGCA 2IP1A 3L05A 4OF4A 1JHUA 3U17A 4U2CA 4DB4A 3TXYA 5FTLA 4JI4B 1O6CA 4KPFC 1CQZA 2VJDA 1UFOA 1I7NA 3IP7A 4GZ6A 3QTTA 1QRSA 5GJBA 4I66A 4Y30A 4C76A 1B6GA 4M0KA 3TSOA 4CMIA 2AHOA 2GUWA 1U6KA 4B8WA 3N8KA 2BZ0A 4DJTA 1HWYA 2QQFA 4D1YA 4UATA 5ANRB 1GNRA 1RM4A 2I62A 4C4ZA 1DOHA 4KQGA 1L5KA 1FMFA 3M2TA 4FJ1A 4NCKA 3C4JA 4FYJA 1XN4A 1TFUA 1LS6A 3JWGA 1M1YE 1FEZA 3JQGB 2BLLA 1O94C 3HBFA 3IQZA 4IO1A 4X1OA 4TKLA 2V7BA 1LZLA 4JROA 8AT1A 1L5LA 4JXZA 2A0WA 3V1TC 1JPUA 5AK3A 1RQ2A 4F1JA 4MGKR 4ZHQF 1Z6GA 2CDNA 3EGCA 2WMNB 2ISQA 3ICCA 4A8HA 3U19A 5IJ0A 4IZOA 4KV9A 4Y2GA 4TS9A 2PNJA 3EH2A 2VPXA 4OFXA 4OHZA 1X14A 3TYXA 1JAXA 2HRRA 3A3KA 4QU0A 2XVMA 2GVDC 3GRAA 4Q9KA 4P0TA 2IX3A 6REQA 1VP9A 1BXGB 2B37A 2OCIA 2PV7A 4QUIA 4RGQA 4D6PA 1YDWA 2NOAA 4ZK6A 2PLNA 4G4GA 1B6TA 1G59A 1EP3B 2QAIA 3DE5X 2BH9A 3I1FA 4IDGA 2V58A 5SY4A 2HK9A 2VOJA 1TMYA 4GQIA 3JZDA 4BBJA 1M1XB 3HR4A 1P4JA 3IPLA 4INJA 3NXSA 5HF8A 5F2OA 1H2RS 1EUZA 3BMXA 5H59A 4CF5A 3C3KA 3KD3A 1D7OA 2WU8A 5I4IA 2QVLA 2X40A 4F3CA 5CFPA 3RUHA 3IBCA 2ZE7A 1D04A 2C94A 4MV7A 4ZYTA 5LOVF 4DR5B 3IP3A 4O2BB 3OQPA 1MTOA 4HPWA 1IY1A 3QY0A 3EW7A 4EX6A 5ESDA 1J2JA 3R8XA 5NLLA 3AHEA 4C14A 1FJ2A 1RXYA 2VWGA 4FZJA 3KJXA 3BXPA 4ENSA 2WJVA 1WSBA 3LBYA 2V97A 3DCNA 4HBGA 4L0MA 3MYYA 4ZRNA 3RRXA 3CPSA 3MUEA 5HILA 2RGYA 4AJ9A 4MO9A 1R0XA 2W6ID 5JI3E 2XOEA 4NBVA 1NQ5A 3KXIA 1YC5A 1NRXA 2QVCA 3VR6A 3WQBA 2E87A 4EY8A 1IHOA 1QHNA 5KMGA 1PJCA 2EV9A 4OLHA 1I3NA 3U4GA 1TO2E 1W36D 1T10A 3P7MA 1A71A 3UTCA 3COJA 4PM4A 4P84A 3E9RA 3WLTA 2SHKA 4ABTA 2O8CB 2C92A 3JQRA 2AJDA 1C4OA 5T4BA 3T7RA 2ZSAA 3S29A 3WKAA 4CUZA 1UOQA 1O94A 3KB8A 3O2NA 2GBLC 3SXUB 4EVIA 5EZYF 3HN2A 4RTPA 2EGHA 6PFKA 2O5EA 3OOYA 1SZJG 3CYFA 5EIHA 4ZI2A 3NOVA 2ZUWA 1QIEA 1KQNA 5KTTA 2FSSA 2F1HA 5EKDA 3RVBA 3M9LA 5GONA 1U1GA 1H23A 4TT8A 2UZAA 3ZHOA 4FSDA 2DPLA 3QPCA 3L1HA 3R9XA 1NA5A 3LSTA 4HB3A 2V65A 3FZYA 5GJVC 2ZT5A 3K0FA 5GZ6A 1ZITA 5B57C 1BKDR 1QOZA 2W6JD 1CUHA 2J59A 4ZO7A 4K1XA 4AX8A 1UEXC 4F97A 1IY0A 1MAUA 3I01A 3WWZA 3CF0A 1FFGA 1ZHFA 5B6JA 1BOOA 1LB1B 4PC7A 3WYDA 1T0JB 4QTYA 1CZKA 3ZHVA 3LH5A 2QXYA 5FLYA 1LDNA 4FVTA 4X65B 1KZGB 1KOJA 4F84A 3HY4A 1GRNA 1I4OA 3UC5A 4BVHA 4IIVA 1LZKA 2RHDA 2YZNA 1O97C 2JZNA 4J90A 4X8OA 3BFPA 2ZYAA 3H9JA 4CM9D 4XVCA 1GDDA 1GNPA 2D59A 1YGYA 2YVKA 2AEEA 1PZNA 1IHPA 3MHPA 4K6OA 1OCEA 5TQ2B 3WB9A 3G79A 1PO7A 3ANTA 1PHPA 1ZVKA 1X7YA 3C6ZA 1D0IA 3QPUA 1O5TA 2WD7B 1RFLA 3PQ5A 3O4GA 3OD1A 3ZE6A 2QSUA 1UOOA 2MYTA 4F9FA 4BGEA 1GL9B 4KR3A 1HTBA 2X13A 4CDGA 2BEUA 4D7AA 4W1PA 4JYZA 2NAPA 2DUNA 5TE9A 4CKYA 3KAKA 1X8LA 1A2KC 3CNOA 4X7RA 4YJFB 3TRJA 1IB6A 1WXEA 1JIIA 3C1OA 4J29A 5FNVF 1VL8A 2BFFA 1GPMA 1LPMA 3VAYA 1EDOA 3TLKA 2XDWA 4QELA 4YCSA 4ZJYA 3KWJA 1LF0A 4FD3A 4ZVQA 1JHAA 5AKJA 4A2WA 3FPAA 3GARA 3WYCA 1DIBA 4K2AA 5EQFA 3RGWS 2HU8A 4UC0A 3B5JA 3T5MA 4YAUA 2C82A 2VDLB 4MQFA 2M1ZA 2PK3A 4QFBA 4BKOA 2P9TA 3IIIA 4QPDA 1FLDA 2HO4A 2C3MA 4WLNA 3M6AA 4BVFA 3MGKA 3OLQA 4L51A 5FCDA 1K89A 3TNFA 3KLBA 1CJTC 3GQVA 4NAHA 2R60A 5F2NA 4PGFA 4TUYB 4DADA 3KQQA 3NOXA 1F7VA 4WOBA 3B5EA 2GCOB 4NZPA 3QMMA 2R751 3OHPA 5LZ2A 4E21A 2G1PA 4M1QA 1YCDA 5TPZA 1JH9A 1V3UA 1X38A 1PDWA 4IKEA 4OQDA 2P6UA 1L4UA 2YN4A 3PIIA 3IAAA 3DKVA 4LHVA 4CKZA 2A9PA 3NHPA 4E94A 3U09A 1G16A 3HJGA 4EFNA 5IH7A 1BNCA 2C88A 2Z8ZA 1JQKA 2WWIA 3JATB 3VU0A 1E9BA 4JVLA 1OZAA 4L50A 3AVPA 2V74B 3ZDQA 1W4RA 2GBPA 2I1LA 2XSZA 2YFYA 4I1IA 5JQWA 2BEJA 2G76A 4OB8A 1LI7A 3TNYA 1PJSA 1EX9A 1YJXA 3D8TA 2AK3A 3HGQA 4AVYA 2EJBA 1P1IA 4O4IF 2XKJE 3KXDA 4GT1A 1UDBA 5FNZA 1Q1NA 3HL0A 1FNMA 3CLUC 4KUEA 2FP4B 8ATCA 1J5XA 2F1IA 1Y33E 2ZS8A 2DKNA 3IUJA 4RMIA 3EZNA 4KWTA 4IJQA 1GV1A 2L42A 1YVEI 3ZCRA 4B73A 4QJBA 4DVJA 5I3CA 2X3YA 1VL1A 4PTZA 4LISA 2CHGA 1PSDA 3PJEA 1VDMA 4QASA 3ZNNA 3PQ4A 4MI3A 5JS6A 1KQGA 4J7UA 1TCCA 2ZYRA 5J2UA 3IUPA 4CQLA 5KYYB 1OPXA 2J3EA 3BDAA 4AY3A 4IHAA 4BV8A 3JALB 1MVNA 5HUQA 1UWCA 2J46A 5C4GB 3W7VA 5HJ7A 5KYGA 2QM0A 2D0IA 4UVEA 3IQEA 2H1VA 4TTRA 4XJXA 1XO1A 2VP4A 3WMXA 1Q95A 2FW1A 4H4DA 4HJXA 1ZOLA 1OIWA 3JY6A 4JLWA 4MZXA 3F67A 3R7DA 1NXVA 4OATA 3PFBA 4IQFA 3KU4A 2AN9A 4J43A 2MSWA 1BQ4A 1JU9A 5FHRA 1Q7EA 1JMVA 4Z9AA 1SM4A 2NP6A 2WABA 4P7BA 1E4EA 2QMOA 4BFYA 4PZPA 2WAXA 1SZDA 1WUTA 4MPTA 4QD3A 1LDGA 3N28A 1Y8QB 5GADl 3L6DA 3SEQA 3IH5A 1U8ZA 2ISSD 3IUBA 4WBNF 5BN3B 4ETIA 1GZDA 5IWCA 1RWQA 2B98A 2PKWA 2LR0A 2R1TA 1PRYA 3DMDA 3HA2A 3JVEA 4WCDA 1M2HA 3V6MA 2YZ2A 4PX2A 1KR5A 1V8BA 2M6RA 4FN5A 1J0EA 1GGFA 1OZ0A 1IPEA 1QR6A 1OHHA 3LCVB 2ATXA 3KX2A 5DFAA 5K4HA 3MT9A 1Q3KA 1VI2A 3AILA 4XIJA 5K0LA 1SOVA 4RNDB 3SJBA 2DHDA 4AO7A 4AKSA 13PKA 2BFEB 2FPUA 3D6AA 2X42A 3ZZ0A 4TMFA 3MZ0A 5BN1A 5TB5A 4GMHA 4QM6A 3A9VA 4QSHA 2WKWA 3BMNA 2AD5A 3DZJA 3OUUA 1BCSB 2OZPA 1UP6A 4HMQA 1U7OA 4UE3S 2WTMA 4AURA 1P4GA 3PEUA 4GL4A 3CCFA 4JSRA 2RJOA 4C6TA 2JRLA 3U60B 4LFAB 1YE5A 2JVIA 4QJ5A 1CY8A 4RH1A 3WMRA 2ZR0A 1WSWA 2O7RA 3QYJA 2TS1A 2SKCA 3RSHA 1U2DC 1H0KA 1E1RD 2BDEA 3BRCA 3NUQA 1Q2XA 5C5CA 1GGKA 5J59A 3JS5A 3OFJA 3GGCA 1ZNYA 2P90A 4ZPJA 4E5MA 2AKEA 4KQ1A 1JA1A 4WFKA 1YHZA 3OCYA 1S9DA 1GPDG 4EF5A 1IEXA 3MGGA 1NDQA 3HA5A 2ZSFA 2EKLA 4OBBA 5EC8A 4YQFA 2QD5A 2RI0A 3X2EA 3OFND 3SC2A 3QKRA 2XCTB 5KUTA 3O31A 3W5HA 5KTNA 3BM5A 3R7NA 3IQHX 2NXNA 3GZTB 5LP1A 2PGNA 1QK4A 3AWIA 1W4LA 4ARIA 1TAHA 4X41A 3FLMA 2PUDA 1VL2A 2H5IA 3GVCA 4UEKA 4W1QA 2HL6A 2VWQA 3NAMA 3ZCTA 1UJ4A 2QL9A 4N9QA 4YRLA 4B43A 1DJNA 3Q9SA 3I04A 4N3AA 2BYTA 1D9ZA 1Q6ZA 1RMTA 1M6VA 3C0KA 3QXCA 4C3VA 4TTTS 2HLDD 2EWMA 5EZQA 3HYRA 4MYTA 1FRZA 2IODA 1S8OA 2FX3A 1WQ3A 2QN3A 2V6JA 2VYFA 3DAOA 5DRYA 5DU2A 1AMUA 3V42A 3T99A 4MROA 4OU4A 3JQ8A 1Q1ZA 1NXQA 2RGDA 1GU7A 1Z8FA 1M2JA 2FUG6 2P6PA 3W4JA 1JKJA 1JFFA 3AK4A 2XEDA 2ZJ5A 3EEYA 5TQ0A 4PICA 3TOXA 4QUKA 3M6IA 2YZMA 1E7SA 1RC1A 2V6MA 2WM8A 3Q5EA 6REQB 5CBPB 4R0NA 3BHIA 3GLHE 4GX5A 4GAEA 4PYQA 1BFKA 3KHTA 1I7PA 1JDVA 1SXJD 1W0CA 2QSJA 3QI7A 2GYUA 1YBMA 4J6FA 4P54A 5KNCA 4RL4A 3F3SA 4MO2A 3RUEA 2H11A 5DN9A 5A5VA 4MKZA 3WLNA 2G71A 1VFNA 3G8YA 4FR5A 4LSZA 1RZRD 3CX3A 2J32A 5C31A 2C0PA 1HT3A 1N5MA 2G9UA 3PUJA 4YMLA 3GLIE 4G0VA 3TDKA 2R8BA 3WWEA 4DCSA 3UWOA 1D2EA 1NJ8A 4KXLA 2C9BA 4RA6A 1BD4A 1YZHA 4MW9A 2Q50A 4UMDA 1B23P 5KU1A 4O5AA 3TL6A 1BH6A 1KIMA 1WPXA 1ZA2A 2VVTA 4ZCSA 2V7WA 2CNWD 2XMRA 3NALA 3WWYA 5LIRA 2I7XA 5IAOA 4GM0A 5GM1A 1Z36A 1L1FA 4PAOA 4AJKA 3HCNA 4F5DA 1HMPA 1W5FA 1FZQA 2DF8A 4AU1A 2CNNA 1U2DA 4G65A 2JBAB 1TLLA 2D1RA 4IZHA 3WNCA 1FSGA 3S5JA 3FCAA 5A4MS 2Y1WA 3DE2X 4MKRA 1OLXB 2NQ8A 2TECE 4G8BA 2QE6A 2JGAA 2FHPA 1WZ2A 4YJ3F 5KVAA 2Q3CA 2QLTA 1I9GA 1HFKA 1SCAA 2Q28A 4KXWA 4QXOA 4BNLA 3F1LA 2AFHE 3KVNA 1BHQ1 2XHEA 4EOGA 3HKEB 1WMDA 1ABEA 2VUHB 5EIBC 2ONCA 1HQKA 2QQGA 5IBCA 1P9WA 3QITA 3W9SA 1ZGJA 4KN6A 3PEYA 4FB5A 3KQLA 5TGDA 1QAQA 3LM8A 2IV3A 3S81A 1UC9A 1UWLA 4RWEA 1RW4A 1V2HE 2DQKA 4FONA 5K05A 3K8OE 3CW8X 3B6JA 4OHBA 1I30A 1LDBA 1XJQA 3DBOB 1KQFA 1IN1A 1XUOA 3L77A 4LF6B 3RG2A 4U00A 4Q1EA 1J8DA 4WBXC 1TVEA 4IQ8A 4YYEA 3IQWA 4N3CA 3QU9A 3H1FA 1J5PA 2C97A 3TKYA 3L7NA 5LQNA 1ZM9A 3DG9A 4NI5A 1R2QA 2EQAA 3LBFA 3ESCA 2QLNA 3I72A 4FHFA 3R9XB 2J0SA 1T9GR 3Q8WA 4LJ6A 5HOQA 3K0FB 3RT1A 1GA6A 5CITA 2JGFA 2VP6A 5JMOA 3NATA 1SUPA 2KS6A 3TAUA 1ZRSA 2ERCA 3ZD6A 3FPGA 3PT9A 1DTWA 4KREA 4CMCA 1R8SA 1KK0A 3AP1A 3LHDA 4MDEA 1OXTA 5F98A 3EXEA 1ECLA 2FN7A 2KBEA 4QBFA 3BS4A 4PBRA 4GYWA 2PL1A 1X1TA 4HPJB 1EQ2A 2JGJA 3QX9A 1K8YB 2ZJ4A 1H94A 2QR3A 3ASYA 4I9HA 1AHIA 2AJLI 2DBZA 5ALQA 5BR1A 5J40A 1GTVA 2I6SA 4EENA 2B5WA 4L5IA 3DPIA 5JHGB 2CXUA 4IHJF 4QTUB 4ZMSA 2C31A 1ZESA 1DOZA 4D57A 2DLCX 3IGFA 2WVHA 3U31A 1WOMA 2NNLD 1W47A 2FX5A 2GJSA 3BH6A 3FNQA 3NDPA 4NENA 1Z2PX 2AK2A 4QUHA 5FOTA 2GHTA 3KZNA 3GLUA 3UAWA 2ANBA 2F1OA 1JSLA 1K75A 3USES 3BTOA 4DEVA 1YH3A 3SBOA 5ITVA 4R8VA 3KZCA 3SR4A 2JDID 1CU1A 3VSBA 4YS6A 4QU9A 1XRLA 1KYIA 4ZAXA 1DC7A 3I5XA 1GT91 1RWMA 4FDVA 5IANA 5C8XA 3TLJA 3ADKA 1M1YB 2VHWA 3HCPA 1H8ED 1V96A 2HAEA 4X6YA 4DMUB 3FOBA 3DHVA 2JJMA 1CRQA 3FNRA 4PN7A 2BFFB 1UK7A 3IQDB 1Y34E 3O8RA 4N1AA 1CIVA 1JYFA 2J07A 2BH2A 5IC4A 4LPSA 4CYMA 3LQ1A 1YZVA 4KIWA 3EOZA 5JJCA 2X4IA 2XB9A 3ZJUA 1Q0UA 2G07A 3VZSA 3MTDA 2W5UA 4GKAA 3PFKA 3BSSA 5F7ZA 4YIKA 4RIIA 5IHXA 1L9KA 3WWPA 1J07A 2NUPB 2YOFA 1DKLA 4YT4A 4G86A 4R31A 1AHHA 2ZJ8A 5HQJA 3WSWA 1ZVMA 4J2HA 4KFTA 1BMFD 1E2HA 1JEAA 2C4TA 5KX5A 1Z2AA 3RAJA 3PHGA 3RC7A 2QORA 5JRDS 1PFGA 3QE4A 1EFRD 2IHBA 3KOZA 3PDIA 1NI4A 1RCFA 4RVOA 3Q88A 3RABA 1CY4A 2IS4A 3H05A 2JPDA 3ONWA 4FDLA 1WTCA 4P4LA 4AUNA 1ZNXA 1KTIA 2WU1A 5G02A 4ER6A 2P6OA 2XNJA 4B47A 2WB2A 2HCBA 5TSDA 3LK7A 1KI8A 3EFEA 1SG6A 3GJ8A 4O4JA 4ETNA 2OBLA 2WPNA 3UMGA 1PWXA 3GZJA 3EPLA 2E5FA 3AR5A 1ZUHA 1E3DA 3ID6C 3KT8A 3T94A 4TZTA 4RANA 3TNDA 4OXIA 1RXWA 4RVSA 1RRGA 4INAA 5CGQB 1XDWA 4POOA 3VNSA 2QNRA 4MIOA 4AQYB 2GYWA 4HN2A 2IOYA 1IZZA 1MP0A 2FQQA 2VJAA 2WTNA 3GH1A 4GH5A 2GSDA 5ALKA 5G53C 3RYHB 1YJAA 5C7YA 2I2AA 5FUBA 3SFTA 1DEXA 3QXHA 3T7DA 5KTRA 4FM9A 2VBGA 1Q22A 4BAUA 4CQLB 1U6IA 5DOVA 4IDQA 4NMXB 1L1EA 1C4WA 2EX0A 3OIDA 3MN1A 3LDGA 1P2FA 3KB2A 3I61A 4XH9B 1RHJA 1OWMA 4RE6A 4CEIB 2YJ5A 4HY3A 2FEWB 5COAA 2HA3A 2E1PA 3QNMA 2UZ4A 1C7EA 2Q0QA 3KSZO 2RGRA 1F3LA 1J0AA 3S99A 4ZQCB 2AFHA 1C9JA 1FF9A 2ZRBA 1OLOA 4C87A 2ZCUA 1N0VC 1GG2A 2FPIB 2JRCA 2X0KA 5DNEA 5A06A 5K9ZA 3OIFA 3P2OA 2B4AA 4KL8S 1X70A 4ICIA 4QPJC 2X6RA 5BWMA 3ESZA 3OIVA 4J0GA 5AKYA 4BVLA 2VHVA 2JI7A 1BKSB 4AICA 4E6PA 2OXCA 2F17A 1VB5A 3ROMA 2X15A 3LA6A 4A0QA 2RGUA 3CFYA 1JIXA 2CCKA 3G6WA 1Y4UA 3MF4A 4WRRA 5EIFA 4OKSA 3RUDA 3HFJA 4JSTA 2XUZA 4AZTA 4BQSA 1DB3A 5EMNA 4E1VA 4DUYB 3EWAA 5F3DA 1GADO 3RBAA 1JALA 2GZRA 2WIFA 3UJAA 4BX0A 2JIOA 5SV2A 4EYEA 1SHKA 1K63A 1TYCA 4EF6A 3BFVA 1RJGA 1AGPA 3BSYA 3V4OA 5LWHA 1EGVB 3PLRA 3TW4A 2OOSA 2R5WA 1FNBA 1GWNA 1O3YA 3HDGA 4LBZA 4MYRA 4QPPA 2P9QA 1RLJA 1T35A 2IYRA 3QEOA 4DAOA 4RKYA 4DLWA 1XNQB 3ZY3A 1PS8A 2XH8A 2PE5A 4C6TB 1YUNA 4OH7A 4DLUA 1JHQA 5EE9A 4ZQFA 2W6MA 3PK0A 2JF0A 5IK2A 3E3AA 3SE7A 3DPUA 3KKNA 1U0HC 4CCAA 4NCJA 3E3LA 5E2BA 1AUXA 3SHVA 3LT1A 5L9AA 1KPGA 2J30A 5FA5A 2RARA 3I5YA 2RGGA 5AJWA 4P35A 3TJRA 3F0TA 5HZHA 1AK9A 1IAVA 1Y98A 3PIDA 2H92A 2RG7A 3ZVLA 4AJHA 1TIKA 3TQFA 3OZAA 3OEEA 1MD9A 2IU6A 2FN3A 1C3EA 3N07A 1NYRA 2ZYHA 2ATIA 5AKGA 4I6JA 4JR2A 3TAHA 4AAYA 2X4GA 3PJFA 2BP7A 4P82A 1WDKA 2FFBA 4OKNA 4DR2B 3IPRA 1R4NA 1YVRA 4FBMA 4LRYA 4QQRA 4RTMA 1Q15A 1D1PA 4NDAA 1C0PA 4OX9Y 2O2CA 2NZWA 3EIEA 4M38A 1EJBA 5DM70 1U2QA 4JOBA 2IYWA 1M6VB 3VGJA 2QXUA 3IX7A 4QOFA 2Y71A 2ZFUA 3SZGA 1A9QA 1EFAA 2ILVA 1QZTA 3EQ6A 4AJ1A 4NBTA 4AMYA 3VR3A 5JS1A 5B3KA 2DJIA 4PZCA 1TUIA 3B8HA 4MR7A 4I4TF 4MA5A 2EXXA 1H5UA 4B31A 4YHHB 4CLOA 1XTIA 2FEPA 1FMTA 3QWFA 1G63A 2O7NA 3KQTA 3MWDB 4O8ZA 3GRRA 3O4RA 4DRYA 3IT2A 1N6KA 4UU8A 4ZK2A 3O74A 4NXMB 1OQAA 4OHUA 3NQ41 1CJUC 3DTNA 4JBHA 2A1IA 5KPJA 4R9SA 1TVMA 4GRAA 3S2FA 4HWKA 3DVQX 4M49A 3V4VB 3GDHA 5CH5A 4EM6A 3R3VA 2FPLA 3DTYA 4J1NA 5CD9A 5KO2A 4MS3B 1I2DA 3UOWA 3P5SA 5CM2Z 3VC3A 4BASA 4C5CA 5LYJF 2PWPA 1E79A 2BBTA 3EYWA 1FFSA 3UMBA 1QHSA 4L5BA 4MQEA 2WFMA 2D8MA 4RSRA 2HWUA 3T5AA 2OECA 1B6SA 5AO9A 4MLCA 2JLVA 3NM4A 4ZCIA 3J81k 3B7PA 1WX1A 1PFQA 3GBVA 4HBZA 2HJWA 4MYDA 2WG2A 4MI9A 4E6EA 2IWRA 3W06A 3VPGA 4Q4CA 1YVPA 1T1EA 5KU7A 1O6GA 3CVYA 3VDNB 1Y7PA 1WQ1R 2YOGA 1HORA 3M7IA 1GNVA 2DR0A 3S1AA 1U02A 4K5QA 1T4GA 1Z5NA 1D0VA 1VHDA 1Y81A 4YPFA 5SY6A 1I5RA 1R12A 1W25A 4LF8B 3SVTA 2QV0A 3B9QA 4QQ8A 1VIYA 2IWHA 2JJ1D 2R66A 3GRKA 3NEJA 3PHJA 1GDHA 4ZQHA 4LE1A 1T34A 2NUBA 2P2GA 2QN9A 3UHPA 1FIUA 4DV1B 1N2BA 1LSUA 1UJBA 2OM2A 3HZZA 2VSXA 3HR7A 1P2TA 4QFMA 4UEQA 3RVDA 2C1XA 1NWCA 2XADA 2ZJ0A 5C0OE 1Q12A 2R8XA 3I05A 3V4SA 2ZDHA 3FB4A 3OU6A 5FOQA 4UUNA 3ZZUA 1T3ZA 3PJDA 3CLSD 3KG2A 4CL3A 5BV1A 4C03A 2F3UA 3EIUA 3QJGA 3S27A 1KMQA 1TXGA 1VMIA 4BFLA 3C14C 4LZWA 3ZJ4A 4CV1A 3P4XA 5C1IA 1KE2A 2R7AA 1WDLA 4FCTA 4RACA 3TB6A 4JA2A 1NTRA 1XIVA 1PYOA 4F4UA 1QGYA 2P5UA 3U61B 1GKUB 4LJ4A 4UUQA 5IBRA 1U5BA 1U7DA 1N8KA 1XXHE 4B48A 2H4HA 2G9VA 3H6GA 2IOFK 3ILVA 2R6HA 3PC3A 4B45A 5B64A 1HQCA 1LFDB 3DEAA 3UB2A 4LJ7A 4OQNA 2KI5A 4UVHA 3ANYB 4WZBA 1N7IA 2BMWA 4DANA 3Q0TA 2YUIA 4HI0E 2O14A 3CLHA 3G2LA 5KYUB 4CEHB 2R5NA 4FYMA 1OH5A 2KBFA 5TMEA 2Q45A 3IHTA 3V8VA 3SSOA 2M6SA 1U2PA 3N39C 2BGNA 3ITEA 2ZITA 3ANMA 2QMEA 4KU4A 3UJNA 3BJZA 3E22B 2HUPA 2RKWA 4GXTA 4XX1A 1I7LA 5AJZA 5B4TA 3MNFA 5ES3A 1A5TA 2FOXA 4QUDA 2GJ9A 5C37A 3DLAA 2GNPA 3UBTA 1N5JA 5M2QA 5JARA 3ND6A 1JG6A 1BWQA 1H22A 1NLFA 1NW4A 3QU2A 3REOA 4KVZA 3NDBB 1Q77A 5FEMA 1K8XB 1L7MA 5EAIA 3RTAA 2FJ0A 2VT6A 3I28A 2XQJA 1BIFA 1CXZA 3ODGA 4KITB 5JNLA 3Q4GA 4OBEA 1S3FA 2Z98A 4EHDA 2ZE8A 1IOWA 1C9KA 1KEUA 4NHOA 4DLVA 1U3DA 3A1SA 3OZWA 2PSSA 3R3HA 2CXPA 3NCHA 4V3BA 1MW8X 1QYDA 3RTBA 1KDPA 3TOCA 1EB8A 1MORA 5JANA 4HSEA 3AR2A 1BXRA 3R3SA 2KPOA 4NMHA 3CZCA 4BB0A 2W6QA 5TQVA 3N2GA 4QUBA 2GKOA 1ULAA 2RSLA 2PD3A 2EP8A 4TWJA 2PH1A 4PNEA 5DI3A 3ZZMA 4LJRA 2V4ZA 3WLQA 4HX9A 5HZMA 2C4MA 3MRVA 4KGZA 4PS0A 1RBYA 4ER3A 4JZKA 4I81A 4YCNA 1R74A 1W52X 4HQNA 4MVYA 2ZBGA 2C3PA 3OQ1A 4MVJM 4XGQA 3IDFA 1GITA 4WNAB 3Q8KA 4C07A 1DZ3A 1ZNWA 3FGPA 1IZ0A 1VLLA 5L3ZA 4K8OA 1S7CA 1ZYUA 4I14A 4GLOA 2V6GA 4RHTA 2BMDA 5CHEA 4YMHA 1X1RA 2G09A 4LGMA 2X1HA 3B36A 4GSYA 5K8CA 1KVSA 3ROQA 5CLFA 2IHNA 3UMMA 3DDOA 3A3NA 3GLHB 2AF3C 2VNAA 3LHFA 4FYHA 4YXWA 1SKAA 2NPFA 4GW3A 4BEWA 1C0EA 3GLKA 4GMDA 4NJEA 5I7RA 1EX7A 5JAHA 1K7SN 5JTTA 1SO8A 3LYLA 1MT3A 1R0YA 1RKBA 4M99A 3BXFA 3ZJYA 4TTJA 5D1HA 2ALJA 2I6GA 1BGXT 1MPXA 2OV8A 4EHAA 4I5GA 3FVVA 4O4JB 3SJ7A 3QWBA 4HFNA 3GLIB 3EDCA 2ZRAA 4JUFA 1RPJA 3B6IA 3AI1A 1ZGAA 4M0DA 3X1MA 1NW7A 4W7HA 3I53A 1A7KA 3IEKA 1ML4A 2GETA 4PG6A 2VT2A 1V39A 2OK8A 2PPLA 2QHXA 4K2HA 4PSAA 2VBFA 1F6DA 1G55A 5DTRA 4BCDA 2QTVA 2ODEA 2DR2A 2BUAA 4BRSA 4GI1A 2CZGA 1V48A 3A2NA 1W0KD 4WVLA 4NJOA 3SNKA 5ALMA 1NW9B 1K6MA 1DIAA 5THQA 2Z2YA 2O4CA 2H4JA 2HJRA 3MK31 3CTPA 1XZIA 5EHGA 4ZDIA 3E0QA 1QFJA 4X1IB 4N03A 3ZIUA 3IO3A 2AFHB 4HKTA 2G80A 3SQOA 1RXSA 4U6NA 2BI7A 2B78A 4JQSA 2EYQA 2I2DA 2PIAA 1M76A 1JZTA 3RU3A 4YRGA 2C4VA 4JP3A 5G4KB 1G5HA 1PD1A 3AIOA 4UW9A 3NFRA 3EHEA 3Q40A 4Q3LA 3WLEA 4BV2A 4M1WA 3HWSA 3DV9A 4D56A 4C2TA 3PJRA 5KKAA 3T54A 1XXHA 3PDUA 3AHGA 1Z16A 3AT1A 3AKCA 4PQGA 3AKYA 4BECA 3AMVA 2QW0X 3NIFB 4NX2A 5IT9A 1KDTA 1YQDA 4RD4A 3F9RA 4N3NA 3F6BX 4MJ7A 4NCBA 3NC0C 3GUHA 3H18A 1ODKA 2QG9A 4TWRA 5A0VA 2P7HA 2GM4A 1UZLA 1JDNA 1K88A 1JJBA 2B82A 3IXQA 4J4TA 5TGZA 3VPDA 1N8NA 5IJWA 2Q3LA 1TQ8A 3UJBA 4R8LA 3D6TB 4TLLB 4XIGS 2NO5A 2PGAA 4DY4A 1RBZA 2KHZA 3OKFA 1QH9A 3VGPA 3RNLA 1LI4A 3DZFA 1IRIA 2REOA 5EINA 3RK4A 3SJCA 3FPKA 3I2YX 1QG0A 5IYZF 4TYNA 1USKA 2P2YA 1ENOA 1D1TA 1M2VA 2ZRJA 4IXDA 3P32A 1CRZA 3U7JA 1QVWA 2RE8A 3G2HA 2WHYA 1TCVA 3K73O 1IIBA 1S9HA 1PR6A 4M6WB 5BYJA 1CRPA 3HLTA 5IDYA 1VHLA 1P4HA 1KKMA 2G4CA 2QTLA 2PT9A 2WM2A 3MTGA 3WDLA 3AVUA 1YFKA 1V1RA 3ABRB 4X6XA 3CJRA 3VNQA 2D5LA 3MPOA 3SKXA 4B6PA 4RJLA 3F7TA 1X2BA 4XARA 3C5WP 4MW1A 4X20A 1U4SA 3RUPA 5JAPA 4BFWA 2BP7B 5CXUA 3CRW1 4I55B 3T0FA 3MOGA 1JVBA 4UU7A 5FL7A 3FAKA 5FYDA 3VX4A 2JIBA 2VQ3A 1IIRA 2I76A 4FT2A 3OEWA 4WLVA 4BMNA 1YDHA 1DCFA 1KFBB 1XD8A 1OLSA 2GHIA 3NAZA 4YRMA 2E6UX 4FMPA 3PD7A 4FGJA 5TT1A 2ZBRA 4L8GA 4NE2A 4F3YA 3T41A 4QGSA 5KDDA 3RPEA 1SRRA 3BWBA 1U3WA 4PBTA 2BCJQ 4UARA 5AW4A 3ZLTA 1PYDA 3KVYA 4J0JA 3V7WA 4GVLA 4B3JA 2YIJA 4OD0A 3AM4A 4UREA 4B3CA 4DW8A 5K01A 1V8DA 5JYCA 5B5SA 1KJWA 3LNCA 1WJGA 1WXIA 3BMQA 3O38A 3ZNPA 1XAHA 5CXSA 1ZM4A 1TAGA 3CRRA 3TMYA 2QMUA 3K0BA 1VE6A 3KQWA 3MS2A 4GP7A 1IEVA 1EFUA 5JFOA 4ZOEA 3T9CA 2QX9A 1VBNA 4S35A 3UPUA 1U04A 1IJFA 1W1WA 3L1UA 2DWUA 3C6QA 1JG7A 3NETA 3URKA 3HHPA 4IYJA 3SVZA 5A9SA 1INLA 3ABZA 1R64A 4PFKA 1DAGA 2I2XB 4FOOA 2J5RA 1S2GA 1YR1A 2JC3A 4O1IA 5AHXA 4FZVA 2Q3DA 4NYJR 1AKEA 4AG3A 4GXNA 2VBIA 3H4IA 1KO4A 2FE1A 2OHHA 3MMPA 4G8JA 4PPYA 4RPIA 3DM9B 4ZTBA 3LXMA 4BS9A 1PEDA 1LV7A 2FZGA 4MQUA 2EFJA 2ZJOA 1L5QA 1X1SA 2QRJA 3GJQA 3L0OA 5DHFA 1NF3A 2FZEA 5AM0A 1E4VA 2E48A 1GLVA 1A9XB 2OHIA 3AO0B 3JV7A 3RVLA 1W75A 1UKZA 1XEXA 3QEJA 3E81A 1ZIPA 5AHKA 3OT5A 5EJMA 3PNLA 1IVSA 1MABA 2ZWMA 5D84A 5CA0F 5ADUS 1PR4A 1KTVA 4R84A 2CMGA 2JIQA 3AF5A 4K6FA 3GRCA 4DKXA 4QODA 1SD5A 1RI4A 4ZMBA 4JBLA 5BVGA 2AN4A 4DSOA 1G20E 3ZUGA 1OGJA 2R8YA 1TJNA 5EYPB 3O73A 1UXJA 1T9HA 2EL9A 1YB6A 1CDZA 4G63A 5FWDA 3T5TA 4F92B 4OXKA 2JFXA 4ND1A 1QU2A 5J4VA 3QXSA 4IIYA 4MW2A 2J9RA 2PZEA 5TT0A 4R7ZA 3UMVA 4W1SA 3TDMA 4CETA 1UBEA 2AYZA 1PT7A 3CTMA 2C8KA 2OKCA 3BZBA 5T4FA 2VAMA 1OU4A 1KO5A 4FFOA 1GPWB 2DQSA 4HFMA 1A8IA 2AOTB 1W4CA 3L7BA 3ONFA 2EW1A 1E5DA 3VU1A 4ES6A 1J1UA 4UNRA 4IOLA 5EJ9A 4WIAA 3W78A 4C04A 1K7EB 2OFPA 2WT8A 3N2NA 3R41A 4FDMA 4BVJA 4EEXA 3SXJA 4XFKA 4KYIB 1OH6A 5B1DA 3AU9A 5AXDA 1I6MA 3HABA 1CTQA 4P3NA 4DC9A 3D8BA 4V0OA 1KZ6A 2KW5A 4WKPA 1RHMA 3PRYA 4DLLA 4Q4HA 4KP7A 3LW7A 2WP0A 3VKUA 4Q19A 3HVIA 2O5VA 2P2DA 2YCBA 3BWDD 5D5HA 3CZQA 4EQ6B 2OBMA 4BP3A 4Z1MD 3HYTA 5ABPA 3DE6X 5AHRA 3ISVA 3DW3X 3H2KA 4PVDA 5K0BA 1X1CA 4ADSG 1VCMA 4AC9A 4K9OA 1ZLXA 4Q5IA 1UMBA 4XAQA 2X9NA 2LDXA 1J8FA 4N7BA 3LCCA 1ILWA 4FLMA 4MRNA 5JCJA 3RSFA 1EZ1A 3H9CA 3WR5A 3HBNA 1USGA 2H8GA 5C53B 4X00A 3MHTA 1NC1A 3WLRA 3I6IA 4ITRC 3BIFA 3I2JA 4RY8A 4S12A 1EVKA 3WK9A 1ZOSA 4WWHA 3PE6A 3PQ3A 3P26A 3GELA 3VBEA 1Z4MA 2HXGA 4TV9A 3U3ZA 1Y5MA 2CXTA 3CN9A 3G2PA 1DRVA 1Q3HA 3WC4A 4FMDB 4A5SA 4PTYA 4BQRA 2Z3VA 2ZM5A 4HTFB 3G1TA 1F8YA 4ENQA 4ZCRA 5BRNA 1WS6A 3ZC3A 3G6KA 3WMGA 1LPAB 3E58A 3FDFA 3ORRA 4IH9A 3H1EA 4F2PA 2VYVA 3LX4A 1TRKA 2OHJA 4GQBA 3TTVA 3O94A 1UBOS 3PSAA 3QW2A 2FQYA 4JASB 4QHSA 2C4KA 1DTEA 4B5LA 3SSMA 4HFJA 4RD2A 5AP9A 2ZUDA 3UY4A 5I47A 3LWZA 2HJSA 5B36A 5CDHA 2JJQA 1Z0DA 2WJGA 2VZ8A 3GUVA 3PRHA 4NBWA 4XFDA 4DSAA 4R71A 1V26A 1VIDA 1L7OA 1LTQA 1TGYA 3BILA 3TD9A 1TYZA 1D6JA 3RNOA 1GPKA 2G6BA 1JQAA 5FUWA 3I39X 1IM8A 5IVIA 2AQKA 1Q7CA 3OT1A 3H0CA 4X61A 3L07A 3X2FA 4YLYA 3U40A 2HCTA 4P36A 1B8PA 1U9YA 3UENA 5L51A 3DF7A 4YI5A 5CW2A 4CFYA 1Y6ZA 5FWXB 5C9ZA 3Q9UA 1B15A 3JVVA 5HIMA 3DYBA 3U7GA 1AGRA 2JGNA 3CF4G 2EFCB 4KMMA 4M76B 1SU8A 5BW8A 3R3XA 2I3BA 4Z7NB 2FPKA 4RY9A 3WSTA 1YJ5A 2FOIA 2W2NA 3CR3C 3THOA 5FLKA 1THGA 1Z7EA 4I1RA 4DILA 2OUIA 2JH8A 4RZ2A 1LGYA 2WAOA 5BQPA 1NYLA 5JI2E 4PYKA 4B40A 1FQKA 4R2JA 5DZSA 4WMLA 3REQB 3LUPA 4BMYA 1H3FA 1TA4A 3ZY6A 4X6UA 1Y8ZA 4PIVA 1TJ3A 1VHTA 2VNSA 4RVDA 5H4GA 3FYUC 2GD1O 2IXFA 4PC1A 1RM0A 2NZXA 1IJEA 4ZT6A 3K70D 2WWXA 5HTOA 2AG8A 5BYBA 5IKEA 2E89A 4E32A 2ZB2A 3N6XA 2WVGA 2OP1A 3TCXB 5KVSA 5KWJA 1NBEA 2CJWB 1VE7A 1HXHA 1U3UA 2P67A 5TPWA 4Q37A 4LRWA 4DQ0A 5L40A 1EQUA 3R6GA 4S2EA 4KKXB 2R4TA 1QP4A 3C3WA 1JPVA 3K8YA 1UXIA 3UEOA 1ICEA 2F8LA 3CZ5A 4DXDA 5ALNA 1FFHA 2JBHA 5A0FA 2IE0A 2D0PB 3VHLB 5CDYA 3DR3A 2HSZA 1F0NA 1G20A 2Y9PB 4FYPA 3WYBA 2QTVB 1JE0A 3D6HA 1AZLA 3QKTA 3RWOA 2PRSA 5K2OA 2K6GA 1GUFA 1KH2A 5DT9A 5K45A 3Q2KA 4Q1VA 5J2UF 3HXQA 3LOQA 1CR2A 1GNQA 1KAEA 3I23A 4QRDA 5CFOA 1E2DA 4DA9A 2HDHA 4LTNA 1E2GA 1NLUA 2UZ1B 2IPAB 4C7BA 3K0AA 4QYIB 4M8KA 4ED9A 4EKNB 1SVMA 1IQ0A 1X7ZB 1Q0HA 4NESA 3OQVA 4BFXA 1FDRA 1NSYA 4CMJA 4CV3A 3THXB 3PHHA 5G41A 2P9YA 1JYEA 3GRYA 2OV1A 5F9FA 5DNAA 4MRMB 1P9OA 2ZJ2A 2W42A 4OJKA 2C4NA 1MG0A 1WR8A 3QVKA 5D7BA 5EOVA 1GGNA 2IH2A 5FEUA 1W2GA 4RFLA 1XRJA 3MUOA 16PKA 2QGNA 4UPVA 2O57A 4FFWA 4FQ7A 1NRWA 4HAWA 1PJ4A 3V7YA 1P33A 3NP9A 1X3SA 3AFGA 1VECA 1N6IA 2ZYSA 4UBIA 4M9CA 1XXHB 2SKDA 1JBQA 1OWPA 1JB9A 4ZO4A 2DR3A 5KBYA 2XJ9A 3GGDA 3LXXA 5G0UA 2CYAA 2ODBA 3B9PA 2D13A 2O0HA 1MTZA 1GLGA 4AKEA 3I9LA 5EMKA 3QBDA 1G19A 2I29A 3NIBA 4RPCA 2R65A 4OLJA 2ZJ6A 1TKRA 2WUEA 2YJ3A 2HRDA 2IGBA 1Z28A 1VYTA 3A2KA 3T61A 1X7WA 1GM5A 1YQTA 2RMKA 5F9HA 2VHCA 3K5IA 3V7UA 2P68A 1Q44A 4GOMD 5DPMA 4DQKA 4DA4A 2GFHA 1N2HA 5DISB 4BP8A 1EBBA 5HE8A 3FMPB 3V2HA 2H29A 1S6YA 3R5JA 3VZBA 4C0JA 5JC1A 1JDTA 1P4SA 1QRAA 2QGZA 4KQJA 3W5UA 4DIBA 5LLDA 1FUEA 1PL0A 1E2FA 2FSIA 2ZE6A 1JKIA 3CVOA 3EAGA 4HX2A 4KQ6A 5EEHA 4OX9B 3GLGE 5IZCC 1OYWA 2Z6AA 3G13A 3FYUA 1WKBA 4A6PA 4YJ2F 1RYZA 4CDMA 5A71A 3A6JA 5ALRA 2Y6VA 1FXSA 1KBQA 3RR2A 1UWVA 3EG9B 4C43A 1Z4JA 2Q2QA 2JLUA 3TLZA 1S1MA 4WCFC 1Z4IA 1Q0QA 3P9ZA 1TQ6A 2BFPA 3LQ2A 1V1RB 3NWBA 4GEKA 3O6VA 4ZU1X 3UM9A 4ZALA 3QKSB 3IKLA 4ARCA 1XNJA 1P39A 3Q15C 2FSPA 1EP9A 5AI0A 4UTRA 2YVLA 4RTSA 1A9YA 1PJTA 3A37A 2V8BA 5CDFE 2R00C 1E0JA 4KQKA 4FR0A 1KFJB 3HLYA 1Q1GA 3AF0A 3WJ2A 1KO7A 4ZODA 3H65A 5AVSA 1JLLB 2OCLA 2PUHA 3QVXA 5FJIA 4MEBA 4PX3A 3DNMA 4DSUA 1VJDA 4GOOD 1OLSB 1USUA 4GDMA 4BLVA 1N2SA 2PZAA 1L7QA 3CXUA 3CWCA 3FCUB 3PU6A 2X14A 3UNXA 1FMJA 3CUYA 4BFUA 1NDHA 2CYBA 1I7SB 4C4AA 3CU5A 1B1AA 2PUBA 4YNBA 3OLVA 1XYGA 3ZI0A 4DCCA 5A3QA 2AWNA 1H0RA 5BSVA 2Q5CA 3TTWA 4FE4A 2AMJA 1QHGA 2GVNA 2Q1XA 5DXAA 4AY5A 1N36B 3BWEA 3PYXA 4V0RA 3KKLA 3GFGA 4RK0A 4ZAWA 4TXLA 1UAAA 2W11A 2HRZA 4PQYA 4EQZA 3L7IA 5AKZA 2VYCA 2WQZA 2JJYA 2XYQA 3P9SA 2RHHA 3IVAA 2GQ0A 3ZGXA 5CJ2A 3LUJA 4ZICA 3KYDB 2N0SA 4UQPA 1T1JA 2RAVA 3I42A 2MU1A 4KLRA 4B74A 1RKVA 3BGWA 3QEKA 4QXMA 4URHA 1T5DX 5BNWA 3EPRA 5A4DA 4W9NC 3LUDA 2M1XA 4KQEA 5DV9A 3QHPA 3R9WA 1AB5A 3DVAB 1FVHA 2PJDA 5JMPA 4EZEA 3IQFA 4ZV9A 4Z4IA 1MV5A 3PP8A 3GJ3A 1JKFA 2IBMA 2PZJA 2OCAA 3DCIA 3Q7PA 3B60A 4KRGA 2TSYB 3PFCA 4Q39A 4YR9A 1E3MA 3IALA 4I4CA 2AC4A 4JNKA 4ZOAA 4CEJA 4KI0A 1PFWA 3GLFA 1VMAA 2ADFA 3NBXX 2HGZA 3NYIA 4FNMA 8ABPA 3GAFA 4LHSA 3UFBA 4EHBA 1T9KA 4PZAA 2J0UB 2YRXA 4CQNA 2MSCB 1NBWB 3IIJA 4EG7A 3MMNA 1SB9A 1T8SA 1ECBA 1Q7BA 4WUVA 2VHXA 4MUJA 5DM0A 4ZQEA 3W05A 1HFEL 2EQBA 5AJUA 5J5VA 1MX9A 2O50A 1C8VB 1L5ZA 5IZCA 3UPTA 1SUCA 3U3XA 3R0JA 3TR5A 2OVFA 2Y27A 4D80A 4LECA 1OX4B 1I80A 2IUTA 1JSZA 5HRCA 1BTOA 2PAFA 2MOKA 5EWJB 4CG3A 4KO1S 5I7EA 2XMDA 2W83A 2G8NA 4BFVA 2IZ0A 1MT0A 1NQVA 4WCFA 4UDXX 1G8AA 3NHKA 4Y2JA 1CV2A 5K0ZA 1O54A 3X44A 1T0IA 4G41A 4YQEA 4ZU6X 3WXBA 4F2DA 1V5GA 4RMJA 5EXPA 2PUEA 3BSWA 1C1HA 4E30A 1IWOA 1PTJA 2UVPA 1XMXA 4M0CA 2PT6A 1X1DA 2R00A 2QPOA 3H16A 3ILXA 5B53A 3RTGA 1N7GA 2PYDA 4EPXA 5C7OO 4Y9UA 4J0KA 1KYWA 1ZY2A 5HFJA 3EASA 4L78A 2V7QA 3CW9A 4JEIA 2QN2A 2VRCA 3KXKA 3QF7A 1NE7A 3HPQA 3G2NA 4CL2A 3AY6A 3U80A 4QT0A 4UUPA 3RODA 4QYWA 1GG8A 5FL3A 5BWNA 5HDBB 2WAMA 3IDSA 4Q4HB 4EPWA 3CJTA 1NFFA 3THYB 1B8NA 2AL7A 3HA3A 4BAZA 3NOQA 2QMHA 4FU0A 2WF5A 1UOPA 4TM8A 4OM7A 5TMBA 1AUOA 2C9DA 3A6HA 4IFEA 3NTLA 1B76A 1Q1AA 3F6YA 1I8TA 2Y92A 3L8GA 5DGIA 2AYYA 2C2HA 4D9KA 4GDFA 1UK6A 3LVQE 2ID7A 4C4SA 4N6GA 3DQZA 1JKMA 4MI6A 3WK8A 2H5EA 1DCKA 1W7AA 4F8JA 2IYPA 3CZPA 2HK7A 2QEQA 1U7UA 4M9SA 1ZUNA 3EIOA 2CWDA 1G8JA 2ADOA 3AZOA 3BE6A 2BEWA 4JP8A 5KTPA 2G88A 3UF0A 4V24A 2BVNA 2FK8A 4TXMA 2IT1A 2JD1A 3NEAA 3NBUA 4RKFA 4CL8A 1G8YA 1OWNA 4HDSB 1HQDA 4IZIA 4W9NA 5CA1A 7REQA 1B3BA 2PZ8A 4C0HA 4AY4A 5CXQA 2GDZA 3DEYX 1H8HA 3HK2A 4KE7A 1C29B 2HBQA 3L8EA 1Z18A 4NDZA 3TLYA 4EA6A 3EARA 5KTKA 3IIKA 4LAFA 3N2KA 5KYWA 1PZXA 4MKHA 2OCYC 3DOOA 1SA0B 2GTIA 1SVLA 4O33A 1O95C 2LVBA 5D8DA 5E7MA 3S2SA 5B2ZA 2VWHA 1BAPA 2VH5R 5EHIA 3SDZA 2GJAA 4NYIQ 4UBOA 3R2JA 4K26A 1I2BA 4AK9A 5EJ4A 3ZD7A 1ZN2A 3BGIA 5GAJA 1JAZA 1V8FA 4LWZA 4MTCA 5I6DA 4LE2A 4CIVA 4ECEA 1MFZA 4BQOA 3FPCA 3QELB 2OE2A 3OT1B 1Q50A 5F23A 1HT1E 5K7SA 3IT1A 1RRKA 4KSCA 1CJKC 1OKKD 3UK7A 1TUEA 3I4CA 1NJSA 1XMJA 4X1YA 5EMLA 3MWLA 3OY7A 5B58T 3M81A 2LCQA 3W6NA 3UA3A 2PUFA 2EKDA 1GSAA 3DXZA 1KDYA 1E1QD 2IIPA 3HUFA 3LE8A 4RPGA 1UDAA 1BRTA 1Z82A 2OGZA 3NHRA 4OFZA 4QFCA 2WFAA 3EK2A 3ZWDA 2JIZD 1FTSA 2GK4A 1TMKA 2M2IA 3L7LA 3CT4A 3DBLA 4YMVA 5CAEA 4OREX 1N3LA 2M32A 2P4QA 3FDZB 4QOEA 2B4KA 3RYIA 4CTOA 3LP5A 4Z2YA 1Z39A 5AKHA 1VJ5A 2Q6KA 4PHCA 1YR3A 2NUAA 4U6QA 3ENKA 1ORWA 4N0DA 4K05A 2NYUA 5JU6A 1NXOA 2V4UA 2GBGA 4OI1A 5ED0A 2CUKA 5LQKA 5A5GA 1ZK1A 3RC2A 3TW0A 4NWIA 3TINA 1JF8A 3A06A 4LJ8A 6AT1A 3HXMA 2VTDA 4OYHA 1UZMA 1DBIA 3Q5DA 3RIGA 1A4RA 3LLCA 1TIBA 3Q2IA 2W2KA 6GPBA 1EFPA 5BMVB 4FX2A 2HU7A 5IW8A 4IIBA 4XD7A 1UXHA 4AN0A 2HF9A 3F47A 1JT2A 2JLCA 3ZD9A 2YC4C 1CQJA 1KJJA 4KFRA 5JBIA 5TPWB 1CJCA 1PLLA 2C7VA 1RI3A 1JR3A 3U26A 2UUBB 3E2MA 3FVTA 3ZBQA 1JT9A 3T9DA 4YB8A 1XNGA 4G9GA 5IC5A 3M5DA 2HT1A 1IE3A 3I9V1 4FDUA 2UZ0A 3IDZA 1HEUA 3F6CA 1U0NA 2C9OA 1KMCA 4ALLA 4HLQB 1DAOA 1EWYA 1G20B 2ZT8A 3NX4A 4UCFA 4B1FA 1P61B 1QRRA 1IPFA 2MSKA 1JDZA 1XF9A 1NXSA 4L3WA 2X9LA 1U2TA 1BJTA 4KE6A 4II2A 2PIDA 1QZUA 2FF5A 4HQ0A 4G0OA 2CF5A 4M88A 3SYMA 4CT5A 1EE2A 1O95A 4YECA 2CNDA 3C7AA 2NV0A 3E05A 3K0AB 1EFKA 2OXRA 5LNK1 4B6GA 1ODCA 3MILA 5AVRA 2AJ8A 3C45A 3DMGA 1K1EA 3FJOA 3O7MA 3HB4X 4HLUC 4BNNA 1ISHA 1RIFA 1VLMA 4EZBA 3MWGA 3SZ3A 1IBCA 2PKEA 2QD1A 1IDN1 2IS1A 3BZUA 1YQ9A 3BPSA 4IVRA 5JOQA 4QVGA 7ABPA 3EAFA 4Q01A 2RGAA 3BFXA 3HP4A 3LBHA 1QC5B 1FTYA 5D5QA 2CL5A 1QAOA 1WD5A 2BDUA 4Z9XA 3QUBA 3WZMA 1OX6A 1RAHA 1PQWA 5AK4A 4ARVA 1EG2A 5LDHA 2JLZA 1QCCA 1H6CA 3H75A 4ARSA 1RRVA 3EGEA 4KC0A 1L5HB 4G09A 3SMVA 1CCWA 3GJ5A 2OFOA 4EA8A 1UJ2A 2NU7B 1Y1SA 2RHRA 2ZAGA 4FGWA 3DT6A 1HE8B 4HZUB 1IN5A 1B0ZA 1WVGA 3LF1A 4QTZA 5ALPA 4WDRA 4C89A 1ISPA 2YY7A 4B6SA 1W36C 1GZUA 4KGDA 4BNKA 4QBTA 3WGIA 1QV9A 2GXSA 1F6BA 3ETHA 1NVTA 1TKCA 4O25A 4L6AA 1POWA 2WT4A 1ZK3A 3R77A 1S89A 3SM3A 4HT3B 1JMYA 3OURA 2BOVA 2VP3A 3JWIA 4KQXA 3SF0A 3K6SB 2EGGA 4IS3A 3I5UA 5H3HA 1XEWY 2WVJA 2W2VA 5BNIA 1SEVA 2ZRIA 1CZUA 2DMRA 3WDSA 1AMOA 1XQVA 1Z2EA 3FHOA 2W6NA 3GA7A 2DFLA 3ZZNA 4F5ZA 2XNCA 1P7YA 3K32A 4NJMA 4CCYB 5GTDA 2I2WA 2A58A 2BMEA 4J7AA 2QW1A 3TQRA 1E7WA 4Y9TA 1FBTA 3EVTA 4EUFA 1LBTA 2NO0A 5FORA 1M74A 4AWBA 4EUNA 3AUSA 1AV7A 4HAVA 4TKVB 1SUEA 2J8ZA 1QP0A 1W76A 1J33A 3FE2A 3KAQA 4OHPA 1FC0A 2OKGA 3SHQA 3UAYA 2ONZA 4D9NA 3B3FA 1DT3A 4ZQBA 4OJYA 4BNDA 1N2IA 4I08A 3LYHA 5JO0A 4JP1A 2ZVPX 1QGUB 5ENDA 2I54A 4EHHA 4G84A 4G4SO 1O77A 2PMCA 1E6EA 1YB4A 1SCQA 1ISIA 3JYHA 2PJZA 3FNIA 1PG0A 3MS7A 5TNXA 1QFYA 2PKRA 1P2UA 1YNSA 2GEDA 3C8UA 1KVRA 1KEKA 4TXJA 2QLFA 2X23A 1W9HA 1DTSA 2I87A 3IEIA 2O8BA 2PZGA 3O1LA 1DP4A 2VDOB 4HLUA 3I8XA 4YRNA 3QPAA 1Y3HA 2ZWOA 1CSEE 3A70A 3K8QA 2OCGA 4LFBB 2QX4A 3DVLA 1EWKA 1B8VA 3B85A 4O4LB 2Q2NA 3FI0A 3KE9A 1P5JA 2CD9A 2OCDA 1VRCA 4PZZA 3VFDA 1SFRA 4N18A 2AEMA 2AB0A 2GJKA 3PWZA 3KTDA 1Y3BE 1T3TA 3A4YA 3JSXA 3L0CA 5E1DA 4W4TA 3PUVA 2WWWA 1L5OA 2X2OA 4QDOA 5J1TB 2YH2A 4WFQA 3U4CA 4G0WA 1J9GA 2JNWA 3QVLA 5JSKA 4LSWA 3Q7RA 5LQAA 1ZVJA 3OA2A 4N65A 4JI1B 3OX2A 4CDRA 2V7EA 4F38A 4ENWA 1US8A 4IDHA 3BQ9A 4Z4QA 2D1TA 1QTRA 1R37A 2YQ5A 4NV1A 4OQEA 1P1CA 2PWYA 2IEYA 1MB2A 1TU3A 2W6IA 4ZVTA 1XL1A 1F5NA 2ZBDA 3D3KA 3HFGA 4KO3S 2VHEA 2FSFA 4JT2A 3SF8B 4CBVA 1H2FA 1EXMA 1K98A 2CGEA 1GU0A 1JA9A 1X42A 1FFEA 2O0KA 3EE6A 4II7A 2KYRA 2ARKA 3EC7A 3O1JC 4G5QA 2XTNA 1Y6JA 1SZPA 4KJZA 5ECGC 4DIFA 2NO6A 3A6GA 4DM3A 1ADJA 5F5NA 1TMGE 1WB4A 3ZW8A 3QVTA 2FFAA 4EATA 5J3JA 1MU0A 3OH8A 4RDHA 1X87A 3VR0A 4W5TA 2ZIFA 2EDAA 2FUNB 4G4IA 5ILQA 5E7IA 5A9TA 1HC7A 2XXJA 3VNAA 4RAOA 5E1BA 2ZUFA 3HKDA 2UUOA 2GN1A 3R9IA 4ZYYA 2VSNA 1BX0A 3K72B 1JHOA 4RADA 1QGED 4JC8A 4ZOCA 1P6XA 2WHQA 2ONJA 1GTG1 2E4XA 1L5NA 4A0GA 1SZCA 3NKVA 4ZOLB 3JQPA 4ZAYA 2BGWA 1YS9A 1KYZA 1YB7A 3WQRA 1GCIA 1TM5E 1G2QA 1UPCA 2V7VA 4GL2A 2Q3EA 4UOQA 4N6NA 1BQ3A 1RI1A 4ISBA 1ZJYA 4XQCA 1ZL0A 2WYOA 3OPYI 1RBQA 2C5AA 2TMDA 2QE7D 3GGOA 4X8HA 4C0XA 3TW6A 4JQOA 3E1GA 5KTMA 1E1CB 2UVPB 3T1OA 1WCXA 3CUTA 2W6JA 5GP1A 4B2LA 5K0FA 4D4HA 2LCFA 3V4RA 5EMMA 2ZI7A 1JLMA 1CS0A 4D97A 1S2NA 5IDXA 1AH2A 2WHPA 1KMHB 3THSA 2Q7XA 3T3MB 4PZUA 3P0IA 1THMA 4PLYA 2ACVA 2DWPA 3DLPX 2ERXA 5L7TA 3VOSA 1XBTA 2DCMA 4LYJA 3WYGA 2ZTVA 4IV8A 4QOIA 4R98A 5MHTA 1Z5WA 2FF7A 1DFIA 3FYCA 2XUOA 3BIXA 3LT4A 4KAXA 4LV6A 4G1UC 2GZMA 3NJ8A 4JBIA 3GU3A 5DGHA 3RK1A 4CM9A 5JH7B 3SXPA 3RM3A 1IUOA 1Y7LA 4OPMA 4X84A 1UBHS 1JR6A 1IXZA 1UPXA 1IATA 3PWSA 2VZEA 5HGJA 2EX4A 2F67A 4YRFA 2PGJA 2XCOA 5LLSA 1FUIA 1KHHA 4DNPA 3DKIA 3DFIA 4QBKA 3STXA 1FVXA 1UJCA 3K7EA 3UXYA 1RLUA 1WUKS 3EPPA 5JNRA 4TLDA 2EZ9A 2G5CA 3FF1A 3LFTA 4JEMA 2BEWB 1V25A 2HHJA 2DFDA 4RX1A 2FLVA 1QTNA 3D4LA 1RXVA 3GLGB 4KQMA 2ZUSA 1U31A 5GOTA 4TPKA 4EJMA 1ZD3A 3TFOA 3FUUA 3WV4A 1NXTA 2R6AA 2P2LA 3HWX1 3QQ5A 5H0IA 4KFUA 4JLNA 2Z2JA 1TUBA 3PCXA 3VBCA 4NOJA 1NVEA 2PX4A 3HI6A 4ND4A 3AL2A 5LP6F 5MFPA 1VPEA 4LY6A 5BWCA 1PE0A 2FGKA 5JJIA 2VJKA 4G07A 4KMRA 4TS4A 2A4MA 5EQTA 4P1ZA 3FF4A 3FFAA 4GECA 2X41A 1GN9A 1ZD2P 2IPNA 4UXHA 5F4ZA 3UCXA 1E98A 3RTCA 3ZVKA 1YA4A 4CXMA 2ZJYA 3FSRA 1DV1A 1OY1A 4IDPA 1D6MA 2WFLA 4L5JA 3RRNA 5A02A 1J22A 1GA4A 5K51A 5BQOA 5CPBA 1DT5A 3V2UA 4A8JB 1BHSA 4JBWA 4ZIRA 1YTUA 3VPHA 2JHAA 2VF4X 3C97A 3P45A 1RYFA 2VP2A 4X1YB 1J90A 1L8LA 1R9NA 3LHKA 3OZEA 4XLZA 5AIAA 1Z5UA 3AEYA 1E9SA 4G5XA 4EY4A 2TMKA 4F04A 4LC1A 7AT1A 3L7CA 1C80A 4UDNA 4MARA 2HDNB 5HF6A 4D3XA 3TVDA 1K2VN 5CMLA 5FOUA 1CY1A 3FOEC 2A1UA 5MN4A 3CNNA 4KQ9A 1N0WA 1ST2A 3VUEA 3U9LA 5CRIA 4PYJA 1QKKA 3M4XA 1CYDA 2Q62A 4WK4B 2NTNA 3EWNA 1YI8A 4D3YA 3MWEA 4RVFA 4LDPA 1HX7A 1GRCA 1H1LA 2BEVA 1UIMA 3KYJB 5DYWA 2NUAB 1Y3FE 2OV3A 2WIDA 4FOSA 4CV2A 4D8VA 5C35A 1BDMA 1FNCA 4WXEA 4UASA 3L1JA 1CPYA 3NHJA 3PYMA 5H9VA 4PWZA 4G3XA 1H2BA 1KI9A 4H1HA 2FTKE 5DSZA 1OI4A 4F86A 1AKUA 2HUNA 1ZM7A 4MYCA 1U4NA 4GZ3A 5KOJA 3PNYA 4MVCA 2LIVA 2IPLA 3NI2A 3QXXA 3SOPA 2Q8PA 1QQTA 4LK3A 4AP9A 3OA0A 1XPRA 1XPUA 4DRXB 1C9NA 1FZTA 1QGOA 3LL4A 4AZ0B 3I2IA 1CFZA 4Q47A 221PA 4OJNA 3HRIA 4KHZA 1WZIA 1NVDA 5DO9A 2Z5GA 3FPBA 1DC3A 3K1AB 4FFVA 4ITUA 3L46A 4MAAA 3ZWYA 3ZGNA 1CLUA 2FWBA 3DLIA 3NNSA 2XNDD 3OLCX 3D6UA 2X58A 3DW1X 3I0ZA 3UT0A 4F6LA 4REQA 2IXBA 3OJOA 1W87A 4R2MA 3PENA 4M1ZA 1SXJC 1UBFA 5JRJA 2TRSB 1DXOA 1T2FA 4MRPA 1JSRA 2NVUA 1BVYF 3AOEC 4NOKA 5DBFA 5M7EA 1WXFA 2XYVA 2CT8A 4B0PA 2OQIA 4ZKEA 3RCBA 5BSTA 1P45A 3G2QA 3LSYA 4KSBA 1KARA 2QL5A 5DBGA 1QORA 5HIAA 3BE8A 3H1TA 4LOAA 2BFCB 2H1SA 3IMFA 3C39A 4WJZA 1QHIA 3BJMA 5C52B 1ABFA 1ZZEA 4M9RA 4MW4A 1GTSA 1YB2A 3RIHA 3KUKA 3M1IA 4YP6A 1LVHA 4UTOA 4DV0B 3Q8LA 3AQIA 5CD1A 2HBYA 4AJ4A 1UQUA 1TW2A 3AH8A 5H9WA 4ZAZA 3L02A 5A2QA 3GOQA 1Z0KA 2HA0A 2MSEB 2G28A 4TWAA 3WO1A 2QW8A 3W5AA 2H52A 2WSMA 5K6TA 1M10A 1YK0A 1AMNA 3FCOA 3SBXA 3BMCB 3II6X 4FYYA 4LWPA 4TQGA 5EP1A 1B14A 1E1RA 1V11A 3UAVA 3C7CB 3ZDRA 4AUMA 2PZLA 3SG0A 1XB2A 4E5SA 1KQOA 1RJ9A 1V7CA