2C2LA

Crystal structure of the chip u-box e3 ubiquitin ligase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
281
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
publication title Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 87
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c2lA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2lA03
4IN3B 4I17A 3HCSA 4I7DA 1WEMA 3KV6A 3UQ3A 1WENA 5A7DB 1YA0A 2EODA 3RO2A 3CV0A 3PE4A 1FBVA 2ECWA 5DBKA 1WEEA 4LK9A 5LKUA 1QQEA 4P5OB 2HDPA 2YSMA 4W4UA 2WPVA 2KWNA 4WZ0A 4GZ6A 1HYIA 2MNYA 1WILA 2E6RA 2MUMA 4ME2A 2KREA 2QFCA 4UQXA 3Q15A 4UQYA 2EGPA 2M85A 2LXHC 2Y1NA 2KC7A 2MT5A 5D1KB 4N3AA 3S7JA 4YADA 1K2FA 4S3OC 2C2LA 3N71A 3RPGB 5EX3A 3TG5A 3GZ2A 3R9AB 4FJCA 2VJEB 1Z2QA 4KXKB 5AYWD 2OXQC 5KH3A 4AYCB 4J8DA 1KLXA 2C0LA 2P58C 4N3CA 4ZDTA 4CGVA 5FZSA 1ZBPA 2RI7A 3KS2A 3LY8A 2VSYA 2MD7B 4YABA 4N3BA 4WNFA 5FTPA 3Q4AB 2VPBA 3GL6A 4X3GA 5FB0A 1T1HA 2E2EA 2MA6A 5LCWB 3JYSA 5G04J 1FCHA 2VJFB 3U3WA 3N9PA 3BEEA 2K4DA 5H9MA 3U5MA 4BBQA 1Z6UA 1VYXA 3N9OA 5D1LB 2JMIA 2KWOA 4JL0A 4UQZA 3HTKC 3MKRA 2M3HA 2QJ0A 2FO7A 2F42A 4LLBA 4H7YA 5LKZA 2YREA 2D8SA 5TBNA 4MVTA 4YAXA 4AYCA 4AIFA 5B79A 1JM7A 3KV5A 1OUVA 2K1JA 1HH8A 3CVPA 3CKCA 5JJ7A 2KYUA 5G05B 4XI0A 4PTBA 4GCNA 3CK7A 4NRHB 1WM5A 2UY1A 2VJFA 3URZA 2BAYA 3FWVA 2VPDA 5HQ8A 2DBAA 1ELRA 2PL2A 4UI9C 4HOTA 2I6HA 3LQHA 2CSYA 4Y6WA 3LQJA 3WXXA 3S7DA 3GYZA 2KGGA 2LDRA 2KE1A 5CCMA 2CT2A 3CK9A 5C11A 1CHCA 5DKAA 2IF4A 5FERA 4WA6A 4XI1A 2Y4UA 3N9MA 3CEQA 3Q47B 4I9EA 5M72A 3VTXA 1ZU2A 2YW8A 1NA3A 4GA1A 2CKLB 3KAEA 1JOCA 5CHEE 2G45A 2H0DA 3ZVZB 4LADB 2YHNA 5AITA 2YHOA 4I2WA 4BTBA 4NQ0A 1IYGA 3M99A 1BORA 2XPIA 1MM3A 5H1VA 4AUQB 1X4UA 3EDTB 1X4JA 4U04A 5BT1A 3U5NA 3QDNA 3PHDA 2FI7A 5A6CA 2UWJG 3LYAA 2JRJA 4WNEA 2LNIA 3RIBA 3HCTA 1IHGA 4AP4A 4U0SA 5FJYA 2VSNA 4GYOA 2KWKA 2HYED 3U5OA 3FL2A 5B75A 2CKLA 2GW1A 3RPGC 3ASGA 5B77A 5FZRA 3GW4A 4B94A 2YUCA 4NN2A 2PUYA 4BT8A 4U0ZA 3CK8A 3QZVA 2F6NA 3VK6A 3ULQA 2LV9A 3CVQA 4YBMA 1XNFA 4FK5A 4A1SA 4J0UA 4U07A 1ELWA 1WE9A 2ECGA 2KU3A 4WNGA 1F62A 5KJLA 5LCWC 5G05J 4V3KC 3ZPVE 2PQNA 4HOUA 3RKVA 3LKUA 4AY6A 1WEVA 1WEOA 2PZIA 4Y6CA 5G0FA 1B89A 3IEGA 4CA1A 4AY5A 2XEVA 1JM7B 4KYOB 3L11A 2IFUA 1VFYA 2FBNA 4UI9K 2G6QA 1WIMA 2YT5A 4GNFA 3ZNIA 4H7XA 4B86C 3O7AA 2PQRA 4WZ3B 4KBQA 4CCGX 2C0MA 3ZYQA 1N87A 3V43A 4TKPB 3S7FA 3AS8A 5ARFA 2UY1B 3OXLA 5KH9A 4N2QA 4I2ZA 3UUXA 2VGXB 4CDRA 5G05C 4GA0A 4WNDA 5DIZA 1HYJA 4UI9J 3ZPJA 4HOSA 4A4BA 5D0OD 2VPEA 4AM9A 3RJVA 3ZGQA 3ZPV1 3E4BA 4YBSA 3SOWA 3SZ7A 5KH7A 1NA0A 2K17A 4GPKA 4XIFA 4O6FA 3DQVR 3FP3A 3O36A 5TABA 4N2SA 1HZ4A 3GV4A 3T7LA 2LSVA 3Q5MA 4MSXA 4G2VA 1Z60A 2H0DB 4G25A 4CGWA 4J8FA 3C5KA 3FFLA 2L5UA 2L80A 1TJCA 2E6SA 2VGXA 2MA5A 3U4TA 2XGMA 2NAAA 4XI9A 4GB0A 2L43A 3VTYA 4BHWA 2KCVA 2XB1A 4F52B 2Y1MA 2YYRA 3HYMB 4RG9A 4GNDA 5I3LA 3TAXA 3KD7A 4Q6FA 5D0QD 1U6GB 2F6JA 2LGGA 4GNEA 4N4FA 3PURA 4APOA 1V87A 2LGKA 2Y43A 4G23A 3M63A 2FEZA 3N9LA 4JHRA 4QF2A 2RSDA 5BNWA 2HR2A 2ZETC 2BUGA 3NG2A 2C2VS 5C13A 5H1TA 4HOQA 3U5PA 3LCAA 2ECVA 3KQIA 2LN0A 1FP0A 2DX8A 2NC9A 4J8EA 1PC2A 3MEKA 2UZGA 5G04B 2LSUA 5H1UA 4GCOA 4L58A 2L6JA 4JA7A 2V5FA 5B78A 5EX0A 3LRQA 2FF4A 4W9RA 3ZFWA 5C1DA 2LQ6A 4YATA 4ABNA 2M1RA 4RG6A 5LCWJ 1WESA 3DPLR 1KT1A 3ASHA 1WEUA 5LKXA 4AVXA 3ASLA 3HCUA 1LDJB 3SHBA 3O35A 4ZUXU 5FEYA 4LKAA 3ZN3A 2EA6A 2AVPA 1W3BA 3EB5A 3I2DA 4N3WA 3EB6A 3S7BA 3T6RA 3ESKA 4GYYA 2XCBA 4GA2A 1DVPA 4JA9A 3C6WA 4LEUA 4QF3A 2G43A 4BTAA 1WGMA 4R7EA 2YQLA 3O37A 1Y8MA 3OXGA 2KFTA 4I9CA 2FUIA 2AN6A 1VD4A 3UPVA 4A4CA 5JJ6A 5B76A 2JMDA 1RMDA 3K9IA 1KT0A 2XEUA 2ECNA 1HXIA 5FT9A 2VP7A 3KNVA 2MD8C 2HO1A 3TG4A 4G1TA 3Q49B 4ZQLA 5KJMA 2MNZA 3RU0A 3NF1A 5FZQA 5EKQD 3OXFA 3AS4A 2OOEA 3MV3B 1LDKC 4U0UA 4IC3A 4R2YA 2VPGA 2QICA 3QKYA 3CVNA 1X4IA 5JJTA 3ASFA 2K16A 3L1ZB 5BW8C 3MA5A 3ZHEB 2ECIA 2LGVA 3O33A 3PUQA 3CVLA 1IYMA 2ONDA 3M62A 2J9QA 5D1MB 2XGSA 2YQMA 3QWWA 4V3LC 2ECJA 2MIQA 1WFKA 1E96B 1WEWA 3AS5A 3GZ1A 4O64A 1WAO1 4G26A 4S3OB 2JMJA 2CSZA 2KWJA 4F3VA 4YNDA 3IHPA 4UP0A 2QIZA 3ZVYA 2VGYA 2MHKA 1XWHA 4LJNA 4GNGA 1G25A 2YHCA 4WZ2A 3ZHEA 3RO3A 4I1AA 5J3XA 1P5QA 2VJEA 1MM2A 3N9QA 1E4UA 3MHSA 2WQHA 4B7YC 4IC2A 3L1XA 3LQIA 3LPZA 5KJNA 5TRBA 5CCLA 4C9ZA 2KCLA 2LGLA 4FO9A 3SOUA 2VYIA 3QWPA 2L75A 4BT9A 5FB1A 3O48A 5G04C 4L7XA 2M6MA 5LKTA 3MV2B 3PE3A 3RTRB 5DINA 4YBTA 4UP5A 4YVQC 3CKBA 2KCKA 5AIUA 3QOUA 2YQ8A 2KGIA 4I7CA 2YSJA 3N9NA 5B8DA 4R8PK 4N39A 2L0BA 5KJKA 2YU4A 3O34A 3ZTGA 5EYAF 3PDNA 5ARGA 2PNXA 5JG6A 4HORA 4YVOA 4FIPA 4UI9B 1A17A 4EQFA 4GZ5A 3LY9A 2ECTA 2LXPC 3QWVA 2I50A 4BWRA 1NZNA 2YURA 4WUYA 2XCCA 2KIZA 4GYWA 1WEPA 4GZ3A 2XGOA 3ASDA 2KR4A 3TGOA 3O70A 2Q7FA 3LY7A 4I7BA 2VQ2A 5HI7A 4A0CD 4G24A 3MHHA 2LRIC 2R5SA 1ZBDB 2FSAA 4PPEA 2IDAA 1QZ2A 2KATA 2HYZA 4N5CA 1WEQA 5TDRA 5TDWA 3SOXA 4YC9A 2FUUA 2Y4TA 3SF4A 2JLBA 4A49A 2VNFA
chains in the Genus database with same CATH superfamily
3UT7A 4ANWA 3ZXSA 1WENA 3PE4A 4U96D 4LK9A 5LKUA 3B7SA 4BEPA 2KWNA 2MOWA 4KMOA 3BG1B 2L7PA 4GZ6A 2MNYA 4NIKA 4PS3A 2M85A 4CCAA 5D1KB 4HRNA 4S3OC 3N71A 4GAAA 2H6FA 4XKCA 1H6OA 2R05A 3C5RA 2FD4A 2RFMA 2VJEB 1Z2QA 5EIDA 5LFAA 2DJAA 2C0LA 2AWIA 4N3CA 2V4LA 2CSVA 4GZDA 4YABA 3FH8A 4XKBA 4WWOA 1T1HA 2E2EA 3WG7E 5B1BE 3HXDA 4UWLA 1UJJA 2DIWA 2FFWA 3U5MA 2K4DA 5H9MA 4BBQA 5CRVA 1E7UA 1Z6UA 4QQ4A 3L82A 3T5VA 1S64A 2DCPA 2P9LG 2L0TB 2M3HA 2L0IA 3B7RL 2FO7A 3V31A 1Q2ZA 5LKZA 2P2CP 3NZUA 4YAXA 4AYCA 4AIFA 1JM7A 2FULA 3B7TA 1HFAA 2ZIRA 1HH8A 5ANRA 3R7RA 4ATZD 2K1JA 3SY2A 2KYUA 4PTBA 4GCNA 4NRHB 3URZA 4UWHA 2VPDA 2DBAA 5AQAA 3TWWA 4Y6WA 3LQJA 5FIOA 2KGGA 2V5QC 2LDRA 5CCMA 2CT2A 5C11A 1OCCE 4XE0A 3JXJA 2GGFA 4RVBA 2IF4A 3N9MA 3CEQA 5M72A 3VTXA 2YW8A 2CKLB 4GA1A 3TWRA 3ZVZB 2YHNA 4KVOA 2YHOA 4OAUC 3RRNB 1MBMA 4TRQA 4A3TA 4MS6A 3TWTA 1MM3A 1N54A 4AUQB 4U04A 3U5NA 3QDNA 1N9AA 2UWJG 3LYAA 4BFRA 4RSYA 2JRJA 2ETCA 4PH4B 4FC8A 1TYQG 4AP4A 4U0SA 4B0ZA 3ASGA 1ZB1A 1U3DA 5FZRA 4MKTA 4O62A 2ZGGA 3JUEA 3I5PA 3CK8A 1JCSA 5ENQD 3SHFA 3QZVA 3VK6A 1PY1A 5AQ7A 3CVQA 5AN8A 1LD8A 2X38A 1UOHA 2I2OA 5G05J 3EJNA 2H6IA 2ETBA 2I1JA 1WEOA 5G0FA 2RD0A 3IEGA 4AY5A 1JM7B 3NBNB 5HRYA 3L11A 4UI9K 2G6QA 1KZPA 2DYSE 4CCGX 2C0MA 1N87A 2XS1A 5ARFA 5T3RA 5KH9A 4N2QA 3PLWA 3QK0A 1E7VA 5DIZA 4HOSA 3CVVA 3RJVA 4CZ2D 1IHBA 2WM9A 3DQVR 3FP3A 5T8IA 3G2SA 4ATGA 4U8VD 2LSVA 3Q5MA 4DX5D 3C98A 3LJNA 4LERA 1SA5A 5CMYA 4CGWA 1N4PA 3FY4A 3DPDA 2VTBB 4GB9A 1JWFA 1N0QA 2VGXA 2XGMA 2NAAA 4GB0A 4I43A 4GMRA 3VTYA 5CMWA 2XB1A 2F0YA 4UUCA 3APDA 4PUCA 3KD7A 5D0QD 3D9JA 2F6JA 2XEEA 4GNEA 3L6AA 2XOYA 1V87A 1OCRE 3FTVA 1K8KG 3ZU7B 1OY3D 2ZETC 3RRUA 3KQIA 1O1SA 5AJLA 1D9SA 1D8EA 4CT0A 3RK6A 4J8EA 4L2YA 3G2WA 1X81A 3DEOA 5H1UA 4L1BA 4GCOA 3SUBA 3APCA 4JA7A 3Q9UC 3CQCB 2LQ6A 3OAWA 3VLEA 4AVXA 3ASLA 3HCUA 5FEYA 4LCTA 4TUMA 3ESKA 4FLHA 2GRLA 3C6WA 3HVEA 4LEUA 1YCSB 2IOLA 2G43A 4K0RA 1JCQA 3O37A 2JEKA 1Y8MA 2AN6A 3UM2A 1MX2A 5KNGA 5KNHD 4A4CA 3FUMA 1RMDA 4UWKA 3ZRHA 5FT9A 2VP7A 2HO1A 4G1TA 4ZQLA 5FZQA 3ISMC 4R2YA 3SQVA 2QICA 2KZTA 1MX6A 3PZ2A 3FTXA 4GU5A 3ASFA 3T8MA 5BW8C 2R59A 4BSXA 5FWQA 4RLYA 2LGVA 3EHNA 2ONDA 1HG2A 3M62A 2DWZA 3O47A 3QWWA 4V3LC 3SBSA 5KWDA 1E96B 1WEWA 3FEHA 4CYMD 4S3OB 2JMJA 3KSQA 3DRAA 3LDZA 4ACKA 4IULA 4AEZC 3ZVYA 4EZKA 2GRPB 3QB2A 3ZXPA 4DI4A 4L23A 2VSOE 2KKXA 1WG0A 1O1TA 4JPSA 4BY6A 4DRXE 4JC8A 2YNQA 4RQIA 4I1OB 3UKRG 1K1BA 3LQIA 3C72A 5TRBA 3LVRE 4C9ZA 3CVXA 1N4SA 2OCCE 3QWPA 4Z68A 2AXVA 1H6PA 1BI8B 3UM1A 4L7XA 3RSEG 4IYPA 2WXQA 2OVBA 2WMNA 5B1AE 2XHEA 1TNZA 2QZAA 5AIUA 1N11A 1QNFA 3I4GA 4CDMA 5B8DA 4R8PK 4N39A 4LSZE 2YU4A 3B13A 4I1MA 3ZTGA 3PDNA 5ARGA 1DC2A 4YVOA 5ENTD 5J08A 1A17A 2CHXA 4GZ5A 2ECTA 2LXPC 3FTWA 1U3CA 1NZNA 2XCCA 2P9PG 3ASDA 5BV1A 1N4QA 1O1RA 3E2DA 2R5SA 1EYHA 2FSAA 5C2YA 1FPPA 2KATA 2HYZA 1JCRA 5TDWA 3SF4A 2JLBA 4A49A 2VNFA 4IN3B 4I17A 4I7DA 1WEMA 1YA0A 3BQOA 3RO2A 3CV0A 2ECWA 3MZLB 1FBVA 2QY7A 1IKND 5J90A 4W4UA 2WPVA 4WZ0A 1L5JA 4O1PA 1HYIA 1WILA 1SW6A 3JQ0A 5BXOA 3CHRA 2PM7A 2Y1NA 1O5MA 4FHKA 3U64A 3KEZA 1K2FA 3ZIMA 3R9AB 2JUNA 1NP7A 2ZGDA 3DSWA 1KLXA 4ZDTA 1KPSB 2RI7A 2GRQB 3GL6A 3S2AA 5G04J 4AP2A 2VJFB 3U3WA 1VYXA 2JMIA 2J49A 4HXIA 1KZOA 2QJ0A 3NOGD 5AENA 4F7AA 2F42A 2P9SG 3IKOB 3FTZA 4H7YA 2WMOA 3ZVVA 2YREA 4FJZA 3KV5A 4XX5A 3UIPC 3W9GA 2JM3A 3UINC 3CK7A 3HXBA 1NFIE 1ELRA 3LQHA 2CSYA 3EHQA 3CK9A 3EU9A 1CHCA 3IXEA 4WAFA 5DKAA 4WA6A 2Y4UA 5CECB 3FTSA 4XEIG 3CLJA 1MYOA 4BX8A 1TNUA 5AITA 3CR3A 4LRZA 3FUFA 3M99A 3FH7A 1BORA 2GRRB 1X4UA 1AP7A 2BKGA 3PVLA 5A6CA 2B6CA 4L9PA 4WNEA 4FU3A 1MQSA 5EDSA 3RAUA 4DX2A 3PZ1A 1IHGA 5A23A 4Q96A 3CSTA 4OGCA 3FL2A 5B75A 2CKLA 4FA6A 4D10C 3FJUB 4B94A 2YUCA 4NN2A 4BT8A 2CRWA 4U0ZA 3Q1DA 5SVXA 3TWVA 2MKEA 2OVFA 4J0UA 4B8CB 2ECGA 3HIZA 5ENNA 5JHAA 1F62A 1DCQA 4WNGA 3W9FA 2VJ8A 1QYMA 2JABA 4AY6A 2PNNA 1WEVA 3TXMA 4GTPA 4WWNA 4KYOB 2DYRE 3V2XA 1VFYA 4PS7A 1N94A 3ZNIA 4B86C 4WZ3B 1HE8A 3S7FA 3AS8A 4I2ZA 3UUXA 5CBNA 3B7BA 3FEYA 3PREA 1E8WA 4GA0A 3ZKJA 2QYUA 4A4BA 1OWLA 2RG8A 3E4BA 3SFXA 5KH7A 4YDEA 1NA0A 4CRWA 4DK5A 4N5QA 3O36A 3GV4A 1HZ4A 3LXUX 3T7LA 5AARA 4MSXA 4I6EA 4JW1A 3FU3A 4G25A 4DPRA 1TNOA 1TNYA 5BXUA 1SVXA 2L80A 1TJCA 2E6SA 1WDYA 2L43A 2F8XK 3HXCA 3HYMB 4GNDA 3IHYA 3TJPA 1S0PA 4HFGA 5CRUA 3HRAA 2Y43A 2FEZA 4QF2A 2RSDA 5BNWA 2HR2A 3NG2A 4HLLA 2C2VS 2WXIA 4ILHB 3ML8A 5LOZA 4LNGA 2NSZA 2VTBA 2ECVA 3ENEA 2J08A 4A55A 3CHOA 1E8YA 4M7CA 2UZGA 3CHQA 3FU6A 2I1KA 1FVHA 4W9RA 5C1DA 2J4BA 1N0RA 5LCWJ 3DPLR 3ASHA 5LKXA 3O35A 3PZDA 4ZUXU 4GPMA 3H7HA 2V4HC 3HXEA 3Q9NC 2AVPA 3T9KA 3QAQA 2YVRA 3ABME 4HBDA 3MGBA 1Z3YA 2XCBA 1DVPA 1NI1A 1OT8A 1K1AA 4GMLA 4QF3A 4R7EA 1OCZE 3OXGA 4I9CA 2FUIA 4EHMA 3AJIA 3UPVA 2NXPA 1Z3XA 2DZNA 1HXIA 1BLXB 3KNVA 3TG4A 2F8YA 1JUQA 2OOEA 3MV3B 1LDKC 3QKYA 4AJWA 3FHEA 3D9HA 3L17A 4TXRA 3L1ZB 1D8DA 3UTMA 3TWXA 2ECIA 2ZISA 3CVLA 1IYMA 1LTXA 2WB2A 4Z0RA 3DSXA 4HS2A 1S70B 3CVUA 5CBOA 3RRMB 3M7KA 4U8YD 2MIQA 3G2TA 3AS5A 3JQ1A 4G26A 2CSZA 4YNDA 1FT2A 2BKKB 4PS8A 4UP0A 3PEUB 2VGYA 2MHKA 4J8SA 1IQUA 3D9IA 3V79K 4OVVA 2KCLA 1MX4A 4I6GA 1DNPA 2L75A 5FB1A 5SVYA 4DI3A 2E0IA 3ZYMA 3O48A 5G04C 5AAOA 4MBGA 3MV2B 3T8KA 2IO3C 5FINA 2LXLA 3FM8C 4URKA 2A5UA 2ILRA 2CG2A 2YQ8A 3Q78A 2OEWA 3N9NA 2J4DA 3KDEC 3X2QE 3DEPA 3UT8A 5KJKA 3MKQA 3ESLA 3FAOA 2J8SD 4OAVB 3FH5A 3AG4E 3UI2A 3JXIA 2R2LA 4J7WA 3D9MA 5EILA 2GRMA 1LD7A 1YMPA 4BWRA 2LUHA 2KIZA 4X8QA 2XGOA 2KM4A 4LNUD 2KR4A 3SO8A 3TGOA 4I6JA 2Q7FA 3I4RB 3LY7A 4A3VA 4G8LA 3E30A 2VQ2A 3ABKE 5HI7A 4G24A 2LRIC 4K5BA 2WXKA 4K5CA 1WEQA 5TDRA 2IJGX 1TR4A 2QYJA 3T5XA 2DSMA 3KV6A 5A7DB 2EODA 1K3ZD 4OYSA 5DBKA 4KVMA 4P5OB 2HDPA 3FDHA 3ULYA 3PUKA 4HLEA 2E6RA 5ENPD 2MUMA 4ME2A 2KREA 4UQXA 1UN8A 4EBAG 2EGPA 3LJUX 2LXHC 2KC7A 2IONA 4F6RD 2YINA 4N3AA 4YADA 2C2LA 2IQCA 3AU4A 5EX3A 4FJCA 2H6HA 3PNLB 4KXKB 4E85A 1HO8A 2MD7B 1BD8A 4N3BA 4WNFA 2VPBA 4X3GA 4QQIA 4HI8A 1FT1A 1HF8A 4YDYA 3Q79A 1EF1C 2RFAA 4ACLA 3VLFA 3N9PA 2MYOA 2WXPA 3KEAA 3N9OA 3FU0A 2X3MA 3BG0B 4H9DA 3AU5A 4EPZA 3PZ3A 2D8SA 5TBNA 4GTVA 3MKQB 2IOSA 5B79A 1OUVA 4J6IA 3CKCA 3L22A 3TWUA 2KXPC 4ANUA 3DXKG 3NAWA 3DBSA 1WM5A 2UY1A 2VJFA 3FWVA 4XZ4A 1TJFA 2X6HA 3AG3E 4HRLA 4HOTA 2I6HA 2VGEA 1BI7B 3WXXA 3AG1E 3S7DA 1E8XA 3GYZA 5AIJA 2LAUA 2KE1A 3E33A 2I9CA 2XS8A 4CDNA 2L6BA 4I9EA 2DVWA 3HG0D 1ZU2A 3D9LA 3CHMA 3KAEA 3L13A 1JOCA 2G45A 2H0DA 4LADB 2P57A 3HHMA 3DWLG 4I2WA 4J8YA 3OTNA 4BTBA 1N52A 3G2VA 5H1VA 2LXMA 2V8SE 4U7EB 4FJYA 1X4JA 2IO2C 5BT1A 2IU1A 2FI7A 3CGHA 3L16A 3PS6A 4C9BB 3RIBA 2L9BA 2WVIA 2EIKE 5FJYA 2VSNA 1H2VC 4GYOA 1H19A 3G2UA 1VDYA 3RPGC 3E37A 1OCOE 3EHRA 3ABLE 4C0MA 4KZ0A 2PUYA 3CVYA 2F6NA 3CSFA 1OWNA 4YBMA 2P9IG 2LAHA 2BF0X 2Y1LE 4EZLA 1WE9A 2XQ0A 2KU3A 3B7UX 2XOZA 5KJLA 3JCKC 1GW6A 1N4RA 4HQDA 5LCWC 4V3KC 4F1SA 3ZPVE 3Q73A 1HS6A 3LKUA 2PZIA 3SFYA 4HVBA 3GZSA 4CA1A 2XEVA 3R7QA 5LP0A 5G55A 2YT5A 4H7XA 4K03A 3EUVA 2UY1B 3OXLA 2WXJA 4CDRA 5G05C 1MZCA 1HYJA 4UI9J 3ZPJA 3PUJA 3ZGQA 3UT4A 4AM9A 3ZPV1 4JZYA 3SI5A 3SOWA 3SZ7A 2K17A 4GPKA 4O6FA 4DX7D 5ENSD 4N2SA 1Z60A 2H0DB 2EINE 3C5KA 1UG3A 5BUZA 5K3QA 4TUUA 3U4TA 3UXGA 3PNTB 1S63A 3CHSA 5ANLA 4F52B 4MLPA 2Y1MA 2V0PA 4DLQA 1Y6IA 4U8HA 4R7LA 3TAXA 4Q6FA 4BSZB 4Q69A 2LGKA 3N9LA 4JHRA 5KBAA 4LNBA 3D9PA 2M63A 5H1TA 3FU5A 2P9NG 3E32A 3LCAA 1SZAA 2LN0A 1FP0A 3DSSA 1HX8A 2NC9A 3BUAA 3FUHA 1BPOA 3PRZA 5G04B 3MYVA 4FHJA 2L6JA 5EX0A 4C48B 2FF4A 3ZFWA 4ABNA 1KT1A 2X6FA 1LDJB 3SHBA 4LKAA 3ZN3A 3EB5A 4N3WA 3EB6A 3T6RA 3I3NA 4TV3A 3P2BA 4JEHA 4JA9A 4BTAA 1WGMA 1HU3A 2YQLA 1FVFA 4G11A 2E61A 1VD4A 4HI9A 5B76A 2JMDA 3IV0A 4ILGA 1KT0A 2XEUA 2ECNA 2MD8C 5EIBE 1MHQA 1XGWA 3U9WA 4KT6B 5FQ8A 5EKQD 3OXFA 1BU9A 3Q7AA 4U0UA 3D9NA 4FP7A 2VPGA 1X5BA 1X4IA 4HRMB 5JJTA 2XZDG 2K16A 3MA5A 3FUEA 3ZHEB 3PUQA 3O33A 3QNKA 2J9QA 4JXTA 4GTSA 2YQMA 4B89A 2ECJA 1UJKA 3ULEG 5FQ6A 4O64A 3R9MA 1A5EA 2QIZA 2J07A 1SZ9A 3C3RA 4JHKA 2DZOA 2D8UA 2WQ6A 4GNGA 1G25A 5E76A 2CONA 4I1AA 5J3XA 3ZYKA 1MM2A 2HE0A 1V55E 3MHSA 2WQHA 4IC2A 1DCEA 3L1XA 5KJNA 5CCLA 1JWGA 3SOUA 2VYIA 2A4ZA 2XZTG 4MRUA 3F6QA 2M6MA 5BV0A 3AG2E 5LKTA 2WXOA 2FO1E 5AQBA 5JMND 3RTRB 5DINA 4YBTA 4UP5A 2Y0BG 3QARA 3Q7FA 5HS0A 1U2VG 3NB2A 4JB8P 3FUKA 5B3SE 3DWDA 3SFZA 5EYAF 1H2TC 5JG6A 3D3MA 2IY0C 4HORA 1OWPA 1YYHA 4FIPA 3EU5A 3UMVA 3JUIA 4EQFA 2I50A 2M13A 2BEDA 2YURA 1WEPA 2ZU6B 4I7BA 4ZHBA 3MHHA 4B8AA 1ZBDB 4WWPA 4PPEA 3E34A 2IDAA 3FTYA 4K5AB 4N5CA 4GTQA 4YC9A 3ONKA 2FUUA 2Y4TA 4IRUA 4HNAD 5IY5E 1UW4B 4YBSA 4ZFHA 3HCSA 1SQMA 1E8ZA 3ZNGA 3UQ3A 3PZ4A 1WEEA 1QQEA 1EDUA 4EECA 2YSMA 1OWOA 3LDYA 2QFCA 3Q15A 2MRIA 2CFZA 4UQYA 1IQRA 2MT5A 3S7JA 4F1PA 3RPGB 1Z6TA 1NL4A 3TG5A 3GZ2A 5AYWD 2OXQC 5KH3A 4AYCB 4J8DA 2P58C 3LEWA 4L7TA 4CGVA 3EIJA 4AV7A 5FZSA 1ZBPA 3KS2A 3FUDA 2VSYA 3LY8A 5CEDB 2XRZA 5FTPA 3Q4AB 2HM8A 5FB0A 4Z0OA 2MA6A 5LCWB 3JYSA 4Q94A 1FCHA 2J09A 3BEEA 2KKYA 5D1LB 4EBAA 4OGEA 2KWOA 2WXFA 4JL0A 4TXPA 4UQZA 4F53A 3HTKC 3MKRA 5D2MC 2RR4A 2BTDA 4LLBA 3C3QA 4MVTA 3SD5A 2Y69E 4JD2G 4GTTA 3SBTB 3P1UA 2LAIA 3CVPA 5JJ7A 5G05B 1N95A 4XI0A 3D9KA 3QC1A 3FUIA 4FULA 3EHMA 2BAYA 5HQ8A 2PL2A 4UI9C 4UWGA 1TN7A 4APFA 4V3IA 3V2OA 2VSXE 3VLDA 1TN6A 5SVIA 4BX9A 5FERA 1IXVA 2Y3AA 4XI1A 4ANVA 3Q47B 3J5PA 1NA3A 5CHEE 4DJAA 4BETA 3U66A 4LUNU 3NOCD 4NQ0A 1IYGA 3SNXA 2XPIA 4DUIA 3EDTB 4GTMA 2WXLA 5AQ9A 3Q75A 3PHDA 1EPUA 2AXUA 3TWSA 2LNIA 3DPYA 3HCTA 3AAAC 3TXNA 2CFUA 4FADA 2KWKA 2HYED 3U5OA 2GW1A 3C3OA 5B77A 4PDXA 3TL5A 3GW4A 5AJDA 2A5EA 3ULQA 4DLOA 2IEJA 2LV9A 1XNFA 4FK5A 4A1SA 4CT4A 4U07A 1ELWA 3ONLA 3UM3A 1OWMA 2PQNA 4HOUA 3DSVA 2AW6A 3RKVA 2LO6A 3MJWA 1QBQA 3ZYLA 1V54E 4Y6CA 3ASNE 2CHZA 5HKPA 1B89A 3FTUA 3QJZA 3KSLA 2IFUA 4AXHA 2FBNA 1MJ0A 3FUNA 2XPYA 1WIMA 3MDBC 4GNFA 3O7AA 2PQRA 2GRNB 4KBQA 2YHEA 3ZYQA 3V43A 4TKPB 4B93B 2VGXB 2P9KG 2R02A 4M3OA 4WNDA 5D0OD 2VPEA 2XRYA 4JEUA 3EIQC 4DX6D 4GTRA 4BERA 3DDTA 5SVIB 2WXNA 4XIFA 2H6GA 5TABA 3FEXA 3L08A 4GTOA 1TN8A 4G2VA 1RZ4A 3DSTA 1SA4A 4J8FA 1JPLA 3O4ZA 3FFLA 4CEMA 3B95A 2L5UA 5JHBA 2MA5A 5ITZF 4XI9A 4AOFA 2F37A 3ML9A 4BHWA 1RW2A 4NURA 2KCVA 2AJAA 2YYRA 5I3LA 4RG9A 1U6GB 2XEHA 2LGGA 5JA4D 4N4FA 3PURA 4APOA 3MCXA 3APFA 4G23A 3M63A 2BUGA 5CERB 5C13A 2R17C 4HOQA 2EILE 3U5PA 2P9UG 3IHVA 3HDXA 2DX8A 3HVEB 1PC2A 5BPPA 3MEKA 3HXFA 3CIAA 2EIJE 2LSUA 4L58A 1HG5A 2V5FA 5B78A 2B0OE 4A63B 1ELKA 3LRQA 3ZUVB 2NYJA 4YATA 2M1RA 4RG6A 4E6HA 1WESA 1WEUA 3MX3A 4L2LA 2EA6A 5H7PA 1W3BA 3I2DA 3LVQE 3S7BA 4G8KA 1E90A 4FLBA 2GROB 2CHWA 4GYYA 3CQGB 5CEAA 2KZTB 4GA2A 4ILIA 3CVWA 2EGMA 2QC9A 4TXQA 4O1OA 3UM0A 1H6KA 4NACA 2KFTA 5D66A 1WY6A 4JHJA 2KBXA 5ENRD 5JJ6A 3SGHA 3K9IA 4U63A 4QFVA 1H2UA 3Q49B 5KJMA 2MNZA 3RU0A 1TNBA 1G3NB 3NF1A 1AWCB 4A1GA 3AS4A 2OV8A 2EQXA 4IC3A 2WQ7A 5EYLA 3UX4A 5ENOD 1Z5SC 3CVNA 4YDOA 2WXRA 3DSUA 3L9TA 2IQJA 3UIOC 2CRRA 2PM6A 1OXJA 1TEZA 4U95D 5KCMA 5D1MB 4HB5A 2XGSA 4O60A 2X6KA 1WFKA 4BESA 3NQPA 3GZ1A 1WAO1 4EZJA 2KWJA 4F3VA 3IHPA 3FUJA 1XWHA 2R03A 2RKKA 4ANXA 2EXUA 4LJNA 5T4YA 2AXZA 2XPZA 2YHCA 4WZ2A 3ZHEA 1LF8A 3RO3A 2WXMA 1P5QA 2VJEA 2OWAA 2X6IA 1PAQA 3N9QA 1E4UA 3J5QB 4LG6A 4B7YC 3PH0C 3L54A 3LPZA 2ZXWE 3FANA 2LGLA 4FO9A 2ETAA 3ASOE 4BT9A 4P29A 3PE3A 2XOCA 2XENA 2WXGA 3V30A 4KZCA 3CHPA 4YVQC 3CKBA 2EIME 2KCKA 3QOUA 4DX1A 3UKUG 2KGIA 2OEVA 4I7CA 4GMJA 4JVSA 2YSJA 2L0BA 3O34A 2CG3A 3ZEFA 5LX8A 2WXHA 2PNXA 4GZCA 3FULA 3IBEA 4UI9B 3DXMG 3TWQA 3LS8A 3LY9A 1INZA 3QWVA 2X6JA 3PEVB 4WUYA 5EN5D 1H0AA 4GYWA 4GZ3A 3O70A 3LJ3A 4UWFA 3NZSA 5FQ4A 1UN9A 2XP0A 4A0CD 5FQ7A 5EYPF 3ZW3A 3BU8A 4C0EA 3D9OA 5E75A 1QZ2A 3SOXA 5G2NA 4OVUA 4YDWA
chains in the Genus database with same CATH topology
3UT7A 4ANWA 3ZXSA 1WENA 3PE4A 4LK9A 5LKUA 3B7SA 2KWNA 2MOWA 4KMOA 3BG1B 4GZ6A 2MNYA 4PS3A 2M85A 4CCAA 5D1KB 4S3OC 3N71A 4GAAA 4XKCA 2VJEB 1Z2QA 5LFAA 2C0LA 2AWIA 4N3CA 2V4LA 4GZDA 4YABA 3FH8A 4XKBA 4WWOA 1T1HA 2E2EA 4UWLA 1UJJA 2DIWA 3U5MA 2K4DA 5H9MA 4BBQA 1E7UA 1Z6UA 3T5VA 2DCPA 2L0TB 2M3HA 2L0IA 3B7RL 2FO7A 5LKZA 3NZUA 4YAXA 4AYCA 4AIFA 1JM7A 2FULA 3B7TA 1HFAA 2K1JA 1HH8A 5ANRA 3R7RA 2KYUA 4PTBA 4GCNA 4NRHB 3URZA 4UWHA 2VPDA 2DBAA 4Y6WA 3LQJA 2KGGA 2LDRA 5CCMA 2CT2A 5C11A 4XE0A 2GGFA 4RVBA 2IF4A 3N9MA 3CEQA 5M72A 3VTXA 2YW8A 2CKLB 4GA1A 3ZVZB 2YHNA 4KVOA 2YHOA 3RRNB 4TRQA 4A3TA 4MS6A 1MM3A 1N54A 4AUQB 4U04A 3U5NA 3QDNA 2UWJG 3LYAA 4BFRA 4RSYA 2JRJA 4PH4B 4FC8A 4AP4A 4U0SA 4B0ZA 3ASGA 1U3DA 5FZRA 4MKTA 3I5PA 3CK8A 3SHFA 3QZVA 3VK6A 1PY1A 3CVQA 2X38A 2I2OA 5G05J 3EJNA 2I1JA 1WEOA 5G0FA 2RD0A 3IEGA 4AY5A 1JM7B 3L11A 4UI9K 2G6QA 4CCGX 2C0MA 1N87A 5ARFA 5T3RA 5KH9A 4N2QA 3QK0A 1E7VA 5DIZA 4HOSA 3CVVA 3RJVA 2WM9A 3DQVR 3FP3A 5T8IA 3G2SA 4ATGA 2LSVA 3Q5MA 3C98A 4LERA 5CMYA 4CGWA 3FY4A 3DPDA 2VTBB 4GB9A 1JWFA 2VGXA 2XGMA 2NAAA 4GB0A 4I43A 3VTYA 5CMWA 2XB1A 3APDA 4PUCA 3KD7A 5D0QD 3D9JA 2F6JA 4GNEA 3L6AA 1V87A 3FTVA 2ZETC 3RRUA 3KQIA 5AJLA 4CT0A 3RK6A 4J8EA 4L2YA 3G2WA 5H1UA 4L1BA 4GCOA 3APCA 4JA7A 3CQCB 2LQ6A 3OAWA 3VLEA 4AVXA 3ASLA 3HCUA 5FEYA 4LCTA 3ESKA 4FLHA 2GRLA 3C6WA 3HVEA 4LEUA 2IOLA 2G43A 4K0RA 3O37A 2JEKA 1Y8MA 2AN6A 4A4CA 3FUMA 1RMDA 4UWKA 3ZRHA 5FT9A 2VP7A 2HO1A 4G1TA 4ZQLA 5FZQA 4R2YA 2QICA 2KZTA 3FTXA 4GU5A 3ASFA 3T8MA 5BW8C 2R59A 4BSXA 5FWQA 2LGVA 3EHNA 2ONDA 1HG2A 3M62A 3QWWA 4V3LC 3SBSA 1E96B 1WEWA 4S3OB 2JMJA 3LDZA 4ACKA 4IULA 4AEZC 3ZVYA 4EZKA 3QB2A 4DI4A 4L23A 2VSOE 4JPSA 4BY6A 4JC8A 2YNQA 4I1OB 3LQIA 5TRBA 3LVRE 4C9ZA 3CVXA 3QWPA 2AXVA 4L7XA 4IYPA 2WXQA 2OVBA 2WMNA 2XHEA 5AIUA 1QNFA 3I4GA 4CDMA 5B8DA 4R8PK 4N39A 2YU4A 3B13A 4I1MA 3ZTGA 3PDNA 5ARGA 4YVOA 5J08A 1A17A 2CHXA 2LXPC 4GZ5A 2ECTA 3FTWA 1U3CA 1NZNA 2XCCA 3ASDA 5BV1A 2R5SA 1EYHA 2FSAA 5C2YA 2KATA 2HYZA 5TDWA 3SF4A 2JLBA 4A49A 2VNFA 4IN3B 4I17A 4I7DA 1WEMA 1YA0A 3RO2A 3CV0A 2ECWA 3MZLB 1FBVA 2QY7A 5J90A 4W4UA 2WPVA 4WZ0A 1L5JA 1HYIA 1WILA 3JQ0A 3CHRA 2PM7A 2Y1NA 4FHKA 3U64A 3KEZA 1K2FA 3ZIMA 3R9AB 1NP7A 1KLXA 4ZDTA 2RI7A 3GL6A 3S2AA 5G04J 4AP2A 2VJFB 3U3WA 1VYXA 2JMIA 2J49A 4HXIA 2QJ0A 5AENA 4F7AA 2F42A 3IKOB 4H7YA 3FTZA 2WMOA 3ZVVA 2YREA 4FJZA 3KV5A 4XX5A 3CK7A 1ELRA 3LQHA 2CSYA 3CK9A 1CHCA 4WAFA 5DKAA 4WA6A 2Y4UA 3FTSA 3CLJA 4BX8A 5AITA 3CR3A 4LRZA 3FUFA 3M99A 3FH7A 1BORA 1X4UA 3PVLA 5A6CA 4WNEA 4FU3A 1MQSA 5EDSA 1IHGA 5A23A 4Q96A 3CSTA 3FL2A 5B75A 2CKLA 4FA6A 4D10C 4B94A 2YUCA 4NN2A 4BT8A 4U0ZA 2OVFA 4J0UA 4B8CB 2ECGA 3HIZA 5ENNA 5JHAA 1F62A 4WNGA 2VJ8A 4AY6A 1WEVA 3TXMA 4WWNA 4KYOB 1VFYA 4PS7A 3ZNIA 4B86C 4WZ3B 1HE8A 3S7FA 3AS8A 4I2ZA 3UUXA 3FEYA 3PREA 1E8WA 4GA0A 4A4BA 1OWLA 2RG8A 3E4BA 5KH7A 1NA0A 4CRWA 4DK5A 3O36A 3GV4A 1HZ4A 3LXUX 3T7LA 4MSXA 4I6EA 4JW1A 3FU3A 4G25A 4DPRA 2L80A 1TJCA 2E6SA 2L43A 3HYMB 4GNDA 3IHYA 3TJPA 1S0PA 4HFGA 2Y43A 2FEZA 4QF2A 2RSDA 5BNWA 2HR2A 3NG2A 2C2VS 2WXIA 4ILHB 3ML8A 5LOZA 2NSZA 2VTBA 2ECVA 3ENEA 2J08A 4A55A 3CHOA 1E8YA 2UZGA 3CHQA 3FU6A 2I1KA 1FVHA 4W9RA 5C1DA 2J4BA 5LCWJ 3DPLR 3ASHA 5LKXA 3O35A 3PZDA 4ZUXU 2AVPA 3QAQA 3MGBA 1Z3YA 2XCBA 1DVPA 4GMLA 4QF3A 4R7EA 3OXGA 4I9CA 2FUIA 3UPVA 2NXPA 1Z3XA 1HXIA 3KNVA 3TG4A 1JUQA 2OOEA 3MV3B 1LDKC 3QKYA 3FHEA 4AJWA 3L17A 3L1ZB 2ECIA 3CVLA 1IYMA 2WB2A 4HS2A 3CVUA 3RRMB 2MIQA 3G2TA 3AS5A 3JQ1A 4G26A 2CSZA 4YNDA 4UP0A 4PS8A 3PEUB 2VGYA 2MHKA 4J8SA 1IQUA 3D9IA 4OVVA 2KCLA 4I6GA 1DNPA 2L75A 5FB1A 4DI3A 2E0IA 3ZYMA 3O48A 5G04C 3MV2B 4URKA 2A5UA 2ILRA 2CG2A 2YQ8A 3N9NA 2J4DA 3UT8A 5KJKA 3MKQA 3ESLA 3FH5A 3D9MA 2GRMA 4BWRA 2KIZA 2XGOA 2KM4A 2KR4A 3TGOA 4I6JA 2Q7FA 3I4RB 3LY7A 4A3VA 2VQ2A 5HI7A 4G24A 2LRIC 2WXKA 1WEQA 5TDRA 2IJGX 3T5XA 3KV6A 5A7DB 2EODA 4OYSA 5DBKA 4KVMA 4P5OB 2HDPA 3FDHA 3PUKA 4HLEA 2E6RA 2MUMA 4ME2A 2KREA 4UQXA 1UN8A 4EBAG 2EGPA 2LXHC 2KC7A 2IONA 2YINA 4N3AA 4YADA 2C2LA 2IQCA 3AU4A 5EX3A 4FJCA 3PNLB 4KXKB 4E85A 1HO8A 2MD7B 4N3BA 4WNFA 2VPBA 4X3GA 1HF8A 1EF1C 4ACLA 3VLFA 3N9PA 2WXPA 3N9OA 3FU0A 2X3MA 3BG0B 3AU5A 4EPZA 2D8SA 5TBNA 3MKQB 2IOSA 5B79A 1OUVA 4J6IA 3CKCA 3L22A 4ANUA 3DBSA 2VJFA 1WM5A 2UY1A 3FWVA 4XZ4A 1TJFA 2X6HA 4HOTA 2I6HA 3WXXA 3S7DA 1E8XA 3GYZA 5AIJA 2KE1A 2I9CA 4CDNA 4I9EA 1ZU2A 3D9LA 3CHMA 3KAEA 3L13A 1JOCA 2G45A 2H0DA 4LADB 3HHMA 4I2WA 3OTNA 4BTBA 1N52A 3G2VA 5H1VA 2V8SE 4FJYA 1X4JA 5BT1A 2IU1A 2FI7A 3CGHA 3L16A 3PS6A 4C9BB 3RIBA 2L9BA 2WVIA 5FJYA 2VSNA 1H2VC 4GYOA 1H19A 3G2UA 1VDYA 3RPGC 4C0MA 4KZ0A 2PUYA 3CVYA 2F6NA 3CSFA 1OWNA 4YBMA 2LAHA 2BF0X 4EZLA 1WE9A 2XQ0A 2KU3A 3B7UX 5KJLA 3JCKC 1GW6A 5LCWC 4V3KC 4F1SA 3ZPVE 1HS6A 3LKUA 2PZIA 4HVBA 3GZSA 4CA1A 2XEVA 3R7QA 5LP0A 5G55A 2YT5A 4H7XA 4K03A 2UY1B 3OXLA 2WXJA 4CDRA 5G05C 1HYJA 4UI9J 3ZPJA 3PUJA 3ZGQA 3UT4A 4AM9A 3ZPV1 4JZYA 3SI5A 3SOWA 3SZ7A 2K17A 4GPKA 4O6FA 4N2SA 1Z60A 2H0DB 3C5KA 1UG3A 5BUZA 4TUUA 3U4TA 3PNTB 3CHSA 5ANLA 4F52B 4MLPA 2Y1MA 2V0PA 4DLQA 1Y6IA 4U8HA 4R7LA 3TAXA 4Q6FA 4Q69A 2LGKA 3N9LA 4JHRA 3D9PA 2M63A 5H1TA 3FU5A 3LCAA 1SZAA 2LN0A 1FP0A 1HX8A 2NC9A 3FUHA 1BPOA 3PRZA 5G04B 3MYVA 4FHJA 2L6JA 5EX0A 2FF4A 3ZFWA 4ABNA 1KT1A 2X6FA 1LDJB 3SHBA 4LKAA 3ZN3A 3EB5A 4N3WA 3EB6A 3T6RA 3I3NA 4TV3A 3P2BA 4JEHA 4JA9A 4BTAA 1WGMA 1HU3A 2YQLA 1FVFA 4G11A 1VD4A 5B76A 2JMDA 3IV0A 4ILGA 1KT0A 2XEUA 2ECNA 2MD8C 1MHQA 1XGWA 3U9WA 4KT6B 5FQ8A 5EKQD 3OXFA 4U0UA 3D9NA 4FP7A 2VPGA 1X5BA 1X4IA 5JJTA 2K16A 3MA5A 3FUEA 3ZHEB 3PUQA 3O33A 3QNKA 2J9QA 4JXTA 2YQMA 4B89A 2ECJA 1UJKA 5FQ6A 4O64A 2QIZA 2J07A 1SZ9A 4JHKA 2WQ6A 4GNGA 1G25A 5E76A 4I1AA 5J3XA 3ZYKA 1MM2A 3MHSA 2WQHA 4IC2A 3L1XA 5KJNA 5CCLA 1JWGA 3SOUA 2VYIA 2A4ZA 4MRUA 2M6MA 5BV0A 5LKTA 2WXOA 3RTRB 5DINA 4YBTA 4UP5A 3QARA 3FUKA 3SFZA 5EYAF 1H2TC 5JG6A 3D3MA 4HORA 1OWPA 4FIPA 3UMVA 3JUIA 4EQFA 2I50A 2YURA 1WEPA 2ZU6B 4I7BA 3MHHA 4B8AA 1ZBDB 4WWPA 4PPEA 2IDAA 3FTYA 4N5CA 4YC9A 3ONKA 2FUUA 2Y4TA 4IRUA 1UW4B 4YBSA 3HCSA 1SQMA 1E8ZA 3UQ3A 1WEEA 1QQEA 1EDUA 4EECA 2YSMA 1OWOA 2QFCA 3Q15A 2MRIA 2CFZA 4UQYA 1IQRA 2MT5A 3S7JA 3RPGB 1Z6TA 3TG5A 3GZ2A 5AYWD 2OXQC 5KH3A 4AYCB 4J8DA 2P58C 3LEWA 4L7TA 4CGVA 3EIJA 4AV7A 5FZSA 1ZBPA 3KS2A 3FUDA 2VSYA 3LY8A 2XRZA 5FTPA 3Q4AB 2HM8A 5FB0A 2MA6A 5LCWB 3JYSA 4Q94A 1FCHA 2J09A 3BEEA 5D1LB 4EBAA 2KWOA 2WXFA 4JL0A 4UQZA 4F53A 3HTKC 3MKRA 2BTDA 4LLBA 4MVTA 3SD5A 3SBTB 3P1UA 2LAIA 3CVPA 5JJ7A 5G05B 4XI0A 3D9KA 3QC1A 3FUIA 4FULA 3EHMA 2BAYA 5HQ8A 2PL2A 4UI9C 4UWGA 4APFA 4V3IA 2VSXE 3VLDA 4BX9A 5FERA 2Y3AA 4XI1A 4ANVA 3Q47B 1NA3A 5CHEE 4DJAA 3U66A 4LUNU 4NQ0A 1IYGA 3SNXA 2XPIA 3EDTB 2WXLA 3PHDA 1EPUA 2AXUA 2LNIA 3HCTA 3TXNA 2CFUA 4FADA 2KWKA 2HYED 3U5OA 2GW1A 5B77A 4PDXA 3TL5A 3GW4A 5AJDA 3ULQA 4DLOA 2LV9A 1XNFA 4FK5A 4A1SA 4CT4A 4U07A 1ELWA 3ONLA 1OWMA 2PQNA 4HOUA 2AW6A 3RKVA 2LO6A 3MJWA 3ZYLA 4Y6CA 2CHZA 1B89A 3FTUA 3QJZA 2IFUA 4AXHA 2FBNA 3FUNA 2XPYA 1WIMA 4GNFA 3O7AA 2PQRA 4KBQA 2YHEA 3ZYQA 3V43A 4TKPB 2VGXB 4M3OA 4WNDA 5D0OD 2VPEA 2XRYA 4JEUA 3EIQC 2WXNA 4XIFA 5TABA 3FEXA 3L08A 4G2VA 4J8FA 1JPLA 3O4ZA 3FFLA 4CEMA 2L5UA 5JHBA 2MA5A 4XI9A 4AOFA 3ML9A 4BHWA 4NURA 2KCVA 2YYRA 5I3LA 4RG9A 1U6GB 2LGGA 4N4FA 3PURA 4APOA 3MCXA 3APFA 4G23A 3M63A 2BUGA 5C13A 2R17C 4HOQA 3U5PA 3IHVA 3HDXA 2DX8A 3HVEB 1PC2A 5BPPA 3MEKA 3CIAA 2LSUA 4L58A 1HG5A 2V5FA 5B78A 1ELKA 3LRQA 4YATA 2M1RA 4RG6A 4E6HA 1WESA 1WEUA 3MX3A 4L2LA 2EA6A 1W3BA 3I2DA 3LVQE 3S7BA 1E90A 4FLBA 2CHWA 4GYYA 3CQGB 2KZTB 4GA2A 4ILIA 3CVWA 1H6KA 4NACA 2KFTA 1WY6A 4JHJA 5JJ6A 3SGHA 3K9IA 4U63A 4QFVA 1H2UA 3Q49B 5KJMA 2MNZA 3RU0A 3NF1A 4A1GA 3AS4A 2OV8A 2EQXA 4IC3A 2WQ7A 3UX4A 3CVNA 2WXRA 2PM6A 1TEZA 5KCMA 5D1MB 2XGSA 2X6KA 1WFKA 3NQPA 3GZ1A 1WAO1 4EZJA 2KWJA 4F3VA 3IHPA 3FUJA 1XWHA 4ANXA 4LJNA 5T4YA 2AXZA 2XPZA 2YHCA 4WZ2A 3ZHEA 1LF8A 3RO3A 2WXMA 1P5QA 2VJEA 2X6IA 1PAQA 3N9QA 1E4UA 4B7YC 3PH0C 3L54A 3LPZA 2LGLA 4FO9A 4BT9A 4P29A 3PE3A 2WXGA 4KZCA 3CHPA 4YVQC 3CKBA 2KCKA 3QOUA 2KGIA 4I7CA 4GMJA 4JVSA 2YSJA 2L0BA 3O34A 2CG3A 3ZEFA 5LX8A 2WXHA 2PNXA 4GZCA 3FULA 3IBEA 4UI9B 3LS8A 3LY9A 1INZA 3QWVA 2X6JA 3PEVB 4WUYA 1H0AA 4GYWA 4GZ3A 3O70A 3LJ3A 4UWFA 3NZSA 5FQ4A 1UN9A 4A0CD 5FQ7A 3ZW3A 4C0EA 3D9OA 5E75A 1QZ2A 3SOXA 5G2NA 4OVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IN3 B;  4I17 A;  3HCS A;  4I7D A;  1WEM A;  3KV6 A;  3UQ3 A;  1WEN A;  5A7D B;  1YA0 A;  2EOD A;  3RO2 A;  3CV0 A;  3PE4 A;  1FBV A;  2ECW A;  5DBK A;  1WEE A;  4LK9 A;  5LKU A;  1QQE A;  4P5O B;  2HDP A;  2YSM A;  4W4U A;  2WPV A;  2KWN A;  4WZ0 A;  4GZ6 A;  1HYI A;  2MNY A;  1WIL A;  2E6R A;  2MUM A;  4ME2 A;  2KRE A;  2QFC A;  4UQX A;  3Q15 A;  4UQY A;  2EGP A;  2M85 A;  2LXH C;  2Y1N A;  2KC7 A;  2MT5 A;  5D1K B;  4N3A A;  3S7J A;  4YAD A;  1K2F A;  4S3O C;  2C2L A;  3N71 A;  3RPG B;  5EX3 A;  3TG5 A;  3GZ2 A;  3R9A B;  4FJC A;  2VJE B;  1Z2Q A;  4KXK B;  5AYW D;  2OXQ C;  5KH3 A;  4AYC B;  4J8D A;  1KLX A;  2C0L A;  2P58 C;  4N3C A;  4ZDT A;  4CGV A;  5FZS A;  1ZBP A;  2RI7 A;  3KS2 A;  3LY8 A;  2VSY A;  2MD7 B;  4YAB A;  4N3B A;  4WNF A;  5FTP A;  3Q4A B;  2VPB A;  3GL6 A;  4X3G A;  5FB0 A;  1T1H A;  2E2E A;  2MA6 A;  5LCW B;  3JYS A;  5G04 J;  1FCH A;  2VJF B;  3U3W A;  3N9P A;  3BEE A;  2K4D A;  5H9M A;  3U5M A;  4BBQ A;  1Z6U A;  1VYX A;  3N9O A;  5D1L B;  2JMI A;  2KWO A;  4JL0 A;  4UQZ A;  3HTK C;  3MKR A;  2M3H A;  2QJ0 A;  2FO7 A;  2F42 A;  4LLB A;  4H7Y A;  5LKZ A;  2YRE A;  2D8S A;  5TBN A;  4MVT A;  4YAX A;  4AYC A;  4AIF A;  5B79 A;  1JM7 A;  3KV5 A;  1OUV A;  2K1J A;  1HH8 A;  3CVP A;  3CKC A;  5JJ7 A;  2KYU A;  5G05 B;  4XI0 A;  4PTB A;  4GCN A;  3CK7 A;  4NRH B;  1WM5 A;  2UY1 A;  2VJF A;  3URZ A;  2BAY A;  3FWV A;  2VPD A;  5HQ8 A;  2DBA A;  1ELR A;  2PL2 A;  4UI9 C;  4HOT A;  2I6H A;  3LQH A;  2CSY A;  4Y6W A;  3LQJ A;  3WXX A;  3S7D A;  3GYZ A;  2KGG A;  2LDR A;  2KE1 A;  5CCM A;  2CT2 A;  3CK9 A;  5C11 A;  1CHC A;  5DKA A;  2IF4 A;  5FER A;  4WA6 A;  4XI1 A;  2Y4U A;  3N9M A;  3CEQ A;  3Q47 B;  4I9E A;  5M72 A;  3VTX A;  1ZU2 A;  2YW8 A;  1NA3 A;  4GA1 A;  2CKL B;  3KAE A;  1JOC A;  5CHE E;  2G45 A;  2H0D A;  3ZVZ B;  4LAD B;  2YHN A;  5AIT A;  2YHO A;  4I2W A;  4BTB A;  4NQ0 A;  1IYG A;  3M99 A;  1BOR A;  2XPI A;  1MM3 A;  5H1V A;  4AUQ B;  1X4U A;  3EDT B;  1X4J A;  4U04 A;  5BT1 A;  3U5N A;  3QDN A;  3PHD A;  2FI7 A;  5A6C A;  2UWJ G;  3LYA A;  2JRJ A;  4WNE A;  2LNI A;  3RIB A;  3HCT A;  1IHG A;  4AP4 A;  4U0S A;  5FJY A;  2VSN A;  4GYO A;  2KWK A;  2HYE D;  3U5O A;  3FL2 A;  5B75 A;  2CKL A;  2GW1 A;  3RPG C;  3ASG A;  5B77 A;  5FZR A;  3GW4 A;  4B94 A;  2YUC A;  4NN2 A;  2PUY A;  4BT8 A;  4U0Z A;  3CK8 A;  3QZV A;  2F6N A;  3VK6 A;  3ULQ A;  2LV9 A;  3CVQ A;  4YBM A;  1XNF A;  4FK5 A;  4A1S A;  4J0U A;  4U07 A;  1ELW A;  1WE9 A;  2ECG A;  2KU3 A;  4WNG A;  1F62 A;  5KJL A;  5LCW C;  5G05 J;  4V3K C;  3ZPV E;  2PQN A;  4HOU A;  3RKV A;  3LKU A;  4AY6 A;  1WEV A;  1WEO A;  2PZI A;  4Y6C A;  5G0F A;  1B89 A;  3IEG A;  4CA1 A;  4AY5 A;  2XEV A;  1JM7 B;  4KYO B;  3L11 A;  2IFU A;  1VFY A;  2FBN A;  4UI9 K;  2G6Q A;  1WIM A;  2YT5 A;  4GNF A;  3ZNI A;  4H7X A;  4B86 C;  3O7A A;  2PQR A;  4WZ3 B;  4KBQ A;  4CCG X;  2C0M A;  3ZYQ A;  1N87 A;  3V43 A;  4TKP B;  3S7F A;  3AS8 A;  5ARF A;  2UY1 B;  3OXL A;  5KH9 A;  4N2Q A;  4I2Z A;  3UUX A;  2VGX B;  4CDR A;  5G05 C;  4GA0 A;  4WND A;  5DIZ A;  1HYJ A;  4UI9 J;  3ZPJ A;  4HOS A;  4A4B A;  5D0O D;  2VPE A;  4AM9 A;  3RJV A;  3ZGQ A;  3ZPV 1;  3E4B A;  4YBS A;  3SOW A;  3SZ7 A;  5KH7 A;  1NA0 A;  2K17 A;  4GPK A;  4XIF A;  4O6F A;  3DQV R;  3FP3 A;  3O36 A;  5TAB A;  4N2S A;  1HZ4 A;  3GV4 A;  3T7L A;  2LSV A;  3Q5M A;  4MSX A;  4G2V A;  1Z60 A;  2H0D B;  4G25 A;  4CGW A;  4J8F A;  3C5K A;  3FFL A;  2L5U A;  2L80 A;  1TJC A;  2E6S A;  2VGX A;  2MA5 A;  3U4T A;  2XGM A;  2NAA A;  4XI9 A;  4GB0 A;  2L43 A;  3VTY A;  4BHW A;  2KCV A;  2XB1 A;  4F52 B;  2Y1M A;  2YYR A;  3HYM B;  4RG9 A;  4GND A;  5I3L A;  3TAX A;  3KD7 A;  4Q6F A;  5D0Q D;  1U6G B;  2F6J A;  2LGG A;  4GNE A;  4N4F A;  3PUR A;  4APO A;  1V87 A;  2LGK A;  2Y43 A;  4G23 A;  3M63 A;  2FEZ A;  3N9L A;  4JHR A;  4QF2 A;  2RSD A;  5BNW A;  2HR2 A;  2ZET C;  2BUG A;  3NG2 A;  2C2V S;  5C13 A;  5H1T A;  4HOQ A;  3U5P A;  3LCA A;  2ECV A;  3KQI A;  2LN0 A;  1FP0 A;  2DX8 A;  2NC9 A;  4J8E A;  1PC2 A;  3MEK A;  2UZG A;  5G04 B;  2LSU A;  5H1U A;  4GCO A;  4L58 A;  2L6J A;  4JA7 A;  2V5F A;  5B78 A;  5EX0 A;  3LRQ A;  2FF4 A;  4W9R A;  3ZFW A;  5C1D A;  2LQ6 A;  4YAT A;  4ABN A;  2M1R A;  4RG6 A;  5LCW J;  1WES A;  3DPL R;  1KT1 A;  3ASH A;  1WEU A;  5LKX A;  4AVX A;  3ASL A;  3HCU A;  1LDJ B;  3SHB A;  3O35 A;  4ZUX U;  5FEY A;  4LKA A;  3ZN3 A;  2EA6 A;  2AVP A;  1W3B A;  3EB5 A;  3I2D A;  4N3W A;  3EB6 A;  3S7B A;  3T6R A;  3ESK A;  4GYY A;  2XCB A;  4GA2 A;  1DVP A;  4JA9 A;  3C6W A;  4LEU A;  4QF3 A;  2G43 A;  4BTA A;  1WGM A;  4R7E A;  2YQL A;  3O37 A;  1Y8M A;  3OXG A;  2KFT A;  4I9C A;  2FUI A;  2AN6 A;  1VD4 A;  3UPV A;  4A4C A;  5JJ6 A;  5B76 A;  2JMD A;  1RMD A;  3K9I A;  1KT0 A;  2XEU A;  2ECN A;  1HXI A;  5FT9 A;  2VP7 A;  3KNV A;  2MD8 C;  2HO1 A;  3TG4 A;  4G1T A;  3Q49 B;  4ZQL A;  5KJM A;  2MNZ A;  3RU0 A;  3NF1 A;  5FZQ A;  5EKQ D;  3OXF A;  3AS4 A;  2OOE A;  3MV3 B;  1LDK C;  4U0U A;  4IC3 A;  4R2Y A;  2VPG A;  2QIC A;  3QKY A;  3CVN A;  1X4I A;  5JJT A;  3ASF A;  2K16 A;  3L1Z B;  5BW8 C;  3MA5 A;  3ZHE B;  2ECI A;  2LGV A;  3O33 A;  3PUQ A;  3CVL A;  1IYM A;  2OND A;  3M62 A;  2J9Q A;  5D1M B;  2XGS A;  2YQM A;  3QWW A;  4V3L C;  2ECJ A;  2MIQ A;  1WFK A;  1E96 B;  1WEW A;  3AS5 A;  3GZ1 A;  4O64 A;  1WAO 1;  4G26 A;  4S3O B;  2JMJ A;  2CSZ A;  2KWJ A;  4F3V A;  4YND A;  3IHP A;  4UP0 A;  2QIZ A;  3ZVY A;  2VGY A;  2MHK A;  1XWH A;  4LJN A;  4GNG A;  1G25 A;  2YHC A;  4WZ2 A;  3ZHE A;  3RO3 A;  4I1A A;  5J3X A;  1P5Q A;  2VJE A;  1MM2 A;  3N9Q A;  1E4U A;  3MHS A;  2WQH A;  4B7Y C;  4IC2 A;  3L1X A;  3LQI A;  3LPZ A;  5KJN A;  5TRB A;  5CCL A;  4C9Z A;  2KCL A;  2LGL A;  4FO9 A;  3SOU A;  2VYI A;  3QWP A;  2L75 A;  4BT9 A;  5FB1 A;  3O48 A;  5G04 C;  4L7X A;  2M6M A;  5LKT A;  3MV2 B;  3PE3 A;  3RTR B;  5DIN A;  4YBT A;  4UP5 A;  4YVQ C;  3CKB A;  2KCK A;  5AIU A;  3QOU A;  2YQ8 A;  2KGI A;  4I7C A;  2YSJ A;  3N9N A;  5B8D A;  4R8P K;  4N39 A;  2L0B A;  5KJK A;  2YU4 A;  3O34 A;  3ZTG A;  5EYA F;  3PDN A;  5ARG A;  2PNX A;  5JG6 A;  4HOR A;  4YVO A;  4FIP A;  4UI9 B;  1A17 A;  4EQF A;  4GZ5 A;  3LY9 A;  2ECT A;  2LXP C;  3QWV A;  2I50 A;  4BWR A;  1NZN A;  2YUR A;  4WUY A;  2XCC A;  2KIZ A;  4GYW A;  1WEP A;  4GZ3 A;  2XGO A;  3ASD A;  2KR4 A;  3TGO A;  3O70 A;  2Q7F A;  3LY7 A;  4I7B A;  2VQ2 A;  5HI7 A;  4A0C D;  4G24 A;  3MHH A;  2LRI C;  2R5S A;  1ZBD B;  2FSA A;  4PPE A;  2IDA A;  1QZ2 A;  2KAT A;  2HYZ A;  4N5C A;  1WEQ A;  5TDR A;  5TDW A;  3SOX A;  4YC9 A;  2FUU A;  2Y4T A;  3SF4 A;  2JLB A;  4A49 A;  2VNF A; 
#chains in the Genus database with same CATH topology
 3UT7 A;  4ANW A;  3ZXS A;  1WEN A;  3PE4 A;  4U96 D;  4LK9 A;  5LKU A;  3B7S A;  4BEP A;  2KWN A;  2MOW A;  4KMO A;  3BG1 B;  2L7P A;  4GZ6 A;  2MNY A;  4NIK A;  4PS3 A;  2M85 A;  4CCA A;  5D1K B;  4HRN A;  4S3O C;  3N71 A;  4GAA A;  2H6F A;  4XKC A;  1H6O A;  2R05 A;  3C5R A;  2FD4 A;  2RFM A;  2VJE B;  1Z2Q A;  5EID A;  5LFA A;  2DJA A;  2C0L A;  2AWI A;  4N3C A;  2V4L A;  2CSV A;  4GZD A;  4YAB A;  3FH8 A;  4XKB A;  4WWO A;  1T1H A;  2E2E A;  3WG7 E;  5B1B E;  3HXD A;  4UWL A;  1UJJ A;  2DIW A;  2FFW A;  3U5M A;  2K4D A;  5H9M A;  4BBQ A;  5CRV A;  1E7U A;  1Z6U A;  4QQ4 A;  3L82 A;  3T5V A;  1S64 A;  2DCP A;  2P9L G;  2L0T B;  2M3H A;  2L0I A;  3B7R L;  2FO7 A;  3V31 A;  1Q2Z A;  5LKZ A;  2P2C P;  3NZU A;  4YAX A;  4AYC A;  4AIF A;  1JM7 A;  2FUL A;  3B7T A;  1HFA A;  2ZIR A;  1HH8 A;  5ANR A;  3R7R A;  4ATZ D;  2K1J A;  3SY2 A;  2KYU A;  4PTB A;  4GCN A;  4NRH B;  3URZ A;  4UWH A;  2VPD A;  2DBA A;  5AQA A;  3TWW A;  4Y6W A;  3LQJ A;  5FIO A;  2KGG A;  2V5Q C;  2LDR A;  5CCM A;  2CT2 A;  5C11 A;  1OCC E;  4XE0 A;  3JXJ A;  2GGF A;  4RVB A;  2IF4 A;  3N9M A;  3CEQ A;  5M72 A;  3VTX A;  2YW8 A;  2CKL B;  4GA1 A;  3TWR A;  3ZVZ B;  2YHN A;  4KVO A;  2YHO A;  4OAU C;  3RRN B;  1MBM A;  4TRQ A;  4A3T A;  4MS6 A;  3TWT A;  1MM3 A;  1N54 A;  4AUQ B;  4U04 A;  3U5N A;  3QDN A;  1N9A A;  2UWJ G;  3LYA A;  4BFR A;  4RSY A;  2JRJ A;  2ETC A;  4PH4 B;  4FC8 A;  1TYQ G;  4AP4 A;  4U0S A;  4B0Z A;  3ASG A;  1ZB1 A;  1U3D A;  5FZR A;  4MKT A;  4O62 A;  2ZGG A;  3JUE A;  3I5P A;  3CK8 A;  1JCS A;  5ENQ D;  3SHF A;  3QZV A;  3VK6 A;  1PY1 A;  5AQ7 A;  3CVQ A;  5AN8 A;  1LD8 A;  2X38 A;  1UOH A;  2I2O A;  5G05 J;  3EJN A;  2H6I A;  2ETB A;  2I1J A;  1WEO A;  5G0F A;  2RD0 A;  3IEG A;  4AY5 A;  1JM7 B;  3NBN B;  5HRY A;  3L11 A;  4UI9 K;  2G6Q A;  1KZP A;  2DYS E;  4CCG X;  2C0M A;  1N87 A;  2XS1 A;  5ARF A;  5T3R A;  5KH9 A;  4N2Q A;  3PLW A;  3QK0 A;  1E7V A;  5DIZ A;  4HOS A;  3CVV A;  3RJV A;  4CZ2 D;  1IHB A;  2WM9 A;  3DQV R;  3FP3 A;  5T8I A;  3G2S A;  4ATG A;  4U8V D;  2LSV A;  3Q5M A;  4DX5 D;  3C98 A;  3LJN A;  4LER A;  1SA5 A;  5CMY A;  4CGW A;  1N4P A;  3FY4 A;  3DPD A;  2VTB B;  4GB9 A;  1JWF A;  1N0Q A;  2VGX A;  2XGM A;  2NAA A;  4GB0 A;  4I43 A;  4GMR A;  3VTY A;  5CMW A;  2XB1 A;  2F0Y A;  4UUC A;  3APD A;  4PUC A;  3KD7 A;  5D0Q D;  3D9J A;  2F6J A;  2XEE A;  4GNE A;  3L6A A;  2XOY A;  1V87 A;  1OCR E;  3FTV A;  1K8K G;  3ZU7 B;  1OY3 D;  2ZET C;  3RRU A;  3KQI A;  1O1S A;  5AJL A;  1D9S A;  1D8E A;  4CT0 A;  3RK6 A;  4J8E A;  4L2Y A;  3G2W A;  1X81 A;  3DEO A;  5H1U A;  4L1B A;  4GCO A;  3SUB A;  3APC A;  4JA7 A;  3Q9U C;  3CQC B;  2LQ6 A;  3OAW A;  3VLE A;  4AVX A;  3ASL A;  3HCU A;  5FEY A;  4LCT A;  4TUM A;  3ESK A;  4FLH A;  2GRL A;  3C6W A;  3HVE A;  4LEU A;  1YCS B;  2IOL A;  2G43 A;  4K0R A;  1JCQ A;  3O37 A;  2JEK A;  1Y8M A;  2AN6 A;  3UM2 A;  1MX2 A;  5KNG A;  5KNH D;  4A4C A;  3FUM A;  1RMD A;  4UWK A;  3ZRH A;  5FT9 A;  2VP7 A;  2HO1 A;  4G1T A;  4ZQL A;  5FZQ A;  3ISM C;  4R2Y A;  3SQV A;  2QIC A;  2KZT A;  1MX6 A;  3PZ2 A;  3FTX A;  4GU5 A;  3ASF A;  3T8M A;  5BW8 C;  2R59 A;  4BSX A;  5FWQ A;  4RLY A;  2LGV A;  3EHN A;  2OND A;  1HG2 A;  3M62 A;  2DWZ A;  3O47 A;  3QWW A;  4V3L C;  3SBS A;  5KWD A;  1E96 B;  1WEW A;  3FEH A;  4CYM D;  4S3O B;  2JMJ A;  3KSQ A;  3DRA A;  3LDZ A;  4ACK A;  4IUL A;  4AEZ C;  3ZVY A;  4EZK A;  2GRP B;  3QB2 A;  3ZXP A;  4DI4 A;  4L23 A;  2VSO E;  2KKX A;  1WG0 A;  1O1T A;  4JPS A;  4BY6 A;  4DRX E;  4JC8 A;  2YNQ A;  4RQI A;  4I1O B;  3UKR G;  1K1B A;  3LQI A;  3C72 A;  5TRB A;  3LVR E;  4C9Z A;  3CVX A;  1N4S A;  2OCC E;  3QWP A;  4Z68 A;  2AXV A;  1H6P A;  1BI8 B;  3UM1 A;  4L7X A;  3RSE G;  4IYP A;  2WXQ A;  2OVB A;  2WMN A;  5B1A E;  2XHE A;  1TNZ A;  2QZA A;  5AIU A;  1N11 A;  1QNF A;  3I4G A;  4CDM A;  5B8D A;  4R8P K;  4N39 A;  4LSZ E;  2YU4 A;  3B13 A;  4I1M A;  3ZTG A;  3PDN A;  5ARG A;  1DC2 A;  4YVO A;  5ENT D;  5J08 A;  1A17 A;  2CHX A;  4GZ5 A;  2ECT A;  2LXP C;  3FTW A;  1U3C A;  1NZN A;  2XCC A;  2P9P G;  3ASD A;  5BV1 A;  1N4Q A;  1O1R A;  3E2D A;  2R5S A;  1EYH A;  2FSA A;  5C2Y A;  1FPP A;  2KAT A;  2HYZ A;  1JCR A;  5TDW A;  3SF4 A;  2JLB A;  4A49 A;  2VNF A;  4IN3 B;  4I17 A;  4I7D A;  1WEM A;  1YA0 A;  3BQO A;  3RO2 A;  3CV0 A;  2ECW A;  3MZL B;  1FBV A;  2QY7 A;  1IKN D;  5J90 A;  4W4U A;  2WPV A;  4WZ0 A;  1L5J A;  4O1P A;  1HYI A;  1WIL A;  1SW6 A;  3JQ0 A;  5BXO A;  3CHR A;  2PM7 A;  2Y1N A;  1O5M A;  4FHK A;  3U64 A;  3KEZ A;  1K2F A;  3ZIM A;  3R9A B;  2JUN A;  1NP7 A;  2ZGD A;  3DSW A;  1KLX A;  4ZDT A;  1KPS B;  2RI7 A;  2GRQ B;  3GL6 A;  3S2A A;  5G04 J;  4AP2 A;  2VJF B;  3U3W A;  1VYX A;  2JMI A;  2J49 A;  4HXI A;  1KZO A;  2QJ0 A;  3NOG D;  5AEN A;  4F7A A;  2F42 A;  2P9S G;  3IKO B;  3FTZ A;  4H7Y A;  2WMO A;  3ZVV A;  2YRE A;  4FJZ A;  3KV5 A;  4XX5 A;  3UIP C;  3W9G A;  2JM3 A;  3UIN C;  3CK7 A;  3HXB A;  1NFI E;  1ELR A;  3LQH A;  2CSY A;  3EHQ A;  3CK9 A;  3EU9 A;  1CHC A;  3IXE A;  4WAF A;  5DKA A;  4WA6 A;  2Y4U A;  5CEC B;  3FTS A;  4XEI G;  3CLJ A;  1MYO A;  4BX8 A;  1TNU A;  5AIT A;  3CR3 A;  4LRZ A;  3FUF A;  3M99 A;  3FH7 A;  1BOR A;  2GRR B;  1X4U A;  1AP7 A;  2BKG A;  3PVL A;  5A6C A;  2B6C A;  4L9P A;  4WNE A;  4FU3 A;  1MQS A;  5EDS A;  3RAU A;  4DX2 A;  3PZ1 A;  1IHG A;  5A23 A;  4Q96 A;  3CST A;  4OGC A;  3FL2 A;  5B75 A;  2CKL A;  4FA6 A;  4D10 C;  3FJU B;  4B94 A;  2YUC A;  4NN2 A;  4BT8 A;  2CRW A;  4U0Z A;  3Q1D A;  5SVX A;  3TWV A;  2MKE A;  2OVF A;  4J0U A;  4B8C B;  2ECG A;  3HIZ A;  5ENN A;  5JHA A;  1F62 A;  1DCQ A;  4WNG A;  3W9F A;  2VJ8 A;  1QYM A;  2JAB A;  4AY6 A;  2PNN A;  1WEV A;  3TXM A;  4GTP A;  4WWN A;  4KYO B;  2DYR E;  3V2X A;  1VFY A;  4PS7 A;  1N94 A;  3ZNI A;  4B86 C;  4WZ3 B;  1HE8 A;  3S7F A;  3AS8 A;  4I2Z A;  3UUX A;  5CBN A;  3B7B A;  3FEY A;  3PRE A;  1E8W A;  4GA0 A;  3ZKJ A;  2QYU A;  4A4B A;  1OWL A;  2RG8 A;  3E4B A;  3SFX A;  5KH7 A;  4YDE A;  1NA0 A;  4CRW A;  4DK5 A;  4N5Q A;  3O36 A;  3GV4 A;  1HZ4 A;  3LXU X;  3T7L A;  5AAR A;  4MSX A;  4I6E A;  4JW1 A;  3FU3 A;  4G25 A;  4DPR A;  1TNO A;  1TNY A;  5BXU A;  1SVX A;  2L80 A;  1TJC A;  2E6S A;  1WDY A;  2L43 A;  2F8X K;  3HXC A;  3HYM B;  4GND A;  3IHY A;  3TJP A;  1S0P A;  4HFG A;  5CRU A;  3HRA A;  2Y43 A;  2FEZ A;  4QF2 A;  2RSD A;  5BNW A;  2HR2 A;  3NG2 A;  4HLL A;  2C2V S;  2WXI A;  4ILH B;  3ML8 A;  5LOZ A;  4LNG A;  2NSZ A;  2VTB A;  2ECV A;  3ENE A;  2J08 A;  4A55 A;  3CHO A;  1E8Y A;  4M7C A;  2UZG A;  3CHQ A;  3FU6 A;  2I1K A;  1FVH A;  4W9R A;  5C1D A;  2J4B A;  1N0R A;  5LCW J;  3DPL R;  3ASH A;  5LKX A;  3O35 A;  3PZD A;  4ZUX U;  4GPM A;  3H7H A;  2V4H C;  3HXE A;  3Q9N C;  2AVP A;  3T9K A;  3QAQ A;  2YVR A;  3ABM E;  4HBD A;  3MGB A;  1Z3Y A;  2XCB A;  1DVP A;  1NI1 A;  1OT8 A;  1K1A A;  4GML A;  4QF3 A;  4R7E A;  1OCZ E;  3OXG A;  4I9C A;  2FUI A;  4EHM A;  3AJI A;  3UPV A;  2NXP A;  1Z3X A;  2DZN A;  1HXI A;  1BLX B;  3KNV A;  3TG4 A;  2F8Y A;  1JUQ A;  2OOE A;  3MV3 B;  1LDK C;  3QKY A;  4AJW A;  3FHE A;  3D9H A;  3L17 A;  4TXR A;  3L1Z B;  1D8D A;  3UTM A;  3TWX A;  2ECI A;  2ZIS A;  3CVL A;  1IYM A;  1LTX A;  2WB2 A;  4Z0R A;  3DSX A;  4HS2 A;  1S70 B;  3CVU A;  5CBO A;  3RRM B;  3M7K A;  4U8Y D;  2MIQ A;  3G2T A;  3AS5 A;  3JQ1 A;  4G26 A;  2CSZ A;  4YND A;  1FT2 A;  2BKK B;  4PS8 A;  4UP0 A;  3PEU B;  2VGY A;  2MHK A;  4J8S A;  1IQU A;  3D9I A;  3V79 K;  4OVV A;  2KCL A;  1MX4 A;  4I6G A;  1DNP A;  2L75 A;  5FB1 A;  5SVY A;  4DI3 A;  2E0I A;  3ZYM A;  3O48 A;  5G04 C;  5AAO A;  4MBG A;  3MV2 B;  3T8K A;  2IO3 C;  5FIN A;  2LXL A;  3FM8 C;  4URK A;  2A5U A;  2ILR A;  2CG2 A;  2YQ8 A;  3Q78 A;  2OEW A;  3N9N A;  2J4D A;  3KDE C;  3X2Q E;  3DEP A;  3UT8 A;  5KJK A;  3MKQ A;  3ESL A;  3FAO A;  2J8S D;  4OAV B;  3FH5 A;  3AG4 E;  3UI2 A;  3JXI A;  2R2L A;  4J7W A;  3D9M A;  5EIL A;  2GRM A;  1LD7 A;  1YMP A;  4BWR A;  2LUH A;  2KIZ A;  4X8Q A;  2XGO A;  2KM4 A;  4LNU D;  2KR4 A;  3SO8 A;  3TGO A;  4I6J A;  2Q7F A;  3I4R B;  3LY7 A;  4A3V A;  4G8L A;  3E30 A;  2VQ2 A;  3ABK E;  5HI7 A;  4G24 A;  2LRI C;  4K5B A;  2WXK A;  4K5C A;  1WEQ A;  5TDR A;  2IJG X;  1TR4 A;  2QYJ A;  3T5X A;  2DSM A;  3KV6 A;  5A7D B;  2EOD A;  1K3Z D;  4OYS A;  5DBK A;  4KVM A;  4P5O B;  2HDP A;  3FDH A;  3ULY A;  3PUK A;  4HLE A;  2E6R A;  5ENP D;  2MUM A;  4ME2 A;  2KRE A;  4UQX A;  1UN8 A;  4EBA G;  2EGP A;  3LJU X;  2LXH C;  2KC7 A;  2ION A;  4F6R D;  2YIN A;  4N3A A;  4YAD A;  2C2L A;  2IQC A;  3AU4 A;  5EX3 A;  4FJC A;  2H6H A;  3PNL B;  4KXK B;  4E85 A;  1HO8 A;  2MD7 B;  1BD8 A;  4N3B A;  4WNF A;  2VPB A;  4X3G A;  4QQI A;  4HI8 A;  1FT1 A;  1HF8 A;  4YDY A;  3Q79 A;  1EF1 C;  2RFA A;  4ACL A;  3VLF A;  3N9P A;  2MYO A;  2WXP A;  3KEA A;  3N9O A;  3FU0 A;  2X3M A;  3BG0 B;  4H9D A;  3AU5 A;  4EPZ A;  3PZ3 A;  2D8S A;  5TBN A;  4GTV A;  3MKQ B;  2IOS A;  5B79 A;  1OUV A;  4J6I A;  3CKC A;  3L22 A;  3TWU A;  2KXP C;  4ANU A;  3DXK G;  3NAW A;  3DBS A;  1WM5 A;  2UY1 A;  2VJF A;  3FWV A;  4XZ4 A;  1TJF A;  2X6H A;  3AG3 E;  4HRL A;  4HOT A;  2I6H A;  2VGE A;  1BI7 B;  3WXX A;  3AG1 E;  3S7D A;  1E8X A;  3GYZ A;  5AIJ A;  2LAU A;  2KE1 A;  3E33 A;  2I9C A;  2XS8 A;  4CDN A;  2L6B A;  4I9E A;  2DVW A;  3HG0 D;  1ZU2 A;  3D9L A;  3CHM A;  3KAE A;  3L13 A;  1JOC A;  2G45 A;  2H0D A;  4LAD B;  2P57 A;  3HHM A;  3DWL G;  4I2W A;  4J8Y A;  3OTN A;  4BTB A;  1N52 A;  3G2V A;  5H1V A;  2LXM A;  2V8S E;  4U7E B;  4FJY A;  1X4J A;  2IO2 C;  5BT1 A;  2IU1 A;  2FI7 A;  3CGH A;  3L16 A;  3PS6 A;  4C9B B;  3RIB A;  2L9B A;  2WVI A;  2EIK E;  5FJY A;  2VSN A;  1H2V C;  4GYO A;  1H19 A;  3G2U A;  1VDY A;  3RPG C;  3E37 A;  1OCO E;  3EHR A;  3ABL E;  4C0M A;  4KZ0 A;  2PUY A;  3CVY A;  2F6N A;  3CSF A;  1OWN A;  4YBM A;  2P9I G;  2LAH A;  2BF0 X;  2Y1L E;  4EZL A;  1WE9 A;  2XQ0 A;  2KU3 A;  3B7U X;  2XOZ A;  5KJL A;  3JCK C;  1GW6 A;  1N4R A;  4HQD A;  5LCW C;  4V3K C;  4F1S A;  3ZPV E;  3Q73 A;  1HS6 A;  3LKU A;  2PZI A;  3SFY A;  4HVB A;  3GZS A;  4CA1 A;  2XEV A;  3R7Q A;  5LP0 A;  5G55 A;  2YT5 A;  4H7X A;  4K03 A;  3EUV A;  2UY1 B;  3OXL A;  2WXJ A;  4CDR A;  5G05 C;  1MZC A;  1HYJ A;  4UI9 J;  3ZPJ A;  3PUJ A;  3ZGQ A;  3UT4 A;  4AM9 A;  3ZPV 1;  4JZY A;  3SI5 A;  3SOW A;  3SZ7 A;  2K17 A;  4GPK A;  4O6F A;  4DX7 D;  5ENS D;  4N2S A;  1Z60 A;  2H0D B;  2EIN E;  3C5K A;  1UG3 A;  5BUZ A;  5K3Q A;  4TUU A;  3U4T A;  3UXG A;  3PNT B;  1S63 A;  3CHS A;  5ANL A;  4F52 B;  4MLP A;  2Y1M A;  2V0P A;  4DLQ A;  1Y6I A;  4U8H A;  4R7L A;  3TAX A;  4Q6F A;  4BSZ B;  4Q69 A;  2LGK A;  3N9L A;  4JHR A;  5KBA A;  4LNB A;  3D9P A;  2M63 A;  5H1T A;  3FU5 A;  2P9N G;  3E32 A;  3LCA A;  1SZA A;  2LN0 A;  1FP0 A;  3DSS A;  1HX8 A;  2NC9 A;  3BUA A;  3FUH A;  1BPO A;  3PRZ A;  5G04 B;  3MYV A;  4FHJ A;  2L6J A;  5EX0 A;  4C48 B;  2FF4 A;  3ZFW A;  4ABN A;  1KT1 A;  2X6F A;  1LDJ B;  3SHB A;  4LKA A;  3ZN3 A;  3EB5 A;  4N3W A;  3EB6 A;  3T6R A;  3I3N A;  4TV3 A;  3P2B A;  4JEH A;  4JA9 A;  4BTA A;  1WGM A;  1HU3 A;  2YQL A;  1FVF A;  4G11 A;  2E61 A;  1VD4 A;  4HI9 A;  5B76 A;  2JMD A;  3IV0 A;  4ILG A;  1KT0 A;  2XEU A;  2ECN A;  2MD8 C;  5EIB E;  1MHQ A;  1XGW A;  3U9W A;  4KT6 B;  5FQ8 A;  5EKQ D;  3OXF A;  1BU9 A;  3Q7A A;  4U0U A;  3D9N A;  4FP7 A;  2VPG A;  1X5B A;  1X4I A;  4HRM B;  5JJT A;  2XZD G;  2K16 A;  3MA5 A;  3FUE A;  3ZHE B;  3PUQ A;  3O33 A;  3QNK A;  2J9Q A;  4JXT A;  4GTS A;  2YQM A;  4B89 A;  2ECJ A;  1UJK A;  3ULE G;  5FQ6 A;  4O64 A;  3R9M A;  1A5E A;  2QIZ A;  2J07 A;  1SZ9 A;  3C3R A;  4JHK A;  2DZO A;  2D8U A;  2WQ6 A;  4GNG A;  1G25 A;  5E76 A;  2CON A;  4I1A A;  5J3X A;  3ZYK A;  1MM2 A;  2HE0 A;  1V55 E;  3MHS A;  2WQH A;  4IC2 A;  1DCE A;  3L1X A;  5KJN A;  5CCL A;  1JWG A;  3SOU A;  2VYI A;  2A4Z A;  2XZT G;  4MRU A;  3F6Q A;  2M6M A;  5BV0 A;  3AG2 E;  5LKT A;  2WXO A;  2FO1 E;  5AQB A;  5JMN D;  3RTR B;  5DIN A;  4YBT A;  4UP5 A;  2Y0B G;  3QAR A;  3Q7F A;  5HS0 A;  1U2V G;  3NB2 A;  4JB8 P;  3FUK A;  5B3S E;  3DWD A;  3SFZ A;  5EYA F;  1H2T C;  5JG6 A;  3D3M A;  2IY0 C;  4HOR A;  1OWP A;  1YYH A;  4FIP A;  3EU5 A;  3UMV A;  3JUI A;  4EQF A;  2I50 A;  2M13 A;  2BED A;  2YUR A;  1WEP A;  2ZU6 B;  4I7B A;  4ZHB A;  3MHH A;  4B8A A;  1ZBD B;  4WWP A;  4PPE A;  3E34 A;  2IDA A;  3FTY A;  4K5A B;  4N5C A;  4GTQ A;  4YC9 A;  3ONK A;  2FUU A;  2Y4T A;  4IRU A;  4HNA D;  5IY5 E;  1UW4 B;  4YBS A;  4ZFH A;  3HCS A;  1SQM A;  1E8Z A;  3ZNG A;  3UQ3 A;  3PZ4 A;  1WEE A;  1QQE A;  1EDU A;  4EEC A;  2YSM A;  1OWO A;  3LDY A;  2QFC A;  3Q15 A;  2MRI A;  2CFZ A;  4UQY A;  1IQR A;  2MT5 A;  3S7J A;  4F1P A;  3RPG B;  1Z6T A;  1NL4 A;  3TG5 A;  3GZ2 A;  5AYW D;  2OXQ C;  5KH3 A;  4AYC B;  4J8D A;  2P58 C;  3LEW A;  4L7T A;  4CGV A;  3EIJ A;  4AV7 A;  5FZS A;  1ZBP A;  3KS2 A;  3FUD A;  2VSY A;  3LY8 A;  5CED B;  2XRZ A;  5FTP A;  3Q4A B;  2HM8 A;  5FB0 A;  4Z0O A;  2MA6 A;  5LCW B;  3JYS A;  4Q94 A;  1FCH A;  2J09 A;  3BEE A;  2KKY A;  5D1L B;  4EBA A;  4OGE A;  2KWO A;  2WXF A;  4JL0 A;  4TXP A;  4UQZ A;  4F53 A;  3HTK C;  3MKR A;  5D2M C;  2RR4 A;  2BTD A;  4LLB A;  3C3Q A;  4MVT A;  3SD5 A;  2Y69 E;  4JD2 G;  4GTT A;  3SBT B;  3P1U A;  2LAI A;  3CVP A;  5JJ7 A;  5G05 B;  1N95 A;  4XI0 A;  3D9K A;  3QC1 A;  3FUI A;  4FUL A;  3EHM A;  2BAY A;  5HQ8 A;  2PL2 A;  4UI9 C;  4UWG A;  1TN7 A;  4APF A;  4V3I A;  3V2O A;  2VSX E;  3VLD A;  1TN6 A;  5SVI A;  4BX9 A;  5FER A;  1IXV A;  2Y3A A;  4XI1 A;  4ANV A;  3Q47 B;  3J5P A;  1NA3 A;  5CHE E;  4DJA A;  4BET A;  3U66 A;  4LUN U;  3NOC D;  4NQ0 A;  1IYG A;  3SNX A;  2XPI A;  4DUI A;  3EDT B;  4GTM A;  2WXL A;  5AQ9 A;  3Q75 A;  3PHD A;  1EPU A;  2AXU A;  3TWS A;  2LNI A;  3DPY A;  3HCT A;  3AAA C;  3TXN A;  2CFU A;  4FAD A;  2KWK A;  2HYE D;  3U5O A;  2GW1 A;  3C3O A;  5B77 A;  4PDX A;  3TL5 A;  3GW4 A;  5AJD A;  2A5E A;  3ULQ A;  4DLO A;  2IEJ A;  2LV9 A;  1XNF A;  4FK5 A;  4A1S A;  4CT4 A;  4U07 A;  1ELW A;  3ONL A;  3UM3 A;  1OWM A;  2PQN A;  4HOU A;  3DSV A;  2AW6 A;  3RKV A;  2LO6 A;  3MJW A;  1QBQ A;  3ZYL A;  1V54 E;  4Y6C A;  3ASN E;  2CHZ A;  5HKP A;  1B89 A;  3FTU A;  3QJZ A;  3KSL A;  2IFU A;  4AXH A;  2FBN A;  1MJ0 A;  3FUN A;  2XPY A;  1WIM A;  3MDB C;  4GNF A;  3O7A A;  2PQR A;  2GRN B;  4KBQ A;  2YHE A;  3ZYQ A;  3V43 A;  4TKP B;  4B93 B;  2VGX B;  2P9K G;  2R02 A;  4M3O A;  4WND A;  5D0O D;  2VPE A;  2XRY A;  4JEU A;  3EIQ C;  4DX6 D;  4GTR A;  4BER A;  3DDT A;  5SVI B;  2WXN A;  4XIF A;  2H6G A;  5TAB A;  3FEX A;  3L08 A;  4GTO A;  1TN8 A;  4G2V A;  1RZ4 A;  3DST A;  1SA4 A;  4J8F A;  1JPL A;  3O4Z A;  3FFL A;  4CEM A;  3B95 A;  2L5U A;  5JHB A;  2MA5 A;  5ITZ F;  4XI9 A;  4AOF A;  2F37 A;  3ML9 A;  4BHW A;  1RW2 A;  4NUR A;  2KCV A;  2AJA A;  2YYR A;  5I3L A;  4RG9 A;  1U6G B;  2XEH A;  2LGG A;  5JA4 D;  4N4F A;  3PUR A;  4APO A;  3MCX A;  3APF A;  4G23 A;  3M63 A;  2BUG A;  5CER B;  5C13 A;  2R17 C;  4HOQ A;  2EIL E;  3U5P A;  2P9U G;  3IHV A;  3HDX A;  2DX8 A;  3HVE B;  1PC2 A;  5BPP A;  3MEK A;  3HXF A;  3CIA A;  2EIJ E;  2LSU A;  4L58 A;  1HG5 A;  2V5F A;  5B78 A;  2B0O E;  4A63 B;  1ELK A;  3LRQ A;  3ZUV B;  2NYJ A;  4YAT A;  2M1R A;  4RG6 A;  4E6H A;  1WES A;  1WEU A;  3MX3 A;  4L2L A;  2EA6 A;  5H7P A;  1W3B A;  3I2D A;  3LVQ E;  3S7B A;  4G8K A;  1E90 A;  4FLB A;  2GRO B;  2CHW A;  4GYY A;  3CQG B;  5CEA A;  2KZT B;  4GA2 A;  4ILI A;  3CVW A;  2EGM A;  2QC9 A;  4TXQ A;  4O1O A;  3UM0 A;  1H6K A;  4NAC A;  2KFT A;  5D66 A;  1WY6 A;  4JHJ A;  2KBX A;  5ENR D;  5JJ6 A;  3SGH A;  3K9I A;  4U63 A;  4QFV A;  1H2U A;  3Q49 B;  5KJM A;  2MNZ A;  3RU0 A;  1TNB A;  1G3N B;  3NF1 A;  1AWC B;  4A1G A;  3AS4 A;  2OV8 A;  2EQX A;  4IC3 A;  2WQ7 A;  5EYL A;  3UX4 A;  5ENO D;  1Z5S C;  3CVN A;  4YDO A;  2WXR A;  3DSU A;  3L9T A;  2IQJ A;  3UIO C;  2CRR A;  2PM6 A;  1OXJ A;  1TEZ A;  4U95 D;  5KCM A;  5D1M B;  4HB5 A;  2XGS A;  4O60 A;  2X6K A;  1WFK A;  4BES A;  3NQP A;  3GZ1 A;  1WAO 1;  4EZJ A;  2KWJ A;  4F3V A;  3IHP A;  3FUJ A;  1XWH A;  2R03 A;  2RKK A;  4ANX A;  2EXU A;  4LJN A;  5T4Y A;  2AXZ A;  2XPZ A;  2YHC A;  4WZ2 A;  3ZHE A;  1LF8 A;  3RO3 A;  2WXM A;  1P5Q A;  2VJE A;  2OWA A;  2X6I A;  1PAQ A;  3N9Q A;  1E4U A;  3J5Q B;  4LG6 A;  4B7Y C;  3PH0 C;  3L54 A;  3LPZ A;  2ZXW E;  3FAN A;  2LGL A;  4FO9 A;  2ETA A;  3ASO E;  4BT9 A;  4P29 A;  3PE3 A;  2XOC A;  2XEN A;  2WXG A;  3V30 A;  4KZC A;  3CHP A;  4YVQ C;  3CKB A;  2EIM E;  2KCK A;  3QOU A;  4DX1 A;  3UKU G;  2KGI A;  2OEV A;  4I7C A;  4GMJ A;  4JVS A;  2YSJ A;  2L0B A;  3O34 A;  2CG3 A;  3ZEF A;  5LX8 A;  2WXH A;  2PNX A;  4GZC A;  3FUL A;  3IBE A;  4UI9 B;  3DXM G;  3TWQ A;  3LS8 A;  3LY9 A;  1INZ A;  3QWV A;  2X6J A;  3PEV B;  4WUY A;  5EN5 D;  1H0A A;  4GYW A;  4GZ3 A;  3O70 A;  3LJ3 A;  4UWF A;  3NZS A;  5FQ4 A;  1UN9 A;  2XP0 A;  4A0C D;  5FQ7 A;  5EYP F;  3ZW3 A;  3BU8 A;  4C0E A;  3D9O A;  5E75 A;  1QZ2 A;  3SOX A;  5G2N A;  4OVU A;  4YDW A; 
#chains in the Genus database with same CATH homology
 3UT7 A;  4ANW A;  3ZXS A;  1WEN A;  3PE4 A;  4LK9 A;  5LKU A;  3B7S A;  2KWN A;  2MOW A;  4KMO A;  3BG1 B;  4GZ6 A;  2MNY A;  4PS3 A;  2M85 A;  4CCA A;  5D1K B;  4S3O C;  3N71 A;  4GAA A;  4XKC A;  2VJE B;  1Z2Q A;  5LFA A;  2C0L A;  2AWI A;  4N3C A;  2V4L A;  4GZD A;  4YAB A;  3FH8 A;  4XKB A;  4WWO A;  1T1H A;  2E2E A;  4UWL A;  1UJJ A;  2DIW A;  3U5M A;  2K4D A;  5H9M A;  4BBQ A;  1E7U A;  1Z6U A;  3T5V A;  2DCP A;  2L0T B;  2M3H A;  2L0I A;  3B7R L;  2FO7 A;  5LKZ A;  3NZU A;  4YAX A;  4AYC A;  4AIF A;  1JM7 A;  2FUL A;  3B7T A;  1HFA A;  2K1J A;  1HH8 A;  5ANR A;  3R7R A;  2KYU A;  4PTB A;  4GCN A;  4NRH B;  3URZ A;  4UWH A;  2VPD A;  2DBA A;  4Y6W A;  3LQJ A;  2KGG A;  2LDR A;  5CCM A;  2CT2 A;  5C11 A;  4XE0 A;  2GGF A;  4RVB A;  2IF4 A;  3N9M A;  3CEQ A;  5M72 A;  3VTX A;  2YW8 A;  2CKL B;  4GA1 A;  3ZVZ B;  2YHN A;  4KVO A;  2YHO A;  3RRN B;  4TRQ A;  4A3T A;  4MS6 A;  1MM3 A;  1N54 A;  4AUQ B;  4U04 A;  3U5N A;  3QDN A;  2UWJ G;  3LYA A;  4BFR A;  4RSY A;  2JRJ A;  4PH4 B;  4FC8 A;  4AP4 A;  4U0S A;  4B0Z A;  3ASG A;  1U3D A;  5FZR A;  4MKT A;  3I5P A;  3CK8 A;  3SHF A;  3QZV A;  3VK6 A;  1PY1 A;  3CVQ A;  2X38 A;  2I2O A;  5G05 J;  3EJN A;  2I1J A;  1WEO A;  5G0F A;  2RD0 A;  3IEG A;  4AY5 A;  1JM7 B;  3L11 A;  4UI9 K;  2G6Q A;  4CCG X;  2C0M A;  1N87 A;  5ARF A;  5T3R A;  5KH9 A;  4N2Q A;  3QK0 A;  1E7V A;  5DIZ A;  4HOS A;  3CVV A;  3RJV A;  2WM9 A;  3DQV R;  3FP3 A;  5T8I A;  3G2S A;  4ATG A;  2LSV A;  3Q5M A;  3C98 A;  4LER A;  5CMY A;  4CGW A;  3FY4 A;  3DPD A;  2VTB B;  4GB9 A;  1JWF A;  2VGX A;  2XGM A;  2NAA A;  4GB0 A;  4I43 A;  3VTY A;  5CMW A;  2XB1 A;  3APD A;  4PUC A;  3KD7 A;  5D0Q D;  3D9J A;  2F6J A;  4GNE A;  3L6A A;  1V87 A;  3FTV A;  2ZET C;  3RRU A;  3KQI A;  5AJL A;  4CT0 A;  3RK6 A;  4J8E A;  4L2Y A;  3G2W A;  5H1U A;  4L1B A;  4GCO A;  3APC A;  4JA7 A;  3CQC B;  2LQ6 A;  3OAW A;  3VLE A;  4AVX A;  3ASL A;  3HCU A;  5FEY A;  4LCT A;  3ESK A;  4FLH A;  2GRL A;  3C6W A;  3HVE A;  4LEU A;  2IOL A;  2G43 A;  4K0R A;  3O37 A;  2JEK A;  1Y8M A;  2AN6 A;  4A4C A;  3FUM A;  1RMD A;  4UWK A;  3ZRH A;  5FT9 A;  2VP7 A;  2HO1 A;  4G1T A;  4ZQL A;  5FZQ A;  4R2Y A;  2QIC A;  2KZT A;  3FTX A;  4GU5 A;  3ASF A;  3T8M A;  5BW8 C;  2R59 A;  4BSX A;  5FWQ A;  2LGV A;  3EHN A;  2OND A;  1HG2 A;  3M62 A;  3QWW A;  4V3L C;  3SBS A;  1E96 B;  1WEW A;  4S3O B;  2JMJ A;  3LDZ A;  4ACK A;  4IUL A;  4AEZ C;  3ZVY A;  4EZK A;  3QB2 A;  4DI4 A;  4L23 A;  2VSO E;  4JPS A;  4BY6 A;  4JC8 A;  2YNQ A;  4I1O B;  3LQI A;  5TRB A;  3LVR E;  4C9Z A;  3CVX A;  3QWP A;  2AXV A;  4L7X A;  4IYP A;  2WXQ A;  2OVB A;  2WMN A;  2XHE A;  5AIU A;  1QNF A;  3I4G A;  4CDM A;  5B8D A;  4R8P K;  4N39 A;  2YU4 A;  3B13 A;  4I1M A;  3ZTG A;  3PDN A;  5ARG A;  4YVO A;  5J08 A;  1A17 A;  2CHX A;  2LXP C;  4GZ5 A;  2ECT A;  3FTW A;  1U3C A;  1NZN A;  2XCC A;  3ASD A;  5BV1 A;  2R5S A;  1EYH A;  2FSA A;  5C2Y A;  2KAT A;  2HYZ A;  5TDW A;  3SF4 A;  2JLB A;  4A49 A;  2VNF A;  4IN3 B;  4I17 A;  4I7D A;  1WEM A;  1YA0 A;  3RO2 A;  3CV0 A;  2ECW A;  3MZL B;  1FBV A;  2QY7 A;  5J90 A;  4W4U A;  2WPV A;  4WZ0 A;  1L5J A;  1HYI A;  1WIL A;  3JQ0 A;  3CHR A;  2PM7 A;  2Y1N A;  4FHK A;  3U64 A;  3KEZ A;  1K2F A;  3ZIM A;  3R9A B;  1NP7 A;  1KLX A;  4ZDT A;  2RI7 A;  3GL6 A;  3S2A A;  5G04 J;  4AP2 A;  2VJF B;  3U3W A;  1VYX A;  2JMI A;  2J49 A;  4HXI A;  2QJ0 A;  5AEN A;  4F7A A;  2F42 A;  3IKO B;  4H7Y A;  3FTZ A;  2WMO A;  3ZVV A;  2YRE A;  4FJZ A;  3KV5 A;  4XX5 A;  3CK7 A;  1ELR A;  3LQH A;  2CSY A;  3CK9 A;  1CHC A;  4WAF A;  5DKA A;  4WA6 A;  2Y4U A;  3FTS A;  3CLJ A;  4BX8 A;  5AIT A;  3CR3 A;  4LRZ A;  3FUF A;  3M99 A;  3FH7 A;  1BOR A;  1X4U A;  3PVL A;  5A6C A;  4WNE A;  4FU3 A;  1MQS A;  5EDS A;  1IHG A;  5A23 A;  4Q96 A;  3CST A;  3FL2 A;  5B75 A;  2CKL A;  4FA6 A;  4D10 C;  4B94 A;  2YUC A;  4NN2 A;  4BT8 A;  4U0Z A;  2OVF A;  4J0U A;  4B8C B;  2ECG A;  3HIZ A;  5ENN A;  5JHA A;  1F62 A;  4WNG A;  2VJ8 A;  4AY6 A;  1WEV A;  3TXM A;  4WWN A;  4KYO B;  1VFY A;  4PS7 A;  3ZNI A;  4B86 C;  4WZ3 B;  1HE8 A;  3S7F A;  3AS8 A;  4I2Z A;  3UUX A;  3FEY A;  3PRE A;  1E8W A;  4GA0 A;  4A4B A;  1OWL A;  2RG8 A;  3E4B A;  5KH7 A;  1NA0 A;  4CRW A;  4DK5 A;  3O36 A;  3GV4 A;  1HZ4 A;  3LXU X;  3T7L A;  4MSX A;  4I6E A;  4JW1 A;  3FU3 A;  4G25 A;  4DPR A;  2L80 A;  1TJC A;  2E6S A;  2L43 A;  3HYM B;  4GND A;  3IHY A;  3TJP A;  1S0P A;  4HFG A;  2Y43 A;  2FEZ A;  4QF2 A;  2RSD A;  5BNW A;  2HR2 A;  3NG2 A;  2C2V S;  2WXI A;  4ILH B;  3ML8 A;  5LOZ A;  2NSZ A;  2VTB A;  2ECV A;  3ENE A;  2J08 A;  4A55 A;  3CHO A;  1E8Y A;  2UZG A;  3CHQ A;  3FU6 A;  2I1K A;  1FVH A;  4W9R A;  5C1D A;  2J4B A;  5LCW J;  3DPL R;  3ASH A;  5LKX A;  3O35 A;  3PZD A;  4ZUX U;  2AVP A;  3QAQ A;  3MGB A;  1Z3Y A;  2XCB A;  1DVP A;  4GML A;  4QF3 A;  4R7E A;  3OXG A;  4I9C A;  2FUI A;  3UPV A;  2NXP A;  1Z3X A;  1HXI A;  3KNV A;  3TG4 A;  1JUQ A;  2OOE A;  3MV3 B;  1LDK C;  3QKY A;  3FHE A;  4AJW A;  3L17 A;  3L1Z B;  2ECI A;  3CVL A;  1IYM A;  2WB2 A;  4HS2 A;  3CVU A;  3RRM B;  2MIQ A;  3G2T A;  3AS5 A;  3JQ1 A;  4G26 A;  2CSZ A;  4YND A;  4UP0 A;  4PS8 A;  3PEU B;  2VGY A;  2MHK A;  4J8S A;  1IQU A;  3D9I A;  4OVV A;  2KCL A;  4I6G A;  1DNP A;  2L75 A;  5FB1 A;  4DI3 A;  2E0I A;  3ZYM A;  3O48 A;  5G04 C;  3MV2 B;  4URK A;  2A5U A;  2ILR A;  2CG2 A;  2YQ8 A;  3N9N A;  2J4D A;  3UT8 A;  5KJK A;  3MKQ A;  3ESL A;  3FH5 A;  3D9M A;  2GRM A;  4BWR A;  2KIZ A;  2XGO A;  2KM4 A;  2KR4 A;  3TGO A;  4I6J A;  2Q7F A;  3I4R B;  3LY7 A;  4A3V A;  2VQ2 A;  5HI7 A;  4G24 A;  2LRI C;  2WXK A;  1WEQ A;  5TDR A;  2IJG X;  3T5X A;  3KV6 A;  5A7D B;  2EOD A;  4OYS A;  5DBK A;  4KVM A;  4P5O B;  2HDP A;  3FDH A;  3PUK A;  4HLE A;  2E6R A;  2MUM A;  4ME2 A;  2KRE A;  4UQX A;  1UN8 A;  4EBA G;  2EGP A;  2LXH C;  2KC7 A;  2ION A;  2YIN A;  4N3A A;  4YAD A;  2C2L A;  2IQC A;  3AU4 A;  5EX3 A;  4FJC A;  3PNL B;  4KXK B;  4E85 A;  1HO8 A;  2MD7 B;  4N3B A;  4WNF A;  2VPB A;  4X3G A;  1HF8 A;  1EF1 C;  4ACL A;  3VLF A;  3N9P A;  2WXP A;  3N9O A;  3FU0 A;  2X3M A;  3BG0 B;  3AU5 A;  4EPZ A;  2D8S A;  5TBN A;  3MKQ B;  2IOS A;  5B79 A;  1OUV A;  4J6I A;  3CKC A;  3L22 A;  4ANU A;  3DBS A;  2VJF A;  1WM5 A;  2UY1 A;  3FWV A;  4XZ4 A;  1TJF A;  2X6H A;  4HOT A;  2I6H A;  3WXX A;  3S7D A;  1E8X A;  3GYZ A;  5AIJ A;  2KE1 A;  2I9C A;  4CDN A;  4I9E A;  1ZU2 A;  3D9L A;  3CHM A;  3KAE A;  3L13 A;  1JOC A;  2G45 A;  2H0D A;  4LAD B;  3HHM A;  4I2W A;  3OTN A;  4BTB A;  1N52 A;  3G2V A;  5H1V A;  2V8S E;  4FJY A;  1X4J A;  5BT1 A;  2IU1 A;  2FI7 A;  3CGH A;  3L16 A;  3PS6 A;  4C9B B;  3RIB A;  2L9B A;  2WVI A;  5FJY A;  2VSN A;  1H2V C;  4GYO A;  1H19 A;  3G2U A;  1VDY A;  3RPG C;  4C0M A;  4KZ0 A;  2PUY A;  3CVY A;  2F6N A;  3CSF A;  1OWN A;  4YBM A;  2LAH A;  2BF0 X;  4EZL A;  1WE9 A;  2XQ0 A;  2KU3 A;  3B7U X;  5KJL A;  3JCK C;  1GW6 A;  5LCW C;  4V3K C;  4F1S A;  3ZPV E;  1HS6 A;  3LKU A;  2PZI A;  4HVB A;  3GZS A;  4CA1 A;  2XEV A;  3R7Q A;  5LP0 A;  5G55 A;  2YT5 A;  4H7X A;  4K03 A;  2UY1 B;  3OXL A;  2WXJ A;  4CDR A;  5G05 C;  1HYJ A;  4UI9 J;  3ZPJ A;  3PUJ A;  3ZGQ A;  3UT4 A;  4AM9 A;  3ZPV 1;  4JZY A;  3SI5 A;  3SOW A;  3SZ7 A;  2K17 A;  4GPK A;  4O6F A;  4N2S A;  1Z60 A;  2H0D B;  3C5K A;  1UG3 A;  5BUZ A;  4TUU A;  3U4T A;  3PNT B;  3CHS A;  5ANL A;  4F52 B;  4MLP A;  2Y1M A;  2V0P A;  4DLQ A;  1Y6I A;  4U8H A;  4R7L A;  3TAX A;  4Q6F A;  4Q69 A;  2LGK A;  3N9L A;  4JHR A;  3D9P A;  2M63 A;  5H1T A;  3FU5 A;  3LCA A;  1SZA A;  2LN0 A;  1FP0 A;  1HX8 A;  2NC9 A;  3FUH A;  1BPO A;  3PRZ A;  5G04 B;  3MYV A;  4FHJ A;  2L6J A;  5EX0 A;  2FF4 A;  3ZFW A;  4ABN A;  1KT1 A;  2X6F A;  1LDJ B;  3SHB A;  4LKA A;  3ZN3 A;  3EB5 A;  4N3W A;  3EB6 A;  3T6R A;  3I3N A;  4TV3 A;  3P2B A;  4JEH A;  4JA9 A;  4BTA A;  1WGM A;  1HU3 A;  2YQL A;  1FVF A;  4G11 A;  1VD4 A;  5B76 A;  2JMD A;  3IV0 A;  4ILG A;  1KT0 A;  2XEU A;  2ECN A;  2MD8 C;  1MHQ A;  1XGW A;  3U9W A;  4KT6 B;  5FQ8 A;  5EKQ D;  3OXF A;  4U0U A;  3D9N A;  4FP7 A;  2VPG A;  1X5B A;  1X4I A;  5JJT A;  2K16 A;  3MA5 A;  3FUE A;  3ZHE B;  3PUQ A;  3O33 A;  3QNK A;  2J9Q A;  4JXT A;  2YQM A;  4B89 A;  2ECJ A;  1UJK A;  5FQ6 A;  4O64 A;  2QIZ A;  2J07 A;  1SZ9 A;  4JHK A;  2WQ6 A;  4GNG A;  1G25 A;  5E76 A;  4I1A A;  5J3X A;  3ZYK A;  1MM2 A;  3MHS A;  2WQH A;  4IC2 A;  3L1X A;  5KJN A;  5CCL A;  1JWG A;  3SOU A;  2VYI A;  2A4Z A;  4MRU A;  2M6M A;  5BV0 A;  5LKT A;  2WXO A;  3RTR B;  5DIN A;  4YBT A;  4UP5 A;  3QAR A;  3FUK A;  3SFZ A;  5EYA F;  1H2T C;  5JG6 A;  3D3M A;  4HOR A;  1OWP A;  4FIP A;  3UMV A;  3JUI A;  4EQF A;  2I50 A;  2YUR A;  1WEP A;  2ZU6 B;  4I7B A;  3MHH A;  4B8A A;  1ZBD B;  4WWP A;  4PPE A;  2IDA A;  3FTY A;  4N5C A;  4YC9 A;  3ONK A;  2FUU A;  2Y4T A;  4IRU A;  1UW4 B;  4YBS A;  3HCS A;  1SQM A;  1E8Z A;  3UQ3 A;  1WEE A;  1QQE A;  1EDU A;  4EEC A;  2YSM A;  1OWO A;  2QFC A;  3Q15 A;  2MRI A;  2CFZ A;  4UQY A;  1IQR A;  2MT5 A;  3S7J A;  3RPG B;  1Z6T A;  3TG5 A;  3GZ2 A;  5AYW D;  2OXQ C;  5KH3 A;  4AYC B;  4J8D A;  2P58 C;  3LEW A;  4L7T A;  4CGV A;  3EIJ A;  4AV7 A;  5FZS A;  1ZBP A;  3KS2 A;  3FUD A;  2VSY A;  3LY8 A;  2XRZ A;  5FTP A;  3Q4A B;  2HM8 A;  5FB0 A;  2MA6 A;  5LCW B;  3JYS A;  4Q94 A;  1FCH A;  2J09 A;  3BEE A;  5D1L B;  4EBA A;  2KWO A;  2WXF A;  4JL0 A;  4UQZ A;  4F53 A;  3HTK C;  3MKR A;  2BTD A;  4LLB A;  4MVT A;  3SD5 A;  3SBT B;  3P1U A;  2LAI A;  3CVP A;  5JJ7 A;  5G05 B;  4XI0 A;  3D9K A;  3QC1 A;  3FUI A;  4FUL A;  3EHM A;  2BAY A;  5HQ8 A;  2PL2 A;  4UI9 C;  4UWG A;  4APF A;  4V3I A;  2VSX E;  3VLD A;  4BX9 A;  5FER A;  2Y3A A;  4XI1 A;  4ANV A;  3Q47 B;  1NA3 A;  5CHE E;  4DJA A;  3U66 A;  4LUN U;  4NQ0 A;  1IYG A;  3SNX A;  2XPI A;  3EDT B;  2WXL A;  3PHD A;  1EPU A;  2AXU A;  2LNI A;  3HCT A;  3TXN A;  2CFU A;  4FAD A;  2KWK A;  2HYE D;  3U5O A;  2GW1 A;  5B77 A;  4PDX A;  3TL5 A;  3GW4 A;  5AJD A;  3ULQ A;  4DLO A;  2LV9 A;  1XNF A;  4FK5 A;  4A1S A;  4CT4 A;  4U07 A;  1ELW A;  3ONL A;  1OWM A;  2PQN A;  4HOU A;  2AW6 A;  3RKV A;  2LO6 A;  3MJW A;  3ZYL A;  4Y6C A;  2CHZ A;  1B89 A;  3FTU A;  3QJZ A;  2IFU A;  4AXH A;  2FBN A;  3FUN A;  2XPY A;  1WIM A;  4GNF A;  3O7A A;  2PQR A;  4KBQ A;  2YHE A;  3ZYQ A;  3V43 A;  4TKP B;  2VGX B;  4M3O A;  4WND A;  5D0O D;  2VPE A;  2XRY A;  4JEU A;  3EIQ C;  2WXN A;  4XIF A;  5TAB A;  3FEX A;  3L08 A;  4G2V A;  4J8F A;  1JPL A;  3O4Z A;  3FFL A;  4CEM A;  2L5U A;  5JHB A;  2MA5 A;  4XI9 A;  4AOF A;  3ML9 A;  4BHW A;  4NUR A;  2KCV A;  2YYR A;  5I3L A;  4RG9 A;  1U6G B;  2LGG A;  4N4F A;  3PUR A;  4APO A;  3MCX A;  3APF A;  4G23 A;  3M63 A;  2BUG A;  5C13 A;  2R17 C;  4HOQ A;  3U5P A;  3IHV A;  3HDX A;  2DX8 A;  3HVE B;  1PC2 A;  5BPP A;  3MEK A;  3CIA A;  2LSU A;  4L58 A;  1HG5 A;  2V5F A;  5B78 A;  1ELK A;  3LRQ A;  4YAT A;  2M1R A;  4RG6 A;  4E6H A;  1WES A;  1WEU A;  3MX3 A;  4L2L A;  2EA6 A;  1W3B A;  3I2D A;  3LVQ E;  3S7B A;  1E90 A;  4FLB A;  2CHW A;  4GYY A;  3CQG B;  2KZT B;  4GA2 A;  4ILI A;  3CVW A;  1H6K A;  4NAC A;  2KFT A;  1WY6 A;  4JHJ A;  5JJ6 A;  3SGH A;  3K9I A;  4U63 A;  4QFV A;  1H2U A;  3Q49 B;  5KJM A;  2MNZ A;  3RU0 A;  3NF1 A;  4A1G A;  3AS4 A;  2OV8 A;  2EQX A;  4IC3 A;  2WQ7 A;  3UX4 A;  3CVN A;  2WXR A;  2PM6 A;  1TEZ A;  5KCM A;  5D1M B;  2XGS A;  2X6K A;  1WFK A;  3NQP A;  3GZ1 A;  1WAO 1;  4EZJ A;  2KWJ A;  4F3V A;  3IHP A;  3FUJ A;  1XWH A;  4ANX A;  4LJN A;  5T4Y A;  2AXZ A;  2XPZ A;  2YHC A;  4WZ2 A;  3ZHE A;  1LF8 A;  3RO3 A;  2WXM A;  1P5Q A;  2VJE A;  2X6I A;  1PAQ A;  3N9Q A;  1E4U A;  4B7Y C;  3PH0 C;  3L54 A;  3LPZ A;  2LGL A;  4FO9 A;  4BT9 A;  4P29 A;  3PE3 A;  2WXG A;  4KZC A;  3CHP A;  4YVQ C;  3CKB A;  2KCK A;  3QOU A;  2KGI A;  4I7C A;  4GMJ A;  4JVS A;  2YSJ A;  2L0B A;  3O34 A;  2CG3 A;  3ZEF A;  5LX8 A;  2WXH A;  2PNX A;  4GZC A;  3FUL A;  3IBE A;  4UI9 B;  3LS8 A;  3LY9 A;  1INZ A;  3QWV A;  2X6J A;  3PEV B;  4WUY A;  1H0A A;  4GYW A;  4GZ3 A;  3O70 A;  3LJ3 A;  4UWF A;  3NZS A;  5FQ4 A;  1UN9 A;  4A0C D;  5FQ7 A;  3ZW3 A;  4C0E A;  3D9O A;  5E75 A;  1QZ2 A;  3SOX A;  5G2N A;  4OVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...