2C2LA

Crystal structure of the chip u-box e3 ubiquitin ligase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
281
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
total genus 87
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c2lA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2lA03
5EX3A 3M99A 5G04B 3K9IA 3RO2A 2VP7A 4GNGA 3HYMB 4G2VA 3UPVA 5FZSA 2QFCA 3OXGA 3ZVZB 3ZHEA 4FIPA 4CA1A 2KWJA 4GYWA 2L43A 3PHDA 4N3CA 3S7JA 3T7LA 3ZPVE 1JM7A 4U0UA 3U5OA 2KWNA 4G1TA 2VSNA 4YADA 2MA5A 4WUYA 3EDTB 3JYSA 4JA9A 3O36A 4R8PK 4RG6A 4Y6CA 5H1TA 4AP4A 2MT5A 1T1HA 2YT5A 5TDWA 3URZA 5TBNA 3MHSA 4Q6FA 3SOWA 2JRJA 2VJEB 2XEVA 1QQEA 4AY6A 1MM3A 2MA6A 2KWKA 4GNDA 3O70A 5H9MA 4AVXA 1WEOA 4GCOA 2EODA 3TAXA 2JMJA 3ZGQA 4N3AA 3QOUA 2ECNA 3O37A 4RG9A 4NQ0A 4U0SA 2DX8A 3CV0A 4G24A 2AN6A 2M85A 3ZNIA 3AS8A 2CSYA 5G05B 4UP5A 4J0UA 2KYUA 3ASDA 1A17A 4WNEA 1WEQA 2LQ6A 3C5KA 1Z60A 2VJFB 3AS5A 4JL0A 3RKVA 2UZGA 5ARFA 5KH3A 4JA7A 2MHKA 2H0DB 5FTPA 4L58A 3SHBA 3GZ2A 2KE1A 5ARGA 2D8SA 2PUYA 4GNFA 4KYOB 4BBQA 1ELWA 1NA0A 1Y8MA 2VQ2A 4YVOA 5DBKA 1WE9A 1WILA 4CDRA 4GA1A 3HCTA 2YHOA 4A4BA 3ZPJA 2LXHC 4I7BA 3MV3B 3S7FA 1ZBDB 5AIUA 3T6RA 2R5SA 2V5FA 2VGYA 1CHCA 5CCLA 4I9CA 3KS2A 4AY5A 4N3BA 2G43A 2VGXB 2FSAA 2C2LA 2HYZA 2JLBA 3ZTGA 4I17A 2C2VS 2H0DA 2KCLA 4HOTA 5FEYA 3GW4A 4QF3A 3U5PA 5D0OD 5C13A 2NAAA 1NZNA 2KCVA 3ULQA 4ABNA 3VTYA 1XWHA 5B79A 4KXKB 1WEUA 2PQNA 5LKXA 2KIZA 4O64A 4S3OB 3PDNA 4Y6WA 4BWRA 3TG5A 4AYCA 3RJVA 3L1XA 2G6QA 5EX0A 2VPBA 3N9NA 3ZPV1 1DVPA 3ASHA 1G25A 5H1UA 4LK9A 5C1DA 2YU4A 2XPIA 4I7CA 2FEZA 2C0MA 4W9RA 2KU3A 5HI7A 2FO7A 3U3WA 3NG2A 3L11A 4GPKA 3GZ1A 5KH9A 2LRIC 4MVTA 5A6CA 5C11A 4J8FA 1LDKC 1E4UA 2UY1A 3PURA 2P58C 4G23A 2L80A 3O33A 5LCWB 4LLBA 4R7EA 2BUGA 4ME2A 3V43A 2ONDA 4GYYA 3PE3A 4UI9C 5B76A 3CK9A 2UWJG 2XGOA 5EKQD 4WA6A 3VTXA 4WZ0A 3CVLA 4X3GA 4XIFA 2JMDA 4YC9A 1NA3A 2F42A 1X4UA 2K1JA 5FERA 1KT1A 3U4TA 3N9MA 3HTKC 2PQRA 4A0CD 4PPEA 2KATA 2OXQC 2KFTA 2LGLA 2VPGA 2L5UA 5KJNA 2L75A 4BT8A 2OOEA 2F6JA 4NN2A 2Y1MA 2UY1B 4ZQLA 2E2EA 3UQ3A 3MEKA 2LNIA 1E96B 1HXIA 4UQYA 3VK6A 5LCWC 3ASGA 3O7AA 4GYOA 4B86C 3KAEA 2VPDA 5JJ6A 3LQHA 4FK5A 4O6FA 3LY7A 2BAYA 1HYIA 2YQMA 1VD4A 4XI0A 2IF4A 3QWVA 4I2WA 2MNZA 3C6WA 4C9ZA 4HOUA 5LCWJ 2NC9A 1ZBPA 4UI9B 3CK8A 3ZHEB 3Q49B 4PTBA 1FCHA 5AITA 3ASLA 2MIQA 3MKRA 3TG4A 2MNYA 5FZQA 5TDRA 4N3WA 2LXPC 4GA0A 1JM7B 3LY9A 2YSMA 4IC3A 2G45A 2DBAA 1Z2QA 2YQLA 3PE4A 3CEQA 3Q5MA 2CKLA 4J8EA 5BW8C 5HQ8A 2WPVA 3GL6A 1ELRA 4BHWA 5BT1A 1WFKA 2LGGA 2ECGA 4TKPB 4KBQA 1W3BA 4N2QA 2AVPA 3FWVA 4BTBA 2WQHA 4U04A 3M63A 5B78A 1ZU2A 1N87A 5TRBA 4U0ZA 5KJMA 2Y43A 3DPLR 1WEVA 4I1AA 2LN0A 4J8DA 4WZ2A 4F3VA 2ZETC 3RIBA 3EB5A 4GCNA 4APOA 2PNXA 4GNEA 3Q15A 5D1LB 1X4IA 4V3LC 2VSYA 2MD7B 5KJLA 4YBSA 1HYJA 5LKZA 3O35A 2QIZA 5G04C 3QKYA 5CHEE 2QICA 2RI7A 4IN3B 1V87A 5LKTA 4FJCA 3ZN3A 3LCAA 2M6MA 2PL2A 2ECJA 3IHPA 5DIZA 3E4BA 3Q4AB 3UUXA 4BT9A 3LRQA 4AIFA 2EGPA 3KV6A 2HR2A 4FO9A 3RTRB 1KT0A 4GZ6A 4YAXA 2YREA 4I7DA 1FP0A 4ZUXU 3PUQA 1VFYA 1U6GB 5DINA 1WEMA 3RU0A 3O48A 4N4FA 3N9PA 4A4CA 5KH7A 4IC2A 4LEUA 4H7XA 4NRHB 3U5NA 4W4UA 3M62A 4V3KC 2M1RA 5FT9A 1B89A 1F62A 1IYGA 2YHCA 5AYWD 4UP0A 3CVQA 1YA0A 2VJEA 2XB1A 2YYRA 3KD7A 3BEEA 4JHRA 5G05C 3N9OA 1WGMA 3R9AB 1LDJB 3U5MA 3DQVR 5A7DB 5I3LA 3SOXA 2YUCA 2Y4TA 2ECIA 2HDPA 4S3OC 4P5OB 3CKCA 4UI9K 2ECTA 2K4DA 5JJTA 4B7YC 4YBTA 1QZ2A 1WESA 2PZIA 1Z6UA 2VYIA 2IFUA 4A49A 3GV4A 1WEPA 3EB6A 1WEWA 3ZYQA 4WZ3B 3TGOA 2XGSA 3LY8A 4HORA 4YVQC 5D1KB 3QDNA 2VJFA 4GA2A 3AS4A 3WXXA 3GYZA 3FP3A 2I6HA 4WNGA 4UI9J 2FF4A 3ASFA 1BORA 5DKAA 3LKUA 2E6SA 3NF1A 3MHHA 2ECVA 1PC2A 2YSJA 3KV5A 3O34A 4LADB 1KLXA 2LSVA 4G25A 3LPZA 1WIMA 3N9LA 4GZ3A 4F52B 4BTAA 2L0BA 2VNFA 4LKAA 4I2ZA 2J9QA 3OXLA 2F6NA 2K16A 1TJCA 2KGIA 4WNDA 2LGKA 5D0QD 5G05J 2LDRA 2GW1A 3ZVYA 4GZ5A 3LQIA 3N9QA 2YW8A 3KQIA 2CKLB 2K17A 2Q7FA 3MV2B 4H7YA 5BNWA 1K2FA 3CVPA 5FJYA 2KREA 2I50A 4CGVA 4EQFA 1VYXA 1P5QA 4N39A 4N2SA 3I2DA 4N5CA 3N71A 2YHNA 2XGMA 2FUIA 4HOQA 2CT2A 2KR4A 2XCBA 2C0LA 3IEGA 3LYAA 3SZ7A 2IDAA 1HZ4A 4HOSA 1OUVA 4A1SA 3HCSA 3S7BA 5CCMA 3ZFWA 4YABA 2FUUA 1WM5A 3RO3A 2ECWA 2FBNA 2LGVA 5LKUA 5FB1A 2KC7A 5FB0A 4YATA 5M72A 3CKBA 4LJNA 3QWPA 3L1ZB 4YNDA 3RPGC 2MUMA 3ESKA 2KCKA 3KNVA 2L6JA 4XI1A 2HYED 4G26A 5H1VA 3OXFA 5KJKA 1MM2A 4QF2A 4CCGX 3FL2A 1WEEA 1IYMA 5FZRA 5B77A 3SOUA 4R2YA 2XCCA 5JJ7A 3QWWA 2Y4UA 1FBVA 4U07A 3FFLA 2HO1A 1WENA 5TABA 5B8DA 3QZVA 2KWOA 5EYAF 4L7XA 5D1MB 4GB0A 3CVNA 4AYCB 3CK7A 2XEUA 4MSXA 2KGGA 5J3XA 2EA6A 2M3HA 2YURA 2LV9A 3MA5A 1XNFA 3RPGB 5JG6A 4WNFA 4CGWA 2FI7A 4UQXA 4AM9A 3Q47B 2VGXA 1HH8A 3S7DA 4AUQB 4YBMA 4XI9A 2JMIA 2LSUA 3HCUA 4I9EA 2YQ8A 5G04J 1WAO1 2CSZA 2VPEA 1JOCA 1RMDA 5B75A 4B94A 2E6RA 3LQJA 2MD8C 2RSDA 5G0FA 4UQZA 3SF4A 2Y1NA 1IHGA 1X4JA 4ZDTA 2QJ0A
chains in the Genus database with same CATH superfamily
3UT4A 5EN5D 2KBXA 2VP7A 4U63A 4G2VA 2MYOA 2M63A 3FTVA 3DSVA 4A63B 5CBNA 1V54E 3M7KA 4CA1A 3KDEC 3U5OA 4ANVA 4JEHA 4R8PK 3ZXSA 2F8XK 3DWDA 2QC9A 5BUZA 2YT5A 2VJEB 2IO2C 4AY6A 5LFAA 4XZ4A 2VSOE 2KWKA 3LXUX 1WEOA 2EODA 1DCQA 4BERA 2YHEA 4U0SA 3CV0A 1TR4A 2A5UA 3DEOA 4HI9A 2M85A 3O47A 3ZNIA 3AS8A 2CSYA 5G05B 4UP5A 1Q2ZA 4KT6B 5FQ4A 1RZ4A 5KCMA 3AS5A 3UIPC 2V4LA 5ARFA 4C0EA 4F6RD 2H0DB 3SHBA 3GZ2A 3TL5A 2KE1A 5ARGA 4YDOA 3PZDA 2VQ2A 4YVOA 3F6QA 5DBKA 1WE9A 1WILA 3PREA 4A4BA 3NOGD 2B6CA 2LXHC 1E8ZA 1ZBDB 2WXRA 2VGYA 3DSWA 5CCLA 3ABKE 4I9CA 5J90A 1CHCA 1UW4B 4AY5A 3SO8A 4N3BA 2DVWA 3CHPA 1KZOA 2FSAA 2C2VS 2KCLA 3CGHA 2NAAA 3APCA 3ULQA 4JHKA 1XWHA 2LXLA 2PQNA 2J09A 2WXLA 4BWRA 2YNQA 3D3MA 5BXUA 3FANA 1K1BA 5C1DA 3DBSA 2C0MA 1IQRA 4W9RA 5HI7A 2FO7A 3U3WA 3HXBA 3G2SA 1ELKA 1U3CA 2FULA 5CEAA 5C11A 4J8FA 1LDKC 1N4PA 2UY1A 3LVQE 2P58C 3O33A 3FTZA 5LCWB 3PRZA 3EJNA 1E90A 2ONDA 4TXRA 1TNYA 3CK9A 2UWJG 2XGOA 4HRMB 3CVLA 2WVIA 4JW1A 5B1BE 3B7BA 4QQIA 2F42A 3KEZA 2L6BA 4A0CD 3E2DA 2VPGA 2LGLA 1OCOE 5KJNA 2E0IA 1S70B 1QBQA 1SA4A 3DSUA 2OCCE 4GTRA 4ZQLA 1HXIA 4UQYA 3VK6A 1PY1A 2IJGX 4KMOA 3KAEA 2I1JA 3SGHA 5JJ6A 3I4GA 3LQHA 4FK5A 1SZ9A 2F37A 1HYIA 5FIOA 4OVVA 2A4ZA 5ENOD 5LCWJ 1EDUA 1SVXA 2NC9A 3FUNA 4K03A 5BV0A 1ZBPA 2XEHA 3ISMC 5AITA 3ASLA 3HIZA 3MKRA 3TG4A 3B7RL 2GRNB 1SQMA 4IC3A 2IOSA 3PE4A 3CEQA 1OWLA 4NIKA 5BW8C 2QZAA 2AXVA 4TXPA 4AEZC 4ANWA 2AVPA 2DZNA 3M63A 2Y43A 3DPLR 4WZ2A 4F3VA 4J7WA 2CRRA 2DSMA 2Y0BG 2J8SD 3UTMA 1H0AA 1V55E 4FADA 4MKTA 4APOA 4PUCA 4UWLA 4GNEA 3B95A 1X4IA 5EDSA 2MD7B 4FLHA 5B1AE 3U9WA 4YBSA 1HYJA 4DI4A 3O35A 3ABME 5CHEE 3ASNE 2RI7A 2E61A 3CVVA 4FJCA 3SD5A 3IHPA 2R59A 3UUXA 3LRQA 4AIFA 2HR2A 1KT0A 2AJAA 4GZDA 4DX7D 4O62A 3I5PA 2AXZA 5ENRD 2OVFA 4EBAA 3O48A 3PVLA 4A4CA 4GPMA 1N52A 1U3DA 4E85A 3G2TA 1KPSB 3SUBA 5D2MC 3QB2A 4W4UA 3M62A 4YDYA 5ENPD 2M1RA 4DX2A 5FT9A 2V5QC 1KZPA 3NAWA 5FQ6A 3D9PA 4PDXA 3R9AB 5A7DB 1EPUA 4S3OC 3CKCA 2ECTA 2K4DA 4B8CB 4XKCA 1TNBA 3KEAA 2CONA 1H2TC 4FP7A 1UOHA 3OAWA 3D9MA 1TN6A 3QDNA 2VJFA 3GYZA 3EIQC 3FTYA 2FF4A 5DKAA 3NF1A 2P2CP 3O34A 4ACLA 2QY7A 3V2XA 2L0BA 1ZB1A 3TWWA 2VJ8A 3RRNB 2JABA 4WNDA 2WXQA 3ZVYA 1BU9A 5G55A 4O60A 4GZ5A 3KQIA 2K17A 3UM1A 2Q7FA 1JCQA 3CVPA 4CGVA 2BEDA 2V4HC 3T8MA 4HVBA 4EQFA 5ENQD 4N39A 4GB9A 2XZDG 4XX5A 3EUVA 5FQ7A 2XGMA 4HOQA 4HB5A 5LP0A 1O5MA 2C0LA 3IEGA 2X6HA 3SFZA 3Q7AA 5CMWA 3FUFA 2NSZA 3E34A 5CCMA 3ZFWA 4YABA 2FUUA 1WM5A 5LKUA 2KC7A 5FB0A 3CKBA 5HS0A 3Q9UC 3NBNB 3ESKA 2KCKA 3ZKJA 2L6JA 2L0IA 3QARA 3E33A 5H1VA 3DXMG 4F7AA 1MM2A 3MDBC 4QF2A 3IHYA 4CCGX 4AV7A 3CSFA 1DNPA 2XCCA 5JJ7A 4ATZD 1MBMA 3LVRE 4U07A 5B8DA 3QZVA 3QAQA 3FAOA 4LERA 4AYCB 2XEUA 5FINA 2RFAA 3TWTA 3IXEA 4Q96A 5JG6A 3DEPA 1E8YA 4WNFA 4ILGA 4GTTA 5G2NA 4CGWA 5KBAA 4AM9A 3Q47B 3D9HA 1HF8A 1IKND 5AAOA 2LSUA 5G04J 1OY3D 1JOCA 3T8KA 3EHMA 2ZISA 3ULEG 3LQJA 3DWLG 2X6JA 3SF4A 2P57A 3PEVB 4ZDTA 2WXFA 3L08A 4DLOA 3D9KA 3K9IA 3ZRHA 2EIJE 4GNGA 4PS3A 4OVUA 2KZTA 4MLPA 1RW2A 3ZHEA 2WXPA 2KWJA 4R7LA 2Y1LE 3S7JA 5EILA 3T7LA 3P2BA 3CR3A 2LAIA 4G1TA 3L54A 4JPSA 3EDTB 4JA9A 4Y6CA 4AP4A 2MT5A 3NB2A 5TDWA 3EHNA 4TUMA 3SOWA 2MA6A 3ULYA 5JMND 3O70A 4AVXA 2LXMA 4GCOA 2CRWA 3NZUA 2L7PA 4ILHB 3QOUA 1D8EA 2DX8A 4G24A 2AN6A 3C3QA 4FULA 3JQ0A 3HXFA 2KYUA 1FT1A 1TN7A 1Z60A 4TXQA 2VJFB 4JL0A 4HRNA 3RKVA 2DJAA 4L2YA 1G3NB 5T4YA 1BLXB 4KYOB 4BBQA 4TV3A 4EBAG 1NA0A 2P9SG 1Y8MA 2XZTG 1N95A 4GA1A 2YHOA 1AWCB 3MX3A 3S7FA 2R5SA 2DYSE 2GRMA 2IO3C 3Q73A 4I17A 1MX2A 1GW6A 5FEYA 3GW4A 3FH8A 1NZNA 2KCVA 4B0ZA 4U96D 3DXKG 3R9MA 4ABNA 3CHSA 2EGMA 1N54A 2MRIA 1OXJA 4O64A 4S3OB 5AN8A 3SY2A 4FLBA 4AYCA 3RJVA 3L1XA 2G6QA 1MYOA 3ZPV1 4EECA 1DVPA 1QYMA 4DLQA 3OTNA 4WWNA 2RFMA 3UXGA 1FVFA 3CQGB 1D9SA 4HBDA 2ZU6B 1H2UA 3TWXA 2OV8A 5KNHD 4XE0A 3RRUA 2CHXA 1E4UA 2BKGA 2L80A 3DPYA 5BXOA 3LS8A 2BUGA 3FUEA 4ME2A 4ZHBA 2P9NG 3BUAA 4UI9C 4URKA 3ZXPA 3ML9A 1HO8A 4YC9A 1NA3A 2LUHA 3JXJA 1X4UA 3U4TA 3N9MA 2YVRA 3HTKC 2EXUA 3AU4A 2DCPA 4PPEA 2KATA 2OXQC 4YDEA 2L75A 4Q94A 2OOEA 4NN2A 3ZUVB 4KVMA 1Y6IA 2XOYA 3ASGA 5E76A 1HE8A 2VPDA 2I9CA 2KXPC 3LDYA 2YQMA 2IF4A 3QWVA 2BKKB 3MCXA 4HOUA 3AG4E 3CK8A 3FTSA 2MNYA 5FZQA 4N3WA 2LXPC 1X81A 3RSEG 2EILE 2YSMA 2DBAA 1JWGA 3ASOE 4J8EA 1N4SA 5HQ8A 1TJFA 4BHWA 4WWPA 5ENTD 5K3QA 4ZFHA 4TKPB 1UJJA 3J5QB 1W3BA 2I1KA 4JVSA 3AU5A 3UM3A 1NP7A 3SNXA 1N87A 4U0ZA 2WXNA 4I1AA 4J8DA 3PNLB 3RIBA 3Q7FA 4AJWA 2ETAA 3IV0A 1TNUA 3T5VA 2EIKE 1Z3YA 3PH0C 2VSYA 1MJ0A 2QIZA 4TUUA 5G04C 3QKYA 1BI7B 2WMNA 4IN3B 3MZLB 3LCAA 1EF1C 2CFZA 2ECJA 5DIZA 4BT9A 4FO9A 2EGPA 4C48B 3I4RB 3FU0A 3RTRB 4OGEA 3DRAA 4L7TA 2NXPA 3AG3E 3DSTA 1U6GB 2KKXA 1WEMA 1TNOA 4N4FA 2BF0X 2X3MA 4CYMD 2B0OE 4MS6A 3APDA 4IYPA 2ZGGA 3U5NA 1DCEA 3MKQB 4V3KC 1H6OA 1IYGA 4CT4A 1YA0A 2VJEA 3Q78A 2XB1A 2YYRA 4G8LA 3KD7A 3BEEA 4GTOA 1TN8A 3D9OA 3U5MA 1OCCE 5JJTA 5AIJA 4LRZA 4KVOA 2PZIA 2OWAA 4BESA 2VYIA 4A49A 3GV4A 4K0RA 1WEPA 1WEWA 4WZ3B 3UIOC 3FTXA 2WMOA 3FH7A 3ONKA 3FP3A 2XRZA 5JHBA 4I43A 2I6HA 4WNGA 4LSZE 3L16A 4UI9J 2AW6A 3ASFA 3LKUA 1PC2A 4LADB 3FULA 4G25A 3N9LA 3LJ3A 3QK0A 4F52B 4L23A 4F53A 1OCRE 3OXLA 2F6NA 4GTSA 1TJCA 2LGKA 4GAAA 2GW1A 1DC2A 3D9NA 3N9QA 2ZXWE 1VDYA 2CKLB 4H7YA 5BNWA 4L1BA 3O4ZA 4HI8A 3R7QA 4CEMA 2QYJA 5CEDB 4B93B 4CT0A 1HX8A 5EIDA 3N71A 4BFRA 2YHNA 4ANUA 1N0RA 3WG7E 2KZTB 3LDZA 3APFA 2OVBA 4G11A 4HOSA 1OUVA 4BETA 1UJKA 2R17C 3FDHA 1Z3XA 5FB1A 4YATA 4LJNA 2ETCA 3QWPA 1FPPA 1UG3A 4K5CA 3UT8A 3KNVA 2HYED 3UMVA 4CZ2D 4GTQA 3ZIMA 3FL2A 1WEEA 1IYMA 5FZRA 5B77A 3QWWA 3ABLE 2XOZA 1H19A 2HO1A 5EIBE 2LO6A 2KWOA 4QQ4A 4HLEA 4L7XA 1O1SA 4GB0A 3V79K 3TWSA 4MSXA 5J3XA 2M3HA 3JUEA 2YURA 1N4RA 2FFWA 4EZJA 1HG5A 3RPGB 3EHRA 5C2YA 1K3ZD 2WXMA 4UQXA 5AARA 5E75A 2JEKA 4YBMA 2JMIA 2WM9A 4I6GA 3HCUA 4I9EA 2CSZA 2WXHA 4XEIG 3MJWA 1QNFA 2RSDA 3FY4A 1L5JA 2QJ0A 1H2VC 3ZEFA 4DK5A 1JWFA 5G04B 3RO2A 2R03A 4LNGA 3HYMB 2QFCA 5ENSD 5IY5E 3OXGA 2F8YA 2J07A 4FIPA 5T3RA 4A3VA 4GYWA 2L43A 1JM7A 3L82A 3UT7A 2RKKA 2R05A 2VSNA 4YADA 2MA5A 3JYSA 2ZGDA 4RG6A 5H1TA 4J6IA 2KM4A 3URZA 5TBNA 1TEZA 3AJIA 4CDNA 4GNDA 5H9MA 3TAXA 2JMJA 4N3AA 2ECNA 3O37A 4NQ0A 1S0PA 4QFVA 3EU9A 3FH5A 4ILIA 3ZYKA 2WQ7A 2ZIRA 2GGFA 4FC8A 4DPRA 2OEWA 3ASDA 3HVEA 4MRUA 1WEQA 1E7VA 1Z6TA 4UWKA 4EZLA 2FD4A 4JD2G 1LF8A 4GMRA 2UZGA 2MHKA 3AG2E 5HRYA 3SQVA 2D8SA 4DI3A 2QYUA 3ZW3A 2XP0A 4WWOA 3VLEA 4YDWA 4CDRA 1MX6A 2DIWA 4CCAA 1S64A 3SBTB 3I3NA 3MV3B 5AIUA 3T6RA 2IOLA 1TNZA 2G43A 2C2LA 2HYZA 2JLBA 3ZTGA 2H0DA 4HOTA 5LOZA 3U5PA 3EU5A 4FJYA 5C13A 3CVXA 3UINC 3X2QE 2PNNA 3KSLA 2X6IA 3VTYA 4AOFA 1WEUA 5LKXA 2KIZA 2HE0A 3TG5A 3TJPA 3FEYA 3N9NA 5EX0A 5AQAA 3ASHA 1LD7A 2XPYA 1IHBA 1N11A 4BEPA 4I7CA 2FEZA 3D9IA 3NZSA 4JHJA 1H6KA 3NQPA 3NG2A 3L11A 4GPKA 3GZ1A 4JB8P 3ZVVA 4MVTA 3GZSA 3B7UX 3V2OA 3PURA 2YINA 5EYLA 5CRVA 4LLBA 4I6JA 4R7EA 3L22A 3ZYMA 3V43A 1S63A 3PE3A 3SFYA 3CVUA 5ANRA 5B76A 3E32A 3B13A 5EKQD 4EPZA 4WA6A 3VTXA 4WZ0A 4X3GA 4XIFA 2JMDA 3L13A 2XRYA 2PM6A 1N94A 3MYVA 2IQCA 2K1JA 5FWQA 5HKPA 2CHWA 3QJZA 3D9LA 3HVEB 3T9KA 2WXKA 2RD0A 2V8SE 4BT8A 1WG0A 1O1RA 2F6JA 3CSTA 3PZ3A 2Y1MA 2E2EA 3MEKA 2LNIA 1E96B 2RG8A 3O7AA 4UWFA 4GYOA 4B86C 3MGBA 3W9FA 4O6FA 3JCKC 1VD4A 2WB2A 2MNZA 3C5RA 3C6WA 4C9ZA 4U7EB 3ZNGA 3Q49B 4AP2A 1EYHA 2MIQA 4I1OB 3FU6A 1JM7B 1JPLA 3LY9A 2L0TB 5JA4D 4DX6D 4HXIA 3FUDA 3C3OA 2WPVA 1ELRA 2GROB 5BT1A 1WFKA 1K8KG 5T8IA 3IBEA 2ECGA 2GRPB 4KBQA 4N2QA 2D8UA 2WQHA 3HXEA 4U04A 1ZU2A 4LG6A 2Y69E 3PZ4A 4UWGA 1YYHA 3PZ1A 2P9LG 3SFXA 3EB5A 3DPDA 5SVIA 5ITZF 3Q15A 5SVIB 4V3LC 4J8SA 2MOWA 5BV1A 2QICA 4ACKA 2J4DA 1V87A 5LKTA 2XEEA 3ZN3A 2PL2A 3Q4AB 1E8XA 3KV6A 4GZ6A 1FP0A 1NFIE 3EHQA 4ZUXU 2CHZA 3PUQA 2GRLA 4GZCA 1VFYA 5DINA 2IQJA 1N4QA 2XS1A 3DDTA 1OWMA 5KH7A 3Q79A 4IC2A 4A3TA 4E6HA 4H7XA 4NRHB 2J4BA 2X38A 3E37A 1OWOA 3PUKA 1F62A 2CFUA 4UP0A 1HFAA 5CRUA 1Z5SC 1TYQG 5LX8A 1WGMA 3IHVA 4P29A 3HHMA 2JUNA 2Y4TA 2HDPA 4P5OB 4UI9K 4B7YC 4YBTA 3SHFA 4IRUA 1WESA 4LUNU 3PS6A 5JHAA 1JUQA 3ZYQA 2CG2A 3TGOA 4DUIA 2XGSA 4MBGA 4HORA 4YVQC 5D1KB 4GA2A 3V31A 4GTMA 3JQ1A 3VLFA 4O1PA 3CVWA 2ECVA 2YSJA 3KV5A 1SA5A 1KLXA 3LPZA 1WIMA 4GZ3A 3FM8C 3BG1B 4B89A 2VNFA 4DX5D 4I2ZA 3CHQA 4FA6A 4LKAA 1MZCA 3KSQA 4G8KA 1MHQA 5G05J 1LD8A 2NYJA 1HS6A 5ENNA 2YW8A 3CHOA 2XENA 2KREA 2I50A 4XKBA 3LEWA 4GMLA 2ETBA 4N2SA 3I2DA 1WY6A 4HQDA 2VGEA 3SZ7A 3LYAA 1HZ4A 3FEHA 4A1SA 2FBNA 2WXGA 3FTUA 5M72A 3RPGC 2MUMA 4L9PA 4G26A 3SBSA 2H6IA 3FUHA 1WDYA 3UM2A 5KJKA 4CDMA 5AQ9A 4R2YA 4J8YA 2R02A 2Y4UA 3FEXA 3UKRG 1FBVA 1BPOA 3IKOB 3G2UA 3FFLA 3UKUG 4HNAD 4KZCA 4F1SA 5D1MB 2PM7A 2P9IG 2V0PA 3CK7A 4OAUC 2KGGA 2EA6A 3TWUA 1YCSB 3HG0D 4PS7A 2FI7A 4FJZA 3BQOA 5KNGA 2VGXA 1HH8A 3PNTB 4XI9A 3RK6A 4M7CA 2YQ8A 1WAO1 4C9BB 1RMDA 5B75A 2E6RA 2MD8C 5G0FA 3FTWA 1IHGA 1X4JA 5EX3A 2J08A 3M99A 1FVHA 1D8DA 3AAAC 3RAUA 3UPVA 5FZSA 3ML8A 3Q75A 4Z68A 5J08A 3ESLA 3ZYLA 3ZVZB 4GMJA 3FUIA 3PHDA 4N3CA 3ONLA 4D10C 3ZPVE 4U0UA 2KWNA 4HLLA 4WUYA 3O36A 1NI1A 1NL4A 2JM3A 4Z0RA 1T1HA 3E30A 4JZYA 3MHSA 4Q6FA 2JRJA 4V3IA 2XEVA 1QQEA 3UX4A 1MM3A 2P9PG 4F1PA 2DYRE 3FJUB 3ZGQA 4DRXE 3P1UA 3JXIA 4RG9A 5CECB 4HS2A 3C98A 2M13A 4JXTA 4J0UA 2KKYA 1A17A 4WNEA 2LQ6A 3Q1DA 3C5KA 2A5EA 2MKEA 5KH3A 4JA7A 4BSXA 5FTPA 5EYPF 4L58A 2P9UG 5H7PA 2PUYA 4GNFA 1ELWA 5AENA 3JUIA 4EHMA 3HXDA 3HCTA 2WQ6A 3ZPJA 4I7BA 1OWPA 5BPPA 3Q9NC 2V5FA 3DSXA 3VLDA 3KS2A 2OEVA 2XPZA 4TRQA 2VGXB 4HRLA 1JCSA 4H9DA 2WXJA 3B7SA 4BX9A 4QF3A 5D0OD 4Q69A 5B79A 3L17A 4KXKB 3S2AA 2EIME 3PDNA 4Y6WA 4I6EA 2VPBA 1G25A 5H1UA 1O1TA 4LK9A 2YU4A 3B7TA 2XPIA 4OAVB 2KU3A 5KH9A 2LRIC 5A6CA 1K1AA 2LAHA 4G23A 3FUKA 2H6HA 5CBOA 5AQ7A 4GYYA 4PH4B 2P9KG 1AP7A 2FO1E 1YMPA 1BD8A 3TXNA 2X6FA 1SZAA 3EIJA 4U8YD 5FERA 1KT1A 4A55A 2PQRA 4JC8A 2KFTA 2J49A 5AQBA 2L5UA 1HG2A 4O1OA 4DJAA 2AXUA 2UY1B 3UQ3A 1E8WA 3U64A 1X5BA 5LCWC 4K5BA 3LY7A 2F0YA 2BAYA 4XI0A 1E7UA 4I2WA 1PAQA 2EINE 2IEJA 3LJNA 4OYSA 4UI9B 5SVXA 3ZHEB 4FHJA 4PTBA 1FCHA 2CG3A 3BG0B 5TDRA 1UN9A 4GA0A 4FHKA 2XHEA 2AWIA 2G45A 1Z2QA 2YQLA 3Q5MA 2CKLA 3TWRA 3GL6A 3CVYA 2LGGA 3T5XA 5A23A 4N5QA 2BTDA 4UUCA 3FWVA 4BTBA 5B78A 3CQCB 5TRBA 5KJMA 1H6PA 3MKQA 3TXMA 1WEVA 2LN0A 4KZ0A 4CRWA 3PZ2A 2ZETC 3RRMB 1INZA 1SW6A 4ATGA 1IXVA 4GCNA 4A1GA 2PNXA 4HFGA 3J5PA 5D1LB 2XQ0A 3FU3A 3H7HA 3C3RA 5KJLA 2XOCA 3TWVA 5LKZA 3HXCA 4NURA 3HDXA 3ENEA 4LNUD 4GTPA 3CHMA 2M6MA 3PEUB 3E4BA 4UWHA 4YAXA 4WAFA 2YREA 4I7DA 1LTXA 2LAUA 3C72A 3HRAA 4RSYA 3RU0A 3CIAA 3QC1A 3N9PA 4OGCA 4LEUA 2IONA 2HM8A 3TWQA 3FUJA 3R7RA 1B89A 3FHEA 3BU8A 2YHCA 5AYWD 3PUJA 3CVQA 1MQSA 5B3SE 4GTVA 3G2VA 4JHRA 1UN8A 1HU3A 5G05C 2WXOA 3N9OA 5D66A 5KWDA 4M3OA 4BX8A 4ANXA 1LDJB 3DQVR 5I3LA 3SOXA 2YUCA 2ECIA 2L9BA 4RVBA 1QZ2A 2X6KA 1Z6UA 2IFUA 3L6AA 3EB6A 4EZKA 3LY8A 3CHRA 3AS4A 3WXXA 3V30A 1BORA 2DWZA 3SI5A 3DSSA 3UM0A 2E6SA 3NOCD 4C0MA 2GRRB 3MHHA 4AXHA 2LSVA 1IQUA 2RR4A 5AJLA 4BTAA 2J9QA 3QNKA 2K16A 2KGIA 4Z0OA 4LNBA 4U8HA 2IY0C 5D0QD 4PS8A 2LDRA 4B8AA 3LQIA 1U2VG 5CMYA 3MV2B 4APFA 4BSZB 2H6FA 1K2FA 5FJYA 1N9AA 4RQIA 3L9TA 1VYXA 1P5QA 4RLYA 1A5EA 3CLJA 2R2LA 4BY6A 4N5CA 1N0QA 4GU5A 2FUIA 2Y3AA 5AJDA 4K5AB 4NACA 2CT2A 2XCBA 2KR4A 4U95D 2IDAA 3AG1E 1OWNA 3ZU7B 3HCSA 3S7BA 5FQ8A 3RO3A 2ECWA 2LGVA 4L2LA 4IULA 4LCTA 5CERB 2ILRA 3L1ZB 4YNDA 1BI8B 2H6GA 4XI1A 3D9JA 3FU5A 3OXFA 4I1MA 1XGWA 1JCRA 1OT8A 3UI2A 3SOUA 2GRQB 1MX4A 4DX1A 2VTBA 1WENA 5TABA 2DZOA 5EYAF 2I2OA 5SVYA 3CVNA 4JEUA 2XS8A 3LJUX 2IU1A 1FT2A 2LV9A 3MA5A 3PLWA 1XNFA 5ANLA 3FUMA 2CSVA 4FU3A 1OCZE 4U8VD 4AUQB 3S7DA 2VTBB 2EQXA 2VSXE 2VPEA 3G2WA 4B94A 2WXIA 3U66A 4UQZA 2Y1NA 4X8QA 3W9GA
chains in the Genus database with same CATH topology
1H2VC 2WXFA 5EX3A 3UT4A 3ZEFA 2J08A 3L08A 4DLOA 1JWFA 3D9KA 4DK5A 1FVHA 3K9IA 3RO2A 2VP7A 3M99A 3ZRHA 4GNGA 5G04B 3HYMB 4U63A 4G2VA 3UPVA 4PS3A 2M63A 3FTVA 3ML8A 2KZTA 2QFCA 4OVUA 5FZSA 5J08A 3ESLA 3OXGA 4MLPA 3ZYLA 2J07A 3ZVZB 3ZHEA 4FIPA 2WXPA 5T3RA 4A3VA 2KWJA 4CA1A 5D1KB 4GMJA 4GYWA 2L43A 4R7LA 3FUIA 3PHDA 4N3CA 3ONLA 3S7JA 3UT7A 4D10C 4U0UA 3T7LA 3ZPVE 1JM7A 3P2BA 4ANVA 3CR3A 3U5OA 2KWNA 2LAIA 2VSNA 3L54A 4G1TA 4JPSA 2MA5A 4YADA 4JEHA 3EDTB 3JYSA 4JA9A 4WUYA 3O36A 4R8PK 3ZXSA 4RG6A 4Y6CA 5H1TA 4J6IA 5BUZA 4AP4A 2KM4A 2MT5A 1T1HA 2YT5A 5TDWA 3URZA 3EHNA 5TBNA 4JZYA 1TEZA 3MHSA 4Q6FA 3SOWA 2JRJA 2VJEB 4V3IA 2XEVA 4CDNA 1QQEA 3UX4A 4AY6A 5LFAA 4XZ4A 1MM3A 2MA6A 2VSOE 2KWKA 4GNDA 3LXUX 3O70A 5H9MA 4AVXA 1WEOA 4GCOA 3NZUA 2EODA 3TAXA 2JMJA 3ZGQA 2YHEA 3P1UA 4ILHB 4N3AA 3QOUA 2ECNA 3O37A 4RG9A 4NQ0A 4U0SA 2DX8A 1S0PA 3CV0A 4HS2A 4G24A 4QFVA 2AN6A 2A5UA 3FH5A 3C98A 4ILIA 2M85A 3ZNIA 4FULA 3AS8A 3ZYKA 2WQ7A 2CSYA 3JQ0A 5G05B 3ZPV1 2GGFA 4JXTA 4UP5A 4FC8A 4J0UA 4DPRA 2KYUA 3ASDA 3HVEA 1A17A 4MRUA 4WNEA 1WEQA 1E7VA 1Z6TA 2LQ6A 4UWKA 4KT6B 4EZLA 5FQ4A 1Z60A 3C5KA 1LF8A 5KCMA 3AS5A 4JL0A 2VJFB 3RKVA 2UZGA 2V4LA 5ARFA 5KH3A 4C0EA 4JA7A 2MHKA 4L2YA 4BSXA 2H0DB 5FTPA 4L58A 3SHBA 3GZ2A 3TL5A 2KE1A 5ARGA 2D8SA 2PUYA 4GNFA 5T4YA 5DKAA 4KYOB 4BBQA 3PZDA 4TV3A 1ELWA 1NA0A 4DI3A 4EBAG 1Y8MA 2VQ2A 3ZW3A 4YVOA 4WWOA 5AENA 5DBKA 3JUIA 1WE9A 3VLEA 1WILA 3PREA 4CDRA 4GA1A 3HCTA 2YHOA 2DIWA 4A4BA 4CCAA 2WQ6A 3ZPJA 2LXHC 4I7BA 3SBTB 3MX3A 1OWPA 1E8ZA 3I3NA 3MV3B 3S7FA 1ZBDB 5AIUA 2WXRA 3T6RA 5BPPA 2R5SA 2V5FA 2VGYA 3VLDA 5CCLA 4I9CA 1CHCA 3KS2A 5J90A 2XPZA 1UW4B 4TRQA 2GRMA 4AY5A 2IOLA 4N3BA 2G43A 3CHPA 2VGXB 2FSAA 2C2LA 2HYZA 2JLBA 3ZTGA 4I17A 2WXJA 3B7SA 1GW6A 2KCLA 2C2VS 2H0DA 4HOTA 5FEYA 3GW4A 5LOZA 4BX9A 4QF3A 3U5PA 5D0OD 4FJYA 3CGHA 5C13A 3FH8A 4Q69A 2NAAA 1NZNA 3APCA 3CVXA 2KCVA 4B0ZA 3ULQA 4JHKA 4ABNA 3VTYA 3CHSA 2X6IA 4AOFA 1N54A 3L17A 4KXKB 3S2AA 1WEUA 1XWHA 5B79A 2MRIA 2PQNA 5LKXA 2J09A 2KIZA 4O64A 4S3OB 2WXLA 3PDNA 2YNQA 4FLBA 4Y6WA 3TG5A 4I6EA 3FEYA 3RJVA 5EX0A 3TJPA 3D3MA 2G6QA 2VPBA 3L1XA 3N9NA 4EECA 1DVPA 3ASHA 1G25A 5H1UA 4DLQA 2XPYA 4LK9A 5C1DA 3B7TA 2YU4A 3OTNA 4WWNA 2XPIA 1FVFA 2FEZA 3D9IA 3NZSA 3DBSA 4JHJA 4I7CA 1H6KA 3CQGB 2C0MA 1IQRA 3NQPA 4W9RA 2KU3A 5HI7A 2FO7A 3U3WA 2ZU6B 3NG2A 3L11A 1H2UA 3GZ1A 4GPKA 3ZVVA 5KH9A 2OV8A 3G2SA 1ELKA 1U3CA 2FULA 4XE0A 2LRIC 5A6CA 3RRUA 2CHXA 4MVTA 5C11A 4J8FA 3GZSA 1LDKC 1E4UA 2LAHA 3B7UX 2UY1A 3PURA 3LVQE 2P58C 4G23A 3FUKA 2L80A 3FTZA 3O33A 2YINA 3PRZA 3EJNA 4LLBA 3LS8A 4I6JA 3L22A 3ZYMA 2BUGA 3FUEA 1E90A 2ONDA 4ME2A 3V43A 4GYYA 3PE3A 4UI9C 4PH4B 4URKA 5ANRA 3CK9A 3CVUA 5B76A 3B13A 4BWRA 2UWJG 2XGOA 5EKQD 4EPZA 4WA6A 3VTXA 4WZ0A 3CVLA 2WVIA 3ML9A 4JW1A 4X3GA 1HO8A 4XIFA 2JMDA 3L13A 3TXNA 2XRYA 2X6FA 4YC9A 1SZAA 1NA3A 2PM6A 2F42A 3MYVA 2IQCA 1X4UA 3EIJA 2K1JA 5FERA 1KT1A 3KEZA 3U4TA 5FWQA 3N9MA 2CHWA 3HTKC 3QJZA 2PQRA 4A55A 3D9LA 3AU4A 3HVEB 2DCPA 4A0CD 2WXKA 2RD0A 4PPEA 2KATA 4JC8A 2KFTA 2LGLA 2OXQC 2J49A 2VPGA 2L5UA 2V8SE 5KJNA 4BT8A 2L75A 4Q94A 2E0IA 1HG2A 2OOEA 2F6JA 4NN2A 3CSTA 4DJAA 2AXUA 4KVMA 2Y1MA 1Y6IA 2UY1B 2E2EA 3UQ3A 1E8WA 2LNIA 3MEKA 3U64A 1X5BA 4ZQLA 1E96B 1HXIA 4UQYA 2RG8A 5LCWC 3VK6A 1PY1A 3ASGA 3O7AA 4UWFA 5E76A 4GYOA 4B86C 3MGBA 2IJGX 4KMOA 1HE8A 3KAEA 2VPDA 2I1JA 3SGHA 2I9CA 5JJ6A 3I4GA 3LQHA 4FK5A 1SZ9A 4O6FA 3LY7A 2BAYA 3JCKC 1HYIA 2YQMA 1VD4A 4XI0A 2IF4A 1E7UA 3QWVA 4I2WA 2WB2A 4OVVA 1PAQA 2MNZA 2A4ZA 3C6WA 3MCXA 4C9ZA 4HOUA 5LCWJ 1EDUA 2NC9A 3FUNA 4K03A 5BV0A 1ZBPA 4OYSA 4UI9B 3CK8A 4FHJA 3Q49B 3ZHEB 4AP2A 4PTBA 1FCHA 5AITA 1EYHA 3ASLA 2CG3A 3BG0B 3FTSA 3HIZA 3MKRA 4I1OB 5FZQA 3TG4A 3B7RL 2MIQA 2MNYA 2LXPC 1UN9A 4N3WA 3FU6A 4GA0A 1JM7B 1JPLA 3LY9A 2L0TB 4FHKA 1SQMA 2XHEA 2AWIA 2G45A 2YSMA 4IC3A 2DBAA 1JWGA 2IOSA 1Z2QA 2YQLA 3PE4A 4HXIA 3CEQA 1OWLA 3Q5MA 2CKLA 3FUDA 4J8EA 5BW8C 5HQ8A 2WPVA 1TJFA 3GL6A 1ELRA 4BHWA 5BT1A 3CVYA 4WWPA 2AXVA 1WFKA 2LGGA 3T5XA 5T8IA 3IBEA 4AEZC 2ECGA 4TKPB 1UJJA 4KBQA 1W3BA 2I1KA 5A23A 4AYCA 4ANWA 4N2QA 2BTDA 4JVSA 3AU5A 2AVPA 3FWVA 4BTBA 2WQHA 4U04A 3M63A 5B78A 3CQCB 1NP7A 1ZU2A 3SNXA 1N87A 5TRBA 4U0ZA 5KJMA 2WXNA 2Y43A 3DPLR 3MKQA 3TXMA 1WEVA 4I1AA 5TDRA 2LN0A 4J8DA 4KZ0A 3PNLB 4CRWA 4F3VA 4WZ2A 2ZETC 3RIBA 4UWGA 3RRMB 4AJWA 1INZA 1H0AA 3IV0A 4ATGA 4MKTA 4GCNA 4APOA 4A1GA 4FADA 2PNXA 3DPDA 3EB5A 4PUCA 4HFGA 4UWLA 3Q15A 4GNEA 2XQ0A 3T5VA 3FU3A 5EDSA 1Z3YA 1X4IA 3PH0C 4R7EA 4V3LC 2VSYA 4FLHA 4J8SA 2MOWA 3U9WA 5BV1A 4DI4A 5KJLA 2MD7B 4YBSA 5LKZA 1HYJA 3O35A 2QIZA 4TUUA 5G04C 3QKYA 5CHEE 2QICA 4ACKA 4NURA 3HDXA 2RI7A 2J4DA 2WMNA 4IN3B 3CVVA 1V87A 5LKTA 3MZLB 4FJCA 3ENEA 3ZN3A 3LCAA 1EF1C 3CHMA 2CFZA 3SD5A 2PL2A 3PEUB 2ECJA 5DIZA 2R59A 2M6MA 3E4BA 3Q4AB 3IHPA 3UUXA 4BT9A 3LRQA 4AIFA 2EGPA 1E8XA 2HR2A 3KV6A 4FO9A 3I4RB 3FU0A 1KT0A 4GZ6A 3RTRB 4UWHA 4YAXA 4WAFA 2YREA 4GZDA 4I7DA 1FP0A 4L7TA 4ZUXU 2CHZA 3PUQA 2NXPA 2GRLA 3I5PA 2AXZA 4GZCA 1VFYA 4RSYA 1U6GB 5DINA 1WEMA 2OVFA 3RU0A 4EBAA 3CIAA 3O48A 4N4FA 3QC1A 3N9PA 2BF0X 3PVLA 1OWMA 4A4CA 5KH7A 2X3MA 4IC2A 4A3TA 1N52A 1U3DA 4MS6A 3APDA 4E6HA 4IYPA 4LEUA 4H7XA 3G2TA 2IONA 4NRHB 4E85A 2HM8A 3U5NA 2J4BA 3FUJA 2X38A 3MKQB 3QB2A 3R7RA 3M62A 2M1RA 4V3KC 5FT9A 1B89A 3FHEA 1OWOA 3PUKA 1IYGA 1F62A 2YHCA 2CFUA 4CT4A 5AYWD 4UP0A 3PUJA 3CVQA 1HFAA 1YA0A 5FQ6A 2VJEA 2XB1A 1MQSA 2YYRA 3D9PA 3KD7A 3G2VA 3BEEA 4JHRA 4PDXA 1UN8A 1HU3A 5G05C 2WXOA 5LX8A 3N9OA 1WGMA 3IHVA 4M3OA 4BX8A 4P29A 3R9AB 3D9OA 3HHMA 4ANXA 1LDJB 3DQVR 5A7DB 3U5MA 3SOXA 2YUCA 2Y4TA 2ECIA 2HDPA 1EPUA 4P5OB 3CKCA 4UI9K 2L9BA 2ECTA 2K4DA 4B8CB 5JJTA 4S3OC 4B7YC 5AIJA 4XKCA 4YBTA 4LRZA 4RVBA 4KVOA 1QZ2A 2X6KA 4IRUA 3SHFA 1WESA 2PZIA 1Z6UA 4LUNU 3PS6A 2VYIA 5JHAA 2IFUA 1H2TC 4FP7A 4A49A 1JUQA 3L6AA 4K0RA 1WEPA 3ZYQA 2CG2A 1WEWA 3OAWA 3EB6A 3GV4A 4W4UA 4WZ3B 3FTXA 3D9MA 3TGOA 2XGSA 3LY8A 4EZKA 4YVQC 4HORA 3QDNA 3CHRA 2WMOA 3AS4A 3FH7A 3ONKA 4GA2A 3GYZA 3EIQC 3WXXA 2VJFA 3FP3A 3FTYA 3JQ1A 5JHBA 4I43A 2I6HA 2XRZA 4WNGA 3L16A 2FF4A 2AW6A 3ASFA 4UI9J 3SI5A 3VLFA 3CVWA 3LKUA 1BORA 3NF1A 4C0MA 2E6SA 3MHHA 2ECVA 1PC2A 2YSJA 3KV5A 4AXHA 3FULA 1KLXA 3O34A 4ACLA 2LSVA 4LADB 2QY7A 1IQUA 4G25A 3LPZA 1WIMA 3N9LA 5AJLA 3LJ3A 3QK0A 4GZ3A 4F52B 4BTAA 3BG1B 4L23A 2L0BA 4B89A 2VNFA 4LKAA 4I2ZA 2VJ8A 2J9QA 3CHQA 3OXLA 3QNKA 3RRNB 4F53A 1TJCA 4FA6A 2F6NA 2K16A 2KGIA 4WNDA 2LGKA 4GAAA 4U8HA 1MHQA 2WXQA 5D0QD 4PS8A 5G05J 2GW1A 2LDRA 3ZVYA 5G55A 3D9NA 1HS6A 4GZ5A 4B8AA 3LQIA 3N9QA 5ENNA 5CMYA 2YW8A 1VDYA 3CHOA 2CKLB 2K17A 3KQIA 2Q7FA 3MV2B 4H7YA 4APFA 5BNWA 4L1BA 3O4ZA 3CVPA 5FJYA 1K2FA 2I50A 4XKBA 2KREA 3LEWA 4CGVA 3R7QA 4GMLA 4EQFA 3T8MA 1P5QA 4CEMA 4HVBA 1VYXA 4N39A 3CLJA 4N2SA 4GB9A 4BY6A 4CT0A 1HX8A 3I2DA 4N5CA 1WY6A 3N71A 4BFRA 4GU5A 4XX5A 5FQ7A 4ANUA 2YHNA 2XGMA 2FUIA 4HOQA 2Y3AA 5AJDA 5LP0A 4NACA 2CT2A 2KR4A 2KZTB 2XCBA 3APFA 3LDZA 2OVBA 2C0LA 3IEGA 2X6HA 3LYAA 3SZ7A 2IDAA 4G11A 1OWNA 1HZ4A 3SFZA 4HOSA 1OUVA 1UJKA 5CMWA 3FUFA 5D1LB 2R17C 2NSZA 4A1SA 3S7BA 5CCMA 3HCSA 3ZFWA 4YABA 2FUUA 1WM5A 5FQ8A 3RO3A 2FBNA 2WXGA 2ECWA 2LGVA 5LKUA 3FDHA 1Z3XA 4L2LA 2KC7A 5FB1A 5FB0A 4IULA 3FTUA 5M72A 3CKBA 4YATA 4LCTA 4LJNA 3QWPA 2ILRA 3L1ZB 4YNDA 3RPGC 1UG3A 2MUMA 3UT8A 3ESKA 2KCKA 3KNVA 2L6JA 2L0IA 3QARA 4G26A 2HYED 3D9JA 3SBSA 4XI1A 5H1VA 3UMVA 3FU5A 3OXFA 3FUHA 4I1MA 5KJKA 1XGWA 4F7AA 1MM2A 4QF2A 4CCGX 3IHYA 3ZIMA 3FL2A 1WEEA 4AV7A 1IYMA 3CSFA 5FZRA 1DNPA 4CDMA 4R2YA 2XCCA 5JJ7A 3SOUA 5B77A 3QWWA 2Y4UA 3FEXA 3LVRE 1FBVA 1BPOA 2VTBA 3IKOB 1H19A 3FFLA 2HO1A 3G2UA 2LO6A 4U07A 1WENA 5TABA 5B8DA 3QZVA 3QAQA 2KWOA 4KZCA 5EYAF 4HLEA 4L7XA 4F1SA 2I2OA 2PM7A 5D1MB 4GB0A 3CVNA 4JEUA 2V0PA 3CK7A 4LERA 2XEUA 4AYCB 4MSXA 2KGGA 2IU1A 5J3XA 2EA6A 2M3HA 2YURA 2LV9A 3MA5A 4EZJA 1XNFA 1HG5A 3RPGB 4Q96A 5ANLA 5C2YA 5JG6A 3FUMA 1E8YA 4PS7A 2WXMA 4WNFA 4FU3A 4ILGA 4CGWA 5G2NA 2FI7A 4UQXA 4FJZA 4AM9A 5E75A 3Q47B 2VGXA 1HH8A 2JEKA 3S7DA 1HF8A 4AUQB 4YBMA 3PNTB 2VTBB 4XI9A 2JMIA 3RK6A 2WM9A 2EQXA 4I6GA 2LSUA 2VSXE 3HCUA 2YQ8A 1WAO1 4I9EA 5G04J 2CSZA 2VPEA 4C9BB 1JOCA 1RMDA 5LCWB 3EHMA 2WXHA 3G2WA 5B75A 4B94A 3MJWA 1QNFA 2E6RA 3LQJA 2MD8C 2WXIA 3U66A 2RSDA 5G0FA 2X6JA 4UQZA 3SF4A 2Y1NA 3FTWA 3PEVB 3FY4A 1IHGA 1L5JA 5I3LA 1X4JA 4ZDTA 2QJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  3M99 A;  5G04 B;  3K9I A;  3RO2 A;  2VP7 A;  4GNG A;  3HYM B;  4G2V A;  3UPV A;  5FZS A;  2QFC A;  3OXG A;  3ZVZ B;  3ZHE A;  4FIP A;  4CA1 A;  2KWJ A;  4GYW A;  2L43 A;  3PHD A;  4N3C A;  3S7J A;  3T7L A;  3ZPV E;  1JM7 A;  4U0U A;  3U5O A;  2KWN A;  4G1T A;  2VSN A;  4YAD A;  2MA5 A;  4WUY A;  3EDT B;  3JYS A;  4JA9 A;  3O36 A;  4R8P K;  4RG6 A;  4Y6C A;  5H1T A;  4AP4 A;  2MT5 A;  1T1H A;  2YT5 A;  5TDW A;  3URZ A;  5TBN A;  3MHS A;  4Q6F A;  3SOW A;  2JRJ A;  2VJE B;  2XEV A;  1QQE A;  4AY6 A;  1MM3 A;  2MA6 A;  2KWK A;  4GND A;  3O70 A;  5H9M A;  4AVX A;  1WEO A;  4GCO A;  2EOD A;  3TAX A;  2JMJ A;  3ZGQ A;  4N3A A;  3QOU A;  2ECN A;  3O37 A;  4RG9 A;  4NQ0 A;  4U0S A;  2DX8 A;  3CV0 A;  4G24 A;  2AN6 A;  2M85 A;  3ZNI A;  3AS8 A;  2CSY A;  5G05 B;  4UP5 A;  4J0U A;  2KYU A;  3ASD A;  1A17 A;  4WNE A;  1WEQ A;  2LQ6 A;  3C5K A;  1Z60 A;  2VJF B;  3AS5 A;  4JL0 A;  3RKV A;  2UZG A;  5ARF A;  5KH3 A;  4JA7 A;  2MHK A;  2H0D B;  5FTP A;  4L58 A;  3SHB A;  3GZ2 A;  2KE1 A;  5ARG A;  2D8S A;  2PUY A;  4GNF A;  4KYO B;  4BBQ A;  1ELW A;  1NA0 A;  1Y8M A;  2VQ2 A;  4YVO A;  5DBK A;  1WE9 A;  1WIL A;  4CDR A;  4GA1 A;  3HCT A;  2YHO A;  4A4B A;  3ZPJ A;  2LXH C;  4I7B A;  3MV3 B;  3S7F A;  1ZBD B;  5AIU A;  3T6R A;  2R5S A;  2V5F A;  2VGY A;  1CHC A;  5CCL A;  4I9C A;  3KS2 A;  4AY5 A;  4N3B A;  2G43 A;  2VGX B;  2FSA A;  2C2L A;  2HYZ A;  2JLB A;  3ZTG A;  4I17 A;  2C2V S;  2H0D A;  2KCL A;  4HOT A;  5FEY A;  3GW4 A;  4QF3 A;  3U5P A;  5D0O D;  5C13 A;  2NAA A;  1NZN A;  2KCV A;  3ULQ A;  4ABN A;  3VTY A;  1XWH A;  5B79 A;  4KXK B;  1WEU A;  2PQN A;  5LKX A;  2KIZ A;  4O64 A;  4S3O B;  3PDN A;  4Y6W A;  4BWR A;  3TG5 A;  4AYC A;  3RJV A;  3L1X A;  2G6Q A;  5EX0 A;  2VPB A;  3N9N A;  3ZPV 1;  1DVP A;  3ASH A;  1G25 A;  5H1U A;  4LK9 A;  5C1D A;  2YU4 A;  2XPI A;  4I7C A;  2FEZ A;  2C0M A;  4W9R A;  2KU3 A;  5HI7 A;  2FO7 A;  3U3W A;  3NG2 A;  3L11 A;  4GPK A;  3GZ1 A;  5KH9 A;  2LRI C;  4MVT A;  5A6C A;  5C11 A;  4J8F A;  1LDK C;  1E4U A;  2UY1 A;  3PUR A;  2P58 C;  4G23 A;  2L80 A;  3O33 A;  5LCW B;  4LLB A;  4R7E A;  2BUG A;  4ME2 A;  3V43 A;  2OND A;  4GYY A;  3PE3 A;  4UI9 C;  5B76 A;  3CK9 A;  2UWJ G;  2XGO A;  5EKQ D;  4WA6 A;  3VTX A;  4WZ0 A;  3CVL A;  4X3G A;  4XIF A;  2JMD A;  4YC9 A;  1NA3 A;  2F42 A;  1X4U A;  2K1J A;  5FER A;  1KT1 A;  3U4T A;  3N9M A;  3HTK C;  2PQR A;  4A0C D;  4PPE A;  2KAT A;  2OXQ C;  2KFT A;  2LGL A;  2VPG A;  2L5U A;  5KJN A;  2L75 A;  4BT8 A;  2OOE A;  2F6J A;  4NN2 A;  2Y1M A;  2UY1 B;  4ZQL A;  2E2E A;  3UQ3 A;  3MEK A;  2LNI A;  1E96 B;  1HXI A;  4UQY A;  3VK6 A;  5LCW C;  3ASG A;  3O7A A;  4GYO A;  4B86 C;  3KAE A;  2VPD A;  5JJ6 A;  3LQH A;  4FK5 A;  4O6F A;  3LY7 A;  2BAY A;  1HYI A;  2YQM A;  1VD4 A;  4XI0 A;  2IF4 A;  3QWV A;  4I2W A;  2MNZ A;  3C6W A;  4C9Z A;  4HOU A;  5LCW J;  2NC9 A;  1ZBP A;  4UI9 B;  3CK8 A;  3ZHE B;  3Q49 B;  4PTB A;  1FCH A;  5AIT A;  3ASL A;  2MIQ A;  3MKR A;  3TG4 A;  2MNY A;  5FZQ A;  5TDR A;  4N3W A;  2LXP C;  4GA0 A;  1JM7 B;  3LY9 A;  2YSM A;  4IC3 A;  2G45 A;  2DBA A;  1Z2Q A;  2YQL A;  3PE4 A;  3CEQ A;  3Q5M A;  2CKL A;  4J8E A;  5BW8 C;  5HQ8 A;  2WPV A;  3GL6 A;  1ELR A;  4BHW A;  5BT1 A;  1WFK A;  2LGG A;  2ECG A;  4TKP B;  4KBQ A;  1W3B A;  4N2Q A;  2AVP A;  3FWV A;  4BTB A;  2WQH A;  4U04 A;  3M63 A;  5B78 A;  1ZU2 A;  1N87 A;  5TRB A;  4U0Z A;  5KJM A;  2Y43 A;  3DPL R;  1WEV A;  4I1A A;  2LN0 A;  4J8D A;  4WZ2 A;  4F3V A;  2ZET C;  3RIB A;  3EB5 A;  4GCN A;  4APO A;  2PNX A;  4GNE A;  3Q15 A;  5D1L B;  1X4I A;  4V3L C;  2VSY A;  2MD7 B;  5KJL A;  4YBS A;  1HYJ A;  5LKZ A;  3O35 A;  2QIZ A;  5G04 C;  3QKY A;  5CHE E;  2QIC A;  2RI7 A;  4IN3 B;  1V87 A;  5LKT A;  4FJC A;  3ZN3 A;  3LCA A;  2M6M A;  2PL2 A;  2ECJ A;  3IHP A;  5DIZ A;  3E4B A;  3Q4A B;  3UUX A;  4BT9 A;  3LRQ A;  4AIF A;  2EGP A;  3KV6 A;  2HR2 A;  4FO9 A;  3RTR B;  1KT0 A;  4GZ6 A;  4YAX A;  2YRE A;  4I7D A;  1FP0 A;  4ZUX U;  3PUQ A;  1VFY A;  1U6G B;  5DIN A;  1WEM A;  3RU0 A;  3O48 A;  4N4F A;  3N9P A;  4A4C A;  5KH7 A;  4IC2 A;  4LEU A;  4H7X A;  4NRH B;  3U5N A;  4W4U A;  3M62 A;  4V3K C;  2M1R A;  5FT9 A;  1B89 A;  1F62 A;  1IYG A;  2YHC A;  5AYW D;  4UP0 A;  3CVQ A;  1YA0 A;  2VJE A;  2XB1 A;  2YYR A;  3KD7 A;  3BEE A;  4JHR A;  5G05 C;  3N9O A;  1WGM A;  3R9A B;  1LDJ B;  3U5M A;  3DQV R;  5A7D B;  5I3L A;  3SOX A;  2YUC A;  2Y4T A;  2ECI A;  2HDP A;  4S3O C;  4P5O B;  3CKC A;  4UI9 K;  2ECT A;  2K4D A;  5JJT A;  4B7Y C;  4YBT A;  1QZ2 A;  1WES A;  2PZI A;  1Z6U A;  2VYI A;  2IFU A;  4A49 A;  3GV4 A;  1WEP A;  3EB6 A;  1WEW A;  3ZYQ A;  4WZ3 B;  3TGO A;  2XGS A;  3LY8 A;  4HOR A;  4YVQ C;  5D1K B;  3QDN A;  2VJF A;  4GA2 A;  3AS4 A;  3WXX A;  3GYZ A;  3FP3 A;  2I6H A;  4WNG A;  4UI9 J;  2FF4 A;  3ASF A;  1BOR A;  5DKA A;  3LKU A;  2E6S A;  3NF1 A;  3MHH A;  2ECV A;  1PC2 A;  2YSJ A;  3KV5 A;  3O34 A;  4LAD B;  1KLX A;  2LSV A;  4G25 A;  3LPZ A;  1WIM A;  3N9L A;  4GZ3 A;  4F52 B;  4BTA A;  2L0B A;  2VNF A;  4LKA A;  4I2Z A;  2J9Q A;  3OXL A;  2F6N A;  2K16 A;  1TJC A;  2KGI A;  4WND A;  2LGK A;  5D0Q D;  5G05 J;  2LDR A;  2GW1 A;  3ZVY A;  4GZ5 A;  3LQI A;  3N9Q A;  2YW8 A;  3KQI A;  2CKL B;  2K17 A;  2Q7F A;  3MV2 B;  4H7Y A;  5BNW A;  1K2F A;  3CVP A;  5FJY A;  2KRE A;  2I50 A;  4CGV A;  4EQF A;  1VYX A;  1P5Q A;  4N39 A;  4N2S A;  3I2D A;  4N5C A;  3N71 A;  2YHN A;  2XGM A;  2FUI A;  4HOQ A;  2CT2 A;  2KR4 A;  2XCB A;  2C0L A;  3IEG A;  3LYA A;  3SZ7 A;  2IDA A;  1HZ4 A;  4HOS A;  1OUV A;  4A1S A;  3HCS A;  3S7B A;  5CCM A;  3ZFW A;  4YAB A;  2FUU A;  1WM5 A;  3RO3 A;  2ECW A;  2FBN A;  2LGV A;  5LKU A;  5FB1 A;  2KC7 A;  5FB0 A;  4YAT A;  5M72 A;  3CKB A;  4LJN A;  3QWP A;  3L1Z B;  4YND A;  3RPG C;  2MUM A;  3ESK A;  2KCK A;  3KNV A;  2L6J A;  4XI1 A;  2HYE D;  4G26 A;  5H1V A;  3OXF A;  5KJK A;  1MM2 A;  4QF2 A;  4CCG X;  3FL2 A;  1WEE A;  1IYM A;  5FZR A;  5B77 A;  3SOU A;  4R2Y A;  2XCC A;  5JJ7 A;  3QWW A;  2Y4U A;  1FBV A;  4U07 A;  3FFL A;  2HO1 A;  1WEN A;  5TAB A;  5B8D A;  3QZV A;  2KWO A;  5EYA F;  4L7X A;  5D1M B;  4GB0 A;  3CVN A;  4AYC B;  3CK7 A;  2XEU A;  4MSX A;  2KGG A;  5J3X A;  2EA6 A;  2M3H A;  2YUR A;  2LV9 A;  3MA5 A;  1XNF A;  3RPG B;  5JG6 A;  4WNF A;  4CGW A;  2FI7 A;  4UQX A;  4AM9 A;  3Q47 B;  2VGX A;  1HH8 A;  3S7D A;  4AUQ B;  4YBM A;  4XI9 A;  2JMI A;  2LSU A;  3HCU A;  4I9E A;  2YQ8 A;  5G04 J;  1WAO 1;  2CSZ A;  2VPE A;  1JOC A;  1RMD A;  5B75 A;  4B94 A;  2E6R A;  3LQJ A;  2MD8 C;  2RSD A;  5G0F A;  4UQZ A;  3SF4 A;  2Y1N A;  1IHG A;  1X4J A;  4ZDT A;  2QJ0 A; 
#chains in the Genus database with same CATH topology
 3UT4 A;  5EN5 D;  2KBX A;  2VP7 A;  4U63 A;  4G2V A;  2MYO A;  2M63 A;  3FTV A;  3DSV A;  4A63 B;  5CBN A;  1V54 E;  3M7K A;  4CA1 A;  3KDE C;  3U5O A;  4ANV A;  4JEH A;  4R8P K;  3ZXS A;  2F8X K;  3DWD A;  2QC9 A;  5BUZ A;  2YT5 A;  2VJE B;  2IO2 C;  4AY6 A;  5LFA A;  4XZ4 A;  2VSO E;  2KWK A;  3LXU X;  1WEO A;  2EOD A;  1DCQ A;  4BER A;  2YHE A;  4U0S A;  3CV0 A;  1TR4 A;  2A5U A;  3DEO A;  4HI9 A;  2M85 A;  3O47 A;  3ZNI A;  3AS8 A;  2CSY A;  5G05 B;  4UP5 A;  1Q2Z A;  4KT6 B;  5FQ4 A;  1RZ4 A;  5KCM A;  3AS5 A;  3UIP C;  2V4L A;  5ARF A;  4C0E A;  4F6R D;  2H0D B;  3SHB A;  3GZ2 A;  3TL5 A;  2KE1 A;  5ARG A;  4YDO A;  3PZD A;  2VQ2 A;  4YVO A;  3F6Q A;  5DBK A;  1WE9 A;  1WIL A;  3PRE A;  4A4B A;  3NOG D;  2B6C A;  2LXH C;  1E8Z A;  1ZBD B;  2WXR A;  2VGY A;  3DSW A;  5CCL A;  3ABK E;  4I9C A;  5J90 A;  1CHC A;  1UW4 B;  4AY5 A;  3SO8 A;  4N3B A;  2DVW A;  3CHP A;  1KZO A;  2FSA A;  2C2V S;  2KCL A;  3CGH A;  2NAA A;  3APC A;  3ULQ A;  4JHK A;  1XWH A;  2LXL A;  2PQN A;  2J09 A;  2WXL A;  4BWR A;  2YNQ A;  3D3M A;  5BXU A;  3FAN A;  1K1B A;  5C1D A;  3DBS A;  2C0M A;  1IQR A;  4W9R A;  5HI7 A;  2FO7 A;  3U3W A;  3HXB A;  3G2S A;  1ELK A;  1U3C A;  2FUL A;  5CEA A;  5C11 A;  4J8F A;  1LDK C;  1N4P A;  2UY1 A;  3LVQ E;  2P58 C;  3O33 A;  3FTZ A;  5LCW B;  3PRZ A;  3EJN A;  1E90 A;  2OND A;  4TXR A;  1TNY A;  3CK9 A;  2UWJ G;  2XGO A;  4HRM B;  3CVL A;  2WVI A;  4JW1 A;  5B1B E;  3B7B A;  4QQI A;  2F42 A;  3KEZ A;  2L6B A;  4A0C D;  3E2D A;  2VPG A;  2LGL A;  1OCO E;  5KJN A;  2E0I A;  1S70 B;  1QBQ A;  1SA4 A;  3DSU A;  2OCC E;  4GTR A;  4ZQL A;  1HXI A;  4UQY A;  3VK6 A;  1PY1 A;  2IJG X;  4KMO A;  3KAE A;  2I1J A;  3SGH A;  5JJ6 A;  3I4G A;  3LQH A;  4FK5 A;  1SZ9 A;  2F37 A;  1HYI A;  5FIO A;  4OVV A;  2A4Z A;  5ENO D;  5LCW J;  1EDU A;  1SVX A;  2NC9 A;  3FUN A;  4K03 A;  5BV0 A;  1ZBP A;  2XEH A;  3ISM C;  5AIT A;  3ASL A;  3HIZ A;  3MKR A;  3TG4 A;  3B7R L;  2GRN B;  1SQM A;  4IC3 A;  2IOS A;  3PE4 A;  3CEQ A;  1OWL A;  4NIK A;  5BW8 C;  2QZA A;  2AXV A;  4TXP A;  4AEZ C;  4ANW A;  2AVP A;  2DZN A;  3M63 A;  2Y43 A;  3DPL R;  4WZ2 A;  4F3V A;  4J7W A;  2CRR A;  2DSM A;  2Y0B G;  2J8S D;  3UTM A;  1H0A A;  1V55 E;  4FAD A;  4MKT A;  4APO A;  4PUC A;  4UWL A;  4GNE A;  3B95 A;  1X4I A;  5EDS A;  2MD7 B;  4FLH A;  5B1A E;  3U9W A;  4YBS A;  1HYJ A;  4DI4 A;  3O35 A;  3ABM E;  5CHE E;  3ASN E;  2RI7 A;  2E61 A;  3CVV A;  4FJC A;  3SD5 A;  3IHP A;  2R59 A;  3UUX A;  3LRQ A;  4AIF A;  2HR2 A;  1KT0 A;  2AJA A;  4GZD A;  4DX7 D;  4O62 A;  3I5P A;  2AXZ A;  5ENR D;  2OVF A;  4EBA A;  3O48 A;  3PVL A;  4A4C A;  4GPM A;  1N52 A;  1U3D A;  4E85 A;  3G2T A;  1KPS B;  3SUB A;  5D2M C;  3QB2 A;  4W4U A;  3M62 A;  4YDY A;  5ENP D;  2M1R A;  4DX2 A;  5FT9 A;  2V5Q C;  1KZP A;  3NAW A;  5FQ6 A;  3D9P A;  4PDX A;  3R9A B;  5A7D B;  1EPU A;  4S3O C;  3CKC A;  2ECT A;  2K4D A;  4B8C B;  4XKC A;  1TNB A;  3KEA A;  2CON A;  1H2T C;  4FP7 A;  1UOH A;  3OAW A;  3D9M A;  1TN6 A;  3QDN A;  2VJF A;  3GYZ A;  3EIQ C;  3FTY A;  2FF4 A;  5DKA A;  3NF1 A;  2P2C P;  3O34 A;  4ACL A;  2QY7 A;  3V2X A;  2L0B A;  1ZB1 A;  3TWW A;  2VJ8 A;  3RRN B;  2JAB A;  4WND A;  2WXQ A;  3ZVY A;  1BU9 A;  5G55 A;  4O60 A;  4GZ5 A;  3KQI A;  2K17 A;  3UM1 A;  2Q7F A;  1JCQ A;  3CVP A;  4CGV A;  2BED A;  2V4H C;  3T8M A;  4HVB A;  4EQF A;  5ENQ D;  4N39 A;  4GB9 A;  2XZD G;  4XX5 A;  3EUV A;  5FQ7 A;  2XGM A;  4HOQ A;  4HB5 A;  5LP0 A;  1O5M A;  2C0L A;  3IEG A;  2X6H A;  3SFZ A;  3Q7A A;  5CMW A;  3FUF A;  2NSZ A;  3E34 A;  5CCM A;  3ZFW A;  4YAB A;  2FUU A;  1WM5 A;  5LKU A;  2KC7 A;  5FB0 A;  3CKB A;  5HS0 A;  3Q9U C;  3NBN B;  3ESK A;  2KCK A;  3ZKJ A;  2L6J A;  2L0I A;  3QAR A;  3E33 A;  5H1V A;  3DXM G;  4F7A A;  1MM2 A;  3MDB C;  4QF2 A;  3IHY A;  4CCG X;  4AV7 A;  3CSF A;  1DNP A;  2XCC A;  5JJ7 A;  4ATZ D;  1MBM A;  3LVR E;  4U07 A;  5B8D A;  3QZV A;  3QAQ A;  3FAO A;  4LER A;  4AYC B;  2XEU A;  5FIN A;  2RFA A;  3TWT A;  3IXE A;  4Q96 A;  5JG6 A;  3DEP A;  1E8Y A;  4WNF A;  4ILG A;  4GTT A;  5G2N A;  4CGW A;  5KBA A;  4AM9 A;  3Q47 B;  3D9H A;  1HF8 A;  1IKN D;  5AAO A;  2LSU A;  5G04 J;  1OY3 D;  1JOC A;  3T8K A;  3EHM A;  2ZIS A;  3ULE G;  3LQJ A;  3DWL G;  2X6J A;  3SF4 A;  2P57 A;  3PEV B;  4ZDT A;  2WXF A;  3L08 A;  4DLO A;  3D9K A;  3K9I A;  3ZRH A;  2EIJ E;  4GNG A;  4PS3 A;  4OVU A;  2KZT A;  4MLP A;  1RW2 A;  3ZHE A;  2WXP A;  2KWJ A;  4R7L A;  2Y1L E;  3S7J A;  5EIL A;  3T7L A;  3P2B A;  3CR3 A;  2LAI A;  4G1T A;  3L54 A;  4JPS A;  3EDT B;  4JA9 A;  4Y6C A;  4AP4 A;  2MT5 A;  3NB2 A;  5TDW A;  3EHN A;  4TUM A;  3SOW A;  2MA6 A;  3ULY A;  5JMN D;  3O70 A;  4AVX A;  2LXM A;  4GCO A;  2CRW A;  3NZU A;  2L7P A;  4ILH B;  3QOU A;  1D8E A;  2DX8 A;  4G24 A;  2AN6 A;  3C3Q A;  4FUL A;  3JQ0 A;  3HXF A;  2KYU A;  1FT1 A;  1TN7 A;  1Z60 A;  4TXQ A;  2VJF B;  4JL0 A;  4HRN A;  3RKV A;  2DJA A;  4L2Y A;  1G3N B;  5T4Y A;  1BLX B;  4KYO B;  4BBQ A;  4TV3 A;  4EBA G;  1NA0 A;  2P9S G;  1Y8M A;  2XZT G;  1N95 A;  4GA1 A;  2YHO A;  1AWC B;  3MX3 A;  3S7F A;  2R5S A;  2DYS E;  2GRM A;  2IO3 C;  3Q73 A;  4I17 A;  1MX2 A;  1GW6 A;  5FEY A;  3GW4 A;  3FH8 A;  1NZN A;  2KCV A;  4B0Z A;  4U96 D;  3DXK G;  3R9M A;  4ABN A;  3CHS A;  2EGM A;  1N54 A;  2MRI A;  1OXJ A;  4O64 A;  4S3O B;  5AN8 A;  3SY2 A;  4FLB A;  4AYC A;  3RJV A;  3L1X A;  2G6Q A;  1MYO A;  3ZPV 1;  4EEC A;  1DVP A;  1QYM A;  4DLQ A;  3OTN A;  4WWN A;  2RFM A;  3UXG A;  1FVF A;  3CQG B;  1D9S A;  4HBD A;  2ZU6 B;  1H2U A;  3TWX A;  2OV8 A;  5KNH D;  4XE0 A;  3RRU A;  2CHX A;  1E4U A;  2BKG A;  2L80 A;  3DPY A;  5BXO A;  3LS8 A;  2BUG A;  3FUE A;  4ME2 A;  4ZHB A;  2P9N G;  3BUA A;  4UI9 C;  4URK A;  3ZXP A;  3ML9 A;  1HO8 A;  4YC9 A;  1NA3 A;  2LUH A;  3JXJ A;  1X4U A;  3U4T A;  3N9M A;  2YVR A;  3HTK C;  2EXU A;  3AU4 A;  2DCP A;  4PPE A;  2KAT A;  2OXQ C;  4YDE A;  2L75 A;  4Q94 A;  2OOE A;  4NN2 A;  3ZUV B;  4KVM A;  1Y6I A;  2XOY A;  3ASG A;  5E76 A;  1HE8 A;  2VPD A;  2I9C A;  2KXP C;  3LDY A;  2YQM A;  2IF4 A;  3QWV A;  2BKK B;  3MCX A;  4HOU A;  3AG4 E;  3CK8 A;  3FTS A;  2MNY A;  5FZQ A;  4N3W A;  2LXP C;  1X81 A;  3RSE G;  2EIL E;  2YSM A;  2DBA A;  1JWG A;  3ASO E;  4J8E A;  1N4S A;  5HQ8 A;  1TJF A;  4BHW A;  4WWP A;  5ENT D;  5K3Q A;  4ZFH A;  4TKP B;  1UJJ A;  3J5Q B;  1W3B A;  2I1K A;  4JVS A;  3AU5 A;  3UM3 A;  1NP7 A;  3SNX A;  1N87 A;  4U0Z A;  2WXN A;  4I1A A;  4J8D A;  3PNL B;  3RIB A;  3Q7F A;  4AJW A;  2ETA A;  3IV0 A;  1TNU A;  3T5V A;  2EIK E;  1Z3Y A;  3PH0 C;  2VSY A;  1MJ0 A;  2QIZ A;  4TUU A;  5G04 C;  3QKY A;  1BI7 B;  2WMN A;  4IN3 B;  3MZL B;  3LCA A;  1EF1 C;  2CFZ A;  2ECJ A;  5DIZ A;  4BT9 A;  4FO9 A;  2EGP A;  4C48 B;  3I4R B;  3FU0 A;  3RTR B;  4OGE A;  3DRA A;  4L7T A;  2NXP A;  3AG3 E;  3DST A;  1U6G B;  2KKX A;  1WEM A;  1TNO A;  4N4F A;  2BF0 X;  2X3M A;  4CYM D;  2B0O E;  4MS6 A;  3APD A;  4IYP A;  2ZGG A;  3U5N A;  1DCE A;  3MKQ B;  4V3K C;  1H6O A;  1IYG A;  4CT4 A;  1YA0 A;  2VJE A;  3Q78 A;  2XB1 A;  2YYR A;  4G8L A;  3KD7 A;  3BEE A;  4GTO A;  1TN8 A;  3D9O A;  3U5M A;  1OCC E;  5JJT A;  5AIJ A;  4LRZ A;  4KVO A;  2PZI A;  2OWA A;  4BES A;  2VYI A;  4A49 A;  3GV4 A;  4K0R A;  1WEP A;  1WEW A;  4WZ3 B;  3UIO C;  3FTX A;  2WMO A;  3FH7 A;  3ONK A;  3FP3 A;  2XRZ A;  5JHB A;  4I43 A;  2I6H A;  4WNG A;  4LSZ E;  3L16 A;  4UI9 J;  2AW6 A;  3ASF A;  3LKU A;  1PC2 A;  4LAD B;  3FUL A;  4G25 A;  3N9L A;  3LJ3 A;  3QK0 A;  4F52 B;  4L23 A;  4F53 A;  1OCR E;  3OXL A;  2F6N A;  4GTS A;  1TJC A;  2LGK A;  4GAA A;  2GW1 A;  1DC2 A;  3D9N A;  3N9Q A;  2ZXW E;  1VDY A;  2CKL B;  4H7Y A;  5BNW A;  4L1B A;  3O4Z A;  4HI8 A;  3R7Q A;  4CEM A;  2QYJ A;  5CED B;  4B93 B;  4CT0 A;  1HX8 A;  5EID A;  3N71 A;  4BFR A;  2YHN A;  4ANU A;  1N0R A;  3WG7 E;  2KZT B;  3LDZ A;  3APF A;  2OVB A;  4G11 A;  4HOS A;  1OUV A;  4BET A;  1UJK A;  2R17 C;  3FDH A;  1Z3X A;  5FB1 A;  4YAT A;  4LJN A;  2ETC A;  3QWP A;  1FPP A;  1UG3 A;  4K5C A;  3UT8 A;  3KNV A;  2HYE D;  3UMV A;  4CZ2 D;  4GTQ A;  3ZIM A;  3FL2 A;  1WEE A;  1IYM A;  5FZR A;  5B77 A;  3QWW A;  3ABL E;  2XOZ A;  1H19 A;  2HO1 A;  5EIB E;  2LO6 A;  2KWO A;  4QQ4 A;  4HLE A;  4L7X A;  1O1S A;  4GB0 A;  3V79 K;  3TWS A;  4MSX A;  5J3X A;  2M3H A;  3JUE A;  2YUR A;  1N4R A;  2FFW A;  4EZJ A;  1HG5 A;  3RPG B;  3EHR A;  5C2Y A;  1K3Z D;  2WXM A;  4UQX A;  5AAR A;  5E75 A;  2JEK A;  4YBM A;  2JMI A;  2WM9 A;  4I6G A;  3HCU A;  4I9E A;  2CSZ A;  2WXH A;  4XEI G;  3MJW A;  1QNF A;  2RSD A;  3FY4 A;  1L5J A;  2QJ0 A;  1H2V C;  3ZEF A;  4DK5 A;  1JWF A;  5G04 B;  3RO2 A;  2R03 A;  4LNG A;  3HYM B;  2QFC A;  5ENS D;  5IY5 E;  3OXG A;  2F8Y A;  2J07 A;  4FIP A;  5T3R A;  4A3V A;  4GYW A;  2L43 A;  1JM7 A;  3L82 A;  3UT7 A;  2RKK A;  2R05 A;  2VSN A;  4YAD A;  2MA5 A;  3JYS A;  2ZGD A;  4RG6 A;  5H1T A;  4J6I A;  2KM4 A;  3URZ A;  5TBN A;  1TEZ A;  3AJI A;  4CDN A;  4GND A;  5H9M A;  3TAX A;  2JMJ A;  4N3A A;  2ECN A;  3O37 A;  4NQ0 A;  1S0P A;  4QFV A;  3EU9 A;  3FH5 A;  4ILI A;  3ZYK A;  2WQ7 A;  2ZIR A;  2GGF A;  4FC8 A;  4DPR A;  2OEW A;  3ASD A;  3HVE A;  4MRU A;  1WEQ A;  1E7V A;  1Z6T A;  4UWK A;  4EZL A;  2FD4 A;  4JD2 G;  1LF8 A;  4GMR A;  2UZG A;  2MHK A;  3AG2 E;  5HRY A;  3SQV A;  2D8S A;  4DI3 A;  2QYU A;  3ZW3 A;  2XP0 A;  4WWO A;  3VLE A;  4YDW A;  4CDR A;  1MX6 A;  2DIW A;  4CCA A;  1S64 A;  3SBT B;  3I3N A;  3MV3 B;  5AIU A;  3T6R A;  2IOL A;  1TNZ A;  2G43 A;  2C2L A;  2HYZ A;  2JLB A;  3ZTG A;  2H0D A;  4HOT A;  5LOZ A;  3U5P A;  3EU5 A;  4FJY A;  5C13 A;  3CVX A;  3UIN C;  3X2Q E;  2PNN A;  3KSL A;  2X6I A;  3VTY A;  4AOF A;  1WEU A;  5LKX A;  2KIZ A;  2HE0 A;  3TG5 A;  3TJP A;  3FEY A;  3N9N A;  5EX0 A;  5AQA A;  3ASH A;  1LD7 A;  2XPY A;  1IHB A;  1N11 A;  4BEP A;  4I7C A;  2FEZ A;  3D9I A;  3NZS A;  4JHJ A;  1H6K A;  3NQP A;  3NG2 A;  3L11 A;  4GPK A;  3GZ1 A;  4JB8 P;  3ZVV A;  4MVT A;  3GZS A;  3B7U X;  3V2O A;  3PUR A;  2YIN A;  5EYL A;  5CRV A;  4LLB A;  4I6J A;  4R7E A;  3L22 A;  3ZYM A;  3V43 A;  1S63 A;  3PE3 A;  3SFY A;  3CVU A;  5ANR A;  5B76 A;  3E32 A;  3B13 A;  5EKQ D;  4EPZ A;  4WA6 A;  3VTX A;  4WZ0 A;  4X3G A;  4XIF A;  2JMD A;  3L13 A;  2XRY A;  2PM6 A;  1N94 A;  3MYV A;  2IQC A;  2K1J A;  5FWQ A;  5HKP A;  2CHW A;  3QJZ A;  3D9L A;  3HVE B;  3T9K A;  2WXK A;  2RD0 A;  2V8S E;  4BT8 A;  1WG0 A;  1O1R A;  2F6J A;  3CST A;  3PZ3 A;  2Y1M A;  2E2E A;  3MEK A;  2LNI A;  1E96 B;  2RG8 A;  3O7A A;  4UWF A;  4GYO A;  4B86 C;  3MGB A;  3W9F A;  4O6F A;  3JCK C;  1VD4 A;  2WB2 A;  2MNZ A;  3C5R A;  3C6W A;  4C9Z A;  4U7E B;  3ZNG A;  3Q49 B;  4AP2 A;  1EYH A;  2MIQ A;  4I1O B;  3FU6 A;  1JM7 B;  1JPL A;  3LY9 A;  2L0T B;  5JA4 D;  4DX6 D;  4HXI A;  3FUD A;  3C3O A;  2WPV A;  1ELR A;  2GRO B;  5BT1 A;  1WFK A;  1K8K G;  5T8I A;  3IBE A;  2ECG A;  2GRP B;  4KBQ A;  4N2Q A;  2D8U A;  2WQH A;  3HXE A;  4U04 A;  1ZU2 A;  4LG6 A;  2Y69 E;  3PZ4 A;  4UWG A;  1YYH A;  3PZ1 A;  2P9L G;  3SFX A;  3EB5 A;  3DPD A;  5SVI A;  5ITZ F;  3Q15 A;  5SVI B;  4V3L C;  4J8S A;  2MOW A;  5BV1 A;  2QIC A;  4ACK A;  2J4D A;  1V87 A;  5LKT A;  2XEE A;  3ZN3 A;  2PL2 A;  3Q4A B;  1E8X A;  3KV6 A;  4GZ6 A;  1FP0 A;  1NFI E;  3EHQ A;  4ZUX U;  2CHZ A;  3PUQ A;  2GRL A;  4GZC A;  1VFY A;  5DIN A;  2IQJ A;  1N4Q A;  2XS1 A;  3DDT A;  1OWM A;  5KH7 A;  3Q79 A;  4IC2 A;  4A3T A;  4E6H A;  4H7X A;  4NRH B;  2J4B A;  2X38 A;  3E37 A;  1OWO A;  3PUK A;  1F62 A;  2CFU A;  4UP0 A;  1HFA A;  5CRU A;  1Z5S C;  1TYQ G;  5LX8 A;  1WGM A;  3IHV A;  4P29 A;  3HHM A;  2JUN A;  2Y4T A;  2HDP A;  4P5O B;  4UI9 K;  4B7Y C;  4YBT A;  3SHF A;  4IRU A;  1WES A;  4LUN U;  3PS6 A;  5JHA A;  1JUQ A;  3ZYQ A;  2CG2 A;  3TGO A;  4DUI A;  2XGS A;  4MBG A;  4HOR A;  4YVQ C;  5D1K B;  4GA2 A;  3V31 A;  4GTM A;  3JQ1 A;  3VLF A;  4O1P A;  3CVW A;  2ECV A;  2YSJ A;  3KV5 A;  1SA5 A;  1KLX A;  3LPZ A;  1WIM A;  4GZ3 A;  3FM8 C;  3BG1 B;  4B89 A;  2VNF A;  4DX5 D;  4I2Z A;  3CHQ A;  4FA6 A;  4LKA A;  1MZC A;  3KSQ A;  4G8K A;  1MHQ A;  5G05 J;  1LD8 A;  2NYJ A;  1HS6 A;  5ENN A;  2YW8 A;  3CHO A;  2XEN A;  2KRE A;  2I50 A;  4XKB A;  3LEW A;  4GML A;  2ETB A;  4N2S A;  3I2D A;  1WY6 A;  4HQD A;  2VGE A;  3SZ7 A;  3LYA A;  1HZ4 A;  3FEH A;  4A1S A;  2FBN A;  2WXG A;  3FTU A;  5M72 A;  3RPG C;  2MUM A;  4L9P A;  4G26 A;  3SBS A;  2H6I A;  3FUH A;  1WDY A;  3UM2 A;  5KJK A;  4CDM A;  5AQ9 A;  4R2Y A;  4J8Y A;  2R02 A;  2Y4U A;  3FEX A;  3UKR G;  1FBV A;  1BPO A;  3IKO B;  3G2U A;  3FFL A;  3UKU G;  4HNA D;  4KZC A;  4F1S A;  5D1M B;  2PM7 A;  2P9I G;  2V0P A;  3CK7 A;  4OAU C;  2KGG A;  2EA6 A;  3TWU A;  1YCS B;  3HG0 D;  4PS7 A;  2FI7 A;  4FJZ A;  3BQO A;  5KNG A;  2VGX A;  1HH8 A;  3PNT B;  4XI9 A;  3RK6 A;  4M7C A;  2YQ8 A;  1WAO 1;  4C9B B;  1RMD A;  5B75 A;  2E6R A;  2MD8 C;  5G0F A;  3FTW A;  1IHG A;  1X4J A;  5EX3 A;  2J08 A;  3M99 A;  1FVH A;  1D8D A;  3AAA C;  3RAU A;  3UPV A;  5FZS A;  3ML8 A;  3Q75 A;  4Z68 A;  5J08 A;  3ESL A;  3ZYL A;  3ZVZ B;  4GMJ A;  3FUI A;  3PHD A;  4N3C A;  3ONL A;  4D10 C;  3ZPV E;  4U0U A;  2KWN A;  4HLL A;  4WUY A;  3O36 A;  1NI1 A;  1NL4 A;  2JM3 A;  4Z0R A;  1T1H A;  3E30 A;  4JZY A;  3MHS A;  4Q6F A;  2JRJ A;  4V3I A;  2XEV A;  1QQE A;  3UX4 A;  1MM3 A;  2P9P G;  4F1P A;  2DYR E;  3FJU B;  3ZGQ A;  4DRX E;  3P1U A;  3JXI A;  4RG9 A;  5CEC B;  4HS2 A;  3C98 A;  2M13 A;  4JXT A;  4J0U A;  2KKY A;  1A17 A;  4WNE A;  2LQ6 A;  3Q1D A;  3C5K A;  2A5E A;  2MKE A;  5KH3 A;  4JA7 A;  4BSX A;  5FTP A;  5EYP F;  4L58 A;  2P9U G;  5H7P A;  2PUY A;  4GNF A;  1ELW A;  5AEN A;  3JUI A;  4EHM A;  3HXD A;  3HCT A;  2WQ6 A;  3ZPJ A;  4I7B A;  1OWP A;  5BPP A;  3Q9N C;  2V5F A;  3DSX A;  3VLD A;  3KS2 A;  2OEV A;  2XPZ A;  4TRQ A;  2VGX B;  4HRL A;  1JCS A;  4H9D A;  2WXJ A;  3B7S A;  4BX9 A;  4QF3 A;  5D0O D;  4Q69 A;  5B79 A;  3L17 A;  4KXK B;  3S2A A;  2EIM E;  3PDN A;  4Y6W A;  4I6E A;  2VPB A;  1G25 A;  5H1U A;  1O1T A;  4LK9 A;  2YU4 A;  3B7T A;  2XPI A;  4OAV B;  2KU3 A;  5KH9 A;  2LRI C;  5A6C A;  1K1A A;  2LAH A;  4G23 A;  3FUK A;  2H6H A;  5CBO A;  5AQ7 A;  4GYY A;  4PH4 B;  2P9K G;  1AP7 A;  2FO1 E;  1YMP A;  1BD8 A;  3TXN A;  2X6F A;  1SZA A;  3EIJ A;  4U8Y D;  5FER A;  1KT1 A;  4A55 A;  2PQR A;  4JC8 A;  2KFT A;  2J49 A;  5AQB A;  2L5U A;  1HG2 A;  4O1O A;  4DJA A;  2AXU A;  2UY1 B;  3UQ3 A;  1E8W A;  3U64 A;  1X5B A;  5LCW C;  4K5B A;  3LY7 A;  2F0Y A;  2BAY A;  4XI0 A;  1E7U A;  4I2W A;  1PAQ A;  2EIN E;  2IEJ A;  3LJN A;  4OYS A;  4UI9 B;  5SVX A;  3ZHE B;  4FHJ A;  4PTB A;  1FCH A;  2CG3 A;  3BG0 B;  5TDR A;  1UN9 A;  4GA0 A;  4FHK A;  2XHE A;  2AWI A;  2G45 A;  1Z2Q A;  2YQL A;  3Q5M A;  2CKL A;  3TWR A;  3GL6 A;  3CVY A;  2LGG A;  3T5X A;  5A23 A;  4N5Q A;  2BTD A;  4UUC A;  3FWV A;  4BTB A;  5B78 A;  3CQC B;  5TRB A;  5KJM A;  1H6P A;  3MKQ A;  3TXM A;  1WEV A;  2LN0 A;  4KZ0 A;  4CRW A;  3PZ2 A;  2ZET C;  3RRM B;  1INZ A;  1SW6 A;  4ATG A;  1IXV A;  4GCN A;  4A1G A;  2PNX A;  4HFG A;  3J5P A;  5D1L B;  2XQ0 A;  3FU3 A;  3H7H A;  3C3R A;  5KJL A;  2XOC A;  3TWV A;  5LKZ A;  3HXC A;  4NUR A;  3HDX A;  3ENE A;  4LNU D;  4GTP A;  3CHM A;  2M6M A;  3PEU B;  3E4B A;  4UWH A;  4YAX A;  4WAF A;  2YRE A;  4I7D A;  1LTX A;  2LAU A;  3C72 A;  3HRA A;  4RSY A;  3RU0 A;  3CIA A;  3QC1 A;  3N9P A;  4OGC A;  4LEU A;  2ION A;  2HM8 A;  3TWQ A;  3FUJ A;  3R7R A;  1B89 A;  3FHE A;  3BU8 A;  2YHC A;  5AYW D;  3PUJ A;  3CVQ A;  1MQS A;  5B3S E;  4GTV A;  3G2V A;  4JHR A;  1UN8 A;  1HU3 A;  5G05 C;  2WXO A;  3N9O A;  5D66 A;  5KWD A;  4M3O A;  4BX8 A;  4ANX A;  1LDJ B;  3DQV R;  5I3L A;  3SOX A;  2YUC A;  2ECI A;  2L9B A;  4RVB A;  1QZ2 A;  2X6K A;  1Z6U A;  2IFU A;  3L6A A;  3EB6 A;  4EZK A;  3LY8 A;  3CHR A;  3AS4 A;  3WXX A;  3V30 A;  1BOR A;  2DWZ A;  3SI5 A;  3DSS A;  3UM0 A;  2E6S A;  3NOC D;  4C0M A;  2GRR B;  3MHH A;  4AXH A;  2LSV A;  1IQU A;  2RR4 A;  5AJL A;  4BTA A;  2J9Q A;  3QNK A;  2K16 A;  2KGI A;  4Z0O A;  4LNB A;  4U8H A;  2IY0 C;  5D0Q D;  4PS8 A;  2LDR A;  4B8A A;  3LQI A;  1U2V G;  5CMY A;  3MV2 B;  4APF A;  4BSZ B;  2H6F A;  1K2F A;  5FJY A;  1N9A A;  4RQI A;  3L9T A;  1VYX A;  1P5Q A;  4RLY A;  1A5E A;  3CLJ A;  2R2L A;  4BY6 A;  4N5C A;  1N0Q A;  4GU5 A;  2FUI A;  2Y3A A;  5AJD A;  4K5A B;  4NAC A;  2CT2 A;  2XCB A;  2KR4 A;  4U95 D;  2IDA A;  3AG1 E;  1OWN A;  3ZU7 B;  3HCS A;  3S7B A;  5FQ8 A;  3RO3 A;  2ECW A;  2LGV A;  4L2L A;  4IUL A;  4LCT A;  5CER B;  2ILR A;  3L1Z B;  4YND A;  1BI8 B;  2H6G A;  4XI1 A;  3D9J A;  3FU5 A;  3OXF A;  4I1M A;  1XGW A;  1JCR A;  1OT8 A;  3UI2 A;  3SOU A;  2GRQ B;  1MX4 A;  4DX1 A;  2VTB A;  1WEN A;  5TAB A;  2DZO A;  5EYA F;  2I2O A;  5SVY A;  3CVN A;  4JEU A;  2XS8 A;  3LJU X;  2IU1 A;  1FT2 A;  2LV9 A;  3MA5 A;  3PLW A;  1XNF A;  5ANL A;  3FUM A;  2CSV A;  4FU3 A;  1OCZ E;  4U8V D;  4AUQ B;  3S7D A;  2VTB B;  2EQX A;  2VSX E;  2VPE A;  3G2W A;  4B94 A;  2WXI A;  3U66 A;  4UQZ A;  2Y1N A;  4X8Q A;  3W9G A; 
#chains in the Genus database with same CATH homology
 1H2V C;  2WXF A;  5EX3 A;  3UT4 A;  3ZEF A;  2J08 A;  3L08 A;  4DLO A;  1JWF A;  3D9K A;  4DK5 A;  1FVH A;  3K9I A;  3RO2 A;  2VP7 A;  3M99 A;  3ZRH A;  4GNG A;  5G04 B;  3HYM B;  4U63 A;  4G2V A;  3UPV A;  4PS3 A;  2M63 A;  3FTV A;  3ML8 A;  2KZT A;  2QFC A;  4OVU A;  5FZS A;  5J08 A;  3ESL A;  3OXG A;  4MLP A;  3ZYL A;  2J07 A;  3ZVZ B;  3ZHE A;  4FIP A;  2WXP A;  5T3R A;  4A3V A;  2KWJ A;  4CA1 A;  5D1K B;  4GMJ A;  4GYW A;  2L43 A;  4R7L A;  3FUI A;  3PHD A;  4N3C A;  3ONL A;  3S7J A;  3UT7 A;  4D10 C;  4U0U A;  3T7L A;  3ZPV E;  1JM7 A;  3P2B A;  4ANV A;  3CR3 A;  3U5O A;  2KWN A;  2LAI A;  2VSN A;  3L54 A;  4G1T A;  4JPS A;  2MA5 A;  4YAD A;  4JEH A;  3EDT B;  3JYS A;  4JA9 A;  4WUY A;  3O36 A;  4R8P K;  3ZXS A;  4RG6 A;  4Y6C A;  5H1T A;  4J6I A;  5BUZ A;  4AP4 A;  2KM4 A;  2MT5 A;  1T1H A;  2YT5 A;  5TDW A;  3URZ A;  3EHN A;  5TBN A;  4JZY A;  1TEZ A;  3MHS A;  4Q6F A;  3SOW A;  2JRJ A;  2VJE B;  4V3I A;  2XEV A;  4CDN A;  1QQE A;  3UX4 A;  4AY6 A;  5LFA A;  4XZ4 A;  1MM3 A;  2MA6 A;  2VSO E;  2KWK A;  4GND A;  3LXU X;  3O70 A;  5H9M A;  4AVX A;  1WEO A;  4GCO A;  3NZU A;  2EOD A;  3TAX A;  2JMJ A;  3ZGQ A;  2YHE A;  3P1U A;  4ILH B;  4N3A A;  3QOU A;  2ECN A;  3O37 A;  4RG9 A;  4NQ0 A;  4U0S A;  2DX8 A;  1S0P A;  3CV0 A;  4HS2 A;  4G24 A;  4QFV A;  2AN6 A;  2A5U A;  3FH5 A;  3C98 A;  4ILI A;  2M85 A;  3ZNI A;  4FUL A;  3AS8 A;  3ZYK A;  2WQ7 A;  2CSY A;  3JQ0 A;  5G05 B;  3ZPV 1;  2GGF A;  4JXT A;  4UP5 A;  4FC8 A;  4J0U A;  4DPR A;  2KYU A;  3ASD A;  3HVE A;  1A17 A;  4MRU A;  4WNE A;  1WEQ A;  1E7V A;  1Z6T A;  2LQ6 A;  4UWK A;  4KT6 B;  4EZL A;  5FQ4 A;  1Z60 A;  3C5K A;  1LF8 A;  5KCM A;  3AS5 A;  4JL0 A;  2VJF B;  3RKV A;  2UZG A;  2V4L A;  5ARF A;  5KH3 A;  4C0E A;  4JA7 A;  2MHK A;  4L2Y A;  4BSX A;  2H0D B;  5FTP A;  4L58 A;  3SHB A;  3GZ2 A;  3TL5 A;  2KE1 A;  5ARG A;  2D8S A;  2PUY A;  4GNF A;  5T4Y A;  5DKA A;  4KYO B;  4BBQ A;  3PZD A;  4TV3 A;  1ELW A;  1NA0 A;  4DI3 A;  4EBA G;  1Y8M A;  2VQ2 A;  3ZW3 A;  4YVO A;  4WWO A;  5AEN A;  5DBK A;  3JUI A;  1WE9 A;  3VLE A;  1WIL A;  3PRE A;  4CDR A;  4GA1 A;  3HCT A;  2YHO A;  2DIW A;  4A4B A;  4CCA A;  2WQ6 A;  3ZPJ A;  2LXH C;  4I7B A;  3SBT B;  3MX3 A;  1OWP A;  1E8Z A;  3I3N A;  3MV3 B;  3S7F A;  1ZBD B;  5AIU A;  2WXR A;  3T6R A;  5BPP A;  2R5S A;  2V5F A;  2VGY A;  3VLD A;  5CCL A;  4I9C A;  1CHC A;  3KS2 A;  5J90 A;  2XPZ A;  1UW4 B;  4TRQ A;  2GRM A;  4AY5 A;  2IOL A;  4N3B A;  2G43 A;  3CHP A;  2VGX B;  2FSA A;  2C2L A;  2HYZ A;  2JLB A;  3ZTG A;  4I17 A;  2WXJ A;  3B7S A;  1GW6 A;  2KCL A;  2C2V S;  2H0D A;  4HOT A;  5FEY A;  3GW4 A;  5LOZ A;  4BX9 A;  4QF3 A;  3U5P A;  5D0O D;  4FJY A;  3CGH A;  5C13 A;  3FH8 A;  4Q69 A;  2NAA A;  1NZN A;  3APC A;  3CVX A;  2KCV A;  4B0Z A;  3ULQ A;  4JHK A;  4ABN A;  3VTY A;  3CHS A;  2X6I A;  4AOF A;  1N54 A;  3L17 A;  4KXK B;  3S2A A;  1WEU A;  1XWH A;  5B79 A;  2MRI A;  2PQN A;  5LKX A;  2J09 A;  2KIZ A;  4O64 A;  4S3O B;  2WXL A;  3PDN A;  2YNQ A;  4FLB A;  4Y6W A;  3TG5 A;  4I6E A;  3FEY A;  3RJV A;  5EX0 A;  3TJP A;  3D3M A;  2G6Q A;  2VPB A;  3L1X A;  3N9N A;  4EEC A;  1DVP A;  3ASH A;  1G25 A;  5H1U A;  4DLQ A;  2XPY A;  4LK9 A;  5C1D A;  3B7T A;  2YU4 A;  3OTN A;  4WWN A;  2XPI A;  1FVF A;  2FEZ A;  3D9I A;  3NZS A;  3DBS A;  4JHJ A;  4I7C A;  1H6K A;  3CQG B;  2C0M A;  1IQR A;  3NQP A;  4W9R A;  2KU3 A;  5HI7 A;  2FO7 A;  3U3W A;  2ZU6 B;  3NG2 A;  3L11 A;  1H2U A;  3GZ1 A;  4GPK A;  3ZVV A;  5KH9 A;  2OV8 A;  3G2S A;  1ELK A;  1U3C A;  2FUL A;  4XE0 A;  2LRI C;  5A6C A;  3RRU A;  2CHX A;  4MVT A;  5C11 A;  4J8F A;  3GZS A;  1LDK C;  1E4U A;  2LAH A;  3B7U X;  2UY1 A;  3PUR A;  3LVQ E;  2P58 C;  4G23 A;  3FUK A;  2L80 A;  3FTZ A;  3O33 A;  2YIN A;  3PRZ A;  3EJN A;  4LLB A;  3LS8 A;  4I6J A;  3L22 A;  3ZYM A;  2BUG A;  3FUE A;  1E90 A;  2OND A;  4ME2 A;  3V43 A;  4GYY A;  3PE3 A;  4UI9 C;  4PH4 B;  4URK A;  5ANR A;  3CK9 A;  3CVU A;  5B76 A;  3B13 A;  4BWR A;  2UWJ G;  2XGO A;  5EKQ D;  4EPZ A;  4WA6 A;  3VTX A;  4WZ0 A;  3CVL A;  2WVI A;  3ML9 A;  4JW1 A;  4X3G A;  1HO8 A;  4XIF A;  2JMD A;  3L13 A;  3TXN A;  2XRY A;  2X6F A;  4YC9 A;  1SZA A;  1NA3 A;  2PM6 A;  2F42 A;  3MYV A;  2IQC A;  1X4U A;  3EIJ A;  2K1J A;  5FER A;  1KT1 A;  3KEZ A;  3U4T A;  5FWQ A;  3N9M A;  2CHW A;  3HTK C;  3QJZ A;  2PQR A;  4A55 A;  3D9L A;  3AU4 A;  3HVE B;  2DCP A;  4A0C D;  2WXK A;  2RD0 A;  4PPE A;  2KAT A;  4JC8 A;  2KFT A;  2LGL A;  2OXQ C;  2J49 A;  2VPG A;  2L5U A;  2V8S E;  5KJN A;  4BT8 A;  2L75 A;  4Q94 A;  2E0I A;  1HG2 A;  2OOE A;  2F6J A;  4NN2 A;  3CST A;  4DJA A;  2AXU A;  4KVM A;  2Y1M A;  1Y6I A;  2UY1 B;  2E2E A;  3UQ3 A;  1E8W A;  2LNI A;  3MEK A;  3U64 A;  1X5B A;  4ZQL A;  1E96 B;  1HXI A;  4UQY A;  2RG8 A;  5LCW C;  3VK6 A;  1PY1 A;  3ASG A;  3O7A A;  4UWF A;  5E76 A;  4GYO A;  4B86 C;  3MGB A;  2IJG X;  4KMO A;  1HE8 A;  3KAE A;  2VPD A;  2I1J A;  3SGH A;  2I9C A;  5JJ6 A;  3I4G A;  3LQH A;  4FK5 A;  1SZ9 A;  4O6F A;  3LY7 A;  2BAY A;  3JCK C;  1HYI A;  2YQM A;  1VD4 A;  4XI0 A;  2IF4 A;  1E7U A;  3QWV A;  4I2W A;  2WB2 A;  4OVV A;  1PAQ A;  2MNZ A;  2A4Z A;  3C6W A;  3MCX A;  4C9Z A;  4HOU A;  5LCW J;  1EDU A;  2NC9 A;  3FUN A;  4K03 A;  5BV0 A;  1ZBP A;  4OYS A;  4UI9 B;  3CK8 A;  4FHJ A;  3Q49 B;  3ZHE B;  4AP2 A;  4PTB A;  1FCH A;  5AIT A;  1EYH A;  3ASL A;  2CG3 A;  3BG0 B;  3FTS A;  3HIZ A;  3MKR A;  4I1O B;  5FZQ A;  3TG4 A;  3B7R L;  2MIQ A;  2MNY A;  2LXP C;  1UN9 A;  4N3W A;  3FU6 A;  4GA0 A;  1JM7 B;  1JPL A;  3LY9 A;  2L0T B;  4FHK A;  1SQM A;  2XHE A;  2AWI A;  2G45 A;  2YSM A;  4IC3 A;  2DBA A;  1JWG A;  2IOS A;  1Z2Q A;  2YQL A;  3PE4 A;  4HXI A;  3CEQ A;  1OWL A;  3Q5M A;  2CKL A;  3FUD A;  4J8E A;  5BW8 C;  5HQ8 A;  2WPV A;  1TJF A;  3GL6 A;  1ELR A;  4BHW A;  5BT1 A;  3CVY A;  4WWP A;  2AXV A;  1WFK A;  2LGG A;  3T5X A;  5T8I A;  3IBE A;  4AEZ C;  2ECG A;  4TKP B;  1UJJ A;  4KBQ A;  1W3B A;  2I1K A;  5A23 A;  4AYC A;  4ANW A;  4N2Q A;  2BTD A;  4JVS A;  3AU5 A;  2AVP A;  3FWV A;  4BTB A;  2WQH A;  4U04 A;  3M63 A;  5B78 A;  3CQC B;  1NP7 A;  1ZU2 A;  3SNX A;  1N87 A;  5TRB A;  4U0Z A;  5KJM A;  2WXN A;  2Y43 A;  3DPL R;  3MKQ A;  3TXM A;  1WEV A;  4I1A A;  5TDR A;  2LN0 A;  4J8D A;  4KZ0 A;  3PNL B;  4CRW A;  4F3V A;  4WZ2 A;  2ZET C;  3RIB A;  4UWG A;  3RRM B;  4AJW A;  1INZ A;  1H0A A;  3IV0 A;  4ATG A;  4MKT A;  4GCN A;  4APO A;  4A1G A;  4FAD A;  2PNX A;  3DPD A;  3EB5 A;  4PUC A;  4HFG A;  4UWL A;  3Q15 A;  4GNE A;  2XQ0 A;  3T5V A;  3FU3 A;  5EDS A;  1Z3Y A;  1X4I A;  3PH0 C;  4R7E A;  4V3L C;  2VSY A;  4FLH A;  4J8S A;  2MOW A;  3U9W A;  5BV1 A;  4DI4 A;  5KJL A;  2MD7 B;  4YBS A;  5LKZ A;  1HYJ A;  3O35 A;  2QIZ A;  4TUU A;  5G04 C;  3QKY A;  5CHE E;  2QIC A;  4ACK A;  4NUR A;  3HDX A;  2RI7 A;  2J4D A;  2WMN A;  4IN3 B;  3CVV A;  1V87 A;  5LKT A;  3MZL B;  4FJC A;  3ENE A;  3ZN3 A;  3LCA A;  1EF1 C;  3CHM A;  2CFZ A;  3SD5 A;  2PL2 A;  3PEU B;  2ECJ A;  5DIZ A;  2R59 A;  2M6M A;  3E4B A;  3Q4A B;  3IHP A;  3UUX A;  4BT9 A;  3LRQ A;  4AIF A;  2EGP A;  1E8X A;  2HR2 A;  3KV6 A;  4FO9 A;  3I4R B;  3FU0 A;  1KT0 A;  4GZ6 A;  3RTR B;  4UWH A;  4YAX A;  4WAF A;  2YRE A;  4GZD A;  4I7D A;  1FP0 A;  4L7T A;  4ZUX U;  2CHZ A;  3PUQ A;  2NXP A;  2GRL A;  3I5P A;  2AXZ A;  4GZC A;  1VFY A;  4RSY A;  1U6G B;  5DIN A;  1WEM A;  2OVF A;  3RU0 A;  4EBA A;  3CIA A;  3O48 A;  4N4F A;  3QC1 A;  3N9P A;  2BF0 X;  3PVL A;  1OWM A;  4A4C A;  5KH7 A;  2X3M A;  4IC2 A;  4A3T A;  1N52 A;  1U3D A;  4MS6 A;  3APD A;  4E6H A;  4IYP A;  4LEU A;  4H7X A;  3G2T A;  2ION A;  4NRH B;  4E85 A;  2HM8 A;  3U5N A;  2J4B A;  3FUJ A;  2X38 A;  3MKQ B;  3QB2 A;  3R7R A;  3M62 A;  2M1R A;  4V3K C;  5FT9 A;  1B89 A;  3FHE A;  1OWO A;  3PUK A;  1IYG A;  1F62 A;  2YHC A;  2CFU A;  4CT4 A;  5AYW D;  4UP0 A;  3PUJ A;  3CVQ A;  1HFA A;  1YA0 A;  5FQ6 A;  2VJE A;  2XB1 A;  1MQS A;  2YYR A;  3D9P A;  3KD7 A;  3G2V A;  3BEE A;  4JHR A;  4PDX A;  1UN8 A;  1HU3 A;  5G05 C;  2WXO A;  5LX8 A;  3N9O A;  1WGM A;  3IHV A;  4M3O A;  4BX8 A;  4P29 A;  3R9A B;  3D9O A;  3HHM A;  4ANX A;  1LDJ B;  3DQV R;  5A7D B;  3U5M A;  3SOX A;  2YUC A;  2Y4T A;  2ECI A;  2HDP A;  1EPU A;  4P5O B;  3CKC A;  4UI9 K;  2L9B A;  2ECT A;  2K4D A;  4B8C B;  5JJT A;  4S3O C;  4B7Y C;  5AIJ A;  4XKC A;  4YBT A;  4LRZ A;  4RVB A;  4KVO A;  1QZ2 A;  2X6K A;  4IRU A;  3SHF A;  1WES A;  2PZI A;  1Z6U A;  4LUN U;  3PS6 A;  2VYI A;  5JHA A;  2IFU A;  1H2T C;  4FP7 A;  4A49 A;  1JUQ A;  3L6A A;  4K0R A;  1WEP A;  3ZYQ A;  2CG2 A;  1WEW A;  3OAW A;  3EB6 A;  3GV4 A;  4W4U A;  4WZ3 B;  3FTX A;  3D9M A;  3TGO A;  2XGS A;  3LY8 A;  4EZK A;  4YVQ C;  4HOR A;  3QDN A;  3CHR A;  2WMO A;  3AS4 A;  3FH7 A;  3ONK A;  4GA2 A;  3GYZ A;  3EIQ C;  3WXX A;  2VJF A;  3FP3 A;  3FTY A;  3JQ1 A;  5JHB A;  4I43 A;  2I6H A;  2XRZ A;  4WNG A;  3L16 A;  2FF4 A;  2AW6 A;  3ASF A;  4UI9 J;  3SI5 A;  3VLF A;  3CVW A;  3LKU A;  1BOR A;  3NF1 A;  4C0M A;  2E6S A;  3MHH A;  2ECV A;  1PC2 A;  2YSJ A;  3KV5 A;  4AXH A;  3FUL A;  1KLX A;  3O34 A;  4ACL A;  2LSV A;  4LAD B;  2QY7 A;  1IQU A;  4G25 A;  3LPZ A;  1WIM A;  3N9L A;  5AJL A;  3LJ3 A;  3QK0 A;  4GZ3 A;  4F52 B;  4BTA A;  3BG1 B;  4L23 A;  2L0B A;  4B89 A;  2VNF A;  4LKA A;  4I2Z A;  2VJ8 A;  2J9Q A;  3CHQ A;  3OXL A;  3QNK A;  3RRN B;  4F53 A;  1TJC A;  4FA6 A;  2F6N A;  2K16 A;  2KGI A;  4WND A;  2LGK A;  4GAA A;  4U8H A;  1MHQ A;  2WXQ A;  5D0Q D;  4PS8 A;  5G05 J;  2GW1 A;  2LDR A;  3ZVY A;  5G55 A;  3D9N A;  1HS6 A;  4GZ5 A;  4B8A A;  3LQI A;  3N9Q A;  5ENN A;  5CMY A;  2YW8 A;  1VDY A;  3CHO A;  2CKL B;  2K17 A;  3KQI A;  2Q7F A;  3MV2 B;  4H7Y A;  4APF A;  5BNW A;  4L1B A;  3O4Z A;  3CVP A;  5FJY A;  1K2F A;  2I50 A;  4XKB A;  2KRE A;  3LEW A;  4CGV A;  3R7Q A;  4GML A;  4EQF A;  3T8M A;  1P5Q A;  4CEM A;  4HVB A;  1VYX A;  4N39 A;  3CLJ A;  4N2S A;  4GB9 A;  4BY6 A;  4CT0 A;  1HX8 A;  3I2D A;  4N5C A;  1WY6 A;  3N71 A;  4BFR A;  4GU5 A;  4XX5 A;  5FQ7 A;  4ANU A;  2YHN A;  2XGM A;  2FUI A;  4HOQ A;  2Y3A A;  5AJD A;  5LP0 A;  4NAC A;  2CT2 A;  2KR4 A;  2KZT B;  2XCB A;  3APF A;  3LDZ A;  2OVB A;  2C0L A;  3IEG A;  2X6H A;  3LYA A;  3SZ7 A;  2IDA A;  4G11 A;  1OWN A;  1HZ4 A;  3SFZ A;  4HOS A;  1OUV A;  1UJK A;  5CMW A;  3FUF A;  5D1L B;  2R17 C;  2NSZ A;  4A1S A;  3S7B A;  5CCM A;  3HCS A;  3ZFW A;  4YAB A;  2FUU A;  1WM5 A;  5FQ8 A;  3RO3 A;  2FBN A;  2WXG A;  2ECW A;  2LGV A;  5LKU A;  3FDH A;  1Z3X A;  4L2L A;  2KC7 A;  5FB1 A;  5FB0 A;  4IUL A;  3FTU A;  5M72 A;  3CKB A;  4YAT A;  4LCT A;  4LJN A;  3QWP A;  2ILR A;  3L1Z B;  4YND A;  3RPG C;  1UG3 A;  2MUM A;  3UT8 A;  3ESK A;  2KCK A;  3KNV A;  2L6J A;  2L0I A;  3QAR A;  4G26 A;  2HYE D;  3D9J A;  3SBS A;  4XI1 A;  5H1V A;  3UMV A;  3FU5 A;  3OXF A;  3FUH A;  4I1M A;  5KJK A;  1XGW A;  4F7A A;  1MM2 A;  4QF2 A;  4CCG X;  3IHY A;  3ZIM A;  3FL2 A;  1WEE A;  4AV7 A;  1IYM A;  3CSF A;  5FZR A;  1DNP A;  4CDM A;  4R2Y A;  2XCC A;  5JJ7 A;  3SOU A;  5B77 A;  3QWW A;  2Y4U A;  3FEX A;  3LVR E;  1FBV A;  1BPO A;  2VTB A;  3IKO B;  1H19 A;  3FFL A;  2HO1 A;  3G2U A;  2LO6 A;  4U07 A;  1WEN A;  5TAB A;  5B8D A;  3QZV A;  3QAQ A;  2KWO A;  4KZC A;  5EYA F;  4HLE A;  4L7X A;  4F1S A;  2I2O A;  2PM7 A;  5D1M B;  4GB0 A;  3CVN A;  4JEU A;  2V0P A;  3CK7 A;  4LER A;  2XEU A;  4AYC B;  4MSX A;  2KGG A;  2IU1 A;  5J3X A;  2EA6 A;  2M3H A;  2YUR A;  2LV9 A;  3MA5 A;  4EZJ A;  1XNF A;  1HG5 A;  3RPG B;  4Q96 A;  5ANL A;  5C2Y A;  5JG6 A;  3FUM A;  1E8Y A;  4PS7 A;  2WXM A;  4WNF A;  4FU3 A;  4ILG A;  4CGW A;  5G2N A;  2FI7 A;  4UQX A;  4FJZ A;  4AM9 A;  5E75 A;  3Q47 B;  2VGX A;  1HH8 A;  2JEK A;  3S7D A;  1HF8 A;  4AUQ B;  4YBM A;  3PNT B;  2VTB B;  4XI9 A;  2JMI A;  3RK6 A;  2WM9 A;  2EQX A;  4I6G A;  2LSU A;  2VSX E;  3HCU A;  2YQ8 A;  1WAO 1;  4I9E A;  5G04 J;  2CSZ A;  2VPE A;  4C9B B;  1JOC A;  1RMD A;  5LCW B;  3EHM A;  2WXH A;  3G2W A;  5B75 A;  4B94 A;  3MJW A;  1QNF A;  2E6R A;  3LQJ A;  2MD8 C;  2WXI A;  3U66 A;  2RSD A;  5G0F A;  2X6J A;  4UQZ A;  3SF4 A;  2Y1N A;  3FTW A;  3PEV B;  3FY4 A;  1IHG A;  1L5J A;  5I3L A;  1X4J A;  4ZDT A;  2QJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...