2C2LA

Crystal structure of the chip u-box e3 ubiquitin ligase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
281
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
total genus 87
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c2lA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2lA03
1FBVA 2QICA 4O6FA 4HORA 2M1RA 3SHBA 3C5KA 1FCHA 2CKLA 4LKAA 3LRQA 3HCUA 2FBNA 2NC9A 3AS4A 1E4UA 3MA5A 3ZHEB 3IEGA 4X3GA 1VD4A 2CSZA 4KYOB 2JMIA 4R8PK 1VFYA 2MD8C 1G25A 1ELWA 3KQIA 2QIZA 4CCGX 5KJKA 3GZ1A 3U5MA 4PTBA 2ECTA 2HYZA 5FJYA 2MT5A 1QQEA 3DPLR 2CKLB 4LLBA 3M63A 3ZNIA 3QKYA 5EYAF 2J9QA 4KBQA 2VPEA 4GPKA 5FZRA 1RMDA 4XI9A 1NA3A 1WEEA 1Z60A 1XWHA 1WILA 4WZ0A 4WZ3B 1YA0A 3PURA 4YAXA 5FB0A 2XGSA 2K1JA 4GCOA 1IYGA 3CEQA 2KWJA 2ONDA 2P58C 2VP7A 3N9QA 5D1LB 4N4FA 5DINA 4NQ0A 1MM2A 3GYZA 4ME2A 2LV9A 3FP3A 2F6JA 3T6RA 3NG2A 2M3HA 4Y6CA 4XIFA 4YADA 4F52B 2XCBA 2PQNA 4G25A 2LGKA 1KT0A 2VNFA 4YVOA 2G45A 2HR2A 3PE4A 3M99A 3ESKA 4CDRA 5G04B 3QWVA 3AS5A 3O7AA 3O48A 1FP0A 2FI7A 3GZ2A 3PHDA 4R7EA 2PNXA 4U0ZA 2VPDA 4P5OB 5B76A 4BTBA 4AVXA 4O64A 3T7LA 2C2LA 4CGWA 4H7YA 2VPGA 4L58A 1JM7B 5FT9A 5B79A 2MHKA 2C0MA 3BEEA 5B8DA 2YHOA 5TBNA 4FJCA 4BHWA 4GYYA 3MV3B 2F42A 4XI0A 2QFCA 4BT8A 5KJLA 3KV6A 4WUYA 1ZBPA 3U5OA 4ZUXU 3MEKA 2XGOA 3QWWA 2E2EA 2XCCA 4B86C 5LKTA 2LSUA 2KE1A 2LGGA 4BT9A 4I7BA 3U4TA 2D8SA 3EDTB 3LY8A 5TDRA 4MVTA 5A7DB 1WFKA 5FTPA 5D1KB 1NZNA 3O33A 4LADB 4G1TA 4AY5A 4U07A 5AIUA 3GV4A 3LY7A 2VPBA 3ZGQA 2ECGA 2KCVA 2VSNA 2XPIA 1WEMA 4C9ZA 4GNGA 3Q15A 1W3BA 5LKZA 2FEZA 2JMJA 5C11A 5AITA 2UWJG 3KD7A 2BUGA 5HI7A 2HO1A 2G43A 3RPGB 1Z2QA 3UUXA 2CT2A 3EB5A 3MV2B 3SOUA 3HYMB 2YT5A 4GNDA 4XI1A 4CGVA 2Y43A 5JG6A 4YBTA 1HH8A 1MM3A 2LDRA 4BWRA 3O70A 3L1ZB 3ZVYA 2BAYA 4QF2A 4UP0A 3DQVR 4N3WA 4U0SA 2YUCA 2KWOA 2YHNA 4I7CA 4QF3A 4YABA 3QOUA 2MIQA 2WQHA 3E4BA 5G05C 2Y4UA 4G26A 2YSMA 5G05J 3CVLA 3CK9A 3SOXA 2YQ8A 4GCNA 2YQLA 2OXQC 2L80A 1E96B 4GA0A 3TG5A 3ZPVE 4IC2A 4JA7A 1HYIA 3M62A 5DBKA 5H1VA 3Q49B 4S3OB 2F6NA 1A17A 2FSAA 5B75A 2KGIA 1WEWA 4N2QA 3VK6A 2XB1A 4UQYA 2VGXA 2LXHC 4YATA 2ECNA 3S7FA 2JRJA 4GZ6A 5AYWD 4GA1A 5BW8C 2L0BA 2FF4A 3R9AB 4UI9J 2ZETC 2LGLA 1X4IA 2KIZA 1IYMA 3CVPA 1Y8MA 3MHSA 3N9LA 2ECVA 4NN2A 2HDPA 2VYIA 3RTRB 5G04J 1QZ2A 4AM9A 4N3AA 5JJ7A 5A6CA 2IDAA 4A49A 2VGXB 1ELRA 2KC7A 2MUMA 2XEVA 2E6SA 2RI7A 4WNGA 3N9OA 5LKUA 4B7YC 5FERA 2Y1NA 4N39A 4WA6A 3WXXA 4RG6A 3ZN3A 3ZFWA 4I2WA 1ZBDB 3N9PA 4CA1A 3CVQA 5ARFA 3RKVA 2YQMA 2WPVA 4YVQC 5EX0A 4J8FA 2LN0A 4I9CA 4FO9A 3O35A 3NF1A 1WIMA 2PL2A 3U5PA 1HYJA 4I17A 5C13A 2CSYA 4FIPA 2VSYA 2Y1MA 5G0FA 5B77A 2IFUA 1U6GB 2MNYA 5I3LA 4AY6A 3ZPJA 1HZ4A 3N71A 5TRBA 3ASFA 5M72A 1KT1A 3U3WA 2RSDA 1KLXA 1WAO1 2YW8A 2H0DB 3OXLA 2E6RA 4N5CA 4LK9A 3MHHA 2V5FA 3O34A 5B78A 2UY1B 4WNDA 4U04A 3IHPA 5TABA 4G23A 1TJCA 4GYOA 4HOTA 2R5SA 2OOEA 3TAXA 5LCWJ 2XGMA 2VQ2A 2VJEA 5KH3A 3QDNA 4GB0A 4AYCB 3AS8A 3Q4AB 3CK8A 4AP4A 1BORA 2YU4A 2XEUA 1NA0A 2FO7A 3S7DA 4N2SA 3LKUA 2KR4A 3CKBA 2MA5A 1WEQA 3ZPV1 3KS2A 3URZA 4ABNA 5LCWC 4V3LC 2K4DA 2JMDA 2LRIC 2YURA 4BTAA 3LQJA 1LDKC 4BBQA 4J0UA 4I9EA 2PUYA 1PC2A 5CHEE 3SZ7A 5FB1A 3FWVA 3LCAA 3N9NA 3O36A 5FZQA 4APOA 4G24A 3FFLA 5KJMA 1ZU2A 3TGOA 2EODA 1WGMA 2KATA 3RIBA 2LNIA 4GNEA 1JOCA 2Q7FA 2KU3A 3I2DA 2MNZA 4R2YA 4AIFA 3KAEA 2C0LA 1WESA 2C2VS 2L5UA 3VTYA 2K17A 2AN6A 2LSVA 3UPVA 3LPZA 2FUIA 4ZQLA 4UI9B 3OXFA 4UI9K 4GA2A 4NRHB 1JM7A 3KV5A 3S7BA 3UQ3A 2KCLA 3VTXA 5C1DA 1WEUA 3ZVZB 3CV0A 3RU0A 2VJFA 3FL2A 4A4BA 2QJ0A 3PDNA 2DBAA 4HOSA 4J8EA 1WM5A 3L11A 4UP5A 5FEYA 4MSXA 5CCLA 5DKAA 4V3KC 2ECJA 4GZ3A 4L7XA 4IC3A 2L75A 4U0UA 3RO2A 3CK7A 4UI9C 2KFTA 2HYED 4RG9A 2UZGA 2VJFB 1VYXA 4HOQA 2IF4A 2LGVA 5KJNA 3PUQA 3RJVA 1Z6UA 5D0OD 5J3XA 1XNFA 4TKPB 4W4UA 4Y6WA 3HCTA 5H9MA 2M6MA 4YNDA 4FK5A 2AVPA 1X4UA 3L1XA 2EA6A 3SOWA 4YBMA 4G2VA 5BNWA 3O37A 2G6QA 3JYSA 4Q6FA 4AYCA 3ASGA 5ARGA 2DX8A 3N9MA 4N3CA 4YBSA 3Q5MA 4B94A 4PPEA 2KWNA 3RPGC 1WEVA 2MD7B 3HTKC 4JHRA 2L43A 2GW1A 2H0DA 4WNEA 3QZVA 5LCWB 1F62A 5D0QD 1HXIA 5TDWA 4JA9A 3SF4A 1DVPA 5G04C 3LQHA 2UY1A 2YREA 4A4CA 3CVNA 4WNFA 1WEPA 4KXKB 3CKCA 5G05B 3GW4A 4I2ZA 2ECIA 1X4JA 4I1AA 5BT1A 2L6JA 2M85A 2VJEB 3ASLA 5D1MB 3S7JA 2KYUA 1IHGA 4ZDTA 5JJTA 3ZYQA 1N87A 1K2FA 2YYRA 5H1UA 5KH7A 4LEUA 2PZIA 5KH9A 5DIZA 3LYAA 4WZ2A 3LQIA 5HQ8A 4A1SA 2KREA 2KCKA 2FUUA 4J8DA 4LJNA 2VGYA 2LQ6A 3ZTGA 3RO3A 1LDJB 4IN3B 3TG4A 1V87A 2Y4TA 4N3BA 2PQRA 5LKXA 2EGPA 5H1TA 4I7DA 4F3VA 1WEOA 2I50A 4GYWA 4AUQB 2YHCA 4GNFA 4UQXA 2MA6A 3ULQA 5JJ6A 1WENA 1WE9A 2KGGA 5EX3A 2YSJA 3HCSA 2KWKA 1P5QA 1CHCA 2NAAA 2JLBA 3ASHA 2ECWA 3EB6A 3C6WA 3LY9A 2K16A 3ASDA 3Q47B 5EKQD 4H7XA 4GZ5A 5FZSA 3KNVA 2LXPC 1OUVA 5CCMA 4S3OC 3ZHEA 4A0CD 4EQFA 4W9RA 4YC9A 4UQZA 1B89A 3PE3A 3K9IA 3MKRA 3OXGA 4HOUA 3GL6A 4JL0A 1T1HA 3U5NA 3V43A 2I6HA 3QWPA
chains in the Genus database with same CATH superfamily
4GMJA 1FBVA 3EUVA 1PAQA 2M1RA 3SHBA 4GTPA 2CKLA 2OVFA 5H7PA 1UG3A 5SVYA 4A1GA 1E90A 3PZ3A 1MYOA 2ILRA 4R8PK 2MD8C 2CSVA 1ELWA 5AQ9A 3KQIA 3E32A 2GRPB 3SY2A 2A5UA 2ECTA 3DPLR 2WXJA 2CKLB 3I5PA 4LLBA 2GRRB 1TN8A 4KBQA 5B1AE 2A5EA 4GPKA 3HRAA 3PURA 2XGSA 4Z68A 1IYGA 3KEAA 2ONDA 3N9QA 4N4FA 1MX6A 4ZHBA 3GYZA 2LV9A 3FP3A 2F6JA 4RQIA 4DUIA 3UT4A 4YADA 3D3MA 3UTMA 2WXIA 5CMYA 4HRMB 3OAWA 1D8EA 4YVOA 3PE4A 3M99A 3CIAA 3UM0A 3O48A 2FI7A 1TNZA 3ASOE 4LG6A 4U0ZA 2PNXA 2VPDA 4P5OB 2C2LA 4CGWA 4H7YA 3FAOA 2X6KA 5B8DA 2YHOA 1SW6A 4I43A 4BHWA 5T3RA 3MV3B 3QNKA 3U5OA 3T9KA 2E2EA 2XCCA 2QY7A 5LKTA 3CVWA 1DCEA 1FT2A 4MVTA 5A7DB 1WFKA 1NZNA 4U63A 3PUKA 4LADB 4G1TA 4AY5A 5T4YA 2GROB 2B0OE 2OVBA 2VSNA 1WEMA 2IOLA 4C9ZA 4G8LA 3CSFA 4B0ZA 2JMJA 5C11A 4FU3A 3PRZA 3IHYA 2AXZA 2X3MA 3EJNA 4DX5D 1FPPA 2BTDA 2E0IA 2YT5A 4XI1A 4GTMA 3EHQA 3PH0C 1NFIE 2LDRA 4EBAA 3L1ZB 3DQVR 4U0SA 3BQOA 5A23A 2RG8A 3C3OA 4YABA 1EPUA 2MIQA 1Z6TA 2Y4UA 2KZTB 4BERA 3NQPA 5G05J 3DDTA 2YQ8A 3HXDA 5ENQD 3H7HA 5CEDB 4EZJA 1E96B 3LJ3A 5EYPF 4EBAG 4JA7A 4U8VD 3QJZA 2F6NA 2H6IA 3T5XA 4UWFA 1YMPA 3VK6A 4JEHA 2XB1A 3O47A 4L7TA 3AU4A 4YATA 2ECNA 5G2NA 2WXOA 4C9BB 4GA1A 3R9AB 2LGLA 1N52A 1IYMA 3J5PA 3MHSA 4LNBA 4A3VA 2HDPA 2LO6A 2JEKA 1HS6A 5CBNA 5KCMA 1OCRE 2FD4A 5BXOA 2WXHA 2KKXA 5LKUA 2RFMA 4N39A 3SHFA 4RG6A 3CLJA 1ZBDB 4I2WA 5CERB 3N9PA 5ARFA 3L22A 5EX0A 4FO9A 4JVSA 4KVOA 3NB2A 2WQ6A 5E76A 5G55A 4FADA 1HYJA 2WXQA 4OVUA 2PM6A 5CRVA 5G0FA 4J8SA 4GTTA 3TWVA 1QBQA 3RRNB 3BG0B 2B6CA 3Q7AA 4L2YA 4U04A 3RRUA 5JA4D 1NP7A 4G23A 1TJCA 2R5SA 3QB2A 2LUHA 2P9IG 4I6EA 2VJEA 4ATGA 3Q4AB 4O1PA 3L9TA 3AG4E 4DPRA 2I1KA 2XEUA 1NA0A 2FO7A 4O1OA 3LKUA 3ZYKA 3I4RB 3KS2A 3MKQB 4ABNA 1LDKC 4OGCA 1PC2A 3E33A 2ZIRA 3N9NA 4KT6B 2DYSE 3ONLA 2KU3A 3B7BA 4AP2A 2L5UA 2V8SE 4YDOA 2K17A 3TL5A 3OXFA 1TN6A 5B1BE 4GA2A 1JM7A 2WM9A 1D8DA 2OWAA 3B7TA 5C1DA 3FUHA 2JABA 4N5QA 3CV0A 3DEOA 3RU0A 2VJFA 3D9NA 5FQ7A 1YYHA 2AXUA 2M13A 2ETAA 4QQIA 4DRXE 3U66A 4MSXA 3FULA 4L7XA 3LDZA 1E8ZA 5IY5E 5J90A 3RO2A 2KFTA 4QQ4A 2XZDG 2VJFB 2WB2A 1D9SA 3KEZA 4Q94A 2LGVA 2R02A 5KJNA 3PUQA 4PH4B 4LSZE 4P29A 4L9PA 4CDMA 1XNFA 4TKPB 5H9MA 5AQAA 4UWHA 2M6MA 2X6HA 3PEVB 4RSYA 2LAIA 4G2VA 5BNWA 3JYSA 4AYCA 3ASGA 4KZ0A 4MS6A 5ENNA 4GTSA 1WY6A 1WEVA 4JHKA 1JWFA 2GW1A 2H0DA 3QZVA 5D0QD 4Z0RA 4JA9A 3UKRG 4K5AB 3FU5A 2UY1A 4BSXA 2YREA 3KSQA 1WEPA 5G05B 4TXRA 3GW4A 4I2ZA 1UW4B 3T5VA 5EYLA 3FU3A 3MYVA 5BT1A 3FH7A 4KZCA 5CECB 1LF8A 2KYUA 5JJTA 1N87A 1K2FA 5KH7A 4LEUA 2YINA 1LD7A 4JHJA 3ZUVB 1ZB1A 3LYAA 5HQ8A 2AJAA 4TXQA 3ZTGA 3RO3A 4IN3B 3TG4A 1V87A 4N3BA 5LOZA 5H1TA 5ANLA 4I7DA 2I50A 4CEMA 1TNBA 3SFZA 2WXPA 3AG1E 2WXLA 3CVUA 2IOSA 2YSJA 3HCSA 2QC9A 2KWKA 2DZOA 2JLBA 3ASHA 3LY9A 1TN7A 2XEHA 5EKQD 3CVYA 3FEYA 4GZ5A 5FZSA 4IRUA 2ZGGA 4S3OC 3ZHEA 3P2BA 3SGHA 4W9RA 4YC9A 1B89A 5BV0A 2CONA 3ENEA 4EZLA 1T1HA 2I6HA 1O1RA 4O6FA 1AWCB 4HORA 3C5KA 3AU5A 1HFAA 3ESLA 3LRQA 3LVQE 5AQ7A 1N4QA 4C0EA 3UKUG 2KZTA 3AS4A 3MA5A 5BV1A 1Z3YA 4UWKA 3ZHEB 1VD4A 4KYOB 4JEUA 2XOCA 4GTQA 1G25A 2NXPA 3E30A 3ZNGA 3L08A 2MT5A 3FTZA 3HHMA 3R9MA 4DLQA 3QKYA 3CR3A 2J9QA 4GTRA 2VPEA 5FZRA 4XI9A 3APDA 4WZ0A 1YA0A 4YAXA 2K1JA 2KWJA 4TUUA 3ABKE 2P58C 3D9OA 3FTVA 3V79K 2V4LA 4ME2A 4FP7A 3APFA 4NIKA 3FY4A 2LGKA 3NAWA 1MX4A 3CHQA 3ESKA 2J09A 2XS8A 1MBMA 2E61A 5B3SE 4GMRA 4AV7A 1FP0A 3GZ2A 3B7UX 3AAAC 4BTBA 4AVXA 4M7CA 2ETCA 2X6FA 5B79A 2MHKA 1H2TC 2C0MA 3HXEA 3IKOB 1K1BA 2X6IA 3C3RA 4PS7A 3SI5A 4LNGA 2DYRE 4XI0A 3SNXA 2QFCA 5FQ4A 5KJLA 3KV6A 3G2VA 1ZBPA 4ZUXU 2KKYA 1TR4A 1E8WA 3ULEG 1U3DA 3U4TA 5AENA 5TDRA 2XQ0A 5FTPA 2P9KG 5D1KB 1HU3A 3O33A 2DVWA 3LY7A 2VPBA 3ZGQA 2XPIA 4GNGA 1W3BA 1MHQA 3D9IA 3PS6A 5AITA 3R7RA 1IQRA 2CHXA 4PUCA 4I1OB 4HRNA 3V2OA 3KD7A 3R7QA 3RPGB 1Z2QA 2EXUA 1GW6A 1KZPA 1V55E 3DXKG 4GNDA 4J7WA 2Y43A 1MM3A 3AG2E 1UN8A 2EINE 3ZXSA 4UP0A 2IONA 4JW1A 1O1SA 2KWOA 3PUJA 2WQHA 3HG0D 3CVLA 3CK9A 3D9LA 3JXJA 3ZYMA 3DSXA 4GCNA 2D8UA 1K1AA 4GA0A 3ZPVE 4MLPA 4B89A 4FULA 5DBKA 1E8XA 3PNTB 3Q49B 3SO8A 3OTNA 4KMOA 2KGIA 3TWQA 4MKTA 3UT8A 3VLFA 3DXMG 1H0AA 1JWGA 2VGXA 3S7FA 4B93B 3ZW3A 3L13A 5AYWD 2WVIA 1H2VC 5LFAA 3N9LA 2XRZA 2CRRA 3RK6A 2ECVA 3FTYA 1S70B 5G04J 4AM9A 2GRLA 4NACA 5JJ7A 2VGXB 5D2MC 2KC7A 2MUMA 2RI7A 1H19A 4AOFA 3WXXA 3ZFWA 3PVLA 3E37A 3IXEA 4A63B 4J8FA 4JPSA 4HVBA 2I2OA 1FVHA 1Q2ZA 4ILGA 3HVEB 4I17A 3UM1A 4FIPA 2IFUA 2JUNA 3ASFA 4URKA 3DSTA 1JUQA 3U3WA 2RSDA 5JMND 1IHBA 2H0DB 4N5CA 3ZVVA 1RW2A 2UY1B 3AJIA 3HVEA 4GYOA 4KVMA 2OOEA 1EF1C 5LCWJ 2XGMA 5EDSA 2XS1A 3DSWA 3Q7FA 4GU5A 3V30A 5ANRA 4AP4A 3FU6A 4HNAD 1TNUA 4XKCA 2YU4A 4N2SA 4HI8A 2KR4A 2MA5A 2ZU6B 1WEQA 3T8KA 3MX3A 4V3LC 2LRIC 2YURA 3LQJA 4BBQA 3NBNB 4I9EA 5LP0A 3BUAA 4OGEA 3QAQA 4J6IA 4MRUA 5CHEE 3EIJA 1N4PA 3O36A 2OV8A 4G24A 3LJUX 1ZU2A 4GNEA 3EU5A 4IULA 4AIFA 2C0LA 4K5BA 2C2VS 3L82A 3VTYA 4DLOA 3G2SA 3O4ZA 2L7PA 2AN6A 1N11A 1NL4A 3W9GA 3LXUX 4DI4A 4NRHB 3ULYA 4F1PA 4DJAA 3I3NA 2J08A 3UQ3A 1FVFA 1WDYA 2MKEA 4E85A 4A4BA 2QJ0A 3PDNA 2BF0X 3CSTA 2EIME 3PZ4A 3NOCD 3FEXA 3Q78A 3HDXA 1QYMA 2YNQA 2ECJA 2AW6A 3C5RA 2VJ8A 1Z3XA 4BX9A 3MDBC 2OEWA 1OWMA 2WXKA 2CRWA 4F6RD 1O5MA 4H9DA 4RG9A 4C48B 1O1TA 4EHMA 1VDYA 1JCQA 3AG3E 4U96D 1VYXA 3SUBA 2P9PG 3RJVA 1Z6UA 5D0OD 3TWRA 3L17A 4R7LA 3ABME 4L23A 3DWDA 3QK0A 4YNDA 3SOWA 2EA6A 3MJWA 3UM2A 3TWXA 4GMLA 5ARGA 3FTUA 4YBSA 2HE0A 1A5EA 2MD7B 3HTKC 4JHRA 1TEZA 5LCWB 1F62A 5ENOD 2GRQB 5TDWA 2XRYA 5G04C 3RRMB 4CCAA 3JCKC 4A4CA 3CVNA 3DSSA 1X5BA 4RVBA 2ECIA 1X4JA 2M85A 3HXBA 3ASLA 5D1MB 3S7JA 3L16A 3ZYQA 4JD2G 1FT1A 2YYRA 5KH9A 5DIZA 3UX4A 2KREA 2KCKA 2VGYA 2LQ6A 3ZRHA 2EGPA 3TWWA 4F3VA 1MZCA 4GNFA 2KGGA 5EX3A 3EB6A 1CHCA 2ECWA 3C6WA 4EZKA 2K16A 3ASDA 5ENTD 1QNFA 2Y0BG 1HX8A 4D10C 4H7XA 4U95D 2LXPC 3FJUB 3HXFA 3TWSA 1E8YA 4EQFA 3OXGA 3GL6A 2F8XK 3GZSA 4K0RA 3U5NA 4EECA 2DWZA 3QWPA 3C72A 2KXPC 1FCHA 3DSUA 2CG2A 2ZISA 2Y1LE 3C3QA 2FBNA 4V3IA 3G2TA 1E4UA 1UJJA 4X3GA 1V54E 4XEIG 2CSZA 3E2DA 2JMIA 4TXPA 4DX1A 3FUNA 3JUIA 4CCGX 2RR4A 2HYZA 3EHMA 3QC1A 1QQEA 4YDYA 3ZNIA 2FFWA 3NOGD 2XOZA 1OCZE 3CQCB 1RMDA 4HB5A 5D66A 1Z60A 1WILA 3CGHA 4I1MA 2L9BA 5FB0A 4GCOA 3CEQA 3D9KA 4WWOA 4G11A 2VP7A 4AXHA 2WXRA 3UIOC 4LNUD 2Y3AA 4NQ0A 5KBAA 5DINA 4ANUA 5SVXA 3T8MA 3B7SA 4ILHB 2M3HA 4Y6CA 4XIFA 4F52B 2XCBA 2P9SG 4BEPA 4CT4A 3UINC 4ANWA 1U3CA 1KT0A 4GTVA 2XOYA 2G45A 3U64A 4CDRA 4Q69A 5G04B 2V4HC 3QWVA 3AS5A 3Q9UC 5HS0A 3VLEA 3FTXA 4FJZA 3PREA 2VPGA 1JM7B 5FT9A 2NSZA 3UIPC 5TBNA 4J8YA 4HXIA 4GYYA 5KNHD 3PNLB 2F42A 4TUMA 4BT8A 3FH8A 3ML8A 1OWOA 3FEHA 3EU9A 5AQBA 3QWWA 5AJDA 4HBDA 2LSUA 3BU8A 2KE1A 4BT9A 2LGGA 4I7BA 5HKPA 2D8SA 3EDTB 3LY8A 2VSOE 2J4DA 1G3NB 3LDYA 1BPOA 1SA4A 5AIUA 2ECGA 4ACLA 3FDHA 3Q15A 3RAUA 2FEZA 3CQGB 4Q96A 3PZ2A 4M3OA 5JHBA 2G43A 4XE0A 2CT2A 3EB5A 3SOUA 3HYMB 4PDXA 3X2QE 4YBTA 1HH8A 1N95A 3O70A 3ZVYA 4QF2A 4C0MA 3UM3A 2YUCA 5ENPD 4I7CA 5G05C 4G26A 2F37A 2YSMA 2IQCA 5ENRD 5FIOA 4ANVA 3LVRE 3TXNA 1HYIA 3DBSA 3TWUA 5H1VA 4S3OB 1A17A 2F8YA 2R05A 1OWLA 5BPPA 2V5QC 2L0IA 5EIBE 2IO3C 5CMWA 4UQYA 5EIDA 2LXHC 1N0QA 2FULA 4GZ6A 4CDNA 5KWDA 4BSZB 4UI9J 1S0PA 2KIZA 2L6BA 1Y8MA 3LJNA 4DX6D 2X6JA 1MJ0A 3FH5A 4NN2A 2VYIA 4O62A 3RTRB 1HE8A 4HLEA 4N3AA 5A6CA 2IDAA 4A49A 2XEVA 2E6SA 3TJPA 3N9OA 2R03A 3IHVA 2P9NG 1H6OA 4WA6A 1BD8A 3NZSA 3PEUB 4CA1A 3CVQA 2XPZA 2RD0A 3RKVA 3SFXA 2YQMA 3DPYA 2Y69E 4YVQC 2LN0A 4I9CA 3NF1A 1WIMA 4PS8A 2PL2A 1N0RA 3UMVA 2CSYA 1H2UA 2LXLA 4FHKA 2LXMA 5I3LA 3CHRA 5TRBA 5M72A 2EIKE 2A4ZA 2AXVA 3FHEA 2V5FA 3O34A 4WNDA 1Z5SC 1SQMA 3QARA 3TAXA 1NI1A 2H6HA 2XENA 5ITZF 1H6PA 3QDNA 4GB0A 4AYCB 2JM3A 4TRQA 3ONKA 3S7DA 4ACKA 4Z0OA 4DK5A 4GPMA 3ZPV1 3MGBA 3URZA 4E6HA 2JMDA 3ML9A 2VTBB 4BTAA 4J0UA 3MZLB 3D9HA 1JCRA 5FB1A 3SZ7A 4WWNA 3CHPA 3FWVA 4U8HA 3FUFA 4APOA 3UI2A 3FFLA 3J5QB 5KJMA 2EODA 2LNIA 1UN9A 3V31A 1JOCA 3I2DA 2MNZA 2IU1A 5BUZA 2DCPA 4FJYA 1WESA 2VTBA 5K3QA 2LSVA 3UPVA 2BKKB 3LPZA 4ZQLA 1TYQG 2KCLA 3WG7E 4GTOA 4BETA 3FL2A 1K3ZD 3B95A 3NZUA 1N54A 2J8SD 4NURA 3FU0A 3L11A 2WXGA 1BLXB 3B13A 5DKAA 3FANA 3Q1DA 4UWGA 4IC3A 2L75A 2ZGDA 3JQ0A 4U0UA 3CK7A 4UI9C 3ZU7B 4A55A 2HYED 4APFA 2UZGA 5FINA 2OCCE 2IF4A 1XGWA 4I6GA 5J3XA 2QYJA 3HCTA 1ELKA 4FK5A 1IKND 2KBXA 1X4UA 2YHEA 2G6QA 4Q6FA 3SBTB 3N9MA 2DX8A 4N3CA 2FO1E 4B94A 3FTWA 2EGMA 5HRYA 2KWNA 5CEAA 2I1JA 4WNEA 4DX7D 1HXIA 3ZIMA 3ZKJA 3MKQA 4ZFHA 3G2UA 1SZAA 4WNFA 1HG2A 3CKCA 2WXMA 3JQ1A 4LUNU 5ENSD 4I1AA 3F6QA 1IHGA 2XPYA 5H1UA 1KZOA 3S2AA 2XHEA 2J4BA 1OY3D 4JXTA 2ETBA 1H6KA 4LRZA 3DPDA 3G2WA 4LJNA 3FUMA 1LDJB 2Y4TA 5LKXA 2PQRA 3BG1B 2LAUA 4UQXA 2MA6A 1WE9A 4BY6A 2NYJA 1P5QA 2NAAA 3CHSA 3CVXA 3M7KA 4XX5A 2DIWA 4UQZA 5AAOA 2PM7A 3SQVA 1S63A 5EN5D 4OAUC 4XKBA 2QICA 4I6JA 3VLDA 4LCTA 1YCSB 1OCOE 4LKAA 4YDWA 3HCUA 2NC9A 3IEGA 3APCA 3Q9NC 1JPLA 1VFYA 4K03A 1X81A 2QIZA 2LAHA 1L5JA 5KJKA 5LX8A 3GZ1A 3RSEG 3U5MA 4PTBA 3JUEA 1OWNA 5FJYA 5FWQA 3M63A 4B8AA 5EYAF 1SA5A 4XZ4A 1WEEA 1AP7A 1NA3A 4TV3A 3Q75A 1XWHA 1MX2A 3CHOA 4WZ3B 2GRNB 2DSMA 3FM8C 3EHNA 2XP0A 3TWTA 3U9WA 5D1LB 4WWPA 4DI3A 1IQUA 4AEZC 2X38A 2F0YA 1MM2A 2EILE 3ZYLA 3T6RA 3NG2A 3FTSA 4GZDA 3FUJA 2PQNA 4G25A 2VNFA 3LEWA 4FA6A 2HR2A 2H6GA 2EQXA 2VGEA 3CHMA 3O7AA 3PHDA 4R7EA 5B76A 4O64A 3T7LA 3PZ1A 4BESA 4L58A 2KM4A 2R17C 3BEEA 4FJCA 1EYHA 2L0TB 2P57A 3B7RL 3ZEFA 1SZ9A 3UXGA 1OCCE 1LD8A 2RFAA 4WUYA 1N94A 3MEKA 2J07A 2XGOA 4B86C 1WG0A 2RKKA 1OWPA 5SVIB 1Y6IA 4YDEA 1MQSA 4U07A 3GV4A 5CBOA 2KCVA 1PY1A 3Q73A 5LKZA 4CT0A 2UWJG 2BUGA 5HI7A 2HO1A 3MCXA 3UUXA 2QYUA 2R59A 3MV2B 5CRUA 2WXFA 1BU9A 4CGVA 5JG6A 3DWLG 3CVVA 3Q79A 4X8QA 4BWRA 2P9UG 3FUEA 4FHJA 2BAYA 4CYMD 4N3WA 2YHNA 4QF3A 4HLLA 3QOUA 3E4BA 3FUDA 3SOXA 2IQJA 2V0PA 2YQLA 4IYPA 2OXQC 2L80A 4U7EB 3TG5A 4IC2A 3M62A 2P2CP 2OEVA 2FSAA 5B75A 2IO2C 2XZTG 1WEWA 4N2QA 1TJFA 3D9PA 1DNPA 2PNNA 2JRJA 2L0BA 5BW8C 2FF4A 4OYSA 4L2LA 2ZETC 1X4IA 3HIZA 3CVPA 4JB8P 1QZ2A 4HRLA 1ELRA 3TXMA 4WNGA 4B7YC 2R2LA 5FERA 2Y1NA 2CG3A 3ZN3A 2MRIA 4QFVA 1UOHA 2WPVA 1BI7B 3O35A 5BXUA 4O60A 4RLYA 1UJKA 3U5PA 1E7UA 5C13A 3SBSA 2VSYA 2Y1MA 5B77A 4MBGA 1U6GB 2MNYA 3L6AA 4AY6A 4A3TA 3ZPJA 1HZ4A 3N71A 1DCQA 1KT1A 1KLXA 1WAO1 3FUIA 2YW8A 2WMOA 4UWLA 3OXLA 2E6RA 4LK9A 3MHHA 2QZAA 4FLBA 5B78A 4L1BA 3D9JA 2WQ7A 3IHPA 1JCSA 5TABA 4HOTA 4ATZD 1KPSB 2VQ2A 5KH3A 3AS8A 2IY0C 1INZA 3CK8A 1BORA 4ILIA 5FQ8A 2CHZA 3CKBA 4U8YD 5LCWC 4HFGA 2K4DA 1IXVA 4K5CA 3DSVA 5JHAA 4LERA 4ANXA 3SFYA 3HXCA 2PUYA 3IBEA 2EIJE 3LCAA 3ABLE 5FZQA 2MOWA 2I9CA 3TGOA 3KSLA 1WGMA 2KATA 3RIBA 3L54A 4F7AA 2Q7FA 4R2YA 2WMNA 3KAEA 4EPZA 1TNOA 5C2YA 4WAFA 1TNYA 3V2XA 5AN8A 1N9AA 2FUIA 1S64A 2MYOA 4UI9B 4UI9K 5AARA 2DJAA 3KV5A 5AJLA 4UUCA 3S7BA 3VTXA 1WEUA 3ZVZB 2BKGA 3E34A 4FLHA 1K8KG 2DBAA 4HOSA 4J8EA 1WM5A 3D9MA 4GZCA 4PS3A 4HS2A 4UP5A 5FEYA 3KDEC 5CCLA 4V3KC 2M63A 4GZ3A 2AWIA 2IJGX 4BFRA 4B8CB 3PLWA 4HQDA 4HOQA 5E75A 3P1UA 1U2VG 1OXJA 2H6FA 2WXNA 4F1SA 4W4UA 4Y6WA 3DRAA 4OAVB 2CHWA 2AVPA 1HG5A 3L1XA 4YBMA 4FC8A 3O37A 4JC8A 3FUKA 3ASNE 2CFUA 3JXIA 3Q5MA 4PPEA 2J49A 3RPGC 1N4RA 4HI9A 2L43A 2GGFA 3ISMC 2CFZA 3SD5A 4OVVA 1RZ4A 1E7VA 2P9LG 3EHRA 1DVPA 2HM8A 3SF4A 3LQHA 3DEPA 1EDUA 4KXKB 1HF8A 1OT8A 4BX8A 2VJEB 2L6JA 4AJWA 4DX2A 4ZDTA 3ZXPA 4GB9A 2PZIA 1LTXA 5EILA 2ZXWE 5J08A 4GAAA 4WZ2A 2VSXE 3LQIA 4A1SA 1N4SA 2FUUA 4CZ2D 4J8DA 1SVXA 3C98A 3LS8A 1DC2A 2YVRA 2GRMA 4F53A 1WEOA 4GYWA 5SVIA 4AUQB 2YHCA 3IV0A 3ULQA 5JJ6A 1WENA 2DZNA 5AIJA 4CRWA 3UT7A 3Q47B 4G8KA 2BEDA 3PZDA 3KNVA 2IEJA 3W9FA 3EIQC 1OUVA 5CCMA 1HO8A 3I4GA 4A0CD 3PE3A 4HOUA 3K9IA 3MKRA 5KNGA 4JL0A 5FQ6A 3V43A 5T8IA 4JZYA 1BI8B 2XEEA
chains in the Genus database with same CATH topology
4GMJA 4XKBA 1FBVA 1X4JA 4I6JA 4O6FA 2QICA 1PAQA 3VLDA 4HORA 2M1RA 3SHBA 4LCTA 3AU5A 3C5KA 1HFAA 1FCHA 2OVFA 2CKLA 3ESLA 4LKAA 2CG2A 3LRQA 3LVQE 1UG3A 4A1GA 4C0EA 3HCUA 4V3IA 2FBNA 2NC9A 2KZTA 3G2TA 3AS4A 1E4UA 3MA5A 5BV1A 1E90A 1Z3YA 1UJJA 3IEGA 3APCA 4UWKA 3ZHEB 1VD4A 3EB6A 4X3GA 2CSZA 1JPLA 4KYOB 4JEUA 2JMIA 2ILRA 4R8PK 1VFYA 2MD8C 3FUNA 3PHDA 1G25A 1ELWA 4K03A 3KQIA 2QIZA 2LAHA 3JUIA 1L5JA 2NXPA 5KJKA 5LX8A 4CCGX 3GZ1A 3U5MA 4PTBA 1OWNA 2A5UA 2ECTA 2HYZA 5FJYA 3EHMA 3QC1A 3L08A 2MT5A 1QQEA 2WXJA 3DPLR 3FTZA 2CKLB 3I5PA 5FWQA 4LLBA 3M63A 3ZNIA 3HHMA 4DLQA 4B8AA 3QKYA 3CR3A 5EYAF 2J9QA 4KBQA 2VPEA 3CQCB 4XZ4A 4GPKA 5FZRA 1RMDA 4XI9A 1NA3A 1WEEA 4TV3A 1Z60A 1XWHA 1WILA 3APDA 3CGHA 4I1MA 4WZ0A 3CHOA 1YA0A 4WZ3B 2L9BA 3PURA 4YAXA 5FB0A 2XGSA 2K1JA 4GCOA 1IYGA 3CEQA 2KWJA 3D9KA 4TUUA 3EHNA 4WWOA 2ONDA 2P58C 4G11A 3U9WA 4AXHA 2VP7A 3N9QA 4N4FA 5D1LB 4WWPA 2WXRA 4DI3A 3D9OA 1IQUA 3FTVA 4AEZC 2X38A 5DINA 2Y3AA 4NQ0A 1MM2A 2V4LA 4ANUA 3GYZA 4ME2A 3T8MA 3FP3A 3B7SA 4FP7A 3APFA 2F6JA 2LV9A 4ILHB 3UT4A 3ZYLA 3NG2A 2M3HA 3T6RA 4Y6CA 4XIFA 4YADA 3D3MA 2XCBA 4F52B 3FTSA 4GZDA 3FUJA 2PQNA 2WXIA 4CT4A 5CMYA 4G25A 3FY4A 2LGKA 4ANWA 1U3CA 1KT0A 2VNFA 3OAWA 4YVOA 3LEWA 2G45A 4FA6A 3CHQA 2HR2A 3U64A 3PE4A 3M99A 3CIAA 3ESKA 4CDRA 2J09A 4Q69A 5G04B 3QWVA 3AS5A 2EQXA 3CHMA 4AV7A 3O48A 1FP0A 2FI7A 3GZ2A 3VLEA 3FTXA 3O7AA 2PNXA 4U0ZA 2VPDA 4P5OB 5B76A 3B7UX 4BTBA 4AVXA 4FJZA 4O64A 3T7LA 3PREA 2C2LA 4CGWA 2X6FA 4H7YA 2VPGA 4L58A 4AYCA 1JM7B 5FT9A 5B79A 2MHKA 2NSZA 2KM4A 1H2TC 2C0MA 2R17C 2X6KA 3BEEA 5B8DA 3IKOB 2YHOA 2X6IA 5TBNA 4FJCA 4I43A 4BHWA 1EYHA 4PS7A 4HXIA 2L0TB 3SI5A 4GYYA 5T3RA 3MV3B 3PNLB 4XI0A 2F42A 3B7RL 2QFCA 3SNXA 1SZ9A 3ZEFA 4BT8A 5FQ4A 5KJLA 3KV6A 3FH8A 3G2VA 3ML8A 4WUYA 1ZBPA 1OWOA 3QNKA 3U5OA 3MEKA 2XGOA 2J07A 3QWWA 2E2EA 5AJDA 4ZUXU 1E8WA 2XCCA 4B86C 2QY7A 2LSUA 2KE1A 2LGGA 1U3DA 4BT9A 3U4TA 3CVWA 2D8SA 4I7BA 3EDTB 3LY8A 5AENA 4MVTA 2VSOE 5TDRA 2J4DA 5A7DB 1OWPA 2XQ0A 1WFKA 5FTPA 5D1KB 1NZNA 4U63A 3PUKA 1HU3A 1BPOA 3O33A 1Y6IA 4G1TA 1MQSA 4AY5A 4U07A 5T4YA 4LADB 3GV4A 3LY7A 5AIUA 2OVBA 2VPBA 3ZGQA 2ECGA 2VSNA 2KCVA 1PY1A 2XPIA 4ACLA 2IOLA 3FDHA 1WEMA 4C9ZA 4GNGA 3Q15A 1W3BA 5LKZA 3CSFA 4B0ZA 1MHQA 2FEZA 3D9IA 4CT0A 3CQGB 3PS6A 4FU3A 3PRZA 4Q96A 3R7RA 2JMJA 3IHYA 1IQRA 2AXZA 2CHXA 4M3OA 4PUCA 4I1OB 2X3MA 5JHBA 2UWJG 3KD7A 2BUGA 5HI7A 3EJNA 2HO1A 3MCXA 3R7QA 2G43A 1Z2QA 3RPGB 4XE0A 3UUXA 2CT2A 1GW6A 2BTDA 2R59A 3MV2B 3EB5A 3SOUA 2E0IA 3HYMB 2YT5A 4GNDA 2WXFA 4PDXA 3ZN3A 4XI1A 5C11A 4CGVA 2Y43A 3CVVA 5JG6A 4YBTA 4R7EA 1HH8A 3PH0C 1MM3A 2LDRA 4BWRA 4EBAA 1UN8A 3L1ZB 3FUEA 4FHJA 3ZXSA 2BAYA 3O70A 3ZVYA 4QF2A 4UP0A 4C0MA 3DQVR 4N3WA 4U0SA 2YUCA 2IONA 4JW1A 5A23A 2RG8A 2KWOA 2YHNA 4I7CA 4QF3A 4YABA 1EPUA 3QOUA 3PUJA 2WQHA 1Z6TA 3E4BA 5G05C 2Y4UA 4G26A 2MIQA 2KZTB 2YSMA 3NQPA 5G05J 3CVLA 3CK9A 3D9LA 3FUDA 3SOXA 2YQ8A 2IQCA 3ZYMA 4GCNA 2V0PA 2YQLA 4IYPA 4ANVA 2OXQC 2L80A 4EZJA 1E96B 4GA0A 3LJ3A 3TG5A 4EBAG 3ZPVE 4MLPA 4IC2A 3LVRE 3TXNA 4JA7A 4B89A 1HYIA 4FULA 3DBSA 3M62A 5DBKA 1E8XA 3PNTB 3Q49B 4S3OB 3QJZA 5H1VA 2F6NA 1A17A 3T5XA 3OTNA 4KMOA 2FSAA 2KGIA 5B75A 1OWLA 4UWFA 5BPPA 4MKTA 4N2QA 3UT8A 1TJFA 2L0IA 1WEWA 4JEHA 2XB1A 3VLFA 3VK6A 4L7TA 1H0AA 3D9PA 3AU4A 1JWGA 4UQYA 5CMWA 2VGXA 2LXHC 4YATA 2ECNA 1DNPA 3S7FA 2FULA 5G2NA 3ZW3A 3L13A 2JRJA 2WXOA 4GZ6A 5AYWD 4C9BB 4GA1A 5BW8C 4CDNA 2L0BA 2FF4A 2WVIA 1H2VC 4OYSA 3R9AB 4UI9J 1S0PA 4L2LA 2LGLA 2ZETC 1X4IA 3HIZA 2KIZA 1N52A 1IYMA 3CVPA 1Y8MA 5LFAA 3MHSA 3N9LA 2XRZA 3RK6A 2ECVA 2X6JA 3FH5A 3FTYA 4NN2A 4A3VA 2HDPA 2VYIA 2LO6A 2JEKA 3RTRB 5G04J 1HS6A 1QZ2A 1HE8A 4HLEA 4AM9A 2GRLA 4NACA 4N3AA 5KCMA 5JJ7A 5A6CA 2IDAA 4A49A 2VGXB 1ELRA 2KC7A 3TXMA 2XEVA 2MUMA 2WXHA 2E6SA 2RI7A 3TJPA 4WNGA 3N9OA 5LKUA 4B7YC 3IHVA 5FERA 2Y1NA 4N39A 4WA6A 1H19A 3NZSA 2CG3A 3SHFA 4RG6A 3WXXA 4AOFA 3CLJA 3PEUB 4I2WA 3PVLA 2MRIA 4QFVA 3ZFWA 3CVQA 2XPZA 2RD0A 3L22A 5ARFA 3RKVA 4CA1A 2YQMA 2WPVA 4YVQC 5EX0A 4J8FA 2LN0A 4I9CA 4FO9A 4JVSA 4KVOA 4JPSA 4HVBA 2I2OA 1FVHA 3O35A 3NF1A 1WIMA 2WQ6A 4ILGA 5E76A 4PS8A 5G55A 2PL2A 1UJKA 3HVEB 1E7UA 4FADA 3U5PA 1HYJA 4I17A 5C13A 3UMVA 2WXQA 2CSYA 3SBSA 4FIPA 2VSYA 1H2UA 2PM6A 4OVUA 2Y1MA 5G0FA 5B77A 2IFUA 1U6GB 4J8SA 4FHKA 2MNYA 3L6AA 5I3LA 4AY6A 4A3TA 3CHRA 1HZ4A 3ZPJA 3N71A 5TRBA 3ASFA 4URKA 1JUQA 5M72A 1KT1A 3U3WA 2RSDA 2A4ZA 1KLXA 1WAO1 3FUIA 3RRNB 2H0DB 2YW8A 2WMOA 3BG0B 3OXLA 4UWLA 4N5CA 2E6RA 4LK9A 2AXVA 3MHHA 3FHEA 3ZVVA 4FLBA 2V5FA 4L2YA 3O34A 5B78A 4L1BA 2UY1B 4WNDA 3D9JA 4U04A 3RRUA 2WQ7A 3IHPA 5TABA 1NP7A 3HVEA 4G23A 1TJCA 1SQMA 4GYOA 4HOTA 4KVMA 2R5SA 3QB2A 2OOEA 3QARA 3TAXA 1EF1C 5LCWJ 2XGMA 2VQ2A 4I6EA 2VJEA 4ATGA 5KH3A 3QDNA 4GB0A 4AYCB 3AS8A 3Q4AB 5EDSA 1ZBDB 4DPRA 1INZA 4GU5A 3CK8A 4AP4A 5ANRA 3FU6A 4TRQA 4XKCA 1BORA 2YU4A 2I1KA 2XEUA 4ILIA 1NA0A 3ONKA 2FO7A 3S7DA 4N2SA 5FQ8A 4ACKA 3LKUA 3ZYKA 2KR4A 2CHZA 3CKBA 2ZU6B 2MA5A 1WEQA 3I4RB 4DK5A 3MX3A 3ZPV1 3KS2A 3MGBA 3MKQB 3URZA 4ABNA 5LCWC 4V3LC 4HFGA 4E6HA 2JMDA 2K4DA 3ML9A 2VTBB 4BTAA 2LRIC 2YURA 3LQJA 1LDKC 4BBQA 5JHAA 4J0UA 4LERA 4I9EA 5LP0A 3MZLB 4ANXA 3QAQA 1PC2A 4J6IA 3IBEA 4MRUA 5CHEE 3SZ7A 4WWNA 2PUYA 3CHPA 3EIJA 3FWVA 3LCAA 4U8HA 3N9NA 3O36A 5FZQA 2OV8A 3FUFA 4APOA 4G24A 4KT6B 2MOWA 3FFLA 2I9CA 1ZU2A 5KJMA 3TGOA 2EODA 1WGMA 2KATA 3RIBA 3L54A 2LNIA 1UN9A 4F7AA 1JOCA 4GNEA 2Q7FA 3ONLA 4IULA 2KU3A 2MNZA 3I2DA 2IU1A 4R2YA 4AP2A 5BUZA 2DCPA 4AIFA 4FJYA 2WMNA 2C0LA 3KAEA 4EPZA 1WESA 2C2VS 5C2YA 4WAFA 2L5UA 2V8SE 3VTYA 2VTBA 2K17A 4DLOA 3G2SA 3O4ZA 2AN6A 2LSVA 3UPVA 3LPZA 3TL5A 2FUIA 4ZQLA 4UI9B 3OXFA 4UI9K 3LXUX 4GA2A 4DI4A 4NRHB 1JM7A 2WM9A 3KV5A 4DJAA 3I3NA 5AJLA 2J08A 3S7BA 3UQ3A 2KCLA 3B7TA 1FVFA 3VTXA 3FUHA 5C1DA 1WEUA 3N9PA 3ZVZB 4E85A 3CV0A 3RU0A 2VJFA 3FL2A 4A4BA 3D9NA 2QJ0A 5FQ7A 3PDNA 2BF0X 3NZUA 1N54A 4FLHA 4NURA 2DBAA 4HOSA 4J8EA 1WM5A 3D9MA 3CSTA 3FU0A 4GZCA 4PS3A 3L11A 2AXUA 4HS2A 3FEXA 4UP5A 2WXGA 5FEYA 3HDXA 3B13A 2YNQA 3U66A 5CCLA 4MSXA 4V3KC 5DKAA 2ECJA 4UWGA 2AW6A 2M63A 4GZ3A 3FULA 2VJ8A 4L7XA 3LDZA 1E8ZA 5J90A 4IC3A 1Z3XA 2AWIA 2IJGX 4BX9A 2L75A 4BFRA 4B8CB 3JQ0A 4U0UA 1OWMA 3RO2A 3CK7A 4UI9C 2WXKA 2KFTA 4A55A 2HYED 4APFA 4RG9A 2UZGA 1VDYA 2VJFB 2WB2A 1VYXA 4HOQA 5E75A 2IF4A 3KEZA 3P1UA 4Q94A 2LGVA 5KJNA 3PUQA 3RJVA 1Z6UA 4PH4B 1XGWA 5D0OD 4I6GA 4P29A 5J3XA 2WXNA 4CDMA 4F1SA 1XNFA 4TKPB 4W4UA 3L17A 4Y6WA 4R7LA 3HCTA 5H9MA 1ELKA 4L23A 4UWHA 2M6MA 2CHWA 2X6HA 3QK0A 4YNDA 4FK5A 3PEVB 2AVPA 4RSYA 1HG5A 2YHEA 1X4UA 2EA6A 3L1XA 3SOWA 4YBMA 2LAIA 4G2VA 5BNWA 3MJWA 4FC8A 3O37A 2G6QA 3JYSA 4JC8A 3FUKA 3SBTB 4Q6FA 3ASGA 2CFUA 4GMLA 4KZ0A 4N3CA 5ARGA 2DX8A 4MS6A 5ENNA 3N9MA 3FTUA 4YBSA 3Q5MA 4B94A 3FTWA 4PPEA 1WY6A 2J49A 2KWNA 3RPGC 1WEVA 2MD7B 3HTKC 4JHKA 4JHRA 2I1JA 1TEZA 1JWFA 2GW1A 2GGFA 2H0DA 4WNEA 2L43A 3QZVA 5LCWB 1F62A 5D0QD 2CFZA 3SD5A 1HXIA 4OVVA 1E7VA 5TDWA 4JA9A 3ZIMA 1DVPA 2HM8A 2XRYA 3FU5A 5G04C 3SF4A 3MKQA 3LQHA 2UY1A 4BSXA 3RRMB 2YREA 4CCAA 3G2UA 3JCKC 4A4CA 1SZAA 3CVNA 4WNFA 1WEPA 1EDUA 4KXKB 1X5BA 1HG2A 3CKCA 4RVBA 2WXMA 5G05B 3GW4A 1HF8A 4I2ZA 3JQ1A 2ECIA 4BX8A 1UW4B 4LUNU 3T5VA 3FU3A 3MYVA 4I1AA 2L6JA 3FH7A 4KZCA 4AJWA 5BT1A 2M85A 2VJEB 3ASLA 5D1MB 1LF8A 3S7JA 2KYUA 1IHGA 2XPYA 3L16A 4ZDTA 5JJTA 3ZYQA 1N87A 1K2FA 5LKTA 2YYRA 5H1UA 5KH7A 3S2AA 4GB9A 4LEUA 2PZIA 2YINA 2XHEA 5KH9A 2J4BA 4JHJA 5DIZA 3UX4A 5J08A 3LYAA 4GAAA 4JXTA 4WZ2A 2VSXE 3LQIA 5HQ8A 4A1SA 2KREA 2KCKA 2FUUA 1H6KA 4LRZA 3DPDA 3G2WA 4J8DA 4LJNA 2VGYA 3FUMA 3LS8A 3C98A 3ZRHA 3RO3A 1LDJB 4IN3B 2LQ6A 3TG4A 1V87A 2Y4TA 3ZTGA 4N3BA 2PQRA 5LOZA 3BG1B 2EGPA 5H1TA 5LKXA 2GRMA 5ANLA 4F53A 4I7DA 4F3VA 1WEOA 4CEMA 2I50A 4GYWA 3SFZA 2WXPA 2YHCA 3IV0A 4GNFA 4UQXA 4AUQB 2MA6A 3ULQA 5JJ6A 2WXLA 1WENA 1WE9A 3CVUA 2IOSA 2KGGA 5EX3A 4BY6A 2YSJA 3HCSA 5FB1A 5AIJA 1P5QA 1CHCA 2KWKA 2JLBA 3CHSA 3ASHA 4CRWA 2ECWA 2NAAA 3C6WA 4EZKA 3LY9A 2K16A 3ASDA 3UT7A 5AITA 3CVXA 1QNFA 3Q47B 5EKQD 3CVYA 3FEYA 1HX8A 3PZDA 4H7XA 4GZ5A 5FZSA 4IRUA 4XX5A 4D10C 3KNVA 3EIQC 2LXPC 1OUVA 5CCMA 4S3OC 1HO8A 3I4GA 3ZHEA 3P2BA 3SGHA 4A0CD 1E8YA 4EQFA 4W9RA 4YC9A 2DIWA 4UQZA 1B89A 3PE3A 3K9IA 3ENEA 3MKRA 3OXGA 4HOUA 5BV0A 3GL6A 2PM7A 4EZLA 4JL0A 1T1HA 3GZSA 4K0RA 5FQ6A 4EECA 3U5NA 3V43A 5T8IA 4JZYA 2I6HA 3QWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  2QIC A;  4O6F A;  4HOR A;  2M1R A;  3SHB A;  3C5K A;  1FCH A;  2CKL A;  4LKA A;  3LRQ A;  3HCU A;  2FBN A;  2NC9 A;  3AS4 A;  1E4U A;  3MA5 A;  3ZHE B;  3IEG A;  4X3G A;  1VD4 A;  2CSZ A;  4KYO B;  2JMI A;  4R8P K;  1VFY A;  2MD8 C;  1G25 A;  1ELW A;  3KQI A;  2QIZ A;  4CCG X;  5KJK A;  3GZ1 A;  3U5M A;  4PTB A;  2ECT A;  2HYZ A;  5FJY A;  2MT5 A;  1QQE A;  3DPL R;  2CKL B;  4LLB A;  3M63 A;  3ZNI A;  3QKY A;  5EYA F;  2J9Q A;  4KBQ A;  2VPE A;  4GPK A;  5FZR A;  1RMD A;  4XI9 A;  1NA3 A;  1WEE A;  1Z60 A;  1XWH A;  1WIL A;  4WZ0 A;  4WZ3 B;  1YA0 A;  3PUR A;  4YAX A;  5FB0 A;  2XGS A;  2K1J A;  4GCO A;  1IYG A;  3CEQ A;  2KWJ A;  2OND A;  2P58 C;  2VP7 A;  3N9Q A;  5D1L B;  4N4F A;  5DIN A;  4NQ0 A;  1MM2 A;  3GYZ A;  4ME2 A;  2LV9 A;  3FP3 A;  2F6J A;  3T6R A;  3NG2 A;  2M3H A;  4Y6C A;  4XIF A;  4YAD A;  4F52 B;  2XCB A;  2PQN A;  4G25 A;  2LGK A;  1KT0 A;  2VNF A;  4YVO A;  2G45 A;  2HR2 A;  3PE4 A;  3M99 A;  3ESK A;  4CDR A;  5G04 B;  3QWV A;  3AS5 A;  3O7A A;  3O48 A;  1FP0 A;  2FI7 A;  3GZ2 A;  3PHD A;  4R7E A;  2PNX A;  4U0Z A;  2VPD A;  4P5O B;  5B76 A;  4BTB A;  4AVX A;  4O64 A;  3T7L A;  2C2L A;  4CGW A;  4H7Y A;  2VPG A;  4L58 A;  1JM7 B;  5FT9 A;  5B79 A;  2MHK A;  2C0M A;  3BEE A;  5B8D A;  2YHO A;  5TBN A;  4FJC A;  4BHW A;  4GYY A;  3MV3 B;  2F42 A;  4XI0 A;  2QFC A;  4BT8 A;  5KJL A;  3KV6 A;  4WUY A;  1ZBP A;  3U5O A;  4ZUX U;  3MEK A;  2XGO A;  3QWW A;  2E2E A;  2XCC A;  4B86 C;  5LKT A;  2LSU A;  2KE1 A;  2LGG A;  4BT9 A;  4I7B A;  3U4T A;  2D8S A;  3EDT B;  3LY8 A;  5TDR A;  4MVT A;  5A7D B;  1WFK A;  5FTP A;  5D1K B;  1NZN A;  3O33 A;  4LAD B;  4G1T A;  4AY5 A;  4U07 A;  5AIU A;  3GV4 A;  3LY7 A;  2VPB A;  3ZGQ A;  2ECG A;  2KCV A;  2VSN A;  2XPI A;  1WEM A;  4C9Z A;  4GNG A;  3Q15 A;  1W3B A;  5LKZ A;  2FEZ A;  2JMJ A;  5C11 A;  5AIT A;  2UWJ G;  3KD7 A;  2BUG A;  5HI7 A;  2HO1 A;  2G43 A;  3RPG B;  1Z2Q A;  3UUX A;  2CT2 A;  3EB5 A;  3MV2 B;  3SOU A;  3HYM B;  2YT5 A;  4GND A;  4XI1 A;  4CGV A;  2Y43 A;  5JG6 A;  4YBT A;  1HH8 A;  1MM3 A;  2LDR A;  4BWR A;  3O70 A;  3L1Z B;  3ZVY A;  2BAY A;  4QF2 A;  4UP0 A;  3DQV R;  4N3W A;  4U0S A;  2YUC A;  2KWO A;  2YHN A;  4I7C A;  4QF3 A;  4YAB A;  3QOU A;  2MIQ A;  2WQH A;  3E4B A;  5G05 C;  2Y4U A;  4G26 A;  2YSM A;  5G05 J;  3CVL A;  3CK9 A;  3SOX A;  2YQ8 A;  4GCN A;  2YQL A;  2OXQ C;  2L80 A;  1E96 B;  4GA0 A;  3TG5 A;  3ZPV E;  4IC2 A;  4JA7 A;  1HYI A;  3M62 A;  5DBK A;  5H1V A;  3Q49 B;  4S3O B;  2F6N A;  1A17 A;  2FSA A;  5B75 A;  2KGI A;  1WEW A;  4N2Q A;  3VK6 A;  2XB1 A;  4UQY A;  2VGX A;  2LXH C;  4YAT A;  2ECN A;  3S7F A;  2JRJ A;  4GZ6 A;  5AYW D;  4GA1 A;  5BW8 C;  2L0B A;  2FF4 A;  3R9A B;  4UI9 J;  2ZET C;  2LGL A;  1X4I A;  2KIZ A;  1IYM A;  3CVP A;  1Y8M A;  3MHS A;  3N9L A;  2ECV A;  4NN2 A;  2HDP A;  2VYI A;  3RTR B;  5G04 J;  1QZ2 A;  4AM9 A;  4N3A A;  5JJ7 A;  5A6C A;  2IDA A;  4A49 A;  2VGX B;  1ELR A;  2KC7 A;  2MUM A;  2XEV A;  2E6S A;  2RI7 A;  4WNG A;  3N9O A;  5LKU A;  4B7Y C;  5FER A;  2Y1N A;  4N39 A;  4WA6 A;  3WXX A;  4RG6 A;  3ZN3 A;  3ZFW A;  4I2W A;  1ZBD B;  3N9P A;  4CA1 A;  3CVQ A;  5ARF A;  3RKV A;  2YQM A;  2WPV A;  4YVQ C;  5EX0 A;  4J8F A;  2LN0 A;  4I9C A;  4FO9 A;  3O35 A;  3NF1 A;  1WIM A;  2PL2 A;  3U5P A;  1HYJ A;  4I17 A;  5C13 A;  2CSY A;  4FIP A;  2VSY A;  2Y1M A;  5G0F A;  5B77 A;  2IFU A;  1U6G B;  2MNY A;  5I3L A;  4AY6 A;  3ZPJ A;  1HZ4 A;  3N71 A;  5TRB A;  3ASF A;  5M72 A;  1KT1 A;  3U3W A;  2RSD A;  1KLX A;  1WAO 1;  2YW8 A;  2H0D B;  3OXL A;  2E6R A;  4N5C A;  4LK9 A;  3MHH A;  2V5F A;  3O34 A;  5B78 A;  2UY1 B;  4WND A;  4U04 A;  3IHP A;  5TAB A;  4G23 A;  1TJC A;  4GYO A;  4HOT A;  2R5S A;  2OOE A;  3TAX A;  5LCW J;  2XGM A;  2VQ2 A;  2VJE A;  5KH3 A;  3QDN A;  4GB0 A;  4AYC B;  3AS8 A;  3Q4A B;  3CK8 A;  4AP4 A;  1BOR A;  2YU4 A;  2XEU A;  1NA0 A;  2FO7 A;  3S7D A;  4N2S A;  3LKU A;  2KR4 A;  3CKB A;  2MA5 A;  1WEQ A;  3ZPV 1;  3KS2 A;  3URZ A;  4ABN A;  5LCW C;  4V3L C;  2K4D A;  2JMD A;  2LRI C;  2YUR A;  4BTA A;  3LQJ A;  1LDK C;  4BBQ A;  4J0U A;  4I9E A;  2PUY A;  1PC2 A;  5CHE E;  3SZ7 A;  5FB1 A;  3FWV A;  3LCA A;  3N9N A;  3O36 A;  5FZQ A;  4APO A;  4G24 A;  3FFL A;  5KJM A;  1ZU2 A;  3TGO A;  2EOD A;  1WGM A;  2KAT A;  3RIB A;  2LNI A;  4GNE A;  1JOC A;  2Q7F A;  2KU3 A;  3I2D A;  2MNZ A;  4R2Y A;  4AIF A;  3KAE A;  2C0L A;  1WES A;  2C2V S;  2L5U A;  3VTY A;  2K17 A;  2AN6 A;  2LSV A;  3UPV A;  3LPZ A;  2FUI A;  4ZQL A;  4UI9 B;  3OXF A;  4UI9 K;  4GA2 A;  4NRH B;  1JM7 A;  3KV5 A;  3S7B A;  3UQ3 A;  2KCL A;  3VTX A;  5C1D A;  1WEU A;  3ZVZ B;  3CV0 A;  3RU0 A;  2VJF A;  3FL2 A;  4A4B A;  2QJ0 A;  3PDN A;  2DBA A;  4HOS A;  4J8E A;  1WM5 A;  3L11 A;  4UP5 A;  5FEY A;  4MSX A;  5CCL A;  5DKA A;  4V3K C;  2ECJ A;  4GZ3 A;  4L7X A;  4IC3 A;  2L75 A;  4U0U A;  3RO2 A;  3CK7 A;  4UI9 C;  2KFT A;  2HYE D;  4RG9 A;  2UZG A;  2VJF B;  1VYX A;  4HOQ A;  2IF4 A;  2LGV A;  5KJN A;  3PUQ A;  3RJV A;  1Z6U A;  5D0O D;  5J3X A;  1XNF A;  4TKP B;  4W4U A;  4Y6W A;  3HCT A;  5H9M A;  2M6M A;  4YND A;  4FK5 A;  2AVP A;  1X4U A;  3L1X A;  2EA6 A;  3SOW A;  4YBM A;  4G2V A;  5BNW A;  3O37 A;  2G6Q A;  3JYS A;  4Q6F A;  4AYC A;  3ASG A;  5ARG A;  2DX8 A;  3N9M A;  4N3C A;  4YBS A;  3Q5M A;  4B94 A;  4PPE A;  2KWN A;  3RPG C;  1WEV A;  2MD7 B;  3HTK C;  4JHR A;  2L43 A;  2GW1 A;  2H0D A;  4WNE A;  3QZV A;  5LCW B;  1F62 A;  5D0Q D;  1HXI A;  5TDW A;  4JA9 A;  3SF4 A;  1DVP A;  5G04 C;  3LQH A;  2UY1 A;  2YRE A;  4A4C A;  3CVN A;  4WNF A;  1WEP A;  4KXK B;  3CKC A;  5G05 B;  3GW4 A;  4I2Z A;  2ECI A;  1X4J A;  4I1A A;  5BT1 A;  2L6J A;  2M85 A;  2VJE B;  3ASL A;  5D1M B;  3S7J A;  2KYU A;  1IHG A;  4ZDT A;  5JJT A;  3ZYQ A;  1N87 A;  1K2F A;  2YYR A;  5H1U A;  5KH7 A;  4LEU A;  2PZI A;  5KH9 A;  5DIZ A;  3LYA A;  4WZ2 A;  3LQI A;  5HQ8 A;  4A1S A;  2KRE A;  2KCK A;  2FUU A;  4J8D A;  4LJN A;  2VGY A;  2LQ6 A;  3ZTG A;  3RO3 A;  1LDJ B;  4IN3 B;  3TG4 A;  1V87 A;  2Y4T A;  4N3B A;  2PQR A;  5LKX A;  2EGP A;  5H1T A;  4I7D A;  4F3V A;  1WEO A;  2I50 A;  4GYW A;  4AUQ B;  2YHC A;  4GNF A;  4UQX A;  2MA6 A;  3ULQ A;  5JJ6 A;  1WEN A;  1WE9 A;  2KGG A;  5EX3 A;  2YSJ A;  3HCS A;  2KWK A;  1P5Q A;  1CHC A;  2NAA A;  2JLB A;  3ASH A;  2ECW A;  3EB6 A;  3C6W A;  3LY9 A;  2K16 A;  3ASD A;  3Q47 B;  5EKQ D;  4H7X A;  4GZ5 A;  5FZS A;  3KNV A;  2LXP C;  1OUV A;  5CCM A;  4S3O C;  3ZHE A;  4A0C D;  4EQF A;  4W9R A;  4YC9 A;  4UQZ A;  1B89 A;  3PE3 A;  3K9I A;  3MKR A;  3OXG A;  4HOU A;  3GL6 A;  4JL0 A;  1T1H A;  3U5N A;  3V43 A;  2I6H A;  3QWP A; 
#chains in the Genus database with same CATH topology
 4GMJ A;  1FBV A;  3EUV A;  1PAQ A;  2M1R A;  3SHB A;  4GTP A;  2CKL A;  2OVF A;  5H7P A;  1UG3 A;  5SVY A;  4A1G A;  1E90 A;  3PZ3 A;  1MYO A;  2ILR A;  4R8P K;  2MD8 C;  2CSV A;  1ELW A;  5AQ9 A;  3KQI A;  3E32 A;  2GRP B;  3SY2 A;  2A5U A;  2ECT A;  3DPL R;  2WXJ A;  2CKL B;  3I5P A;  4LLB A;  2GRR B;  1TN8 A;  4KBQ A;  5B1A E;  2A5E A;  4GPK A;  3HRA A;  3PUR A;  2XGS A;  4Z68 A;  1IYG A;  3KEA A;  2OND A;  3N9Q A;  4N4F A;  1MX6 A;  4ZHB A;  3GYZ A;  2LV9 A;  3FP3 A;  2F6J A;  4RQI A;  4DUI A;  3UT4 A;  4YAD A;  3D3M A;  3UTM A;  2WXI A;  5CMY A;  4HRM B;  3OAW A;  1D8E A;  4YVO A;  3PE4 A;  3M99 A;  3CIA A;  3UM0 A;  3O48 A;  2FI7 A;  1TNZ A;  3ASO E;  4LG6 A;  4U0Z A;  2PNX A;  2VPD A;  4P5O B;  2C2L A;  4CGW A;  4H7Y A;  3FAO A;  2X6K A;  5B8D A;  2YHO A;  1SW6 A;  4I43 A;  4BHW A;  5T3R A;  3MV3 B;  3QNK A;  3U5O A;  3T9K A;  2E2E A;  2XCC A;  2QY7 A;  5LKT A;  3CVW A;  1DCE A;  1FT2 A;  4MVT A;  5A7D B;  1WFK A;  1NZN A;  4U63 A;  3PUK A;  4LAD B;  4G1T A;  4AY5 A;  5T4Y A;  2GRO B;  2B0O E;  2OVB A;  2VSN A;  1WEM A;  2IOL A;  4C9Z A;  4G8L A;  3CSF A;  4B0Z A;  2JMJ A;  5C11 A;  4FU3 A;  3PRZ A;  3IHY A;  2AXZ A;  2X3M A;  3EJN A;  4DX5 D;  1FPP A;  2BTD A;  2E0I A;  2YT5 A;  4XI1 A;  4GTM A;  3EHQ A;  3PH0 C;  1NFI E;  2LDR A;  4EBA A;  3L1Z B;  3DQV R;  4U0S A;  3BQO A;  5A23 A;  2RG8 A;  3C3O A;  4YAB A;  1EPU A;  2MIQ A;  1Z6T A;  2Y4U A;  2KZT B;  4BER A;  3NQP A;  5G05 J;  3DDT A;  2YQ8 A;  3HXD A;  5ENQ D;  3H7H A;  5CED B;  4EZJ A;  1E96 B;  3LJ3 A;  5EYP F;  4EBA G;  4JA7 A;  4U8V D;  3QJZ A;  2F6N A;  2H6I A;  3T5X A;  4UWF A;  1YMP A;  3VK6 A;  4JEH A;  2XB1 A;  3O47 A;  4L7T A;  3AU4 A;  4YAT A;  2ECN A;  5G2N A;  2WXO A;  4C9B B;  4GA1 A;  3R9A B;  2LGL A;  1N52 A;  1IYM A;  3J5P A;  3MHS A;  4LNB A;  4A3V A;  2HDP A;  2LO6 A;  2JEK A;  1HS6 A;  5CBN A;  5KCM A;  1OCR E;  2FD4 A;  5BXO A;  2WXH A;  2KKX A;  5LKU A;  2RFM A;  4N39 A;  3SHF A;  4RG6 A;  3CLJ A;  1ZBD B;  4I2W A;  5CER B;  3N9P A;  5ARF A;  3L22 A;  5EX0 A;  4FO9 A;  4JVS A;  4KVO A;  3NB2 A;  2WQ6 A;  5E76 A;  5G55 A;  4FAD A;  1HYJ A;  2WXQ A;  4OVU A;  2PM6 A;  5CRV A;  5G0F A;  4J8S A;  4GTT A;  3TWV A;  1QBQ A;  3RRN B;  3BG0 B;  2B6C A;  3Q7A A;  4L2Y A;  4U04 A;  3RRU A;  5JA4 D;  1NP7 A;  4G23 A;  1TJC A;  2R5S A;  3QB2 A;  2LUH A;  2P9I G;  4I6E A;  2VJE A;  4ATG A;  3Q4A B;  4O1P A;  3L9T A;  3AG4 E;  4DPR A;  2I1K A;  2XEU A;  1NA0 A;  2FO7 A;  4O1O A;  3LKU A;  3ZYK A;  3I4R B;  3KS2 A;  3MKQ B;  4ABN A;  1LDK C;  4OGC A;  1PC2 A;  3E33 A;  2ZIR A;  3N9N A;  4KT6 B;  2DYS E;  3ONL A;  2KU3 A;  3B7B A;  4AP2 A;  2L5U A;  2V8S E;  4YDO A;  2K17 A;  3TL5 A;  3OXF A;  1TN6 A;  5B1B E;  4GA2 A;  1JM7 A;  2WM9 A;  1D8D A;  2OWA A;  3B7T A;  5C1D A;  3FUH A;  2JAB A;  4N5Q A;  3CV0 A;  3DEO A;  3RU0 A;  2VJF A;  3D9N A;  5FQ7 A;  1YYH A;  2AXU A;  2M13 A;  2ETA A;  4QQI A;  4DRX E;  3U66 A;  4MSX A;  3FUL A;  4L7X A;  3LDZ A;  1E8Z A;  5IY5 E;  5J90 A;  3RO2 A;  2KFT A;  4QQ4 A;  2XZD G;  2VJF B;  2WB2 A;  1D9S A;  3KEZ A;  4Q94 A;  2LGV A;  2R02 A;  5KJN A;  3PUQ A;  4PH4 B;  4LSZ E;  4P29 A;  4L9P A;  4CDM A;  1XNF A;  4TKP B;  5H9M A;  5AQA A;  4UWH A;  2M6M A;  2X6H A;  3PEV B;  4RSY A;  2LAI A;  4G2V A;  5BNW A;  3JYS A;  4AYC A;  3ASG A;  4KZ0 A;  4MS6 A;  5ENN A;  4GTS A;  1WY6 A;  1WEV A;  4JHK A;  1JWF A;  2GW1 A;  2H0D A;  3QZV A;  5D0Q D;  4Z0R A;  4JA9 A;  3UKR G;  4K5A B;  3FU5 A;  2UY1 A;  4BSX A;  2YRE A;  3KSQ A;  1WEP A;  5G05 B;  4TXR A;  3GW4 A;  4I2Z A;  1UW4 B;  3T5V A;  5EYL A;  3FU3 A;  3MYV A;  5BT1 A;  3FH7 A;  4KZC A;  5CEC B;  1LF8 A;  2KYU A;  5JJT A;  1N87 A;  1K2F A;  5KH7 A;  4LEU A;  2YIN A;  1LD7 A;  4JHJ A;  3ZUV B;  1ZB1 A;  3LYA A;  5HQ8 A;  2AJA A;  4TXQ A;  3ZTG A;  3RO3 A;  4IN3 B;  3TG4 A;  1V87 A;  4N3B A;  5LOZ A;  5H1T A;  5ANL A;  4I7D A;  2I50 A;  4CEM A;  1TNB A;  3SFZ A;  2WXP A;  3AG1 E;  2WXL A;  3CVU A;  2IOS A;  2YSJ A;  3HCS A;  2QC9 A;  2KWK A;  2DZO A;  2JLB A;  3ASH A;  3LY9 A;  1TN7 A;  2XEH A;  5EKQ D;  3CVY A;  3FEY A;  4GZ5 A;  5FZS A;  4IRU A;  2ZGG A;  4S3O C;  3ZHE A;  3P2B A;  3SGH A;  4W9R A;  4YC9 A;  1B89 A;  5BV0 A;  2CON A;  3ENE A;  4EZL A;  1T1H A;  2I6H A;  1O1R A;  4O6F A;  1AWC B;  4HOR A;  3C5K A;  3AU5 A;  1HFA A;  3ESL A;  3LRQ A;  3LVQ E;  5AQ7 A;  1N4Q A;  4C0E A;  3UKU G;  2KZT A;  3AS4 A;  3MA5 A;  5BV1 A;  1Z3Y A;  4UWK A;  3ZHE B;  1VD4 A;  4KYO B;  4JEU A;  2XOC A;  4GTQ A;  1G25 A;  2NXP A;  3E30 A;  3ZNG A;  3L08 A;  2MT5 A;  3FTZ A;  3HHM A;  3R9M A;  4DLQ A;  3QKY A;  3CR3 A;  2J9Q A;  4GTR A;  2VPE A;  5FZR A;  4XI9 A;  3APD A;  4WZ0 A;  1YA0 A;  4YAX A;  2K1J A;  2KWJ A;  4TUU A;  3ABK E;  2P58 C;  3D9O A;  3FTV A;  3V79 K;  2V4L A;  4ME2 A;  4FP7 A;  3APF A;  4NIK A;  3FY4 A;  2LGK A;  3NAW A;  1MX4 A;  3CHQ A;  3ESK A;  2J09 A;  2XS8 A;  1MBM A;  2E61 A;  5B3S E;  4GMR A;  4AV7 A;  1FP0 A;  3GZ2 A;  3B7U X;  3AAA C;  4BTB A;  4AVX A;  4M7C A;  2ETC A;  2X6F A;  5B79 A;  2MHK A;  1H2T C;  2C0M A;  3HXE A;  3IKO B;  1K1B A;  2X6I A;  3C3R A;  4PS7 A;  3SI5 A;  4LNG A;  2DYR E;  4XI0 A;  3SNX A;  2QFC A;  5FQ4 A;  5KJL A;  3KV6 A;  3G2V A;  1ZBP A;  4ZUX U;  2KKY A;  1TR4 A;  1E8W A;  3ULE G;  1U3D A;  3U4T A;  5AEN A;  5TDR A;  2XQ0 A;  5FTP A;  2P9K G;  5D1K B;  1HU3 A;  3O33 A;  2DVW A;  3LY7 A;  2VPB A;  3ZGQ A;  2XPI A;  4GNG A;  1W3B A;  1MHQ A;  3D9I A;  3PS6 A;  5AIT A;  3R7R A;  1IQR A;  2CHX A;  4PUC A;  4I1O B;  4HRN A;  3V2O A;  3KD7 A;  3R7Q A;  3RPG B;  1Z2Q A;  2EXU A;  1GW6 A;  1KZP A;  1V55 E;  3DXK G;  4GND A;  4J7W A;  2Y43 A;  1MM3 A;  3AG2 E;  1UN8 A;  2EIN E;  3ZXS A;  4UP0 A;  2ION A;  4JW1 A;  1O1S A;  2KWO A;  3PUJ A;  2WQH A;  3HG0 D;  3CVL A;  3CK9 A;  3D9L A;  3JXJ A;  3ZYM A;  3DSX A;  4GCN A;  2D8U A;  1K1A A;  4GA0 A;  3ZPV E;  4MLP A;  4B89 A;  4FUL A;  5DBK A;  1E8X A;  3PNT B;  3Q49 B;  3SO8 A;  3OTN A;  4KMO A;  2KGI A;  3TWQ A;  4MKT A;  3UT8 A;  3VLF A;  3DXM G;  1H0A A;  1JWG A;  2VGX A;  3S7F A;  4B93 B;  3ZW3 A;  3L13 A;  5AYW D;  2WVI A;  1H2V C;  5LFA A;  3N9L A;  2XRZ A;  2CRR A;  3RK6 A;  2ECV A;  3FTY A;  1S70 B;  5G04 J;  4AM9 A;  2GRL A;  4NAC A;  5JJ7 A;  2VGX B;  5D2M C;  2KC7 A;  2MUM A;  2RI7 A;  1H19 A;  4AOF A;  3WXX A;  3ZFW A;  3PVL A;  3E37 A;  3IXE A;  4A63 B;  4J8F A;  4JPS A;  4HVB A;  2I2O A;  1FVH A;  1Q2Z A;  4ILG A;  3HVE B;  4I17 A;  3UM1 A;  4FIP A;  2IFU A;  2JUN A;  3ASF A;  4URK A;  3DST A;  1JUQ A;  3U3W A;  2RSD A;  5JMN D;  1IHB A;  2H0D B;  4N5C A;  3ZVV A;  1RW2 A;  2UY1 B;  3AJI A;  3HVE A;  4GYO A;  4KVM A;  2OOE A;  1EF1 C;  5LCW J;  2XGM A;  5EDS A;  2XS1 A;  3DSW A;  3Q7F A;  4GU5 A;  3V30 A;  5ANR A;  4AP4 A;  3FU6 A;  4HNA D;  1TNU A;  4XKC A;  2YU4 A;  4N2S A;  4HI8 A;  2KR4 A;  2MA5 A;  2ZU6 B;  1WEQ A;  3T8K A;  3MX3 A;  4V3L C;  2LRI C;  2YUR A;  3LQJ A;  4BBQ A;  3NBN B;  4I9E A;  5LP0 A;  3BUA A;  4OGE A;  3QAQ A;  4J6I A;  4MRU A;  5CHE E;  3EIJ A;  1N4P A;  3O36 A;  2OV8 A;  4G24 A;  3LJU X;  1ZU2 A;  4GNE A;  3EU5 A;  4IUL A;  4AIF A;  2C0L A;  4K5B A;  2C2V S;  3L82 A;  3VTY A;  4DLO A;  3G2S A;  3O4Z A;  2L7P A;  2AN6 A;  1N11 A;  1NL4 A;  3W9G A;  3LXU X;  4DI4 A;  4NRH B;  3ULY A;  4F1P A;  4DJA A;  3I3N A;  2J08 A;  3UQ3 A;  1FVF A;  1WDY A;  2MKE A;  4E85 A;  4A4B A;  2QJ0 A;  3PDN A;  2BF0 X;  3CST A;  2EIM E;  3PZ4 A;  3NOC D;  3FEX A;  3Q78 A;  3HDX A;  1QYM A;  2YNQ A;  2ECJ A;  2AW6 A;  3C5R A;  2VJ8 A;  1Z3X A;  4BX9 A;  3MDB C;  2OEW A;  1OWM A;  2WXK A;  2CRW A;  4F6R D;  1O5M A;  4H9D A;  4RG9 A;  4C48 B;  1O1T A;  4EHM A;  1VDY A;  1JCQ A;  3AG3 E;  4U96 D;  1VYX A;  3SUB A;  2P9P G;  3RJV A;  1Z6U A;  5D0O D;  3TWR A;  3L17 A;  4R7L A;  3ABM E;  4L23 A;  3DWD A;  3QK0 A;  4YND A;  3SOW A;  2EA6 A;  3MJW A;  3UM2 A;  3TWX A;  4GML A;  5ARG A;  3FTU A;  4YBS A;  2HE0 A;  1A5E A;  2MD7 B;  3HTK C;  4JHR A;  1TEZ A;  5LCW B;  1F62 A;  5ENO D;  2GRQ B;  5TDW A;  2XRY A;  5G04 C;  3RRM B;  4CCA A;  3JCK C;  4A4C A;  3CVN A;  3DSS A;  1X5B A;  4RVB A;  2ECI A;  1X4J A;  2M85 A;  3HXB A;  3ASL A;  5D1M B;  3S7J A;  3L16 A;  3ZYQ A;  4JD2 G;  1FT1 A;  2YYR A;  5KH9 A;  5DIZ A;  3UX4 A;  2KRE A;  2KCK A;  2VGY A;  2LQ6 A;  3ZRH A;  2EGP A;  3TWW A;  4F3V A;  1MZC A;  4GNF A;  2KGG A;  5EX3 A;  3EB6 A;  1CHC A;  2ECW A;  3C6W A;  4EZK A;  2K16 A;  3ASD A;  5ENT D;  1QNF A;  2Y0B G;  1HX8 A;  4D10 C;  4H7X A;  4U95 D;  2LXP C;  3FJU B;  3HXF A;  3TWS A;  1E8Y A;  4EQF A;  3OXG A;  3GL6 A;  2F8X K;  3GZS A;  4K0R A;  3U5N A;  4EEC A;  2DWZ A;  3QWP A;  3C72 A;  2KXP C;  1FCH A;  3DSU A;  2CG2 A;  2ZIS A;  2Y1L E;  3C3Q A;  2FBN A;  4V3I A;  3G2T A;  1E4U A;  1UJJ A;  4X3G A;  1V54 E;  4XEI G;  2CSZ A;  3E2D A;  2JMI A;  4TXP A;  4DX1 A;  3FUN A;  3JUI A;  4CCG X;  2RR4 A;  2HYZ A;  3EHM A;  3QC1 A;  1QQE A;  4YDY A;  3ZNI A;  2FFW A;  3NOG D;  2XOZ A;  1OCZ E;  3CQC B;  1RMD A;  4HB5 A;  5D66 A;  1Z60 A;  1WIL A;  3CGH A;  4I1M A;  2L9B A;  5FB0 A;  4GCO A;  3CEQ A;  3D9K A;  4WWO A;  4G11 A;  2VP7 A;  4AXH A;  2WXR A;  3UIO C;  4LNU D;  2Y3A A;  4NQ0 A;  5KBA A;  5DIN A;  4ANU A;  5SVX A;  3T8M A;  3B7S A;  4ILH B;  2M3H A;  4Y6C A;  4XIF A;  4F52 B;  2XCB A;  2P9S G;  4BEP A;  4CT4 A;  3UIN C;  4ANW A;  1U3C A;  1KT0 A;  4GTV A;  2XOY A;  2G45 A;  3U64 A;  4CDR A;  4Q69 A;  5G04 B;  2V4H C;  3QWV A;  3AS5 A;  3Q9U C;  5HS0 A;  3VLE A;  3FTX A;  4FJZ A;  3PRE A;  2VPG A;  1JM7 B;  5FT9 A;  2NSZ A;  3UIP C;  5TBN A;  4J8Y A;  4HXI A;  4GYY A;  5KNH D;  3PNL B;  2F42 A;  4TUM A;  4BT8 A;  3FH8 A;  3ML8 A;  1OWO A;  3FEH A;  3EU9 A;  5AQB A;  3QWW A;  5AJD A;  4HBD A;  2LSU A;  3BU8 A;  2KE1 A;  4BT9 A;  2LGG A;  4I7B A;  5HKP A;  2D8S A;  3EDT B;  3LY8 A;  2VSO E;  2J4D A;  1G3N B;  3LDY A;  1BPO A;  1SA4 A;  5AIU A;  2ECG A;  4ACL A;  3FDH A;  3Q15 A;  3RAU A;  2FEZ A;  3CQG B;  4Q96 A;  3PZ2 A;  4M3O A;  5JHB A;  2G43 A;  4XE0 A;  2CT2 A;  3EB5 A;  3SOU A;  3HYM B;  4PDX A;  3X2Q E;  4YBT A;  1HH8 A;  1N95 A;  3O70 A;  3ZVY A;  4QF2 A;  4C0M A;  3UM3 A;  2YUC A;  5ENP D;  4I7C A;  5G05 C;  4G26 A;  2F37 A;  2YSM A;  2IQC A;  5ENR D;  5FIO A;  4ANV A;  3LVR E;  3TXN A;  1HYI A;  3DBS A;  3TWU A;  5H1V A;  4S3O B;  1A17 A;  2F8Y A;  2R05 A;  1OWL A;  5BPP A;  2V5Q C;  2L0I A;  5EIB E;  2IO3 C;  5CMW A;  4UQY A;  5EID A;  2LXH C;  1N0Q A;  2FUL A;  4GZ6 A;  4CDN A;  5KWD A;  4BSZ B;  4UI9 J;  1S0P A;  2KIZ A;  2L6B A;  1Y8M A;  3LJN A;  4DX6 D;  2X6J A;  1MJ0 A;  3FH5 A;  4NN2 A;  2VYI A;  4O62 A;  3RTR B;  1HE8 A;  4HLE A;  4N3A A;  5A6C A;  2IDA A;  4A49 A;  2XEV A;  2E6S A;  3TJP A;  3N9O A;  2R03 A;  3IHV A;  2P9N G;  1H6O A;  4WA6 A;  1BD8 A;  3NZS A;  3PEU B;  4CA1 A;  3CVQ A;  2XPZ A;  2RD0 A;  3RKV A;  3SFX A;  2YQM A;  3DPY A;  2Y69 E;  4YVQ C;  2LN0 A;  4I9C A;  3NF1 A;  1WIM A;  4PS8 A;  2PL2 A;  1N0R A;  3UMV A;  2CSY A;  1H2U A;  2LXL A;  4FHK A;  2LXM A;  5I3L A;  3CHR A;  5TRB A;  5M72 A;  2EIK E;  2A4Z A;  2AXV A;  3FHE A;  2V5F A;  3O34 A;  4WND A;  1Z5S C;  1SQM A;  3QAR A;  3TAX A;  1NI1 A;  2H6H A;  2XEN A;  5ITZ F;  1H6P A;  3QDN A;  4GB0 A;  4AYC B;  2JM3 A;  4TRQ A;  3ONK A;  3S7D A;  4ACK A;  4Z0O A;  4DK5 A;  4GPM A;  3ZPV 1;  3MGB A;  3URZ A;  4E6H A;  2JMD A;  3ML9 A;  2VTB B;  4BTA A;  4J0U A;  3MZL B;  3D9H A;  1JCR A;  5FB1 A;  3SZ7 A;  4WWN A;  3CHP A;  3FWV A;  4U8H A;  3FUF A;  4APO A;  3UI2 A;  3FFL A;  3J5Q B;  5KJM A;  2EOD A;  2LNI A;  1UN9 A;  3V31 A;  1JOC A;  3I2D A;  2MNZ A;  2IU1 A;  5BUZ A;  2DCP A;  4FJY A;  1WES A;  2VTB A;  5K3Q A;  2LSV A;  3UPV A;  2BKK B;  3LPZ A;  4ZQL A;  1TYQ G;  2KCL A;  3WG7 E;  4GTO A;  4BET A;  3FL2 A;  1K3Z D;  3B95 A;  3NZU A;  1N54 A;  2J8S D;  4NUR A;  3FU0 A;  3L11 A;  2WXG A;  1BLX B;  3B13 A;  5DKA A;  3FAN A;  3Q1D A;  4UWG A;  4IC3 A;  2L75 A;  2ZGD A;  3JQ0 A;  4U0U A;  3CK7 A;  4UI9 C;  3ZU7 B;  4A55 A;  2HYE D;  4APF A;  2UZG A;  5FIN A;  2OCC E;  2IF4 A;  1XGW A;  4I6G A;  5J3X A;  2QYJ A;  3HCT A;  1ELK A;  4FK5 A;  1IKN D;  2KBX A;  1X4U A;  2YHE A;  2G6Q A;  4Q6F A;  3SBT B;  3N9M A;  2DX8 A;  4N3C A;  2FO1 E;  4B94 A;  3FTW A;  2EGM A;  5HRY A;  2KWN A;  5CEA A;  2I1J A;  4WNE A;  4DX7 D;  1HXI A;  3ZIM A;  3ZKJ A;  3MKQ A;  4ZFH A;  3G2U A;  1SZA A;  4WNF A;  1HG2 A;  3CKC A;  2WXM A;  3JQ1 A;  4LUN U;  5ENS D;  4I1A A;  3F6Q A;  1IHG A;  2XPY A;  5H1U A;  1KZO A;  3S2A A;  2XHE A;  2J4B A;  1OY3 D;  4JXT A;  2ETB A;  1H6K A;  4LRZ A;  3DPD A;  3G2W A;  4LJN A;  3FUM A;  1LDJ B;  2Y4T A;  5LKX A;  2PQR A;  3BG1 B;  2LAU A;  4UQX A;  2MA6 A;  1WE9 A;  4BY6 A;  2NYJ A;  1P5Q A;  2NAA A;  3CHS A;  3CVX A;  3M7K A;  4XX5 A;  2DIW A;  4UQZ A;  5AAO A;  2PM7 A;  3SQV A;  1S63 A;  5EN5 D;  4OAU C;  4XKB A;  2QIC A;  4I6J A;  3VLD A;  4LCT A;  1YCS B;  1OCO E;  4LKA A;  4YDW A;  3HCU A;  2NC9 A;  3IEG A;  3APC A;  3Q9N C;  1JPL A;  1VFY A;  4K03 A;  1X81 A;  2QIZ A;  2LAH A;  1L5J A;  5KJK A;  5LX8 A;  3GZ1 A;  3RSE G;  3U5M A;  4PTB A;  3JUE A;  1OWN A;  5FJY A;  5FWQ A;  3M63 A;  4B8A A;  5EYA F;  1SA5 A;  4XZ4 A;  1WEE A;  1AP7 A;  1NA3 A;  4TV3 A;  3Q75 A;  1XWH A;  1MX2 A;  3CHO A;  4WZ3 B;  2GRN B;  2DSM A;  3FM8 C;  3EHN A;  2XP0 A;  3TWT A;  3U9W A;  5D1L B;  4WWP A;  4DI3 A;  1IQU A;  4AEZ C;  2X38 A;  2F0Y A;  1MM2 A;  2EIL E;  3ZYL A;  3T6R A;  3NG2 A;  3FTS A;  4GZD A;  3FUJ A;  2PQN A;  4G25 A;  2VNF A;  3LEW A;  4FA6 A;  2HR2 A;  2H6G A;  2EQX A;  2VGE A;  3CHM A;  3O7A A;  3PHD A;  4R7E A;  5B76 A;  4O64 A;  3T7L A;  3PZ1 A;  4BES A;  4L58 A;  2KM4 A;  2R17 C;  3BEE A;  4FJC A;  1EYH A;  2L0T B;  2P57 A;  3B7R L;  3ZEF A;  1SZ9 A;  3UXG A;  1OCC E;  1LD8 A;  2RFA A;  4WUY A;  1N94 A;  3MEK A;  2J07 A;  2XGO A;  4B86 C;  1WG0 A;  2RKK A;  1OWP A;  5SVI B;  1Y6I A;  4YDE A;  1MQS A;  4U07 A;  3GV4 A;  5CBO A;  2KCV A;  1PY1 A;  3Q73 A;  5LKZ A;  4CT0 A;  2UWJ G;  2BUG A;  5HI7 A;  2HO1 A;  3MCX A;  3UUX A;  2QYU A;  2R59 A;  3MV2 B;  5CRU A;  2WXF A;  1BU9 A;  4CGV A;  5JG6 A;  3DWL G;  3CVV A;  3Q79 A;  4X8Q A;  4BWR A;  2P9U G;  3FUE A;  4FHJ A;  2BAY A;  4CYM D;  4N3W A;  2YHN A;  4QF3 A;  4HLL A;  3QOU A;  3E4B A;  3FUD A;  3SOX A;  2IQJ A;  2V0P A;  2YQL A;  4IYP A;  2OXQ C;  2L80 A;  4U7E B;  3TG5 A;  4IC2 A;  3M62 A;  2P2C P;  2OEV A;  2FSA A;  5B75 A;  2IO2 C;  2XZT G;  1WEW A;  4N2Q A;  1TJF A;  3D9P A;  1DNP A;  2PNN A;  2JRJ A;  2L0B A;  5BW8 C;  2FF4 A;  4OYS A;  4L2L A;  2ZET C;  1X4I A;  3HIZ A;  3CVP A;  4JB8 P;  1QZ2 A;  4HRL A;  1ELR A;  3TXM A;  4WNG A;  4B7Y C;  2R2L A;  5FER A;  2Y1N A;  2CG3 A;  3ZN3 A;  2MRI A;  4QFV A;  1UOH A;  2WPV A;  1BI7 B;  3O35 A;  5BXU A;  4O60 A;  4RLY A;  1UJK A;  3U5P A;  1E7U A;  5C13 A;  3SBS A;  2VSY A;  2Y1M A;  5B77 A;  4MBG A;  1U6G B;  2MNY A;  3L6A A;  4AY6 A;  4A3T A;  3ZPJ A;  1HZ4 A;  3N71 A;  1DCQ A;  1KT1 A;  1KLX A;  1WAO 1;  3FUI A;  2YW8 A;  2WMO A;  4UWL A;  3OXL A;  2E6R A;  4LK9 A;  3MHH A;  2QZA A;  4FLB A;  5B78 A;  4L1B A;  3D9J A;  2WQ7 A;  3IHP A;  1JCS A;  5TAB A;  4HOT A;  4ATZ D;  1KPS B;  2VQ2 A;  5KH3 A;  3AS8 A;  2IY0 C;  1INZ A;  3CK8 A;  1BOR A;  4ILI A;  5FQ8 A;  2CHZ A;  3CKB A;  4U8Y D;  5LCW C;  4HFG A;  2K4D A;  1IXV A;  4K5C A;  3DSV A;  5JHA A;  4LER A;  4ANX A;  3SFY A;  3HXC A;  2PUY A;  3IBE A;  2EIJ E;  3LCA A;  3ABL E;  5FZQ A;  2MOW A;  2I9C A;  3TGO A;  3KSL A;  1WGM A;  2KAT A;  3RIB A;  3L54 A;  4F7A A;  2Q7F A;  4R2Y A;  2WMN A;  3KAE A;  4EPZ A;  1TNO A;  5C2Y A;  4WAF A;  1TNY A;  3V2X A;  5AN8 A;  1N9A A;  2FUI A;  1S64 A;  2MYO A;  4UI9 B;  4UI9 K;  5AAR A;  2DJA A;  3KV5 A;  5AJL A;  4UUC A;  3S7B A;  3VTX A;  1WEU A;  3ZVZ B;  2BKG A;  3E34 A;  4FLH A;  1K8K G;  2DBA A;  4HOS A;  4J8E A;  1WM5 A;  3D9M A;  4GZC A;  4PS3 A;  4HS2 A;  4UP5 A;  5FEY A;  3KDE C;  5CCL A;  4V3K C;  2M63 A;  4GZ3 A;  2AWI A;  2IJG X;  4BFR A;  4B8C B;  3PLW A;  4HQD A;  4HOQ A;  5E75 A;  3P1U A;  1U2V G;  1OXJ A;  2H6F A;  2WXN A;  4F1S A;  4W4U A;  4Y6W A;  3DRA A;  4OAV B;  2CHW A;  2AVP A;  1HG5 A;  3L1X A;  4YBM A;  4FC8 A;  3O37 A;  4JC8 A;  3FUK A;  3ASN E;  2CFU A;  3JXI A;  3Q5M A;  4PPE A;  2J49 A;  3RPG C;  1N4R A;  4HI9 A;  2L43 A;  2GGF A;  3ISM C;  2CFZ A;  3SD5 A;  4OVV A;  1RZ4 A;  1E7V A;  2P9L G;  3EHR A;  1DVP A;  2HM8 A;  3SF4 A;  3LQH A;  3DEP A;  1EDU A;  4KXK B;  1HF8 A;  1OT8 A;  4BX8 A;  2VJE B;  2L6J A;  4AJW A;  4DX2 A;  4ZDT A;  3ZXP A;  4GB9 A;  2PZI A;  1LTX A;  5EIL A;  2ZXW E;  5J08 A;  4GAA A;  4WZ2 A;  2VSX E;  3LQI A;  4A1S A;  1N4S A;  2FUU A;  4CZ2 D;  4J8D A;  1SVX A;  3C98 A;  3LS8 A;  1DC2 A;  2YVR A;  2GRM A;  4F53 A;  1WEO A;  4GYW A;  5SVI A;  4AUQ B;  2YHC A;  3IV0 A;  3ULQ A;  5JJ6 A;  1WEN A;  2DZN A;  5AIJ A;  4CRW A;  3UT7 A;  3Q47 B;  4G8K A;  2BED A;  3PZD A;  3KNV A;  2IEJ A;  3W9F A;  3EIQ C;  1OUV A;  5CCM A;  1HO8 A;  3I4G A;  4A0C D;  3PE3 A;  4HOU A;  3K9I A;  3MKR A;  5KNG A;  4JL0 A;  5FQ6 A;  3V43 A;  5T8I A;  4JZY A;  1BI8 B;  2XEE A; 
#chains in the Genus database with same CATH homology
 4GMJ A;  4XKB A;  1FBV A;  1X4J A;  4I6J A;  4O6F A;  2QIC A;  1PAQ A;  3VLD A;  4HOR A;  2M1R A;  3SHB A;  4LCT A;  3AU5 A;  3C5K A;  1HFA A;  1FCH A;  2OVF A;  2CKL A;  3ESL A;  4LKA A;  2CG2 A;  3LRQ A;  3LVQ E;  1UG3 A;  4A1G A;  4C0E A;  3HCU A;  4V3I A;  2FBN A;  2NC9 A;  2KZT A;  3G2T A;  3AS4 A;  1E4U A;  3MA5 A;  5BV1 A;  1E90 A;  1Z3Y A;  1UJJ A;  3IEG A;  3APC A;  4UWK A;  3ZHE B;  1VD4 A;  3EB6 A;  4X3G A;  2CSZ A;  1JPL A;  4KYO B;  4JEU A;  2JMI A;  2ILR A;  4R8P K;  1VFY A;  2MD8 C;  3FUN A;  3PHD A;  1G25 A;  1ELW A;  4K03 A;  3KQI A;  2QIZ A;  2LAH A;  3JUI A;  1L5J A;  2NXP A;  5KJK A;  5LX8 A;  4CCG X;  3GZ1 A;  3U5M A;  4PTB A;  1OWN A;  2A5U A;  2ECT A;  2HYZ A;  5FJY A;  3EHM A;  3QC1 A;  3L08 A;  2MT5 A;  1QQE A;  2WXJ A;  3DPL R;  3FTZ A;  2CKL B;  3I5P A;  5FWQ A;  4LLB A;  3M63 A;  3ZNI A;  3HHM A;  4DLQ A;  4B8A A;  3QKY A;  3CR3 A;  5EYA F;  2J9Q A;  4KBQ A;  2VPE A;  3CQC B;  4XZ4 A;  4GPK A;  5FZR A;  1RMD A;  4XI9 A;  1NA3 A;  1WEE A;  4TV3 A;  1Z60 A;  1XWH A;  1WIL A;  3APD A;  3CGH A;  4I1M A;  4WZ0 A;  3CHO A;  1YA0 A;  4WZ3 B;  2L9B A;  3PUR A;  4YAX A;  5FB0 A;  2XGS A;  2K1J A;  4GCO A;  1IYG A;  3CEQ A;  2KWJ A;  3D9K A;  4TUU A;  3EHN A;  4WWO A;  2OND A;  2P58 C;  4G11 A;  3U9W A;  4AXH A;  2VP7 A;  3N9Q A;  4N4F A;  5D1L B;  4WWP A;  2WXR A;  4DI3 A;  3D9O A;  1IQU A;  3FTV A;  4AEZ C;  2X38 A;  5DIN A;  2Y3A A;  4NQ0 A;  1MM2 A;  2V4L A;  4ANU A;  3GYZ A;  4ME2 A;  3T8M A;  3FP3 A;  3B7S A;  4FP7 A;  3APF A;  2F6J A;  2LV9 A;  4ILH B;  3UT4 A;  3ZYL A;  3NG2 A;  2M3H A;  3T6R A;  4Y6C A;  4XIF A;  4YAD A;  3D3M A;  2XCB A;  4F52 B;  3FTS A;  4GZD A;  3FUJ A;  2PQN A;  2WXI A;  4CT4 A;  5CMY A;  4G25 A;  3FY4 A;  2LGK A;  4ANW A;  1U3C A;  1KT0 A;  2VNF A;  3OAW A;  4YVO A;  3LEW A;  2G45 A;  4FA6 A;  3CHQ A;  2HR2 A;  3U64 A;  3PE4 A;  3M99 A;  3CIA A;  3ESK A;  4CDR A;  2J09 A;  4Q69 A;  5G04 B;  3QWV A;  3AS5 A;  2EQX A;  3CHM A;  4AV7 A;  3O48 A;  1FP0 A;  2FI7 A;  3GZ2 A;  3VLE A;  3FTX A;  3O7A A;  2PNX A;  4U0Z A;  2VPD A;  4P5O B;  5B76 A;  3B7U X;  4BTB A;  4AVX A;  4FJZ A;  4O64 A;  3T7L A;  3PRE A;  2C2L A;  4CGW A;  2X6F A;  4H7Y A;  2VPG A;  4L58 A;  4AYC A;  1JM7 B;  5FT9 A;  5B79 A;  2MHK A;  2NSZ A;  2KM4 A;  1H2T C;  2C0M A;  2R17 C;  2X6K A;  3BEE A;  5B8D A;  3IKO B;  2YHO A;  2X6I A;  5TBN A;  4FJC A;  4I43 A;  4BHW A;  1EYH A;  4PS7 A;  4HXI A;  2L0T B;  3SI5 A;  4GYY A;  5T3R A;  3MV3 B;  3PNL B;  4XI0 A;  2F42 A;  3B7R L;  2QFC A;  3SNX A;  1SZ9 A;  3ZEF A;  4BT8 A;  5FQ4 A;  5KJL A;  3KV6 A;  3FH8 A;  3G2V A;  3ML8 A;  4WUY A;  1ZBP A;  1OWO A;  3QNK A;  3U5O A;  3MEK A;  2XGO A;  2J07 A;  3QWW A;  2E2E A;  5AJD A;  4ZUX U;  1E8W A;  2XCC A;  4B86 C;  2QY7 A;  2LSU A;  2KE1 A;  2LGG A;  1U3D A;  4BT9 A;  3U4T A;  3CVW A;  2D8S A;  4I7B A;  3EDT B;  3LY8 A;  5AEN A;  4MVT A;  2VSO E;  5TDR A;  2J4D A;  5A7D B;  1OWP A;  2XQ0 A;  1WFK A;  5FTP A;  5D1K B;  1NZN A;  4U63 A;  3PUK A;  1HU3 A;  1BPO A;  3O33 A;  1Y6I A;  4G1T A;  1MQS A;  4AY5 A;  4U07 A;  5T4Y A;  4LAD B;  3GV4 A;  3LY7 A;  5AIU A;  2OVB A;  2VPB A;  3ZGQ A;  2ECG A;  2VSN A;  2KCV A;  1PY1 A;  2XPI A;  4ACL A;  2IOL A;  3FDH A;  1WEM A;  4C9Z A;  4GNG A;  3Q15 A;  1W3B A;  5LKZ A;  3CSF A;  4B0Z A;  1MHQ A;  2FEZ A;  3D9I A;  4CT0 A;  3CQG B;  3PS6 A;  4FU3 A;  3PRZ A;  4Q96 A;  3R7R A;  2JMJ A;  3IHY A;  1IQR A;  2AXZ A;  2CHX A;  4M3O A;  4PUC A;  4I1O B;  2X3M A;  5JHB A;  2UWJ G;  3KD7 A;  2BUG A;  5HI7 A;  3EJN A;  2HO1 A;  3MCX A;  3R7Q A;  2G43 A;  1Z2Q A;  3RPG B;  4XE0 A;  3UUX A;  2CT2 A;  1GW6 A;  2BTD A;  2R59 A;  3MV2 B;  3EB5 A;  3SOU A;  2E0I A;  3HYM B;  2YT5 A;  4GND A;  2WXF A;  4PDX A;  3ZN3 A;  4XI1 A;  5C11 A;  4CGV A;  2Y43 A;  3CVV A;  5JG6 A;  4YBT A;  4R7E A;  1HH8 A;  3PH0 C;  1MM3 A;  2LDR A;  4BWR A;  4EBA A;  1UN8 A;  3L1Z B;  3FUE A;  4FHJ A;  3ZXS A;  2BAY A;  3O70 A;  3ZVY A;  4QF2 A;  4UP0 A;  4C0M A;  3DQV R;  4N3W A;  4U0S A;  2YUC A;  2ION A;  4JW1 A;  5A23 A;  2RG8 A;  2KWO A;  2YHN A;  4I7C A;  4QF3 A;  4YAB A;  1EPU A;  3QOU A;  3PUJ A;  2WQH A;  1Z6T A;  3E4B A;  5G05 C;  2Y4U A;  4G26 A;  2MIQ A;  2KZT B;  2YSM A;  3NQP A;  5G05 J;  3CVL A;  3CK9 A;  3D9L A;  3FUD A;  3SOX A;  2YQ8 A;  2IQC A;  3ZYM A;  4GCN A;  2V0P A;  2YQL A;  4IYP A;  4ANV A;  2OXQ C;  2L80 A;  4EZJ A;  1E96 B;  4GA0 A;  3LJ3 A;  3TG5 A;  4EBA G;  3ZPV E;  4MLP A;  4IC2 A;  3LVR E;  3TXN A;  4JA7 A;  4B89 A;  1HYI A;  4FUL A;  3DBS A;  3M62 A;  5DBK A;  1E8X A;  3PNT B;  3Q49 B;  4S3O B;  3QJZ A;  5H1V A;  2F6N A;  1A17 A;  3T5X A;  3OTN A;  4KMO A;  2FSA A;  2KGI A;  5B75 A;  1OWL A;  4UWF A;  5BPP A;  4MKT A;  4N2Q A;  3UT8 A;  1TJF A;  2L0I A;  1WEW A;  4JEH A;  2XB1 A;  3VLF A;  3VK6 A;  4L7T A;  1H0A A;  3D9P A;  3AU4 A;  1JWG A;  4UQY A;  5CMW A;  2VGX A;  2LXH C;  4YAT A;  2ECN A;  1DNP A;  3S7F A;  2FUL A;  5G2N A;  3ZW3 A;  3L13 A;  2JRJ A;  2WXO A;  4GZ6 A;  5AYW D;  4C9B B;  4GA1 A;  5BW8 C;  4CDN A;  2L0B A;  2FF4 A;  2WVI A;  1H2V C;  4OYS A;  3R9A B;  4UI9 J;  1S0P A;  4L2L A;  2LGL A;  2ZET C;  1X4I A;  3HIZ A;  2KIZ A;  1N52 A;  1IYM A;  3CVP A;  1Y8M A;  5LFA A;  3MHS A;  3N9L A;  2XRZ A;  3RK6 A;  2ECV A;  2X6J A;  3FH5 A;  3FTY A;  4NN2 A;  4A3V A;  2HDP A;  2VYI A;  2LO6 A;  2JEK A;  3RTR B;  5G04 J;  1HS6 A;  1QZ2 A;  1HE8 A;  4HLE A;  4AM9 A;  2GRL A;  4NAC A;  4N3A A;  5KCM A;  5JJ7 A;  5A6C A;  2IDA A;  4A49 A;  2VGX B;  1ELR A;  2KC7 A;  3TXM A;  2XEV A;  2MUM A;  2WXH A;  2E6S A;  2RI7 A;  3TJP A;  4WNG A;  3N9O A;  5LKU A;  4B7Y C;  3IHV A;  5FER A;  2Y1N A;  4N39 A;  4WA6 A;  1H19 A;  3NZS A;  2CG3 A;  3SHF A;  4RG6 A;  3WXX A;  4AOF A;  3CLJ A;  3PEU B;  4I2W A;  3PVL A;  2MRI A;  4QFV A;  3ZFW A;  3CVQ A;  2XPZ A;  2RD0 A;  3L22 A;  5ARF A;  3RKV A;  4CA1 A;  2YQM A;  2WPV A;  4YVQ C;  5EX0 A;  4J8F A;  2LN0 A;  4I9C A;  4FO9 A;  4JVS A;  4KVO A;  4JPS A;  4HVB A;  2I2O A;  1FVH A;  3O35 A;  3NF1 A;  1WIM A;  2WQ6 A;  4ILG A;  5E76 A;  4PS8 A;  5G55 A;  2PL2 A;  1UJK A;  3HVE B;  1E7U A;  4FAD A;  3U5P A;  1HYJ A;  4I17 A;  5C13 A;  3UMV A;  2WXQ A;  2CSY A;  3SBS A;  4FIP A;  2VSY A;  1H2U A;  2PM6 A;  4OVU A;  2Y1M A;  5G0F A;  5B77 A;  2IFU A;  1U6G B;  4J8S A;  4FHK A;  2MNY A;  3L6A A;  5I3L A;  4AY6 A;  4A3T A;  3CHR A;  1HZ4 A;  3ZPJ A;  3N71 A;  5TRB A;  3ASF A;  4URK A;  1JUQ A;  5M72 A;  1KT1 A;  3U3W A;  2RSD A;  2A4Z A;  1KLX A;  1WAO 1;  3FUI A;  3RRN B;  2H0D B;  2YW8 A;  2WMO A;  3BG0 B;  3OXL A;  4UWL A;  4N5C A;  2E6R A;  4LK9 A;  2AXV A;  3MHH A;  3FHE A;  3ZVV A;  4FLB A;  2V5F A;  4L2Y A;  3O34 A;  5B78 A;  4L1B A;  2UY1 B;  4WND A;  3D9J A;  4U04 A;  3RRU A;  2WQ7 A;  3IHP A;  5TAB A;  1NP7 A;  3HVE A;  4G23 A;  1TJC A;  1SQM A;  4GYO A;  4HOT A;  4KVM A;  2R5S A;  3QB2 A;  2OOE A;  3QAR A;  3TAX A;  1EF1 C;  5LCW J;  2XGM A;  2VQ2 A;  4I6E A;  2VJE A;  4ATG A;  5KH3 A;  3QDN A;  4GB0 A;  4AYC B;  3AS8 A;  3Q4A B;  5EDS A;  1ZBD B;  4DPR A;  1INZ A;  4GU5 A;  3CK8 A;  4AP4 A;  5ANR A;  3FU6 A;  4TRQ A;  4XKC A;  1BOR A;  2YU4 A;  2I1K A;  2XEU A;  4ILI A;  1NA0 A;  3ONK A;  2FO7 A;  3S7D A;  4N2S A;  5FQ8 A;  4ACK A;  3LKU A;  3ZYK A;  2KR4 A;  2CHZ A;  3CKB A;  2ZU6 B;  2MA5 A;  1WEQ A;  3I4R B;  4DK5 A;  3MX3 A;  3ZPV 1;  3KS2 A;  3MGB A;  3MKQ B;  3URZ A;  4ABN A;  5LCW C;  4V3L C;  4HFG A;  4E6H A;  2JMD A;  2K4D A;  3ML9 A;  2VTB B;  4BTA A;  2LRI C;  2YUR A;  3LQJ A;  1LDK C;  4BBQ A;  5JHA A;  4J0U A;  4LER A;  4I9E A;  5LP0 A;  3MZL B;  4ANX A;  3QAQ A;  1PC2 A;  4J6I A;  3IBE A;  4MRU A;  5CHE E;  3SZ7 A;  4WWN A;  2PUY A;  3CHP A;  3EIJ A;  3FWV A;  3LCA A;  4U8H A;  3N9N A;  3O36 A;  5FZQ A;  2OV8 A;  3FUF A;  4APO A;  4G24 A;  4KT6 B;  2MOW A;  3FFL A;  2I9C A;  1ZU2 A;  5KJM A;  3TGO A;  2EOD A;  1WGM A;  2KAT A;  3RIB A;  3L54 A;  2LNI A;  1UN9 A;  4F7A A;  1JOC A;  4GNE A;  2Q7F A;  3ONL A;  4IUL A;  2KU3 A;  2MNZ A;  3I2D A;  2IU1 A;  4R2Y A;  4AP2 A;  5BUZ A;  2DCP A;  4AIF A;  4FJY A;  2WMN A;  2C0L A;  3KAE A;  4EPZ A;  1WES A;  2C2V S;  5C2Y A;  4WAF A;  2L5U A;  2V8S E;  3VTY A;  2VTB A;  2K17 A;  4DLO A;  3G2S A;  3O4Z A;  2AN6 A;  2LSV A;  3UPV A;  3LPZ A;  3TL5 A;  2FUI A;  4ZQL A;  4UI9 B;  3OXF A;  4UI9 K;  3LXU X;  4GA2 A;  4DI4 A;  4NRH B;  1JM7 A;  2WM9 A;  3KV5 A;  4DJA A;  3I3N A;  5AJL A;  2J08 A;  3S7B A;  3UQ3 A;  2KCL A;  3B7T A;  1FVF A;  3VTX A;  3FUH A;  5C1D A;  1WEU A;  3N9P A;  3ZVZ B;  4E85 A;  3CV0 A;  3RU0 A;  2VJF A;  3FL2 A;  4A4B A;  3D9N A;  2QJ0 A;  5FQ7 A;  3PDN A;  2BF0 X;  3NZU A;  1N54 A;  4FLH A;  4NUR A;  2DBA A;  4HOS A;  4J8E A;  1WM5 A;  3D9M A;  3CST A;  3FU0 A;  4GZC A;  4PS3 A;  3L11 A;  2AXU A;  4HS2 A;  3FEX A;  4UP5 A;  2WXG A;  5FEY A;  3HDX A;  3B13 A;  2YNQ A;  3U66 A;  5CCL A;  4MSX A;  4V3K C;  5DKA A;  2ECJ A;  4UWG A;  2AW6 A;  2M63 A;  4GZ3 A;  3FUL A;  2VJ8 A;  4L7X A;  3LDZ A;  1E8Z A;  5J90 A;  4IC3 A;  1Z3X A;  2AWI A;  2IJG X;  4BX9 A;  2L75 A;  4BFR A;  4B8C B;  3JQ0 A;  4U0U A;  1OWM A;  3RO2 A;  3CK7 A;  4UI9 C;  2WXK A;  2KFT A;  4A55 A;  2HYE D;  4APF A;  4RG9 A;  2UZG A;  1VDY A;  2VJF B;  2WB2 A;  1VYX A;  4HOQ A;  5E75 A;  2IF4 A;  3KEZ A;  3P1U A;  4Q94 A;  2LGV A;  5KJN A;  3PUQ A;  3RJV A;  1Z6U A;  4PH4 B;  1XGW A;  5D0O D;  4I6G A;  4P29 A;  5J3X A;  2WXN A;  4CDM A;  4F1S A;  1XNF A;  4TKP B;  4W4U A;  3L17 A;  4Y6W A;  4R7L A;  3HCT A;  5H9M A;  1ELK A;  4L23 A;  4UWH A;  2M6M A;  2CHW A;  2X6H A;  3QK0 A;  4YND A;  4FK5 A;  3PEV B;  2AVP A;  4RSY A;  1HG5 A;  2YHE A;  1X4U A;  2EA6 A;  3L1X A;  3SOW A;  4YBM A;  2LAI A;  4G2V A;  5BNW A;  3MJW A;  4FC8 A;  3O37 A;  2G6Q A;  3JYS A;  4JC8 A;  3FUK A;  3SBT B;  4Q6F A;  3ASG A;  2CFU A;  4GML A;  4KZ0 A;  4N3C A;  5ARG A;  2DX8 A;  4MS6 A;  5ENN A;  3N9M A;  3FTU A;  4YBS A;  3Q5M A;  4B94 A;  3FTW A;  4PPE A;  1WY6 A;  2J49 A;  2KWN A;  3RPG C;  1WEV A;  2MD7 B;  3HTK C;  4JHK A;  4JHR A;  2I1J A;  1TEZ A;  1JWF A;  2GW1 A;  2GGF A;  2H0D A;  4WNE A;  2L43 A;  3QZV A;  5LCW B;  1F62 A;  5D0Q D;  2CFZ A;  3SD5 A;  1HXI A;  4OVV A;  1E7V A;  5TDW A;  4JA9 A;  3ZIM A;  1DVP A;  2HM8 A;  2XRY A;  3FU5 A;  5G04 C;  3SF4 A;  3MKQ A;  3LQH A;  2UY1 A;  4BSX A;  3RRM B;  2YRE A;  4CCA A;  3G2U A;  3JCK C;  4A4C A;  1SZA A;  3CVN A;  4WNF A;  1WEP A;  1EDU A;  4KXK B;  1X5B A;  1HG2 A;  3CKC A;  4RVB A;  2WXM A;  5G05 B;  3GW4 A;  1HF8 A;  4I2Z A;  3JQ1 A;  2ECI A;  4BX8 A;  1UW4 B;  4LUN U;  3T5V A;  3FU3 A;  3MYV A;  4I1A A;  2L6J A;  3FH7 A;  4KZC A;  4AJW A;  5BT1 A;  2M85 A;  2VJE B;  3ASL A;  5D1M B;  1LF8 A;  3S7J A;  2KYU A;  1IHG A;  2XPY A;  3L16 A;  4ZDT A;  5JJT A;  3ZYQ A;  1N87 A;  1K2F A;  5LKT A;  2YYR A;  5H1U A;  5KH7 A;  3S2A A;  4GB9 A;  4LEU A;  2PZI A;  2YIN A;  2XHE A;  5KH9 A;  2J4B A;  4JHJ A;  5DIZ A;  3UX4 A;  5J08 A;  3LYA A;  4GAA A;  4JXT A;  4WZ2 A;  2VSX E;  3LQI A;  5HQ8 A;  4A1S A;  2KRE A;  2KCK A;  2FUU A;  1H6K A;  4LRZ A;  3DPD A;  3G2W A;  4J8D A;  4LJN A;  2VGY A;  3FUM A;  3LS8 A;  3C98 A;  3ZRH A;  3RO3 A;  1LDJ B;  4IN3 B;  2LQ6 A;  3TG4 A;  1V87 A;  2Y4T A;  3ZTG A;  4N3B A;  2PQR A;  5LOZ A;  3BG1 B;  2EGP A;  5H1T A;  5LKX A;  2GRM A;  5ANL A;  4F53 A;  4I7D A;  4F3V A;  1WEO A;  4CEM A;  2I50 A;  4GYW A;  3SFZ A;  2WXP A;  2YHC A;  3IV0 A;  4GNF A;  4UQX A;  4AUQ B;  2MA6 A;  3ULQ A;  5JJ6 A;  2WXL A;  1WEN A;  1WE9 A;  3CVU A;  2IOS A;  2KGG A;  5EX3 A;  4BY6 A;  2YSJ A;  3HCS A;  5FB1 A;  5AIJ A;  1P5Q A;  1CHC A;  2KWK A;  2JLB A;  3CHS A;  3ASH A;  4CRW A;  2ECW A;  2NAA A;  3C6W A;  4EZK A;  3LY9 A;  2K16 A;  3ASD A;  3UT7 A;  5AIT A;  3CVX A;  1QNF A;  3Q47 B;  5EKQ D;  3CVY A;  3FEY A;  1HX8 A;  3PZD A;  4H7X A;  4GZ5 A;  5FZS A;  4IRU A;  4XX5 A;  4D10 C;  3KNV A;  3EIQ C;  2LXP C;  1OUV A;  5CCM A;  4S3O C;  1HO8 A;  3I4G A;  3ZHE A;  3P2B A;  3SGH A;  4A0C D;  1E8Y A;  4EQF A;  4W9R A;  4YC9 A;  2DIW A;  4UQZ A;  1B89 A;  3PE3 A;  3K9I A;  3ENE A;  3MKR A;  3OXG A;  4HOU A;  5BV0 A;  3GL6 A;  2PM7 A;  4EZL A;  4JL0 A;  1T1H A;  3GZS A;  4K0R A;  5FQ6 A;  4EEC A;  3U5N A;  3V43 A;  5T8I A;  4JZY A;  2I6H A;  3QWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...