2C2LA

Crystal structure of the chip u-box e3 ubiquitin ligase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
281
structure length
281
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
publication title Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 87
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04564 U-box U-box domain
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18391 CHIP_TPR_N CHIP N-terminal tetratricopeptide repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2c2lA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2c2lA03
1WE9A 4UQYA 2JMJA 1BORA 3GV4A 3ASDA 5A7DB 4F3VA 3ZVYA 2WQHA 3IEGA 4N2SA 4YC9A 4JA9A 3I2DA 3PE4A 5DIZA 4UP0A 3RKVA 3RO3A 4MSXA 5AITA 1NZNA 4U07A 5D0QD 2VJFA 4JHRA 2KCKA 4APOA 3ZYQA 3QWPA 3VK6A 3O7AA 4S3OC 2C0LA 3PUQA 1HH8A 5BNWA 3MKRA 2QFCA 3ULQA 2HDPA 2KATA 2YW8A 1FBVA 3MV2B 4XIFA 2ECIA 4RG9A 5G05J 4I9EA 1ZBDB 3BEEA 4CGWA 2H0DB 2M6MA 4G26A 2F6NA 4I17A 3ZPV1 1WEEA 3HCUA 1KT1A 4U0ZA 1LDKC 3RPGC 3ZNIA 2BUGA 4BHWA 2ECWA 2LXPC 2MT5A 4FJCA 4GNDA 2I6HA 1WFKA 2VGXA 3PE3A 1WEOA 5B77A 2E2EA 5JJTA 5TRBA 2Y4UA 3GZ1A 4KXKB 3LY9A 2QJ0A 1ZU2A 5LCWC 2MD7B 4BT8A 3L11A 1TJCA 2OXQC 3CK8A 4BWRA 3CEQA 5KJMA 2VJEB 2KGGA 2L0BA 2VGYA 5H9MA 3LRQA 2KR4A 4FIPA 2KYUA 5G04B 2KU3A 2CSYA 1X4IA 3EDTB 3VTYA 3Q4AB 3CVNA 2YHNA 2HYED 2RSDA 3SOUA 1KT0A 3L1ZB 4YBMA 1B89A 2VPBA 5FJYA 3SOXA 3QKYA 2PUYA 2GW1A 4O6FA 4GPKA 3UPVA 3ASLA 4N4FA 2H0DA 2XB1A 4A4CA 3FP3A 2JMIA 3UQ3A 2XCCA 1LDJB 4H7YA 4QF3A 2HYZA 3O34A 4BTBA 3PDNA 4XI0A 3M63A 4I7BA 5C13A 1G25A 2K16A 3GYZA 1WEUA 5B78A 2MD8C 1ELWA 1XWHA 1DVPA 4YABA 3RIBA 4LJNA 2AN6A 5B8DA 1HXIA 2PQRA 4Y6CA 5EX0A 2L6JA 2MIQA 4B7YC 2CSZA 1IYMA 3GL6A 2LQ6A 3O35A 1VD4A 2G45A 3NG2A 2WPVA 3ZPJA 2LDRA 1IHGA 1WIMA 2E6RA 3OXLA 2MHKA 2PNXA 4C9ZA 2IFUA 4GNFA 3DPLR 4GB0A 5D1LB 2KCLA 2K1JA 3URZA 4WA6A 4Q6FA 2F42A 3LYAA 2ECNA 4G1TA 4A1SA 3RPGB 3ESKA 2FUUA 3U5OA 4W4UA 1X4JA 5FB0A 4Y6WA 4BT9A 4I7CA 2LXHC 4F52B 2MUMA 3T6RA 3QWVA 2DX8A 5FERA 2VQ2A 2PQNA 5KH7A 2CT2A 4GZ5A 4AP4A 3ZN3A 3DQVR 2VPGA 1WENA 3CVQA 5DINA 1WILA 1T1HA 2UY1B 3PURA 5LCWB 5FZQA 4AYCB 5HQ8A 4NN2A 4JA7A 2KC7A 4IC3A 5TDWA 2QICA 3OXGA 4U0SA 1E96B 3CVLA 4GYOA 2LGKA 2HO1A 4KYOB 2LV9A 2VPEA 1HYIA 3S7BA 5D0OD 4XI9A 2FEZA 1HYJA 4BTAA 3U5MA 2Y43A 4A49A 2FSAA 4L58A 4N5CA 5EKQD 2VSNA 4P5OB 2UWJG 1F62A 4GA1A 4B86C 5G04J 3MEKA 3HCTA 2XPIA 5ARFA 5TDRA 4XI1A 5KH3A 4GNGA 3VTXA 3EB6A 1JM7B 2XEVA 3LQHA 4UI9C 1Z6UA 3O37A 5G0FA 2VP7A 4YADA 3KQIA 5KJLA 3UUXA 1W3BA 3Q5MA 4GNEA 1IYGA 2XEUA 3U5PA 2KWKA 4UI9K 3Q47B 5ARGA 5H1TA 2HR2A 3HYMB 5FEYA 1PC2A 4LEUA 3LPZA 2XGSA 4MVTA 2Y1NA 3SZ7A 4N39A 2UY1A 3R9AB 5I3LA 5EYAF 3ZGQA 3CK7A 4UP5A 4J0UA 5H1VA 2DBAA 4G23A 2MA5A 1Y8MA 1CHCA 5C1DA 3MHSA 4R2YA 4GCNA 2I50A 3O36A 2KWNA 1Z2QA 3MHHA 5J3XA 2YSJA 1QQEA 4AY5A 4G2VA 4R7EA 2ZETC 4ZQLA 3FL2A 3Q15A 3C6WA 5KJNA 2KWJA 2RI7A 3N9OA 4CDRA 4YBSA 5C11A 2YQMA 2M3HA 4U04A 4IN3B 4WNDA 4PTBA 5HI7A 4GA2A 5FZSA 4AM9A 3ASHA 2AVPA 3TAXA 2JMDA 1JM7A 5DBKA 1WGMA 3N9NA 4A4BA 2VPDA 4I2WA 4R8PK 1WM5A 3CKCA 4JL0A 1ZBPA 4FO9A 5LCWJ 2NAAA 3MA5A 2EODA 5LKXA 2Y4TA 5M72A 4S3OB 3LKUA 2M85A 5FT9A 2L5UA 2L80A 2XCBA 2MNZA 2V5FA 4WZ2A 3CVPA 3FFLA 1ELRA 4LK9A 2ECVA 2KWOA 4WZ0A 5CCMA 2FI7A 2VJEA 3LQIA 1YA0A 5AIUA 3N9QA 3KV5A 4B94A 5FZRA 5KH9A 4HOSA 1WEQA 4AUQB 4FK5A 3OXFA 3IHPA 2IDAA 1P5QA 4AIFA 2JRJA 3SHBA 5KJKA 5G05C 2LNIA 2XGMA 2E6SA 3E4BA 3GW4A 4HOUA 1V87A 4GCOA 5A6CA 4G25A 4IC2A 3QOUA 3CV0A 4UQXA 2L43A 2VGXB 5D1MB 2ECGA 4J8FA 4WNEA 3U5NA 4I7DA 4V3LC 5D1KB 4YVOA 4J8DA 2LRIC 2LSUA 2CKLB 3LY7A 3CK9A 1Z60A 3ZFWA 3S7JA 1WEVA 5BW8C 1MM3A 1FP0A 2Y1MA 4CCGX 2YU4A 3CKBA 1WESA 3S7DA 4CGVA 4I1AA 3RJVA 2MA6A 3QWWA 5CHEE 3WXXA 4GA0A 3S7FA 2C2LA 1HZ4A 3TG4A 2YQ8A 2FO7A 2R5SA 4N3BA 4N3CA 1MM2A 2QIZA 4ZDTA 3RU0A 4ABNA 3HTKC 4HORA 4GYWA 2XGOA 1U6GB 2KFTA 3LCAA 2YUCA 2VNFA 4LADB 4L7XA 3AS8A 3FWVA 3N9LA 1WEPA 4W9RA 3RO2A 4N2QA 2LN0A 5DKAA 3M99A 4WZ3B 4PPEA 1VFYA 3U4TA 5AYWD 5EX3A 4O64A 3KAEA 4I2ZA 3KD7A 4YVQC 4GZ6A 3ZTGA 3JYSA 4YNDA 2FF4A 1NA0A 4N3AA 5B76A 2PZIA 1QZ2A 2VSYA 5JJ7A 2YT5A 3T7LA 3SF4A 1XNFA 2YREA 1VYXA 4AYCA 3V43A 4BBQA 4V3KC 5B79A 2YHOA 4WUYA 5B75A 3TGOA 4NRHB 2KREA 3O70A 2C0MA 3AS4A 2NC9A 3LY8A 2CKLA 4H7XA 3O33A 1K2FA 2YYRA 1WEMA 2ECJA 3N9MA 2LSVA 2LGLA 2KCVA 1RMDA 4YATA 3HCSA 5BT1A 2YHCA 1WEWA 2KIZA 5TBNA 1FCHA 1KLXA 4YBTA 5JG6A 5G05B 4A0CD 4HOQA 3AS5A 1A17A 4ZUXU 3ZHEB 4AY6A 5LKZA 4HOTA 3L1XA 4UI9J 3PHDA 4NQ0A 3ZPVE 3TG5A 4WNFA 1E4UA 3NF1A 4GYYA 4QF2A 2KGIA 3K9IA 2G43A 2KE1A 2IF4A 2VYIA 4AVXA 4RG6A 2UZGA 2Q7FA 2G6QA 5H1UA 4WNGA 4UQZA 3QDNA 4U0UA 2K17A 2YQLA 4LLBA 4GZ3A 4LKAA 2JLBA 2MNYA 1X4UA 2ECTA 2EA6A 2FUIA 4N3WA 1WAO1 5LKUA 3EB5A 4I9CA 3ASFA 1N87A 2L75A 3KV6A 3U3WA 3ASGA 2VJFB 4ME2A 3KNVA 3N71A 2C2VS 5CCLA 3RTRB 4EQFA 4KBQA 2YURA 4G24A 3M62A 2D8SA 5JJ6A 3KS2A 2LGGA 3N9PA 2BAYA 5TABA 5FB1A 3SOWA 1OUVA 4UI9B 2P58C 2FBNA 2K4DA 5FTPA 5G04C 2PL2A 4J8EA 2EGPA 3C5KA 3QZVA 3ZVZB 2YSMA 2M1RA 4TKPB 2J9QA 2LGVA 3MV3B 2OOEA 3ZHEA 2ONDA 1NA3A 3LQJA 3Q49B 5LKTA 4X3GA 1JOCA 3GZ2A 4CA1A 4YAXA 3O48A 2F6JA
chains in the Genus database with same CATH superfamily
3DPDA 4A3TA 4ZHBA 4J8SA 2LAIA 3EJNA 5CEDB 1NZNA 4LG6A 1IQRA 1OWOA 1MQSA 2I1JA 2VJFA 3ABLE 4JHRA 3ZYQA 4APOA 3DSSA 4E6HA 3B13A 4ZFHA 1UJJA 3O7AA 3MKRA 1X5BA 3IHYA 2KATA 2ZGGA 1U3DA 3DSTA 2ECIA 5G05J 4I9EA 5ENNA 2P9IG 2MYOA 2CONA 2V0PA 3DRAA 3MZLB 4GTQA 1QYMA 3FTSA 3LY9A 3PZ2A 1ZU2A 1HO8A 2MD7B 4K0RA 3C98A 3JXIA 3ZXPA 3HVEB 1S64A 2KGGA 2L0BA 2CSVA 5T8IA 3B7UX 2JM3A 3NAWA 3TWWA 2LXMA 4JEHA 2YINA 3VTYA 3CVNA 3UM0A 3T5XA 3FTUA 2YHNA 2P9NG 4U7EB 3SOUA 3EU5A 1KT0A 4LSZE 4XX5A 2VPBA 5FJYA 3SOXA 3QKYA 2PUYA 2GW1A 4O6FA 4A63B 4GPKA 5AJLA 4D10C 2HYZA 3O34A 3PDNA 1RW2A 3EHQA 3GYZA 2AXUA 4DX7D 5JA4D 1WEUA 2MD8C 1YYHA 4HRNA 2VTBB 1DVPA 2B6CA 1XWHA 4YABA 3CLJA 5EX0A 4L9PA 2L6JA 5FQ8A 2P9SG 3O35A 1VD4A 3I5PA 2G45A 4ATZD 4HRLA 3L9TA 5CRVA 1IHGA 2V5QC 2MHKA 3JQ0A 3FH7A 3DEPA 2KCLA 5FQ4A 2K1JA 3TXNA 4WA6A 3D9JA 1N4QA 4A1SA 2WXPA 4FJYA 2FUUA 4W4UA 4G11A 4BT9A 2DYSE 2X6HA 3QWVA 2PQNA 2CT2A 2WMOA 4AP4A 3ZN3A 2IONA 5LCWB 4AYCB 5HQ8A 4NN2A 4C9BB 4IC3A 4LUNU 2PM7A 2DZOA 4U0SA 3CVLA 2VPEA 1HYIA 3S7BA 4F53A 3PVLA 4A49A 4L58A 3L54A 2DCPA 4KZ0A 4OAVB 3FY4A 1F62A 4B86C 4DJAA 1TNYA 3LJ3A 3HG0D 1HFAA 1JM7B 3FUMA 1KZOA 1Z6UA 2KZTA 2DSMA 4YADA 1O1RA 3EU9A 3U5PA 3LDYA 2HR2A 2WQ7A 5FEYA 4N5QA 3ISMC 3LPZA 3FULA 3SZ7A 2JUNA 4FHKA 5I3LA 3CK7A 2XZTG 4JHKA 5LX8A 4MBGA 4RQIA 2YSJA 4G2VA 4R7EA 4ZQLA 1S0PA 3ONKA 1K1AA 1N0QA 3SFZA 4GA2A 2P9LG 3L17A 5FZSA 1H19A 4U8HA 3TAXA 4JC8A 3C3OA 4Q94A 2V4LA 1WM5A 1EF1C 1WDYA 5SVIA 1TYQG 2ZISA 3DBSA 1N94A 3MA5A 4GTTA 2EODA 1N4PA 3DSXA 4EZLA 3RAUA 4LK9A 4WZ0A 4HNAD 5CCMA 2EIME 2F0YA 2QYJA 5FZRA 2WXRA 1D8EA 4GB9A 4FK5A 4AV7A 2IDAA 1O1SA 1RZ4A 3V31A 4OGEA 1V87A 3ZRHA 4EBAG 1OWNA 3QOUA 1JUQA 1NFIE 3CV0A 5D1MB 2ECGA 4HI9A 2CKLB 2J49A 5BW8C 3CVWA 2AXZA 3CKBA 5J08A 4LNGA 3PS6A 4DX1A 1TNZA 3RJVA 5CHEE 4GA0A 3APDA 3Q78A 1SA4A 2FO7A 3RRMB 3LJNA 5EDSA 3RU0A 4Z68A 5CECB 4ACLA 5AAOA 3LCAA 3HRAA 2P57A 2YUCA 1MZCA 3M7KA 4L7XA 5FWQA 1WEPA 3TWRA 3RO2A 2LN0A 3UT8A 3L13A 4LNBA 3U4TA 3RSEG 3ZTGA 4GZ6A 3LS8A 3B95A 4N3AA 4HLLA 3OAWA 3T7LA 5KNGA 5ENQD 1XNFA 2KBXA 2XPZA 3V43A 1BU9A 5B79A 2XQ0A 2YHOA 2WXNA 3LY8A 1K2FA 2YYRA 3WG7E 2ECJA 1E7VA 1EYHA 2LGLA 3GZSA 1RMDA 1X81A 3HCSA 2YHCA 4BETA 3PH0C 1JCRA 4O62A 5G05B 4FLBA 4GAAA 4HOQA 4A0CD 3ZEFA 3ZHEB 1JCQA 1DCEA 4BSXA 4L7TA 2CFZA 3P1UA 4GYYA 3FUIA 4DLOA 2KGIA 3K9IA 4QF2A 2Y3AA 3CIAA 4JEUA 2VYIA 2Q7FA 2AWIA 3CHMA 4LLBA 2ETBA 2GRLA 4GZ3A 5CRUA 3ENEA 2ECTA 4C48B 2YHEA 5T4YA 3EB5A 4ME2A 3FTWA 4U96D 5JJ6A 3D3MA 3N9PA 4GTOA 5TABA 2F37A 1OT8A 4TKPB 2IQJA 2KZTB 4Q96A 4MRUA 3NZUA 5CBOA 3HXEA 5IY5E 2DZNA 4X3GA 3JCKC 3GZ2A 3MEKA 5CEAA 4ANUA 2F6JA 3KSLA 4EZKA 4Z0OA 4UQYA 4BEPA 3GV4A 3Q75A 3ZNGA 3UKUG 4N2SA 2RFAA 3MX3A 4JA9A 1BPOA 3PE4A 4YC9A 4CDNA 3CSTA 2V8SE 5CMWA 3RKVA 4MSXA 1WG0A 3CQGB 3AU4A 2KCKA 4J8YA 2C0LA 1HH8A 4FULA 2HDPA 1SVXA 3MV2B 4XIFA 5D66A 3FUNA 3BEEA 3APCA 4HS2A 1TR4A 4O1OA 3CHSA 2F6NA 3IHVA 1WEEA 1KT1A 4CT0A 5AJDA 2LXPC 4FJCA 2I6HA 4ILHB 3RRUA 5B77A 5ENOD 2QJ0A 5E75A 3SFYA 3TWUA 5LCWC 3QAQA 3W9GA 3EHRA 3BG1B 3B7BA 3PEUB 3D9NA 4BWRA 2EXUA 3D9LA 5KJMA 2DJAA 2VGYA 1H2UA 5H9MA 3LRQA 4WAFA 2NSZA 2KYUA 4GPMA 3ONLA 2HYED 2XPYA 1LTXA 3L1ZB 2LAHA 4YBMA 4XKBA 2GGFA 2AXVA 2J08A 2P9KG 3FUJA 3ASLA 3NOGD 2H0DA 2MRIA 4A4CA 1K8KG 3PUJA 3UQ3A 2XCCA 1LDJB 4QF3A 1Z3YA 1G25A 2A4ZA 2L0IA 4CYMD 4UUCA 2XS8A 1JCSA 4ILIA 1ELWA 5FQ7A 1YCSB 3LJUX 2WQ6A 3RIBA 3EIJA 3C72A 3FAOA 1OY3D 3FTYA 2QY7A 2PQRA 4DX6D 1S63A 2VGEA 2MIQA 4OVVA 4H9DA 3D9MA 3VLEA 1Y6IA 2ZGDA 4HRMB 1WIMA 4WWOA 3SI5A 5AQ7A 4C9ZA 1TN8A 4GB0A 3QARA 2A5UA 4CT4A 5D1LB 4Q6FA 3LYAA 4G1TA 5B1BE 4XKCA 4R7LA 3VLDA 4GTPA 1X4JA 5ANRA 4Y6WA 2BTDA 2KKXA 2GRQB 4EECA 2MUMA 2DX8A 1H6OA 1AWCB 3V2OA 1IHBA 4BERA 1WENA 3EHMA 5DINA 2UY1B 5FZQA 3DEOA 3OXGA 4PTBA 1E96B 1UJKA 2LGKA 1S70B 5D0OD 4XI9A 3APFA 4DLQA 1H6PA 3UT7A 4A3VA 4TXPA 3FJUB 2KKYA 4N5CA 3ZU7B 2UWJG 4CRWA 4QQ4A 3FH8A 1FPPA 5G04J 3NB2A 3HCTA 2XPIA 2WB2A 5TDRA 5KH3A 4GNGA 2OVFA 3EB6A 1H6KA 4DI3A 3FTZA 3G2VA 5KJLA 2CRWA 3Q5MA 4I6GA 4AP2A 3BG0B 1IYGA 2J4BA 1QBQA 4GZDA 3HYMB 4I43A 2CHXA 3IKOB 3FTXA 4JXTA 3R9AB 2XRYA 5EYAF 1D9SA 2DBAA 1Y8MA 2WM9A 3MHSA 4R2YA 3QB2A 4ANVA 3G2SA 5JHAA 1TNOA 3NBNB 3MYVA 4K5CA 5KJNA 3KSQA 3UM2A 4CDRA 1L5JA 2WXOA 4YBSA 4PS3A 2CHWA 5EN5D 4JD2G 3FH5A 2M3HA 1H0AA 4WNDA 4KMOA 4B0ZA 4HLEA 2JMDA 4O60A 1UN8A 2VPDA 2KM4A 4R8PK 3FUFA 3D9KA 4P29A 3J5PA 2NAAA 2F8XK 4LERA 2M85A 2I9CA 2L5UA 3MJWA 2XCBA 2MNZA 2V5FA 4WZ2A 3CVPA 1ELRA 2GRNB 2KWOA 4B89A 4NACA 3HIZA 3RK6A 3LQIA 2J07A 3IXEA 3HXFA 3UIOC 5AIUA 2CFUA 4B94A 4IYPA 3SY2A 4HOSA 2WXFA 1WEQA 4AUQB 3SNXA 3OXFA 3P2BA 1P5QA 1DNPA 2WXLA 5G05C 4YDOA 2XGMA 3GW4A 4AJWA 4GU5A 2RR4A 4RLYA 1O5MA 4GMLA 2IU1A 4WNEA 4V3LC 4G8KA 3R7RA 2L7PA 4J8DA 2LSUA 2F8YA 1HX8A 1Z60A 3S7JA 1WEVA 2YU4A 3S7DA 4RSYA 4I1AA 2L0TB 3PUKA 3QWWA 3CR3A 3WXXA 1KZPA 4FLHA 2R59A 3TG4A 2YQ8A 3V79K 2R5SA 4N3CA 1OCRE 2J4DA 2Y0BG 5CERB 3HTKC 1N54A 4GYWA 2KFTA 4LADB 1MYOA 3AS8A 2XRZA 1LD8A 3M99A 3KAEA 4I2ZA 4DPRA 3KD7A 2WXGA 3TL5A 1NA0A 4XE0A 2P9PG 2PZIA 1QZ2A 1E7UA 3UINC 3T5VA 4OGCA 3CHQA 1Z5SC 4U63A 3UX4A 1MX2A 3UIPC 1ZB1A 4DRXE 4WUYA 2EINE 5HS0A 3TGOA 2GROB 4NRHB 1HF8A 2C0MA 3ZIMA 4BFRA 2R05A 2PNNA 3ULYA 3O33A 3N9MA 3AG1E 2X6IA 2LSVA 2KCVA 4YATA 2H6GA 5TBNA 2OVBA 1U3CA 4IULA 5JG6A 3AS5A 3QC1A 3Q9UC 1OCCE 5EYLA 4AY6A 5LKZA 3L1XA 4UI9J 1SZ9A 3TG5A 4WNFA 1E4UA 2EIJE 4RVBA 4M7CA 3ZXSA 4CCAA 2XOYA 4WNGA 4UQZA 4UWGA 4G8LA 2K17A 1X4UA 3Q7FA 5BV0A 3UXGA 1WAO1 5LKUA 3ASFA 2ETAA 3U3WA 3ASGA 2VJFB 3KNVA 4XEIG 4YDYA 3RTRB 4EQFA 2RD0A 3M62A 2IEJA 3KS2A 3SFXA 3SUBA 4XZ4A 4I1MA 3G2UA 3SOWA 2XENA 3S2AA 1V55E 3FHEA 5B3SE 2XEHA 2K4DA 2EGPA 3C5KA 5BXOA 2YSMA 4C0MA 2FFWA 1VDYA 2J9QA 4EBAA 3MV3B 1FVHA 1NA3A 3LQJA 4YAXA 4JHJA 4MKTA 5T3RA 4X8QA 3D9OA 2KXPC 1WE9A 3ABKE 2X6KA 1JPLA 3V2XA 3ASDA 3Q73A 4F3VA 3ASOE 2WXJA 3CHRA 2VSXE 3SO8A 3I2DA 5DIZA 3RO3A 5AITA 4WWPA 5BV1A 5BPPA 3I3NA 4U95D 2YVRA 3VK6A 4S3OC 3PUQA 4GMRA 5BNWA 3ULQA 2OV8A 2YW8A 4J6IA 2P2CP 2XS1A 4CGWA 4G26A 4I17A 3FU3A 1GW6A 3LVQE 3HCUA 4BSZB 3PNLB 1LDKC 2MKEA 2BUGA 4C0EA 4GNDA 1WFKA 2I1KA 1WEOA 2CHZA 2E2EA 5JJTA 2Y4UA 3GZ1A 5D2MC 4KXKB 3LDZA 3CHPA 3FUHA 3E2DA 1TJCA 3PEVB 2R03A 2OXQC 1PY1A 3AAAC 1EPUA 5G04B 3EDTB 3Q4AB 4JW1A 4PH4B 2JABA 3UPVA 4TXQA 2BKKB 2XB1A 5HRYA 4JPSA 3FP3A 4FP7A 3ABME 1TEZA 4H7YA 3FANA 4BTBA 5EIBE 4I7BA 2E61A 3M63A 5C13A 3UM3A 1IKND 1N0RA 5G2NA 2WXIA 2EIKE 2A5EA 2EILE 3JXJA 4O1PA 2AN6A 1HXIA 4PS7A 1N52A 4HBDA 2CSZA 1IYMA 2LQ6A 4KZCA 3NG2A 2WPVA 2M13A 1WY6A 3ZPJA 2PNXA 1HG5A 2IFUA 4GNFA 1Z3XA 3URZA 5AQBA 2F42A 2NYJA 2ECNA 3RPGB 3JUIA 3U5OA 4GZCA 1HE8A 5AENA 3EIQC 2LXHC 5FERA 4TUMA 4L1BA 3DQVR 1OWMA 3CVQA 3CSFA 3V30A 4ACKA 1T1HA 4CA1A 3AG4E 4JA7A 2H6IA 2KC7A 4APFA 5ITZF 5TDWA 4GMJA 4GYOA 2HO1A 4KYOB 2LV9A 4HB5A 2DIWA 2FEZA 1HYJA 3MGBA 4ANWA 5A23A 2NXPA 1ELKA 4AEZC 2FSAA 3KEAA 5EKQD 2HM8A 3Q79A 4P5OB 3Q9NC 1XGWA 4LCTA 2LUHA 2R2LA 4K5AB 1SA5A 3VTXA 2XEVA 4V3IA 3C3RA 3FUKA 3KQIA 5SVIB 3BU8A 3QNKA 3X2QE 3MKQA 4GNEA 2VSOE 2XEUA 3Q47B 5ARGA 5H1TA 5ANLA 5B1AE 2XOCA 2XGSA 2Y1NA 3L16A 4EHMA 1UN9A 4J0UA 1LD7A 2OEWA 5H1VA 4G23A 2WXHA 1CHCA 4GTSA 4GCNA 2I50A 3O36A 1Z2QA 4KVMA 1E90A 1AP7A 4AY5A 5ENPD 2ZETC 4TV3A 3Q15A 3DXKG 2KWJA 4TUUA 3N9OA 3ZW3A 5C11A 2YQMA 3HXBA 3F6QA 1SZAA 5HI7A 4AM9A 3Q7AA 2AVPA 3UMVA 1JM7A 1WGMA 3N9NA 4L23A 5LP0A 4QFVA 4JL0A 1ZBPA 5LKXA 3PZ3A 5M72A 3E37A 4UWHA 4S3OB 2L80A 3FFLA 4DUIA 2ECVA 2FI7A 2VJEA 1YA0A 3N9QA 3KV5A 4ANXA 5KH9A 4HQDA 2CG2A 2R02A 3UKRG 3ZYKA 3O4ZA 1N9AA 3IHPA 1E8YA 3BQOA 1YMPA 2E6SA 3CQCB 3E4BA 4HOUA 3NQPA 2PM6A 1H2VC 4GCOA 1NL4A 4G25A 2IQCA 5AIJA 1MBMA 2L43A 4Z0RA 1BI7B 3U5NA 4I7DA 4YVOA 4WWNA 2LRIC 4CDMA 2Y1LE 5ENSD 3CK9A 3ZFWA 2QYUA 1K3ZD 1MM3A 4ATGA 2MA6A 4BY6A 4HFGA 2E0IA 3S7FA 3BUAA 2C2LA 1HZ4A 3FU5A 4N3BA 1MM2A 2QIZA 3D9PA 4ZDTA 3KEZA 2X3MA 4FU3A 3T8KA 2IO3C 4HORA 1SW6A 2XGOA 3HXDA 3SBTB 2VJ8A 5E76A 2VNFA 4K03A 3FWVA 5HKPA 3N9LA 3W9FA 4W9RA 4N2QA 3G2TA 5DKAA 2X6JA 1VFYA 5AYWD 5EX3A 2XP0A 3JYSA 4F1SA 4YNDA 2FF4A 5B76A 3CVYA 4B8CB 2VSYA 2X6FA 3QK0A 2EGMA 1BLXB 2YREA 4BBQA 4V3KC 2XOZA 4DX5D 4NURA 2KREA 4FA6A 3AS4A 3R7QA 2NC9A 2CKLA 2P9UG 5KCMA 1E8ZA 3HHMA 2L6BA 1JWGA 3J5QB 3G2WA 3EUVA 5BT1A 4YDEA 4F6RD 5AARA 2B0OE 1KLXA 2WXQA 2JEKA 4FHJA 3OTNA 4ZUXU 3ZYMA 1N95A 3TWTA 2YNQA 4HOTA 3UT4A 3ZPVE 3ML9A 4NQ0A 3PHDA 3ESLA 5BXUA 3NF1A 4CZ2D 3AG3E 4BX8A 1K1BA 4RG6A 2UZGA 3CVVA 4LKAA 2XZDG 2MNYA 3I4RB 3D9IA 1TN7A 4K5BA 4N3WA 4I9CA 1N87A 4LNUD 3KV6A 2I2OA 5CCLA 3TWSA 5K3QA 4G24A 2D8SA 3UI2A 1EDUA 2LGGA 3AG2E 3NZSA 2OCCE 1DC2A 1D8DA 4U8VD 2P58C 3CVXA 4BESA 4AOFA 5G04C 1MJ0A 3ZVZB 5KWDA 2M1RA 3SD5A 2OOEA 3L08A 3ZHEA 1QNFA 3Q49B 3FEHA 3CGHA 3PZDA 3MKQB 1JOCA 3L6AA 2VPGA 3LXUX 4A55A 4PUCA 1TNBA 2JMJA 2DYRE 1BORA 5A7DB 3ZVYA 2WQHA 3L22A 1FT2A 3IEGA 1IQUA 3O47A 4UP0A 4OYSA 4TRQA 4JVSA 4U07A 4IRUA 5D0QD 3QWPA 4LRZA 5AQAA 2QFCA 5AQ9A 1BI8B 1FBVA 4RG9A 3LVRE 1ZBDB 2RFMA 5AN8A 2H0DB 5LOZA 2M6MA 2J8SD 3ZPV1 4U0ZA 3RPGC 2Y69E 3ZNIA 4BHWA 3U66A 2ECWA 2MT5A 1OCOE 4B93B 3TWVA 4F1PA 5JHBA 2VGXA 3PE3A 2BF0X 5EIDA 5TRBA 4OAUC 1OWLA 4U8YD 4FJZA 3HDXA 5KBAA 2MOWA 4BT8A 4JZYA 3L11A 3U9WA 2IY0C 3CK8A 4FADA 3CEQA 3DXMG 2VJEB 3DSVA 2IOSA 2X38A 4CEMA 2EQXA 2KR4A 4FIPA 3JQ1A 2KU3A 2CSYA 1X4IA 2ETCA 1OCZE 3DDTA 5FIOA 2RSDA 1OXJA 3T9KA 4J7WA 1U2VG 1B89A 3E30A 2J09A 2R17C 4HXIA 5H7PA 4UWKA 4N4FA 3B7RL 1H2TC 2JMIA 2GRMA 3PRZA 4XI0A 1UW4B 3E32A 2K16A 2ILRA 1TN6A 3Q1DA 5B78A 3H7HA 4LJNA 3PLWA 5B8DA 4Y6CA 2WXKA 3CHOA 4L2LA 4B7YC 3GL6A 2ZIRA 2LDRA 2E6RA 3OXLA 4DK5A 2HE0A 1V54E 4DI4A 3DPLR 1MX4A 3AU5A 3FM8C 3ESKA 1BD8A 5CBNA 1N4RA 5FB0A 1E8WA 4I7CA 4F52B 3T6RA 5J90A 2VQ2A 4OVUA 5KH7A 4GZ5A 3E34A 1WILA 3QJZA 3PURA 3TJPA 2QICA 2H6HA 3DSWA 4BTAA 3U5MA 2Y43A 3PNTB 2WMNA 3ZKJA 1DCQA 2VSNA 3FU6A 3IBEA 4GA1A 1UOHA 2XHEA 5ARFA 5KNHD 1A5EA 2H6FA 4XI1A 3UM1A 2M63A 1HU3A 3MDBC 3U64A 2LAUA 4UI9C 5LFAA 3LQHA 3MCXA 3O37A 5G0FA 2VP7A 3B7SA 3UUXA 1W3BA 2BKGA 1O1TA 4I1OB 2GRRB 3EHNA 2KWKA 4UI9K 3JUEA 2FULA 1PC2A 4LEUA 4MVTA 2IOLA 4N39A 2UY1A 3ZYLA 1HG2A 3ZGQA 4UP5A 4B8AA 2QZAA 3T8MA 2MA5A 1OWPA 3C3QA 5C1DA 5C2YA 2KWNA 3MHHA 5J3XA 3CVUA 1MX6A 1QQEA 5SVXA 3FL2A 3C6WA 3PZ1A 2RI7A 4UWFA 4U04A 4QQIA 4IN3B 3DSUA 3ASHA 3ZVVA 5DBKA 4A4BA 2FO1E 4I2WA 4URKA 3CKCA 3R9MA 4FO9A 5LCWJ 4DX2A 2GRPB 3AJIA 2WVIA 2L9BA 2Y4TA 3UTMA 3LKUA 3TXMA 5FT9A 2DVWA 4PDXA 4FC8A 3HVEA 4UWLA 5EYPF 1TJFA 4ILGA 4EZJA 2WXMA 5FQ6A 3SGHA 2AW6A 3FEYA 4AIFA 2JRJA 3ULEG 3SHBA 5KJKA 2LNIA 1MHQA 1UG3A 5ENRD 5G55A 1FVFA 5A6CA 2AJAA 4KT6B 4IC2A 1Q2ZA 4UQXA 2VGXB 2IJGX 4J8FA 4M3OA 5D1KB 1KPSB 5JMND 3LY7A 2Y1MA 2VTBA 1FP0A 4CCGX 2XEEA 4L2YA 1WESA 4CGVA 3FUEA 3DWDA 5FINA 3FUDA 2OEVA 4AXHA 4ABNA 4I6EA 3HXCA 3SQVA 1U6GB 4NIKA 2RG8A 1LF8A 4WZ3B 5EILA 4PPEA 4O64A 4YDWA 3ZUVB 4YVQC 2ZU6B 3ASNE 3L82A 5CMYA 5JJ7A 2YT5A 3SF4A 3KDEC 1N11A 3IV0A 1VYXA 4AYCA 3FU0A 3D9HA 2V4HC 5ENTD 5B75A 2CG3A 5SVYA 3O70A 4F7AA 4JB8P 3FTVA 4H7XA 4A1GA 2BEDA 2CRRA 4HVBA 1WEMA 2IO2C 4PS8A 4GTMA 4MLPA 3DWLG 2RKKA 4EPZA 4Q69A 3PREA 1WEWA 2KIZA 1FCHA 1INZA 1SQMA 4YBTA 3ML8A 1A17A 1FT1A 2QC9A 4KVOA 4TXRA 3RRNB 1E8XA 3FDHA 2FD4A 4MS6A 3PZ4A 2G43A 2KE1A 2IF4A 3SHFA 4AVXA 2G6QA 5H1UA 3QDNA 4U0UA 2YQLA 3NOCD 3TWXA 2JLBA 2D8UA 4GTRA 1JWFA 1NP7A 2EA6A 2FUIA 3SBSA 2L75A 4I6JA 3N71A 2C2VS 3C5RA 4KBQA 2YURA 1PAQA 1G3NB 2OWAA 2BAYA 5FB1A 3TWQA 1OUVA 4UI9B 2LXLA 3LEWA 1IXVA 2FBNA 3B7TA 3FEXA 5FTPA 1NI1A 2PL2A 4J8EA 3QZVA 4HI8A 4BX9A 1Z6TA 1HS6A 3I4GA 4E85A 2LGVA 1N4SA 3DPYA 2DWZA 2ONDA 3VLFA 5LKTA 2LO6A 4GTVA 3E33A 1TNUA 5BUZA 2ZXWE 3O48A
chains in the Genus database with same CATH topology
3DPDA 4A3TA 4J8SA 2LAIA 3EJNA 1NZNA 1IQRA 1OWOA 1MQSA 2I1JA 2VJFA 4JHRA 3ZYQA 4APOA 4E6HA 3B13A 3O7AA 1UJJA 3MKRA 1X5BA 3IHYA 2KATA 1U3DA 2ECIA 5G05J 4I9EA 5ENNA 2V0PA 3MZLB 3FTSA 3LY9A 1ZU2A 1HO8A 2MD7B 4K0RA 3C98A 3HVEB 2KGGA 2L0BA 5T8IA 3B7UX 4JEHA 2YINA 3VTYA 3CVNA 3T5XA 3FTUA 2YHNA 3SOUA 1KT0A 4XX5A 2VPBA 5FJYA 3SOXA 3QKYA 2PUYA 2GW1A 4O6FA 4GPKA 5AJLA 4D10C 2HYZA 3O34A 3PDNA 3GYZA 2AXUA 1WEUA 2MD8C 2VTBB 1DVPA 1XWHA 4YABA 3CLJA 5EX0A 2L6JA 5FQ8A 3O35A 1VD4A 3I5PA 2G45A 1IHGA 2MHKA 3JQ0A 3FH7A 2KCLA 5FQ4A 2K1JA 3TXNA 4WA6A 3D9JA 4A1SA 2WXPA 4FJYA 2FUUA 4W4UA 4G11A 4BT9A 2X6HA 3QWVA 2PQNA 2CT2A 2WMOA 4AP4A 3ZN3A 2IONA 5LCWB 4AYCB 5HQ8A 4NN2A 4C9BB 4IC3A 4LUNU 2PM7A 4U0SA 3CVLA 2VPEA 1HYIA 3S7BA 4F53A 3PVLA 4A49A 4L58A 3L54A 2DCPA 4KZ0A 3FY4A 1F62A 4B86C 4DJAA 3LJ3A 1HFAA 1JM7B 3FUMA 1Z6UA 2KZTA 4YADA 3U5PA 2HR2A 2WQ7A 5FEYA 3LPZA 3FULA 3SZ7A 4FHKA 5I3LA 3CK7A 4JHKA 5LX8A 2YSJA 4G2VA 4R7EA 4ZQLA 1S0PA 3ONKA 3SFZA 4GA2A 3L17A 5FZSA 1H19A 4U8HA 3TAXA 4JC8A 4Q94A 2V4LA 1WM5A 1EF1C 3DBSA 3MA5A 2EODA 4EZLA 4LK9A 4WZ0A 5CCMA 5FZRA 2WXRA 4GB9A 4FK5A 4AV7A 2IDAA 1V87A 3ZRHA 4EBAG 1OWNA 3QOUA 1JUQA 3CV0A 5D1MB 2ECGA 2CKLB 2J49A 5BW8C 3CVWA 2AXZA 3CKBA 5J08A 3PS6A 3RJVA 5CHEE 4GA0A 3APDA 2FO7A 3RRMB 5EDSA 3RU0A 4ACLA 3LCAA 2YUCA 4L7XA 5FWQA 1WEPA 2LN0A 3RO2A 3UT8A 3L13A 3U4TA 3ZTGA 4GZ6A 3LS8A 4N3AA 3OAWA 3T7LA 1XNFA 2XPZA 3V43A 5B79A 2XQ0A 2YHOA 2WXNA 3LY8A 1K2FA 2YYRA 2ECJA 1E7VA 1EYHA 2LGLA 3GZSA 1RMDA 3HCSA 2YHCA 3PH0C 5G05B 4FLBA 4GAAA 4HOQA 4A0CD 3ZEFA 3ZHEB 4BSXA 4L7TA 2CFZA 3P1UA 4GYYA 3FUIA 4DLOA 2KGIA 3K9IA 4QF2A 2Y3AA 3CIAA 4JEUA 2VYIA 2Q7FA 2AWIA 3CHMA 4LLBA 2GRLA 4GZ3A 3ENEA 2ECTA 2YHEA 5T4YA 3EB5A 4ME2A 3FTWA 5JJ6A 3D3MA 3N9PA 5TABA 4TKPB 2KZTB 4Q96A 4MRUA 3NZUA 4X3GA 3JCKC 3GZ2A 3MEKA 2F6JA 4ANUA 4EZKA 4UQYA 3GV4A 4N2SA 4YC9A 3MX3A 4JA9A 1BPOA 3PE4A 4CDNA 3CSTA 2V8SE 5CMWA 3RKVA 4MSXA 3CQGB 3AU4A 2KCKA 2C0LA 1HH8A 4FULA 2HDPA 3MV2B 4XIFA 3FUNA 3BEEA 3APCA 4HS2A 3CHSA 2F6NA 3IHVA 1WEEA 1KT1A 4CT0A 5AJDA 2LXPC 4FJCA 2I6HA 4ILHB 3RRUA 5B77A 2QJ0A 5E75A 5LCWC 3QAQA 3BG1B 3PEUB 3D9NA 4BWRA 3D9LA 5KJMA 2VGYA 1H2UA 5H9MA 3LRQA 4WAFA 2NSZA 2KYUA 3ONLA 2HYED 2XPYA 3L1ZB 2LAHA 4YBMA 4XKBA 2GGFA 2AXVA 2J08A 3FUJA 3ASLA 2H0DA 2MRIA 4A4CA 3PUJA 3UQ3A 2XCCA 1LDJB 4QF3A 1Z3YA 1G25A 2A4ZA 2L0IA 4ILIA 1ELWA 5FQ7A 2WQ6A 3RIBA 3EIJA 3FTYA 2QY7A 2PQRA 2MIQA 4OVVA 3D9MA 3VLEA 1Y6IA 1WIMA 4WWOA 3SI5A 4C9ZA 4GB0A 3QARA 2A5UA 4CT4A 5D1LB 4Q6FA 3LYAA 4G1TA 4XKCA 4R7LA 3VLDA 1X4JA 5ANRA 4Y6WA 2BTDA 4EECA 2MUMA 2DX8A 1WENA 3EHMA 5DINA 2UY1B 5FZQA 3OXGA 4PTBA 1E96B 1UJKA 2LGKA 5D0OD 4XI9A 3APFA 4DLQA 3UT7A 4A3VA 4N5CA 2UWJG 4CRWA 3FH8A 5G04J 3HCTA 2XPIA 2WB2A 5TDRA 5KH3A 4GNGA 2OVFA 3EB6A 1H6KA 4DI3A 3FTZA 3G2VA 5KJLA 3Q5MA 4I6GA 4AP2A 3BG0B 1IYGA 2J4BA 4GZDA 3HYMB 4I43A 2CHXA 3IKOB 3FTXA 4JXTA 3R9AB 2XRYA 5EYAF 2DBAA 1Y8MA 2WM9A 3MHSA 4R2YA 3QB2A 4ANVA 3G2SA 5JHAA 3MYVA 5KJNA 4CDRA 1L5JA 2WXOA 4YBSA 4PS3A 2CHWA 2M3HA 3FH5A 1H0AA 4WNDA 4KMOA 4B0ZA 4HLEA 2JMDA 1UN8A 2VPDA 2KM4A 4R8PK 3FUFA 3D9KA 4P29A 2NAAA 4LERA 2M85A 2I9CA 2L5UA 3MJWA 2XCBA 2MNZA 2V5FA 4WZ2A 3CVPA 1ELRA 2KWOA 4B89A 4NACA 3HIZA 3RK6A 3LQIA 2J07A 5AIUA 2CFUA 4B94A 4IYPA 4HOSA 2WXFA 1WEQA 4AUQB 3SNXA 3OXFA 3P2BA 1P5QA 1DNPA 2WXLA 5G05C 2XGMA 3GW4A 4AJWA 4GU5A 4GMLA 2IU1A 4WNEA 4V3LC 3R7RA 4J8DA 2LSUA 1HX8A 1Z60A 3S7JA 1WEVA 2YU4A 3S7DA 4RSYA 4I1AA 2L0TB 3PUKA 3QWWA 3CR3A 3WXXA 4FLHA 2R59A 2YQ8A 3TG4A 2R5SA 4N3CA 2J4DA 3HTKC 1N54A 4GYWA 2KFTA 4LADB 3AS8A 2XRZA 3M99A 3KAEA 4I2ZA 4DPRA 3KD7A 2WXGA 3TL5A 1NA0A 4XE0A 2PZIA 1QZ2A 1E7UA 3T5VA 3CHQA 4U63A 3UX4A 4WUYA 3TGOA 4NRHB 1HF8A 2C0MA 3ZIMA 4BFRA 3O33A 3N9MA 2X6IA 2LSVA 2KCVA 4YATA 5TBNA 2OVBA 1U3CA 4IULA 5JG6A 3AS5A 3QC1A 4AY6A 5LKZA 3L1XA 4UI9J 1SZ9A 3TG5A 4WNFA 1E4UA 4RVBA 3ZXSA 4CCAA 4WNGA 4UQZA 4UWGA 2K17A 1X4UA 5BV0A 1WAO1 5LKUA 3ASFA 3U3WA 3ASGA 2VJFB 3KNVA 3RTRB 4EQFA 2RD0A 3M62A 3KS2A 4XZ4A 4I1MA 3G2UA 3SOWA 3S2AA 3FHEA 2K4DA 2EGPA 3C5KA 2YSMA 4C0MA 1VDYA 2J9QA 4EBAA 3MV3B 1FVHA 1NA3A 3LQJA 4JHJA 4MKTA 5T3RA 3D9OA 1WE9A 2X6KA 1JPLA 3ASDA 4F3VA 2WXJA 3CHRA 2VSXE 3I2DA 5DIZA 3RO3A 5AITA 4WWPA 5BV1A 5BPPA 3I3NA 3VK6A 4S3OC 3PUQA 5BNWA 3ULQA 2OV8A 2YW8A 4J6IA 4CGWA 4G26A 4I17A 3FU3A 1GW6A 3LVQE 3HCUA 3PNLB 1LDKC 2BUGA 4C0EA 4GNDA 1WFKA 2I1KA 1WEOA 2CHZA 2E2EA 5JJTA 2Y4UA 3GZ1A 4KXKB 3LDZA 3CHPA 3FUHA 1TJCA 3PEVB 2OXQC 1PY1A 1EPUA 5G04B 3EDTB 3Q4AB 4JW1A 4PH4B 3UPVA 2XB1A 4JPSA 3FP3A 4FP7A 1TEZA 4H7YA 4BTBA 4I7BA 3M63A 5C13A 5G2NA 2WXIA 2AN6A 1HXIA 4PS7A 1N52A 2CSZA 1IYMA 2LQ6A 4KZCA 3NG2A 2WPVA 1WY6A 3ZPJA 2PNXA 1HG5A 2IFUA 4GNFA 1Z3XA 3URZA 2F42A 2ECNA 3RPGB 3JUIA 3U5OA 4GZCA 1HE8A 5AENA 3EIQC 2LXHC 5FERA 4L1BA 3DQVR 1OWMA 3CVQA 3CSFA 4CA1A 4ACKA 1T1HA 4JA7A 2KC7A 4APFA 5TDWA 4GMJA 4GYOA 2HO1A 4KYOB 2LV9A 2DIWA 2FEZA 1HYJA 3MGBA 4ANWA 5A23A 2NXPA 1ELKA 4AEZC 2FSAA 5EKQD 2HM8A 4P5OB 1XGWA 4LCTA 3VTXA 2XEVA 4V3IA 3FUKA 3KQIA 3QNKA 3MKQA 4GNEA 2VSOE 2XEUA 3Q47B 5ARGA 5H1TA 5ANLA 2XGSA 2Y1NA 3L16A 1UN9A 4J0UA 5H1VA 4G23A 2WXHA 1CHCA 4GCNA 2I50A 3O36A 1Z2QA 4KVMA 1E90A 4AY5A 2ZETC 4TV3A 3Q15A 2KWJA 4TUUA 3N9OA 3ZW3A 5C11A 2YQMA 1SZAA 5HI7A 4AM9A 2AVPA 3UMVA 1JM7A 1WGMA 3N9NA 4L23A 5LP0A 4QFVA 4JL0A 1ZBPA 5LKXA 5M72A 4UWHA 4S3OB 2L80A 3FFLA 2ECVA 2FI7A 2VJEA 1YA0A 3N9QA 3KV5A 4ANXA 5KH9A 2CG2A 3ZYKA 3O4ZA 3IHPA 1E8YA 2E6SA 3CQCB 3E4BA 4HOUA 3NQPA 2PM6A 1H2VC 4GCOA 4G25A 2IQCA 5AIJA 2L43A 3U5NA 4I7DA 4YVOA 4WWNA 2LRIC 4CDMA 3CK9A 3ZFWA 1MM3A 4ATGA 2MA6A 4BY6A 4HFGA 2E0IA 3S7FA 2C2LA 1HZ4A 3FU5A 4N3BA 1MM2A 2QIZA 3D9PA 4ZDTA 3KEZA 2X3MA 4FU3A 4HORA 2XGOA 3SBTB 2VJ8A 5E76A 2VNFA 4K03A 3FWVA 3N9LA 4W9RA 4N2QA 3G2TA 5DKAA 2X6JA 1VFYA 5AYWD 5EX3A 3JYSA 4F1SA 4YNDA 2FF4A 5B76A 3CVYA 4B8CB 2VSYA 2X6FA 3QK0A 2YREA 4BBQA 4V3KC 4NURA 2KREA 4FA6A 3AS4A 3R7QA 2NC9A 2CKLA 5KCMA 1E8ZA 3HHMA 1JWGA 3G2WA 5BT1A 1KLXA 2WXQA 2JEKA 4FHJA 3OTNA 4ZUXU 3ZYMA 2YNQA 4HOTA 3UT4A 3ZPVE 3ML9A 4NQ0A 3PHDA 3ESLA 3NF1A 4BX8A 4RG6A 2UZGA 3CVVA 4LKAA 2MNYA 3I4RB 3D9IA 4N3WA 4I9CA 1N87A 3KV6A 2I2OA 5CCLA 4G24A 2D8SA 1EDUA 2LGGA 3NZSA 2P58C 3CVXA 4AOFA 5G04C 3ZVZB 2M1RA 3SD5A 2OOEA 3L08A 3ZHEA 1QNFA 3Q49B 3CGHA 3PZDA 3MKQB 1JOCA 3L6AA 2VPGA 3LXUX 4A55A 4PUCA 2JMJA 1BORA 5A7DB 3ZVYA 2WQHA 3L22A 3IEGA 1IQUA 4UP0A 4OYSA 4TRQA 4JVSA 4U07A 4IRUA 5D0QD 3QWPA 4LRZA 2QFCA 1FBVA 4RG9A 3LVRE 1ZBDB 2H0DB 5LOZA 2M6MA 3ZPV1 4U0ZA 3RPGC 3ZNIA 4BHWA 3U66A 2ECWA 2MT5A 5JHBA 2VGXA 3PE3A 2BF0X 5TRBA 1OWLA 4FJZA 3HDXA 2MOWA 4BT8A 4JZYA 3L11A 3U9WA 3CK8A 4FADA 3CEQA 2VJEB 2IOSA 2X38A 4CEMA 2EQXA 2KR4A 4FIPA 3JQ1A 2KU3A 2CSYA 1X4IA 2RSDA 1B89A 2J09A 2R17C 4HXIA 4UWKA 4N4FA 3B7RL 1H2TC 2JMIA 2GRMA 3PRZA 4XI0A 1UW4B 2K16A 2ILRA 5B78A 4LJNA 5B8DA 4Y6CA 2WXKA 3CHOA 4L2LA 4B7YC 3GL6A 2LDRA 2E6RA 3OXLA 4DK5A 4DI4A 3DPLR 3AU5A 3ESKA 5FB0A 1E8WA 4I7CA 4F52B 3T6RA 5J90A 2VQ2A 4OVUA 5KH7A 4GZ5A 1WILA 3QJZA 3PURA 3TJPA 2QICA 4BTAA 3U5MA 2Y43A 3PNTB 2WMNA 2VSNA 3FU6A 3IBEA 4GA1A 2XHEA 5ARFA 4XI1A 2M63A 1HU3A 3U64A 3LQHA 4UI9C 5LFAA 3MCXA 3O37A 5G0FA 2VP7A 3B7SA 3UUXA 1W3BA 4I1OB 3EHNA 2KWKA 4UI9K 2FULA 1PC2A 4LEUA 4MVTA 2IOLA 4N39A 2UY1A 3ZYLA 1HG2A 3ZGQA 4UP5A 4B8AA 3T8MA 2MA5A 1OWPA 5C1DA 5C2YA 2KWNA 3MHHA 5J3XA 3CVUA 1QQEA 3FL2A 3C6WA 2RI7A 4UWFA 4U04A 4IN3B 3ASHA 3ZVVA 5DBKA 4A4BA 4I2WA 4URKA 3CKCA 4FO9A 5LCWJ 2WVIA 2L9BA 2Y4TA 3LKUA 3TXMA 5FT9A 4PDXA 4FC8A 3HVEA 4UWLA 1TJFA 4ILGA 4EZJA 2WXMA 5FQ6A 3SGHA 2AW6A 3FEYA 4AIFA 2JRJA 3SHBA 5KJKA 2LNIA 1MHQA 1UG3A 5G55A 1FVFA 5A6CA 4KT6B 4IC2A 4UQXA 2VGXB 2IJGX 4J8FA 4M3OA 5D1KB 3LY7A 2Y1MA 2VTBA 1FP0A 4CCGX 4L2YA 1WESA 4CGVA 3FUEA 3FUDA 4ABNA 4AXHA 4I6EA 1U6GB 2RG8A 1LF8A 4WZ3B 4PPEA 4O64A 4YVQC 2ZU6B 5CMYA 5JJ7A 2YT5A 3SF4A 3IV0A 1VYXA 4AYCA 3FU0A 5B75A 2CG3A 3O70A 4F7AA 3FTVA 4H7XA 4A1GA 4HVBA 1WEMA 4PS8A 4MLPA 4EPZA 4Q69A 3PREA 1WEWA 2KIZA 1FCHA 1INZA 1SQMA 4YBTA 3ML8A 1A17A 4KVOA 3RRNB 1E8XA 3FDHA 4MS6A 2G43A 2KE1A 2IF4A 3SHFA 4AVXA 2G6QA 5H1UA 3QDNA 4U0UA 2YQLA 2JLBA 1JWFA 1NP7A 2EA6A 2FUIA 3SBSA 2L75A 4I6JA 3N71A 2C2VS 4KBQA 2YURA 1PAQA 2BAYA 5FB1A 1OUVA 4UI9B 3LEWA 2FBNA 3B7TA 3FEXA 5FTPA 2PL2A 4J8EA 3QZVA 4BX9A 1Z6TA 1HS6A 3I4GA 4E85A 2LGVA 2ONDA 3VLFA 5LKTA 2LO6A 5BUZA 4YAXA 3O48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE9 A;  4UQY A;  2JMJ A;  1BOR A;  3GV4 A;  3ASD A;  5A7D B;  4F3V A;  3ZVY A;  2WQH A;  3IEG A;  4N2S A;  4YC9 A;  4JA9 A;  3I2D A;  3PE4 A;  5DIZ A;  4UP0 A;  3RKV A;  3RO3 A;  4MSX A;  5AIT A;  1NZN A;  4U07 A;  5D0Q D;  2VJF A;  4JHR A;  2KCK A;  4APO A;  3ZYQ A;  3QWP A;  3VK6 A;  3O7A A;  4S3O C;  2C0L A;  3PUQ A;  1HH8 A;  5BNW A;  3MKR A;  2QFC A;  3ULQ A;  2HDP A;  2KAT A;  2YW8 A;  1FBV A;  3MV2 B;  4XIF A;  2ECI A;  4RG9 A;  5G05 J;  4I9E A;  1ZBD B;  3BEE A;  4CGW A;  2H0D B;  2M6M A;  4G26 A;  2F6N A;  4I17 A;  3ZPV 1;  1WEE A;  3HCU A;  1KT1 A;  4U0Z A;  1LDK C;  3RPG C;  3ZNI A;  2BUG A;  4BHW A;  2ECW A;  2LXP C;  2MT5 A;  4FJC A;  4GND A;  2I6H A;  1WFK A;  2VGX A;  3PE3 A;  1WEO A;  5B77 A;  2E2E A;  5JJT A;  5TRB A;  2Y4U A;  3GZ1 A;  4KXK B;  3LY9 A;  2QJ0 A;  1ZU2 A;  5LCW C;  2MD7 B;  4BT8 A;  3L11 A;  1TJC A;  2OXQ C;  3CK8 A;  4BWR A;  3CEQ A;  5KJM A;  2VJE B;  2KGG A;  2L0B A;  2VGY A;  5H9M A;  3LRQ A;  2KR4 A;  4FIP A;  2KYU A;  5G04 B;  2KU3 A;  2CSY A;  1X4I A;  3EDT B;  3VTY A;  3Q4A B;  3CVN A;  2YHN A;  2HYE D;  2RSD A;  3SOU A;  1KT0 A;  3L1Z B;  4YBM A;  1B89 A;  2VPB A;  5FJY A;  3SOX A;  3QKY A;  2PUY A;  2GW1 A;  4O6F A;  4GPK A;  3UPV A;  3ASL A;  4N4F A;  2H0D A;  2XB1 A;  4A4C A;  3FP3 A;  2JMI A;  3UQ3 A;  2XCC A;  1LDJ B;  4H7Y A;  4QF3 A;  2HYZ A;  3O34 A;  4BTB A;  3PDN A;  4XI0 A;  3M63 A;  4I7B A;  5C13 A;  1G25 A;  2K16 A;  3GYZ A;  1WEU A;  5B78 A;  2MD8 C;  1ELW A;  1XWH A;  1DVP A;  4YAB A;  3RIB A;  4LJN A;  2AN6 A;  5B8D A;  1HXI A;  2PQR A;  4Y6C A;  5EX0 A;  2L6J A;  2MIQ A;  4B7Y C;  2CSZ A;  1IYM A;  3GL6 A;  2LQ6 A;  3O35 A;  1VD4 A;  2G45 A;  3NG2 A;  2WPV A;  3ZPJ A;  2LDR A;  1IHG A;  1WIM A;  2E6R A;  3OXL A;  2MHK A;  2PNX A;  4C9Z A;  2IFU A;  4GNF A;  3DPL R;  4GB0 A;  5D1L B;  2KCL A;  2K1J A;  3URZ A;  4WA6 A;  4Q6F A;  2F42 A;  3LYA A;  2ECN A;  4G1T A;  4A1S A;  3RPG B;  3ESK A;  2FUU A;  3U5O A;  4W4U A;  1X4J A;  5FB0 A;  4Y6W A;  4BT9 A;  4I7C A;  2LXH C;  4F52 B;  2MUM A;  3T6R A;  3QWV A;  2DX8 A;  5FER A;  2VQ2 A;  2PQN A;  5KH7 A;  2CT2 A;  4GZ5 A;  4AP4 A;  3ZN3 A;  3DQV R;  2VPG A;  1WEN A;  3CVQ A;  5DIN A;  1WIL A;  1T1H A;  2UY1 B;  3PUR A;  5LCW B;  5FZQ A;  4AYC B;  5HQ8 A;  4NN2 A;  4JA7 A;  2KC7 A;  4IC3 A;  5TDW A;  2QIC A;  3OXG A;  4U0S A;  1E96 B;  3CVL A;  4GYO A;  2LGK A;  2HO1 A;  4KYO B;  2LV9 A;  2VPE A;  1HYI A;  3S7B A;  5D0O D;  4XI9 A;  2FEZ A;  1HYJ A;  4BTA A;  3U5M A;  2Y43 A;  4A49 A;  2FSA A;  4L58 A;  4N5C A;  5EKQ D;  2VSN A;  4P5O B;  2UWJ G;  1F62 A;  4GA1 A;  4B86 C;  5G04 J;  3MEK A;  3HCT A;  2XPI A;  5ARF A;  5TDR A;  4XI1 A;  5KH3 A;  4GNG A;  3VTX A;  3EB6 A;  1JM7 B;  2XEV A;  3LQH A;  4UI9 C;  1Z6U A;  3O37 A;  5G0F A;  2VP7 A;  4YAD A;  3KQI A;  5KJL A;  3UUX A;  1W3B A;  3Q5M A;  4GNE A;  1IYG A;  2XEU A;  3U5P A;  2KWK A;  4UI9 K;  3Q47 B;  5ARG A;  5H1T A;  2HR2 A;  3HYM B;  5FEY A;  1PC2 A;  4LEU A;  3LPZ A;  2XGS A;  4MVT A;  2Y1N A;  3SZ7 A;  4N39 A;  2UY1 A;  3R9A B;  5I3L A;  5EYA F;  3ZGQ A;  3CK7 A;  4UP5 A;  4J0U A;  5H1V A;  2DBA A;  4G23 A;  2MA5 A;  1Y8M A;  1CHC A;  5C1D A;  3MHS A;  4R2Y A;  4GCN A;  2I50 A;  3O36 A;  2KWN A;  1Z2Q A;  3MHH A;  5J3X A;  2YSJ A;  1QQE A;  4AY5 A;  4G2V A;  4R7E A;  2ZET C;  4ZQL A;  3FL2 A;  3Q15 A;  3C6W A;  5KJN A;  2KWJ A;  2RI7 A;  3N9O A;  4CDR A;  4YBS A;  5C11 A;  2YQM A;  2M3H A;  4U04 A;  4IN3 B;  4WND A;  4PTB A;  5HI7 A;  4GA2 A;  5FZS A;  4AM9 A;  3ASH A;  2AVP A;  3TAX A;  2JMD A;  1JM7 A;  5DBK A;  1WGM A;  3N9N A;  4A4B A;  2VPD A;  4I2W A;  4R8P K;  1WM5 A;  3CKC A;  4JL0 A;  1ZBP A;  4FO9 A;  5LCW J;  2NAA A;  3MA5 A;  2EOD A;  5LKX A;  2Y4T A;  5M72 A;  4S3O B;  3LKU A;  2M85 A;  5FT9 A;  2L5U A;  2L80 A;  2XCB A;  2MNZ A;  2V5F A;  4WZ2 A;  3CVP A;  3FFL A;  1ELR A;  4LK9 A;  2ECV A;  2KWO A;  4WZ0 A;  5CCM A;  2FI7 A;  2VJE A;  3LQI A;  1YA0 A;  5AIU A;  3N9Q A;  3KV5 A;  4B94 A;  5FZR A;  5KH9 A;  4HOS A;  1WEQ A;  4AUQ B;  4FK5 A;  3OXF A;  3IHP A;  2IDA A;  1P5Q A;  4AIF A;  2JRJ A;  3SHB A;  5KJK A;  5G05 C;  2LNI A;  2XGM A;  2E6S A;  3E4B A;  3GW4 A;  4HOU A;  1V87 A;  4GCO A;  5A6C A;  4G25 A;  4IC2 A;  3QOU A;  3CV0 A;  4UQX A;  2L43 A;  2VGX B;  5D1M B;  2ECG A;  4J8F A;  4WNE A;  3U5N A;  4I7D A;  4V3L C;  5D1K B;  4YVO A;  4J8D A;  2LRI C;  2LSU A;  2CKL B;  3LY7 A;  3CK9 A;  1Z60 A;  3ZFW A;  3S7J A;  1WEV A;  5BW8 C;  1MM3 A;  1FP0 A;  2Y1M A;  4CCG X;  2YU4 A;  3CKB A;  1WES A;  3S7D A;  4CGV A;  4I1A A;  3RJV A;  2MA6 A;  3QWW A;  5CHE E;  3WXX A;  4GA0 A;  3S7F A;  2C2L A;  1HZ4 A;  3TG4 A;  2YQ8 A;  2FO7 A;  2R5S A;  4N3B A;  4N3C A;  1MM2 A;  2QIZ A;  4ZDT A;  3RU0 A;  4ABN A;  3HTK C;  4HOR A;  4GYW A;  2XGO A;  1U6G B;  2KFT A;  3LCA A;  2YUC A;  2VNF A;  4LAD B;  4L7X A;  3AS8 A;  3FWV A;  3N9L A;  1WEP A;  4W9R A;  3RO2 A;  4N2Q A;  2LN0 A;  5DKA A;  3M99 A;  4WZ3 B;  4PPE A;  1VFY A;  3U4T A;  5AYW D;  5EX3 A;  4O64 A;  3KAE A;  4I2Z A;  3KD7 A;  4YVQ C;  4GZ6 A;  3ZTG A;  3JYS A;  4YND A;  2FF4 A;  1NA0 A;  4N3A A;  5B76 A;  2PZI A;  1QZ2 A;  2VSY A;  5JJ7 A;  2YT5 A;  3T7L A;  3SF4 A;  1XNF A;  2YRE A;  1VYX A;  4AYC A;  3V43 A;  4BBQ A;  4V3K C;  5B79 A;  2YHO A;  4WUY A;  5B75 A;  3TGO A;  4NRH B;  2KRE A;  3O70 A;  2C0M A;  3AS4 A;  2NC9 A;  3LY8 A;  2CKL A;  4H7X A;  3O33 A;  1K2F A;  2YYR A;  1WEM A;  2ECJ A;  3N9M A;  2LSV A;  2LGL A;  2KCV A;  1RMD A;  4YAT A;  3HCS A;  5BT1 A;  2YHC A;  1WEW A;  2KIZ A;  5TBN A;  1FCH A;  1KLX A;  4YBT A;  5JG6 A;  5G05 B;  4A0C D;  4HOQ A;  3AS5 A;  1A17 A;  4ZUX U;  3ZHE B;  4AY6 A;  5LKZ A;  4HOT A;  3L1X A;  4UI9 J;  3PHD A;  4NQ0 A;  3ZPV E;  3TG5 A;  4WNF A;  1E4U A;  3NF1 A;  4GYY A;  4QF2 A;  2KGI A;  3K9I A;  2G43 A;  2KE1 A;  2IF4 A;  2VYI A;  4AVX A;  4RG6 A;  2UZG A;  2Q7F A;  2G6Q A;  5H1U A;  4WNG A;  4UQZ A;  3QDN A;  4U0U A;  2K17 A;  2YQL A;  4LLB A;  4GZ3 A;  4LKA A;  2JLB A;  2MNY A;  1X4U A;  2ECT A;  2EA6 A;  2FUI A;  4N3W A;  1WAO 1;  5LKU A;  3EB5 A;  4I9C A;  3ASF A;  1N87 A;  2L75 A;  3KV6 A;  3U3W A;  3ASG A;  2VJF B;  4ME2 A;  3KNV A;  3N71 A;  2C2V S;  5CCL A;  3RTR B;  4EQF A;  4KBQ A;  2YUR A;  4G24 A;  3M62 A;  2D8S A;  5JJ6 A;  3KS2 A;  2LGG A;  3N9P A;  2BAY A;  5TAB A;  5FB1 A;  3SOW A;  1OUV A;  4UI9 B;  2P58 C;  2FBN A;  2K4D A;  5FTP A;  5G04 C;  2PL2 A;  4J8E A;  2EGP A;  3C5K A;  3QZV A;  3ZVZ B;  2YSM A;  2M1R A;  4TKP B;  2J9Q A;  2LGV A;  3MV3 B;  2OOE A;  3ZHE A;  2OND A;  1NA3 A;  3LQJ A;  3Q49 B;  5LKT A;  4X3G A;  1JOC A;  3GZ2 A;  4CA1 A;  4YAX A;  3O48 A;  2F6J A; 
#chains in the Genus database with same CATH topology
 3DPD A;  4A3T A;  4ZHB A;  4J8S A;  2LAI A;  3EJN A;  5CED B;  1NZN A;  4LG6 A;  1IQR A;  1OWO A;  1MQS A;  2I1J A;  2VJF A;  3ABL E;  4JHR A;  3ZYQ A;  4APO A;  3DSS A;  4E6H A;  3B13 A;  4ZFH A;  1UJJ A;  3O7A A;  3MKR A;  1X5B A;  3IHY A;  2KAT A;  2ZGG A;  1U3D A;  3DST A;  2ECI A;  5G05 J;  4I9E A;  5ENN A;  2P9I G;  2MYO A;  2CON A;  2V0P A;  3DRA A;  3MZL B;  4GTQ A;  1QYM A;  3FTS A;  3LY9 A;  3PZ2 A;  1ZU2 A;  1HO8 A;  2MD7 B;  4K0R A;  3C98 A;  3JXI A;  3ZXP A;  3HVE B;  1S64 A;  2KGG A;  2L0B A;  2CSV A;  5T8I A;  3B7U X;  2JM3 A;  3NAW A;  3TWW A;  2LXM A;  4JEH A;  2YIN A;  3VTY A;  3CVN A;  3UM0 A;  3T5X A;  3FTU A;  2YHN A;  2P9N G;  4U7E B;  3SOU A;  3EU5 A;  1KT0 A;  4LSZ E;  4XX5 A;  2VPB A;  5FJY A;  3SOX A;  3QKY A;  2PUY A;  2GW1 A;  4O6F A;  4A63 B;  4GPK A;  5AJL A;  4D10 C;  2HYZ A;  3O34 A;  3PDN A;  1RW2 A;  3EHQ A;  3GYZ A;  2AXU A;  4DX7 D;  5JA4 D;  1WEU A;  2MD8 C;  1YYH A;  4HRN A;  2VTB B;  1DVP A;  2B6C A;  1XWH A;  4YAB A;  3CLJ A;  5EX0 A;  4L9P A;  2L6J A;  5FQ8 A;  2P9S G;  3O35 A;  1VD4 A;  3I5P A;  2G45 A;  4ATZ D;  4HRL A;  3L9T A;  5CRV A;  1IHG A;  2V5Q C;  2MHK A;  3JQ0 A;  3FH7 A;  3DEP A;  2KCL A;  5FQ4 A;  2K1J A;  3TXN A;  4WA6 A;  3D9J A;  1N4Q A;  4A1S A;  2WXP A;  4FJY A;  2FUU A;  4W4U A;  4G11 A;  4BT9 A;  2DYS E;  2X6H A;  3QWV A;  2PQN A;  2CT2 A;  2WMO A;  4AP4 A;  3ZN3 A;  2ION A;  5LCW B;  4AYC B;  5HQ8 A;  4NN2 A;  4C9B B;  4IC3 A;  4LUN U;  2PM7 A;  2DZO A;  4U0S A;  3CVL A;  2VPE A;  1HYI A;  3S7B A;  4F53 A;  3PVL A;  4A49 A;  4L58 A;  3L54 A;  2DCP A;  4KZ0 A;  4OAV B;  3FY4 A;  1F62 A;  4B86 C;  4DJA A;  1TNY A;  3LJ3 A;  3HG0 D;  1HFA A;  1JM7 B;  3FUM A;  1KZO A;  1Z6U A;  2KZT A;  2DSM A;  4YAD A;  1O1R A;  3EU9 A;  3U5P A;  3LDY A;  2HR2 A;  2WQ7 A;  5FEY A;  4N5Q A;  3ISM C;  3LPZ A;  3FUL A;  3SZ7 A;  2JUN A;  4FHK A;  5I3L A;  3CK7 A;  2XZT G;  4JHK A;  5LX8 A;  4MBG A;  4RQI A;  2YSJ A;  4G2V A;  4R7E A;  4ZQL A;  1S0P A;  3ONK A;  1K1A A;  1N0Q A;  3SFZ A;  4GA2 A;  2P9L G;  3L17 A;  5FZS A;  1H19 A;  4U8H A;  3TAX A;  4JC8 A;  3C3O A;  4Q94 A;  2V4L A;  1WM5 A;  1EF1 C;  1WDY A;  5SVI A;  1TYQ G;  2ZIS A;  3DBS A;  1N94 A;  3MA5 A;  4GTT A;  2EOD A;  1N4P A;  3DSX A;  4EZL A;  3RAU A;  4LK9 A;  4WZ0 A;  4HNA D;  5CCM A;  2EIM E;  2F0Y A;  2QYJ A;  5FZR A;  2WXR A;  1D8E A;  4GB9 A;  4FK5 A;  4AV7 A;  2IDA A;  1O1S A;  1RZ4 A;  3V31 A;  4OGE A;  1V87 A;  3ZRH A;  4EBA G;  1OWN A;  3QOU A;  1JUQ A;  1NFI E;  3CV0 A;  5D1M B;  2ECG A;  4HI9 A;  2CKL B;  2J49 A;  5BW8 C;  3CVW A;  2AXZ A;  3CKB A;  5J08 A;  4LNG A;  3PS6 A;  4DX1 A;  1TNZ A;  3RJV A;  5CHE E;  4GA0 A;  3APD A;  3Q78 A;  1SA4 A;  2FO7 A;  3RRM B;  3LJN A;  5EDS A;  3RU0 A;  4Z68 A;  5CEC B;  4ACL A;  5AAO A;  3LCA A;  3HRA A;  2P57 A;  2YUC A;  1MZC A;  3M7K A;  4L7X A;  5FWQ A;  1WEP A;  3TWR A;  3RO2 A;  2LN0 A;  3UT8 A;  3L13 A;  4LNB A;  3U4T A;  3RSE G;  3ZTG A;  4GZ6 A;  3LS8 A;  3B95 A;  4N3A A;  4HLL A;  3OAW A;  3T7L A;  5KNG A;  5ENQ D;  1XNF A;  2KBX A;  2XPZ A;  3V43 A;  1BU9 A;  5B79 A;  2XQ0 A;  2YHO A;  2WXN A;  3LY8 A;  1K2F A;  2YYR A;  3WG7 E;  2ECJ A;  1E7V A;  1EYH A;  2LGL A;  3GZS A;  1RMD A;  1X81 A;  3HCS A;  2YHC A;  4BET A;  3PH0 C;  1JCR A;  4O62 A;  5G05 B;  4FLB A;  4GAA A;  4HOQ A;  4A0C D;  3ZEF A;  3ZHE B;  1JCQ A;  1DCE A;  4BSX A;  4L7T A;  2CFZ A;  3P1U A;  4GYY A;  3FUI A;  4DLO A;  2KGI A;  3K9I A;  4QF2 A;  2Y3A A;  3CIA A;  4JEU A;  2VYI A;  2Q7F A;  2AWI A;  3CHM A;  4LLB A;  2ETB A;  2GRL A;  4GZ3 A;  5CRU A;  3ENE A;  2ECT A;  4C48 B;  2YHE A;  5T4Y A;  3EB5 A;  4ME2 A;  3FTW A;  4U96 D;  5JJ6 A;  3D3M A;  3N9P A;  4GTO A;  5TAB A;  2F37 A;  1OT8 A;  4TKP B;  2IQJ A;  2KZT B;  4Q96 A;  4MRU A;  3NZU A;  5CBO A;  3HXE A;  5IY5 E;  2DZN A;  4X3G A;  3JCK C;  3GZ2 A;  3MEK A;  5CEA A;  4ANU A;  2F6J A;  3KSL A;  4EZK A;  4Z0O A;  4UQY A;  4BEP A;  3GV4 A;  3Q75 A;  3ZNG A;  3UKU G;  4N2S A;  2RFA A;  3MX3 A;  4JA9 A;  1BPO A;  3PE4 A;  4YC9 A;  4CDN A;  3CST A;  2V8S E;  5CMW A;  3RKV A;  4MSX A;  1WG0 A;  3CQG B;  3AU4 A;  2KCK A;  4J8Y A;  2C0L A;  1HH8 A;  4FUL A;  2HDP A;  1SVX A;  3MV2 B;  4XIF A;  5D66 A;  3FUN A;  3BEE A;  3APC A;  4HS2 A;  1TR4 A;  4O1O A;  3CHS A;  2F6N A;  3IHV A;  1WEE A;  1KT1 A;  4CT0 A;  5AJD A;  2LXP C;  4FJC A;  2I6H A;  4ILH B;  3RRU A;  5B77 A;  5ENO D;  2QJ0 A;  5E75 A;  3SFY A;  3TWU A;  5LCW C;  3QAQ A;  3W9G A;  3EHR A;  3BG1 B;  3B7B A;  3PEU B;  3D9N A;  4BWR A;  2EXU A;  3D9L A;  5KJM A;  2DJA A;  2VGY A;  1H2U A;  5H9M A;  3LRQ A;  4WAF A;  2NSZ A;  2KYU A;  4GPM A;  3ONL A;  2HYE D;  2XPY A;  1LTX A;  3L1Z B;  2LAH A;  4YBM A;  4XKB A;  2GGF A;  2AXV A;  2J08 A;  2P9K G;  3FUJ A;  3ASL A;  3NOG D;  2H0D A;  2MRI A;  4A4C A;  1K8K G;  3PUJ A;  3UQ3 A;  2XCC A;  1LDJ B;  4QF3 A;  1Z3Y A;  1G25 A;  2A4Z A;  2L0I A;  4CYM D;  4UUC A;  2XS8 A;  1JCS A;  4ILI A;  1ELW A;  5FQ7 A;  1YCS B;  3LJU X;  2WQ6 A;  3RIB A;  3EIJ A;  3C72 A;  3FAO A;  1OY3 D;  3FTY A;  2QY7 A;  2PQR A;  4DX6 D;  1S63 A;  2VGE A;  2MIQ A;  4OVV A;  4H9D A;  3D9M A;  3VLE A;  1Y6I A;  2ZGD A;  4HRM B;  1WIM A;  4WWO A;  3SI5 A;  5AQ7 A;  4C9Z A;  1TN8 A;  4GB0 A;  3QAR A;  2A5U A;  4CT4 A;  5D1L B;  4Q6F A;  3LYA A;  4G1T A;  5B1B E;  4XKC A;  4R7L A;  3VLD A;  4GTP A;  1X4J A;  5ANR A;  4Y6W A;  2BTD A;  2KKX A;  2GRQ B;  4EEC A;  2MUM A;  2DX8 A;  1H6O A;  1AWC B;  3V2O A;  1IHB A;  4BER A;  1WEN A;  3EHM A;  5DIN A;  2UY1 B;  5FZQ A;  3DEO A;  3OXG A;  4PTB A;  1E96 B;  1UJK A;  2LGK A;  1S70 B;  5D0O D;  4XI9 A;  3APF A;  4DLQ A;  1H6P A;  3UT7 A;  4A3V A;  4TXP A;  3FJU B;  2KKY A;  4N5C A;  3ZU7 B;  2UWJ G;  4CRW A;  4QQ4 A;  3FH8 A;  1FPP A;  5G04 J;  3NB2 A;  3HCT A;  2XPI A;  2WB2 A;  5TDR A;  5KH3 A;  4GNG A;  2OVF A;  3EB6 A;  1H6K A;  4DI3 A;  3FTZ A;  3G2V A;  5KJL A;  2CRW A;  3Q5M A;  4I6G A;  4AP2 A;  3BG0 B;  1IYG A;  2J4B A;  1QBQ A;  4GZD A;  3HYM B;  4I43 A;  2CHX A;  3IKO B;  3FTX A;  4JXT A;  3R9A B;  2XRY A;  5EYA F;  1D9S A;  2DBA A;  1Y8M A;  2WM9 A;  3MHS A;  4R2Y A;  3QB2 A;  4ANV A;  3G2S A;  5JHA A;  1TNO A;  3NBN B;  3MYV A;  4K5C A;  5KJN A;  3KSQ A;  3UM2 A;  4CDR A;  1L5J A;  2WXO A;  4YBS A;  4PS3 A;  2CHW A;  5EN5 D;  4JD2 G;  3FH5 A;  2M3H A;  1H0A A;  4WND A;  4KMO A;  4B0Z A;  4HLE A;  2JMD A;  4O60 A;  1UN8 A;  2VPD A;  2KM4 A;  4R8P K;  3FUF A;  3D9K A;  4P29 A;  3J5P A;  2NAA A;  2F8X K;  4LER A;  2M85 A;  2I9C A;  2L5U A;  3MJW A;  2XCB A;  2MNZ A;  2V5F A;  4WZ2 A;  3CVP A;  1ELR A;  2GRN B;  2KWO A;  4B89 A;  4NAC A;  3HIZ A;  3RK6 A;  3LQI A;  2J07 A;  3IXE A;  3HXF A;  3UIO C;  5AIU A;  2CFU A;  4B94 A;  4IYP A;  3SY2 A;  4HOS A;  2WXF A;  1WEQ A;  4AUQ B;  3SNX A;  3OXF A;  3P2B A;  1P5Q A;  1DNP A;  2WXL A;  5G05 C;  4YDO A;  2XGM A;  3GW4 A;  4AJW A;  4GU5 A;  2RR4 A;  4RLY A;  1O5M A;  4GML A;  2IU1 A;  4WNE A;  4V3L C;  4G8K A;  3R7R A;  2L7P A;  4J8D A;  2LSU A;  2F8Y A;  1HX8 A;  1Z60 A;  3S7J A;  1WEV A;  2YU4 A;  3S7D A;  4RSY A;  4I1A A;  2L0T B;  3PUK A;  3QWW A;  3CR3 A;  3WXX A;  1KZP A;  4FLH A;  2R59 A;  3TG4 A;  2YQ8 A;  3V79 K;  2R5S A;  4N3C A;  1OCR E;  2J4D A;  2Y0B G;  5CER B;  3HTK C;  1N54 A;  4GYW A;  2KFT A;  4LAD B;  1MYO A;  3AS8 A;  2XRZ A;  1LD8 A;  3M99 A;  3KAE A;  4I2Z A;  4DPR A;  3KD7 A;  2WXG A;  3TL5 A;  1NA0 A;  4XE0 A;  2P9P G;  2PZI A;  1QZ2 A;  1E7U A;  3UIN C;  3T5V A;  4OGC A;  3CHQ A;  1Z5S C;  4U63 A;  3UX4 A;  1MX2 A;  3UIP C;  1ZB1 A;  4DRX E;  4WUY A;  2EIN E;  5HS0 A;  3TGO A;  2GRO B;  4NRH B;  1HF8 A;  2C0M A;  3ZIM A;  4BFR A;  2R05 A;  2PNN A;  3ULY A;  3O33 A;  3N9M A;  3AG1 E;  2X6I A;  2LSV A;  2KCV A;  4YAT A;  2H6G A;  5TBN A;  2OVB A;  1U3C A;  4IUL A;  5JG6 A;  3AS5 A;  3QC1 A;  3Q9U C;  1OCC E;  5EYL A;  4AY6 A;  5LKZ A;  3L1X A;  4UI9 J;  1SZ9 A;  3TG5 A;  4WNF A;  1E4U A;  2EIJ E;  4RVB A;  4M7C A;  3ZXS A;  4CCA A;  2XOY A;  4WNG A;  4UQZ A;  4UWG A;  4G8L A;  2K17 A;  1X4U A;  3Q7F A;  5BV0 A;  3UXG A;  1WAO 1;  5LKU A;  3ASF A;  2ETA A;  3U3W A;  3ASG A;  2VJF B;  3KNV A;  4XEI G;  4YDY A;  3RTR B;  4EQF A;  2RD0 A;  3M62 A;  2IEJ A;  3KS2 A;  3SFX A;  3SUB A;  4XZ4 A;  4I1M A;  3G2U A;  3SOW A;  2XEN A;  3S2A A;  1V55 E;  3FHE A;  5B3S E;  2XEH A;  2K4D A;  2EGP A;  3C5K A;  5BXO A;  2YSM A;  4C0M A;  2FFW A;  1VDY A;  2J9Q A;  4EBA A;  3MV3 B;  1FVH A;  1NA3 A;  3LQJ A;  4YAX A;  4JHJ A;  4MKT A;  5T3R A;  4X8Q A;  3D9O A;  2KXP C;  1WE9 A;  3ABK E;  2X6K A;  1JPL A;  3V2X A;  3ASD A;  3Q73 A;  4F3V A;  3ASO E;  2WXJ A;  3CHR A;  2VSX E;  3SO8 A;  3I2D A;  5DIZ A;  3RO3 A;  5AIT A;  4WWP A;  5BV1 A;  5BPP A;  3I3N A;  4U95 D;  2YVR A;  3VK6 A;  4S3O C;  3PUQ A;  4GMR A;  5BNW A;  3ULQ A;  2OV8 A;  2YW8 A;  4J6I A;  2P2C P;  2XS1 A;  4CGW A;  4G26 A;  4I17 A;  3FU3 A;  1GW6 A;  3LVQ E;  3HCU A;  4BSZ B;  3PNL B;  1LDK C;  2MKE A;  2BUG A;  4C0E A;  4GND A;  1WFK A;  2I1K A;  1WEO A;  2CHZ A;  2E2E A;  5JJT A;  2Y4U A;  3GZ1 A;  5D2M C;  4KXK B;  3LDZ A;  3CHP A;  3FUH A;  3E2D A;  1TJC A;  3PEV B;  2R03 A;  2OXQ C;  1PY1 A;  3AAA C;  1EPU A;  5G04 B;  3EDT B;  3Q4A B;  4JW1 A;  4PH4 B;  2JAB A;  3UPV A;  4TXQ A;  2BKK B;  2XB1 A;  5HRY A;  4JPS A;  3FP3 A;  4FP7 A;  3ABM E;  1TEZ A;  4H7Y A;  3FAN A;  4BTB A;  5EIB E;  4I7B A;  2E61 A;  3M63 A;  5C13 A;  3UM3 A;  1IKN D;  1N0R A;  5G2N A;  2WXI A;  2EIK E;  2A5E A;  2EIL E;  3JXJ A;  4O1P A;  2AN6 A;  1HXI A;  4PS7 A;  1N52 A;  4HBD A;  2CSZ A;  1IYM A;  2LQ6 A;  4KZC A;  3NG2 A;  2WPV A;  2M13 A;  1WY6 A;  3ZPJ A;  2PNX A;  1HG5 A;  2IFU A;  4GNF A;  1Z3X A;  3URZ A;  5AQB A;  2F42 A;  2NYJ A;  2ECN A;  3RPG B;  3JUI A;  3U5O A;  4GZC A;  1HE8 A;  5AEN A;  3EIQ C;  2LXH C;  5FER A;  4TUM A;  4L1B A;  3DQV R;  1OWM A;  3CVQ A;  3CSF A;  3V30 A;  4ACK A;  1T1H A;  4CA1 A;  3AG4 E;  4JA7 A;  2H6I A;  2KC7 A;  4APF A;  5ITZ F;  5TDW A;  4GMJ A;  4GYO A;  2HO1 A;  4KYO B;  2LV9 A;  4HB5 A;  2DIW A;  2FEZ A;  1HYJ A;  3MGB A;  4ANW A;  5A23 A;  2NXP A;  1ELK A;  4AEZ C;  2FSA A;  3KEA A;  5EKQ D;  2HM8 A;  3Q79 A;  4P5O B;  3Q9N C;  1XGW A;  4LCT A;  2LUH A;  2R2L A;  4K5A B;  1SA5 A;  3VTX A;  2XEV A;  4V3I A;  3C3R A;  3FUK A;  3KQI A;  5SVI B;  3BU8 A;  3QNK A;  3X2Q E;  3MKQ A;  4GNE A;  2VSO E;  2XEU A;  3Q47 B;  5ARG A;  5H1T A;  5ANL A;  5B1A E;  2XOC A;  2XGS A;  2Y1N A;  3L16 A;  4EHM A;  1UN9 A;  4J0U A;  1LD7 A;  2OEW A;  5H1V A;  4G23 A;  2WXH A;  1CHC A;  4GTS A;  4GCN A;  2I50 A;  3O36 A;  1Z2Q A;  4KVM A;  1E90 A;  1AP7 A;  4AY5 A;  5ENP D;  2ZET C;  4TV3 A;  3Q15 A;  3DXK G;  2KWJ A;  4TUU A;  3N9O A;  3ZW3 A;  5C11 A;  2YQM A;  3HXB A;  3F6Q A;  1SZA A;  5HI7 A;  4AM9 A;  3Q7A A;  2AVP A;  3UMV A;  1JM7 A;  1WGM A;  3N9N A;  4L23 A;  5LP0 A;  4QFV A;  4JL0 A;  1ZBP A;  5LKX A;  3PZ3 A;  5M72 A;  3E37 A;  4UWH A;  4S3O B;  2L80 A;  3FFL A;  4DUI A;  2ECV A;  2FI7 A;  2VJE A;  1YA0 A;  3N9Q A;  3KV5 A;  4ANX A;  5KH9 A;  4HQD A;  2CG2 A;  2R02 A;  3UKR G;  3ZYK A;  3O4Z A;  1N9A A;  3IHP A;  1E8Y A;  3BQO A;  1YMP A;  2E6S A;  3CQC B;  3E4B A;  4HOU A;  3NQP A;  2PM6 A;  1H2V C;  4GCO A;  1NL4 A;  4G25 A;  2IQC A;  5AIJ A;  1MBM A;  2L43 A;  4Z0R A;  1BI7 B;  3U5N A;  4I7D A;  4YVO A;  4WWN A;  2LRI C;  4CDM A;  2Y1L E;  5ENS D;  3CK9 A;  3ZFW A;  2QYU A;  1K3Z D;  1MM3 A;  4ATG A;  2MA6 A;  4BY6 A;  4HFG A;  2E0I A;  3S7F A;  3BUA A;  2C2L A;  1HZ4 A;  3FU5 A;  4N3B A;  1MM2 A;  2QIZ A;  3D9P A;  4ZDT A;  3KEZ A;  2X3M A;  4FU3 A;  3T8K A;  2IO3 C;  4HOR A;  1SW6 A;  2XGO A;  3HXD A;  3SBT B;  2VJ8 A;  5E76 A;  2VNF A;  4K03 A;  3FWV A;  5HKP A;  3N9L A;  3W9F A;  4W9R A;  4N2Q A;  3G2T A;  5DKA A;  2X6J A;  1VFY A;  5AYW D;  5EX3 A;  2XP0 A;  3JYS A;  4F1S A;  4YND A;  2FF4 A;  5B76 A;  3CVY A;  4B8C B;  2VSY A;  2X6F A;  3QK0 A;  2EGM A;  1BLX B;  2YRE A;  4BBQ A;  4V3K C;  2XOZ A;  4DX5 D;  4NUR A;  2KRE A;  4FA6 A;  3AS4 A;  3R7Q A;  2NC9 A;  2CKL A;  2P9U G;  5KCM A;  1E8Z A;  3HHM A;  2L6B A;  1JWG A;  3J5Q B;  3G2W A;  3EUV A;  5BT1 A;  4YDE A;  4F6R D;  5AAR A;  2B0O E;  1KLX A;  2WXQ A;  2JEK A;  4FHJ A;  3OTN A;  4ZUX U;  3ZYM A;  1N95 A;  3TWT A;  2YNQ A;  4HOT A;  3UT4 A;  3ZPV E;  3ML9 A;  4NQ0 A;  3PHD A;  3ESL A;  5BXU A;  3NF1 A;  4CZ2 D;  3AG3 E;  4BX8 A;  1K1B A;  4RG6 A;  2UZG A;  3CVV A;  4LKA A;  2XZD G;  2MNY A;  3I4R B;  3D9I A;  1TN7 A;  4K5B A;  4N3W A;  4I9C A;  1N87 A;  4LNU D;  3KV6 A;  2I2O A;  5CCL A;  3TWS A;  5K3Q A;  4G24 A;  2D8S A;  3UI2 A;  1EDU A;  2LGG A;  3AG2 E;  3NZS A;  2OCC E;  1DC2 A;  1D8D A;  4U8V D;  2P58 C;  3CVX A;  4BES A;  4AOF A;  5G04 C;  1MJ0 A;  3ZVZ B;  5KWD A;  2M1R A;  3SD5 A;  2OOE A;  3L08 A;  3ZHE A;  1QNF A;  3Q49 B;  3FEH A;  3CGH A;  3PZD A;  3MKQ B;  1JOC A;  3L6A A;  2VPG A;  3LXU X;  4A55 A;  4PUC A;  1TNB A;  2JMJ A;  2DYR E;  1BOR A;  5A7D B;  3ZVY A;  2WQH A;  3L22 A;  1FT2 A;  3IEG A;  1IQU A;  3O47 A;  4UP0 A;  4OYS A;  4TRQ A;  4JVS A;  4U07 A;  4IRU A;  5D0Q D;  3QWP A;  4LRZ A;  5AQA A;  2QFC A;  5AQ9 A;  1BI8 B;  1FBV A;  4RG9 A;  3LVR E;  1ZBD B;  2RFM A;  5AN8 A;  2H0D B;  5LOZ A;  2M6M A;  2J8S D;  3ZPV 1;  4U0Z A;  3RPG C;  2Y69 E;  3ZNI A;  4BHW A;  3U66 A;  2ECW A;  2MT5 A;  1OCO E;  4B93 B;  3TWV A;  4F1P A;  5JHB A;  2VGX A;  3PE3 A;  2BF0 X;  5EID A;  5TRB A;  4OAU C;  1OWL A;  4U8Y D;  4FJZ A;  3HDX A;  5KBA A;  2MOW A;  4BT8 A;  4JZY A;  3L11 A;  3U9W A;  2IY0 C;  3CK8 A;  4FAD A;  3CEQ A;  3DXM G;  2VJE B;  3DSV A;  2IOS A;  2X38 A;  4CEM A;  2EQX A;  2KR4 A;  4FIP A;  3JQ1 A;  2KU3 A;  2CSY A;  1X4I A;  2ETC A;  1OCZ E;  3DDT A;  5FIO A;  2RSD A;  1OXJ A;  3T9K A;  4J7W A;  1U2V G;  1B89 A;  3E30 A;  2J09 A;  2R17 C;  4HXI A;  5H7P A;  4UWK A;  4N4F A;  3B7R L;  1H2T C;  2JMI A;  2GRM A;  3PRZ A;  4XI0 A;  1UW4 B;  3E32 A;  2K16 A;  2ILR A;  1TN6 A;  3Q1D A;  5B78 A;  3H7H A;  4LJN A;  3PLW A;  5B8D A;  4Y6C A;  2WXK A;  3CHO A;  4L2L A;  4B7Y C;  3GL6 A;  2ZIR A;  2LDR A;  2E6R A;  3OXL A;  4DK5 A;  2HE0 A;  1V54 E;  4DI4 A;  3DPL R;  1MX4 A;  3AU5 A;  3FM8 C;  3ESK A;  1BD8 A;  5CBN A;  1N4R A;  5FB0 A;  1E8W A;  4I7C A;  4F52 B;  3T6R A;  5J90 A;  2VQ2 A;  4OVU A;  5KH7 A;  4GZ5 A;  3E34 A;  1WIL A;  3QJZ A;  3PUR A;  3TJP A;  2QIC A;  2H6H A;  3DSW A;  4BTA A;  3U5M A;  2Y43 A;  3PNT B;  2WMN A;  3ZKJ A;  1DCQ A;  2VSN A;  3FU6 A;  3IBE A;  4GA1 A;  1UOH A;  2XHE A;  5ARF A;  5KNH D;  1A5E A;  2H6F A;  4XI1 A;  3UM1 A;  2M63 A;  1HU3 A;  3MDB C;  3U64 A;  2LAU A;  4UI9 C;  5LFA A;  3LQH A;  3MCX A;  3O37 A;  5G0F A;  2VP7 A;  3B7S A;  3UUX A;  1W3B A;  2BKG A;  1O1T A;  4I1O B;  2GRR B;  3EHN A;  2KWK A;  4UI9 K;  3JUE A;  2FUL A;  1PC2 A;  4LEU A;  4MVT A;  2IOL A;  4N39 A;  2UY1 A;  3ZYL A;  1HG2 A;  3ZGQ A;  4UP5 A;  4B8A A;  2QZA A;  3T8M A;  2MA5 A;  1OWP A;  3C3Q A;  5C1D A;  5C2Y A;  2KWN A;  3MHH A;  5J3X A;  3CVU A;  1MX6 A;  1QQE A;  5SVX A;  3FL2 A;  3C6W A;  3PZ1 A;  2RI7 A;  4UWF A;  4U04 A;  4QQI A;  4IN3 B;  3DSU A;  3ASH A;  3ZVV A;  5DBK A;  4A4B A;  2FO1 E;  4I2W A;  4URK A;  3CKC A;  3R9M A;  4FO9 A;  5LCW J;  4DX2 A;  2GRP B;  3AJI A;  2WVI A;  2L9B A;  2Y4T A;  3UTM A;  3LKU A;  3TXM A;  5FT9 A;  2DVW A;  4PDX A;  4FC8 A;  3HVE A;  4UWL A;  5EYP F;  1TJF A;  4ILG A;  4EZJ A;  2WXM A;  5FQ6 A;  3SGH A;  2AW6 A;  3FEY A;  4AIF A;  2JRJ A;  3ULE G;  3SHB A;  5KJK A;  2LNI A;  1MHQ A;  1UG3 A;  5ENR D;  5G55 A;  1FVF A;  5A6C A;  2AJA A;  4KT6 B;  4IC2 A;  1Q2Z A;  4UQX A;  2VGX B;  2IJG X;  4J8F A;  4M3O A;  5D1K B;  1KPS B;  5JMN D;  3LY7 A;  2Y1M A;  2VTB A;  1FP0 A;  4CCG X;  2XEE A;  4L2Y A;  1WES A;  4CGV A;  3FUE A;  3DWD A;  5FIN A;  3FUD A;  2OEV A;  4AXH A;  4ABN A;  4I6E A;  3HXC A;  3SQV A;  1U6G B;  4NIK A;  2RG8 A;  1LF8 A;  4WZ3 B;  5EIL A;  4PPE A;  4O64 A;  4YDW A;  3ZUV B;  4YVQ C;  2ZU6 B;  3ASN E;  3L82 A;  5CMY A;  5JJ7 A;  2YT5 A;  3SF4 A;  3KDE C;  1N11 A;  3IV0 A;  1VYX A;  4AYC A;  3FU0 A;  3D9H A;  2V4H C;  5ENT D;  5B75 A;  2CG3 A;  5SVY A;  3O70 A;  4F7A A;  4JB8 P;  3FTV A;  4H7X A;  4A1G A;  2BED A;  2CRR A;  4HVB A;  1WEM A;  2IO2 C;  4PS8 A;  4GTM A;  4MLP A;  3DWL G;  2RKK A;  4EPZ A;  4Q69 A;  3PRE A;  1WEW A;  2KIZ A;  1FCH A;  1INZ A;  1SQM A;  4YBT A;  3ML8 A;  1A17 A;  1FT1 A;  2QC9 A;  4KVO A;  4TXR A;  3RRN B;  1E8X A;  3FDH A;  2FD4 A;  4MS6 A;  3PZ4 A;  2G43 A;  2KE1 A;  2IF4 A;  3SHF A;  4AVX A;  2G6Q A;  5H1U A;  3QDN A;  4U0U A;  2YQL A;  3NOC D;  3TWX A;  2JLB A;  2D8U A;  4GTR A;  1JWF A;  1NP7 A;  2EA6 A;  2FUI A;  3SBS A;  2L75 A;  4I6J A;  3N71 A;  2C2V S;  3C5R A;  4KBQ A;  2YUR A;  1PAQ A;  1G3N B;  2OWA A;  2BAY A;  5FB1 A;  3TWQ A;  1OUV A;  4UI9 B;  2LXL A;  3LEW A;  1IXV A;  2FBN A;  3B7T A;  3FEX A;  5FTP A;  1NI1 A;  2PL2 A;  4J8E A;  3QZV A;  4HI8 A;  4BX9 A;  1Z6T A;  1HS6 A;  3I4G A;  4E85 A;  2LGV A;  1N4S A;  3DPY A;  2DWZ A;  2OND A;  3VLF A;  5LKT A;  2LO6 A;  4GTV A;  3E33 A;  1TNU A;  5BUZ A;  2ZXW E;  3O48 A; 
#chains in the Genus database with same CATH homology
 3DPD A;  4A3T A;  4J8S A;  2LAI A;  3EJN A;  1NZN A;  1IQR A;  1OWO A;  1MQS A;  2I1J A;  2VJF A;  4JHR A;  3ZYQ A;  4APO A;  4E6H A;  3B13 A;  3O7A A;  1UJJ A;  3MKR A;  1X5B A;  3IHY A;  2KAT A;  1U3D A;  2ECI A;  5G05 J;  4I9E A;  5ENN A;  2V0P A;  3MZL B;  3FTS A;  3LY9 A;  1ZU2 A;  1HO8 A;  2MD7 B;  4K0R A;  3C98 A;  3HVE B;  2KGG A;  2L0B A;  5T8I A;  3B7U X;  4JEH A;  2YIN A;  3VTY A;  3CVN A;  3T5X A;  3FTU A;  2YHN A;  3SOU A;  1KT0 A;  4XX5 A;  2VPB A;  5FJY A;  3SOX A;  3QKY A;  2PUY A;  2GW1 A;  4O6F A;  4GPK A;  5AJL A;  4D10 C;  2HYZ A;  3O34 A;  3PDN A;  3GYZ A;  2AXU A;  1WEU A;  2MD8 C;  2VTB B;  1DVP A;  1XWH A;  4YAB A;  3CLJ A;  5EX0 A;  2L6J A;  5FQ8 A;  3O35 A;  1VD4 A;  3I5P A;  2G45 A;  1IHG A;  2MHK A;  3JQ0 A;  3FH7 A;  2KCL A;  5FQ4 A;  2K1J A;  3TXN A;  4WA6 A;  3D9J A;  4A1S A;  2WXP A;  4FJY A;  2FUU A;  4W4U A;  4G11 A;  4BT9 A;  2X6H A;  3QWV A;  2PQN A;  2CT2 A;  2WMO A;  4AP4 A;  3ZN3 A;  2ION A;  5LCW B;  4AYC B;  5HQ8 A;  4NN2 A;  4C9B B;  4IC3 A;  4LUN U;  2PM7 A;  4U0S A;  3CVL A;  2VPE A;  1HYI A;  3S7B A;  4F53 A;  3PVL A;  4A49 A;  4L58 A;  3L54 A;  2DCP A;  4KZ0 A;  3FY4 A;  1F62 A;  4B86 C;  4DJA A;  3LJ3 A;  1HFA A;  1JM7 B;  3FUM A;  1Z6U A;  2KZT A;  4YAD A;  3U5P A;  2HR2 A;  2WQ7 A;  5FEY A;  3LPZ A;  3FUL A;  3SZ7 A;  4FHK A;  5I3L A;  3CK7 A;  4JHK A;  5LX8 A;  2YSJ A;  4G2V A;  4R7E A;  4ZQL A;  1S0P A;  3ONK A;  3SFZ A;  4GA2 A;  3L17 A;  5FZS A;  1H19 A;  4U8H A;  3TAX A;  4JC8 A;  4Q94 A;  2V4L A;  1WM5 A;  1EF1 C;  3DBS A;  3MA5 A;  2EOD A;  4EZL A;  4LK9 A;  4WZ0 A;  5CCM A;  5FZR A;  2WXR A;  4GB9 A;  4FK5 A;  4AV7 A;  2IDA A;  1V87 A;  3ZRH A;  4EBA G;  1OWN A;  3QOU A;  1JUQ A;  3CV0 A;  5D1M B;  2ECG A;  2CKL B;  2J49 A;  5BW8 C;  3CVW A;  2AXZ A;  3CKB A;  5J08 A;  3PS6 A;  3RJV A;  5CHE E;  4GA0 A;  3APD A;  2FO7 A;  3RRM B;  5EDS A;  3RU0 A;  4ACL A;  3LCA A;  2YUC A;  4L7X A;  5FWQ A;  1WEP A;  2LN0 A;  3RO2 A;  3UT8 A;  3L13 A;  3U4T A;  3ZTG A;  4GZ6 A;  3LS8 A;  4N3A A;  3OAW A;  3T7L A;  1XNF A;  2XPZ A;  3V43 A;  5B79 A;  2XQ0 A;  2YHO A;  2WXN A;  3LY8 A;  1K2F A;  2YYR A;  2ECJ A;  1E7V A;  1EYH A;  2LGL A;  3GZS A;  1RMD A;  3HCS A;  2YHC A;  3PH0 C;  5G05 B;  4FLB A;  4GAA A;  4HOQ A;  4A0C D;  3ZEF A;  3ZHE B;  4BSX A;  4L7T A;  2CFZ A;  3P1U A;  4GYY A;  3FUI A;  4DLO A;  2KGI A;  3K9I A;  4QF2 A;  2Y3A A;  3CIA A;  4JEU A;  2VYI A;  2Q7F A;  2AWI A;  3CHM A;  4LLB A;  2GRL A;  4GZ3 A;  3ENE A;  2ECT A;  2YHE A;  5T4Y A;  3EB5 A;  4ME2 A;  3FTW A;  5JJ6 A;  3D3M A;  3N9P A;  5TAB A;  4TKP B;  2KZT B;  4Q96 A;  4MRU A;  3NZU A;  4X3G A;  3JCK C;  3GZ2 A;  3MEK A;  2F6J A;  4ANU A;  4EZK A;  4UQY A;  3GV4 A;  4N2S A;  4YC9 A;  3MX3 A;  4JA9 A;  1BPO A;  3PE4 A;  4CDN A;  3CST A;  2V8S E;  5CMW A;  3RKV A;  4MSX A;  3CQG B;  3AU4 A;  2KCK A;  2C0L A;  1HH8 A;  4FUL A;  2HDP A;  3MV2 B;  4XIF A;  3FUN A;  3BEE A;  3APC A;  4HS2 A;  3CHS A;  2F6N A;  3IHV A;  1WEE A;  1KT1 A;  4CT0 A;  5AJD A;  2LXP C;  4FJC A;  2I6H A;  4ILH B;  3RRU A;  5B77 A;  2QJ0 A;  5E75 A;  5LCW C;  3QAQ A;  3BG1 B;  3PEU B;  3D9N A;  4BWR A;  3D9L A;  5KJM A;  2VGY A;  1H2U A;  5H9M A;  3LRQ A;  4WAF A;  2NSZ A;  2KYU A;  3ONL A;  2HYE D;  2XPY A;  3L1Z B;  2LAH A;  4YBM A;  4XKB A;  2GGF A;  2AXV A;  2J08 A;  3FUJ A;  3ASL A;  2H0D A;  2MRI A;  4A4C A;  3PUJ A;  3UQ3 A;  2XCC A;  1LDJ B;  4QF3 A;  1Z3Y A;  1G25 A;  2A4Z A;  2L0I A;  4ILI A;  1ELW A;  5FQ7 A;  2WQ6 A;  3RIB A;  3EIJ A;  3FTY A;  2QY7 A;  2PQR A;  2MIQ A;  4OVV A;  3D9M A;  3VLE A;  1Y6I A;  1WIM A;  4WWO A;  3SI5 A;  4C9Z A;  4GB0 A;  3QAR A;  2A5U A;  4CT4 A;  5D1L B;  4Q6F A;  3LYA A;  4G1T A;  4XKC A;  4R7L A;  3VLD A;  1X4J A;  5ANR A;  4Y6W A;  2BTD A;  4EEC A;  2MUM A;  2DX8 A;  1WEN A;  3EHM A;  5DIN A;  2UY1 B;  5FZQ A;  3OXG A;  4PTB A;  1E96 B;  1UJK A;  2LGK A;  5D0O D;  4XI9 A;  3APF A;  4DLQ A;  3UT7 A;  4A3V A;  4N5C A;  2UWJ G;  4CRW A;  3FH8 A;  5G04 J;  3HCT A;  2XPI A;  2WB2 A;  5TDR A;  5KH3 A;  4GNG A;  2OVF A;  3EB6 A;  1H6K A;  4DI3 A;  3FTZ A;  3G2V A;  5KJL A;  3Q5M A;  4I6G A;  4AP2 A;  3BG0 B;  1IYG A;  2J4B A;  4GZD A;  3HYM B;  4I43 A;  2CHX A;  3IKO B;  3FTX A;  4JXT A;  3R9A B;  2XRY A;  5EYA F;  2DBA A;  1Y8M A;  2WM9 A;  3MHS A;  4R2Y A;  3QB2 A;  4ANV A;  3G2S A;  5JHA A;  3MYV A;  5KJN A;  4CDR A;  1L5J A;  2WXO A;  4YBS A;  4PS3 A;  2CHW A;  2M3H A;  3FH5 A;  1H0A A;  4WND A;  4KMO A;  4B0Z A;  4HLE A;  2JMD A;  1UN8 A;  2VPD A;  2KM4 A;  4R8P K;  3FUF A;  3D9K A;  4P29 A;  2NAA A;  4LER A;  2M85 A;  2I9C A;  2L5U A;  3MJW A;  2XCB A;  2MNZ A;  2V5F A;  4WZ2 A;  3CVP A;  1ELR A;  2KWO A;  4B89 A;  4NAC A;  3HIZ A;  3RK6 A;  3LQI A;  2J07 A;  5AIU A;  2CFU A;  4B94 A;  4IYP A;  4HOS A;  2WXF A;  1WEQ A;  4AUQ B;  3SNX A;  3OXF A;  3P2B A;  1P5Q A;  1DNP A;  2WXL A;  5G05 C;  2XGM A;  3GW4 A;  4AJW A;  4GU5 A;  4GML A;  2IU1 A;  4WNE A;  4V3L C;  3R7R A;  4J8D A;  2LSU A;  1HX8 A;  1Z60 A;  3S7J A;  1WEV A;  2YU4 A;  3S7D A;  4RSY A;  4I1A A;  2L0T B;  3PUK A;  3QWW A;  3CR3 A;  3WXX A;  4FLH A;  2R59 A;  2YQ8 A;  3TG4 A;  2R5S A;  4N3C A;  2J4D A;  3HTK C;  1N54 A;  4GYW A;  2KFT A;  4LAD B;  3AS8 A;  2XRZ A;  3M99 A;  3KAE A;  4I2Z A;  4DPR A;  3KD7 A;  2WXG A;  3TL5 A;  1NA0 A;  4XE0 A;  2PZI A;  1QZ2 A;  1E7U A;  3T5V A;  3CHQ A;  4U63 A;  3UX4 A;  4WUY A;  3TGO A;  4NRH B;  1HF8 A;  2C0M A;  3ZIM A;  4BFR A;  3O33 A;  3N9M A;  2X6I A;  2LSV A;  2KCV A;  4YAT A;  5TBN A;  2OVB A;  1U3C A;  4IUL A;  5JG6 A;  3AS5 A;  3QC1 A;  4AY6 A;  5LKZ A;  3L1X A;  4UI9 J;  1SZ9 A;  3TG5 A;  4WNF A;  1E4U A;  4RVB A;  3ZXS A;  4CCA A;  4WNG A;  4UQZ A;  4UWG A;  2K17 A;  1X4U A;  5BV0 A;  1WAO 1;  5LKU A;  3ASF A;  3U3W A;  3ASG A;  2VJF B;  3KNV A;  3RTR B;  4EQF A;  2RD0 A;  3M62 A;  3KS2 A;  4XZ4 A;  4I1M A;  3G2U A;  3SOW A;  3S2A A;  3FHE A;  2K4D A;  2EGP A;  3C5K A;  2YSM A;  4C0M A;  1VDY A;  2J9Q A;  4EBA A;  3MV3 B;  1FVH A;  1NA3 A;  3LQJ A;  4JHJ A;  4MKT A;  5T3R A;  3D9O A;  1WE9 A;  2X6K A;  1JPL A;  3ASD A;  4F3V A;  2WXJ A;  3CHR A;  2VSX E;  3I2D A;  5DIZ A;  3RO3 A;  5AIT A;  4WWP A;  5BV1 A;  5BPP A;  3I3N A;  3VK6 A;  4S3O C;  3PUQ A;  5BNW A;  3ULQ A;  2OV8 A;  2YW8 A;  4J6I A;  4CGW A;  4G26 A;  4I17 A;  3FU3 A;  1GW6 A;  3LVQ E;  3HCU A;  3PNL B;  1LDK C;  2BUG A;  4C0E A;  4GND A;  1WFK A;  2I1K A;  1WEO A;  2CHZ A;  2E2E A;  5JJT A;  2Y4U A;  3GZ1 A;  4KXK B;  3LDZ A;  3CHP A;  3FUH A;  1TJC A;  3PEV B;  2OXQ C;  1PY1 A;  1EPU A;  5G04 B;  3EDT B;  3Q4A B;  4JW1 A;  4PH4 B;  3UPV A;  2XB1 A;  4JPS A;  3FP3 A;  4FP7 A;  1TEZ A;  4H7Y A;  4BTB A;  4I7B A;  3M63 A;  5C13 A;  5G2N A;  2WXI A;  2AN6 A;  1HXI A;  4PS7 A;  1N52 A;  2CSZ A;  1IYM A;  2LQ6 A;  4KZC A;  3NG2 A;  2WPV A;  1WY6 A;  3ZPJ A;  2PNX A;  1HG5 A;  2IFU A;  4GNF A;  1Z3X A;  3URZ A;  2F42 A;  2ECN A;  3RPG B;  3JUI A;  3U5O A;  4GZC A;  1HE8 A;  5AEN A;  3EIQ C;  2LXH C;  5FER A;  4L1B A;  3DQV R;  1OWM A;  3CVQ A;  3CSF A;  4CA1 A;  4ACK A;  1T1H A;  4JA7 A;  2KC7 A;  4APF A;  5TDW A;  4GMJ A;  4GYO A;  2HO1 A;  4KYO B;  2LV9 A;  2DIW A;  2FEZ A;  1HYJ A;  3MGB A;  4ANW A;  5A23 A;  2NXP A;  1ELK A;  4AEZ C;  2FSA A;  5EKQ D;  2HM8 A;  4P5O B;  1XGW A;  4LCT A;  3VTX A;  2XEV A;  4V3I A;  3FUK A;  3KQI A;  3QNK A;  3MKQ A;  4GNE A;  2VSO E;  2XEU A;  3Q47 B;  5ARG A;  5H1T A;  5ANL A;  2XGS A;  2Y1N A;  3L16 A;  1UN9 A;  4J0U A;  5H1V A;  4G23 A;  2WXH A;  1CHC A;  4GCN A;  2I50 A;  3O36 A;  1Z2Q A;  4KVM A;  1E90 A;  4AY5 A;  2ZET C;  4TV3 A;  3Q15 A;  2KWJ A;  4TUU A;  3N9O A;  3ZW3 A;  5C11 A;  2YQM A;  1SZA A;  5HI7 A;  4AM9 A;  2AVP A;  3UMV A;  1JM7 A;  1WGM A;  3N9N A;  4L23 A;  5LP0 A;  4QFV A;  4JL0 A;  1ZBP A;  5LKX A;  5M72 A;  4UWH A;  4S3O B;  2L80 A;  3FFL A;  2ECV A;  2FI7 A;  2VJE A;  1YA0 A;  3N9Q A;  3KV5 A;  4ANX A;  5KH9 A;  2CG2 A;  3ZYK A;  3O4Z A;  3IHP A;  1E8Y A;  2E6S A;  3CQC B;  3E4B A;  4HOU A;  3NQP A;  2PM6 A;  1H2V C;  4GCO A;  4G25 A;  2IQC A;  5AIJ A;  2L43 A;  3U5N A;  4I7D A;  4YVO A;  4WWN A;  2LRI C;  4CDM A;  3CK9 A;  3ZFW A;  1MM3 A;  4ATG A;  2MA6 A;  4BY6 A;  4HFG A;  2E0I A;  3S7F A;  2C2L A;  1HZ4 A;  3FU5 A;  4N3B A;  1MM2 A;  2QIZ A;  3D9P A;  4ZDT A;  3KEZ A;  2X3M A;  4FU3 A;  4HOR A;  2XGO A;  3SBT B;  2VJ8 A;  5E76 A;  2VNF A;  4K03 A;  3FWV A;  3N9L A;  4W9R A;  4N2Q A;  3G2T A;  5DKA A;  2X6J A;  1VFY A;  5AYW D;  5EX3 A;  3JYS A;  4F1S A;  4YND A;  2FF4 A;  5B76 A;  3CVY A;  4B8C B;  2VSY A;  2X6F A;  3QK0 A;  2YRE A;  4BBQ A;  4V3K C;  4NUR A;  2KRE A;  4FA6 A;  3AS4 A;  3R7Q A;  2NC9 A;  2CKL A;  5KCM A;  1E8Z A;  3HHM A;  1JWG A;  3G2W A;  5BT1 A;  1KLX A;  2WXQ A;  2JEK A;  4FHJ A;  3OTN A;  4ZUX U;  3ZYM A;  2YNQ A;  4HOT A;  3UT4 A;  3ZPV E;  3ML9 A;  4NQ0 A;  3PHD A;  3ESL A;  3NF1 A;  4BX8 A;  4RG6 A;  2UZG A;  3CVV A;  4LKA A;  2MNY A;  3I4R B;  3D9I A;  4N3W A;  4I9C A;  1N87 A;  3KV6 A;  2I2O A;  5CCL A;  4G24 A;  2D8S A;  1EDU A;  2LGG A;  3NZS A;  2P58 C;  3CVX A;  4AOF A;  5G04 C;  3ZVZ B;  2M1R A;  3SD5 A;  2OOE A;  3L08 A;  3ZHE A;  1QNF A;  3Q49 B;  3CGH A;  3PZD A;  3MKQ B;  1JOC A;  3L6A A;  2VPG A;  3LXU X;  4A55 A;  4PUC A;  2JMJ A;  1BOR A;  5A7D B;  3ZVY A;  2WQH A;  3L22 A;  3IEG A;  1IQU A;  4UP0 A;  4OYS A;  4TRQ A;  4JVS A;  4U07 A;  4IRU A;  5D0Q D;  3QWP A;  4LRZ A;  2QFC A;  1FBV A;  4RG9 A;  3LVR E;  1ZBD B;  2H0D B;  5LOZ A;  2M6M A;  3ZPV 1;  4U0Z A;  3RPG C;  3ZNI A;  4BHW A;  3U66 A;  2ECW A;  2MT5 A;  5JHB A;  2VGX A;  3PE3 A;  2BF0 X;  5TRB A;  1OWL A;  4FJZ A;  3HDX A;  2MOW A;  4BT8 A;  4JZY A;  3L11 A;  3U9W A;  3CK8 A;  4FAD A;  3CEQ A;  2VJE B;  2IOS A;  2X38 A;  4CEM A;  2EQX A;  2KR4 A;  4FIP A;  3JQ1 A;  2KU3 A;  2CSY A;  1X4I A;  2RSD A;  1B89 A;  2J09 A;  2R17 C;  4HXI A;  4UWK A;  4N4F A;  3B7R L;  1H2T C;  2JMI A;  2GRM A;  3PRZ A;  4XI0 A;  1UW4 B;  2K16 A;  2ILR A;  5B78 A;  4LJN A;  5B8D A;  4Y6C A;  2WXK A;  3CHO A;  4L2L A;  4B7Y C;  3GL6 A;  2LDR A;  2E6R A;  3OXL A;  4DK5 A;  4DI4 A;  3DPL R;  3AU5 A;  3ESK A;  5FB0 A;  1E8W A;  4I7C A;  4F52 B;  3T6R A;  5J90 A;  2VQ2 A;  4OVU A;  5KH7 A;  4GZ5 A;  1WIL A;  3QJZ A;  3PUR A;  3TJP A;  2QIC A;  4BTA A;  3U5M A;  2Y43 A;  3PNT B;  2WMN A;  2VSN A;  3FU6 A;  3IBE A;  4GA1 A;  2XHE A;  5ARF A;  4XI1 A;  2M63 A;  1HU3 A;  3U64 A;  3LQH A;  4UI9 C;  5LFA A;  3MCX A;  3O37 A;  5G0F A;  2VP7 A;  3B7S A;  3UUX A;  1W3B A;  4I1O B;  3EHN A;  2KWK A;  4UI9 K;  2FUL A;  1PC2 A;  4LEU A;  4MVT A;  2IOL A;  4N39 A;  2UY1 A;  3ZYL A;  1HG2 A;  3ZGQ A;  4UP5 A;  4B8A A;  3T8M A;  2MA5 A;  1OWP A;  5C1D A;  5C2Y A;  2KWN A;  3MHH A;  5J3X A;  3CVU A;  1QQE A;  3FL2 A;  3C6W A;  2RI7 A;  4UWF A;  4U04 A;  4IN3 B;  3ASH A;  3ZVV A;  5DBK A;  4A4B A;  4I2W A;  4URK A;  3CKC A;  4FO9 A;  5LCW J;  2WVI A;  2L9B A;  2Y4T A;  3LKU A;  3TXM A;  5FT9 A;  4PDX A;  4FC8 A;  3HVE A;  4UWL A;  1TJF A;  4ILG A;  4EZJ A;  2WXM A;  5FQ6 A;  3SGH A;  2AW6 A;  3FEY A;  4AIF A;  2JRJ A;  3SHB A;  5KJK A;  2LNI A;  1MHQ A;  1UG3 A;  5G55 A;  1FVF A;  5A6C A;  4KT6 B;  4IC2 A;  4UQX A;  2VGX B;  2IJG X;  4J8F A;  4M3O A;  5D1K B;  3LY7 A;  2Y1M A;  2VTB A;  1FP0 A;  4CCG X;  4L2Y A;  1WES A;  4CGV A;  3FUE A;  3FUD A;  4ABN A;  4AXH A;  4I6E A;  1U6G B;  2RG8 A;  1LF8 A;  4WZ3 B;  4PPE A;  4O64 A;  4YVQ C;  2ZU6 B;  5CMY A;  5JJ7 A;  2YT5 A;  3SF4 A;  3IV0 A;  1VYX A;  4AYC A;  3FU0 A;  5B75 A;  2CG3 A;  3O70 A;  4F7A A;  3FTV A;  4H7X A;  4A1G A;  4HVB A;  1WEM A;  4PS8 A;  4MLP A;  4EPZ A;  4Q69 A;  3PRE A;  1WEW A;  2KIZ A;  1FCH A;  1INZ A;  1SQM A;  4YBT A;  3ML8 A;  1A17 A;  4KVO A;  3RRN B;  1E8X A;  3FDH A;  4MS6 A;  2G43 A;  2KE1 A;  2IF4 A;  3SHF A;  4AVX A;  2G6Q A;  5H1U A;  3QDN A;  4U0U A;  2YQL A;  2JLB A;  1JWF A;  1NP7 A;  2EA6 A;  2FUI A;  3SBS A;  2L75 A;  4I6J A;  3N71 A;  2C2V S;  4KBQ A;  2YUR A;  1PAQ A;  2BAY A;  5FB1 A;  1OUV A;  4UI9 B;  3LEW A;  2FBN A;  3B7T A;  3FEX A;  5FTP A;  2PL2 A;  4J8E A;  3QZV A;  4BX9 A;  1Z6T A;  1HS6 A;  3I4G A;  4E85 A;  2LGV A;  2OND A;  3VLF A;  5LKT A;  2LO6 A;  5BUZ A;  4YAX A;  3O48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...