2C2MA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2mA00
5LU9A 2Y1LA 2J31A 2C2MA 4JR2A 4JR0A 3RJMA 2QL9A 1RHUA 4JB8A 2FP3A 3EDQA 3KJFA 2FUNB 3DEJA 5K20A 5IARA 2J30A 2CDRA 4EHLA 2K7ZA 4QUBA 4EHDA 3V55A 3DEIA 4DCJA 1RHMA 4FGUA 5IC4A 4ZVRA 1CVRA 4JQZA 1I4OA 4EHAA 4JJ7A 2J32A 4QTXA 3K7EA 3PCXA 3D6HA 4N5DA 3V4LA 1RE1A 4N6GA 2H65A 4D3XA 1RHJA 1CP3A 1I51A 1K86A 4LSZA 4QUGA 2NN3C 4N7MA 2H4WA 2H5JA 4PRZA 2CNLA 4D3YA 1KMCA 4N7JA 2Y0BA 3ITNA 2H5IA 3NR2A 4PS0A 4M9RA 4I1RA 4DCOA 4QUIA 2H51A 5LU8A 3DEHA 2CJYA 2QLFA 3V6MA 1K88A 4IYRA 1IBCA 2H4YA 2QL5A 2QL7A 4D3ZA 2XYPA 3QNWA 1SC1A 1RWKA 4FDLA 3P4UA 4JJEA 3V6LA 4I1PA 5IAEA 3H0EA 1SC3A 5IBPA 3NS7A 3V4OA 4AWBA 1GQFA 3KJQA 3R7SA 1JXQA 2QLBA 1M72A 2CNNA 4EHFA 3R5JA 1SHJA 2H48A 3R6LA 2C2OA 4ZVQA 5I9BA 2CJXA 3S70A 1PYOA 2H54A 5H0IA 1RWWA 3IBCA 4N6NA 5IC6A 3UOAB 1I3OA 1PAUA 2HBYA 2WDPA 3GJRA 5IAGA 1F1JA 4QUDA 1QX3A 1QDUA 4HQRA 4AWAA 4QULA 3S8EA 3EDRA 4QTYA 4ZVTA 1NMQA 4NBLA 5LUBA 2J33A 3NKFA 4DCPA 1RWOA 4FXOA 2C1EA 4AW9A 4PRYA 3GJTA 1SC4A 1RWVA 3R6GA 1SHLA 4NOMA 4EHKA 3D6MA 2XZTA 3BIJA 4ZVOA 3D6FA 5IABA 2FQQA 1BMQA 1RWPA 1NW9B 2CNOA 4FEAA 4JQYA 3H1PA 3H11B 3P45A 4PS1A 4QU9A 4QUHA 4ZVSA 5I9TA 1F9EA 2C2KA 3PD0A 1RHKA 3R7BA 4NOLA 3IBFA 4QU5A 1QTNA 4EJFA 1RWNA 4NBKA 1NMSA 1RWXA 2C2ZA 4JJ8A 3R7NA 1RHQA 3DEKA 3UO8B 5IBCA 4QUEA 4QUAA 4NOJA 5IBRA 1GFWA 4JR1A 4HVAA 5IAKA 2XZDA 4ZVPA 3R5KA 5LUAA 1RWMA 2P2CA 5IAJA 4EHHA 3H13A 3V3KA 3SIPA 4QU0A 4EHNA 4ZVUA 2HBQA 2DKOA 4NOKA 2CNKA 3GJSA 5IASA 4IEFB 5JFTA 3GJQA 3PD1A 1RHRA 4NBNA 4QU8A 2HBZA 5IANA 4N6OA 2QLJA 4HQ0A 1I4EB 3E4CA 1ICEA 3SIRA 2XYGA 2HBRA 3KJNA 1NMEA 2AR9A 2XYHA 3H11A 3OD5A 4QUJA
chains in the Genus database with same CATH superfamily
4G89A 4S1VA 4B6PA 5KAPA 1JPVA 1SHZA 4M86A 5T4BA 2DWUA 3V2HA 1ZMOA 2P75A 2CDRA 4DEVA 4MGYR 4NCBA 2P0EA 4J07A 4U4AA 2SKDA 4IQ8A 4B3XA 5JYCA 5DWVA 5ARDA 4JDUA 3O31A 1YRWA 3NH9A 2LPMA 5JZBA 1B43A 1E2UA 3ZOZA 4E0BA 3TQIA 4XRGA 1SG9A 4N6GA 5LLTA 3SKYA 2FDXA 2H65A 1EGAA 1JS1X 3IVCA 4UDXX 2AIRA 2XYVA 2NPOA 4JYBA 1IXYA 1RPTA 2IHUA 4WY8A 2FSHA 3GLTA 4DMRA 3RC8A 1NQTA 5SZIA 1UXOA 4YROA 1O5OA 2EXXA 2QS9A 3M4XA 5JDCA 2HDWA 2R8XA 4EI2A 4LZLA 4BNXA 4AKIA 4EJSA 1T8WA 4M0UA 4PAOA 3JPWA 5GQSA 3UWMA 2A88A 2BFBA 3VH4A 1S4MA 5F7OA 3U4MA 2WYOA 3RBZA 1VPDA 4BNIA 1TKBA 3TZKA 4ZYYA 3NOQA 4OI0A 3B9BA 4A91A 1DRVA 4X8HA 4EYQA 5JSZB 3WBKA 2VXCA 4ACBA 3Q3IA 1VPLA 1H1LA 2DBQA 2VZLA 4HB3A 2CFTA 3JCZA 4U8GA 1VZ3A 1ZPDA 5SY9A 4PSDA 3RARA 1XHFA 1LK7A 3ZLJA 1JPNA 2PY6A 4AMYA 2YHIB 1T4CB 2YQ5A 5AI8A 3IDOA 4WK4B 5IH3A 2L82A 4NXNB 1DC6A 2YWGA 4XQEA 1RTTA 3PNLA 3VZRA 1RXWA 3DBRA 4GP6A 4LWOA 5IAGA 3FDFA 3NBYC 2VATA 3RYCB 4DBZA 1BMDA 3IC5A 3P32A 2J3LA 3BWXA 5EXTA 5AIBA 5DHSA 3P9IA 1U1GA 3BMOA 1HNXB 3BD7A 4FYJA 4G81A 1VE1A 1KI7A 1VGRA 5KSZA 3HGQA 1EQAA 3SXUB 1NG9A 1H05A 4B3FX 2WSYB 4UBOA 3IUPA 3RV4A 4IGFA 4A1FA 4CEHA 3ZH9B 1U0OC 3ZZMA 1U3UA 4X66B 1PNTA 4Q0MA 3T9FA 3PYXA 4OGWA 1U9IA 2D7JA 4DCMA 1OYWA 3HJTA 5F35A 2M9MA 4ZOEA 3H5TA 4CU2A 1L8AA 2ZBVA 3IR6A 4FINA 2WIJA 4N9WA 2JJ2D 2C7QA 5BSGA 3SG0A 1BJTA 1DZIA 3NNNA 1L3IA 1YRBA 1K2WA 2QAIA 4UOQA 1RYEA 5F76A 4PRKA 5KYVA 4Z1MA 3FI9A 1P9WA 3CQ9A 1IWBB 3WYAA 4M0MA 4HRAA 1FNCA 1ESNA 4CG1A 3X43A 3L8DA 3U56A 1MGOA 4NCKA 3TB6A 4EHNA 1WSBA 1CZLA 2GK4A 1IY9A 1NNUA 4JI6B 2FJ0A 2WHPB 3GD7A 4HBGA 5C3UA 5IASA 3BWMA 5LZ5A 1TUBA 4L9WA 4F3RA 3AV3A 3Q6MA 3TVDA 2FMTA 4WZ6A 4RKEA 1NULA 1Z4QA 2Q1XA 2QSJA 3R77A 3KJNA 1JIIA 2XGSA 3HKCA 4H1HA 4X7BA 2FJPA 2XKAA 4LVNA 1A0OA 4W99A 2NQ8A 4DJ5X 3HCBA 3Q5GA 2C9MA 1X77A 4A8HA 4E13A 1QP7A 1OFIA 2C4TA 4UCWA 2OWEA 3ORFA 5K3AA 4D2IA 4F4FA 4DV2B 1VI2A 2AMLA 1UUFA 5F1YA 1T1GA 4O5OA 1C30B 5HA5A 1ZKMA 4KMSA 4A0FA 3ZVRA 3E9MA 1B0UA 5DGXA 2XHEA 3OHSX 3UXMA 3ER8A 1NVBA 4Q19A 4HH3C 1Q11A 3G0DA 2H6EA 4DV5B 3BH7A 2QR3A 3CBGA 4MKHA 4D3FA 3T9AA 4EG6A 1J0CA 2OCKA 3D3WB 3IKJA 4BMDA 2ZZNA 1GZ3A 5SYNA 3IIEA 1NE7A 4M2LA 2ADMA 1E4EB 1GUZA 3DFIA 1E6CA 5FBQB 4QJ4A 2V1UA 4OX9Y 4LNAA 1D04A 1OI3A 3FPLA 3TSZA 1E3SA 3H4IA 1BWPA 4RS4A 5KYXA 1YKGA 3K6RA 4HGOA 2A4MA 2WKWA 4ZTUB 4PXSA 2QVBA 5DSXA 1FMLA 3ZHXA 1R50A 3KIPA 1UEJA 1K6EA 2GHIA 3H5VA 2VP2A 2A9FA 3AFMA 421PA 1YCFA 4FHDA 1KQ3A 4D02A 3VNUA 3BB1A 1N8NA 4G37A 3L7CA 1DKRA 3ND5A 4IDEA 2HGSA 5ALTA 4AJEA 1JVSA 1ILWA 1RI2A 2GAFA 2WJAA 4B1FA 4CIVA 4E03A 4CJXA 1HT3A 4QYIB 4LJ9A 1C1XB 1TFUA 2ADOA 1SUCA 4MW6A 4H7IA 5EKXA 1GRNA 3A1EA 3MBKA 4CMEA 5A7HA 2QMYA 3R3HA 1G5HA 2ZB7A 3LFHA 4F4UA 2G04A 8MHTA 1WCYA 4H31A 4ODIA 4PFJA 2QQEA 1YHNA 4J1SA 4WD3A 5BWLA 2JEOA 2OO3A 4JYPA 1QQBA 1K8YB 1NW5A 3KXDA 1LQUA 1P5ZB 3I32A 4HAUA 4PX5A 2O8EA 3USZA 2JLRA 4RESA 1AM4D 1GL3A 4GL4A 4QTYA 1DG3A 3ZKWB 2C8JA 4LCBA 4CM5A 2DFLA 4EA6A 1RBZA 5CFNA 2ODQA 3PC4A 4NYJQ 5E1OA 1P9RA 4L07A 5IABA 3ZLVA 4WCFB 1V11B 3BE8A 4PS1A 3RJZA 2ZRIA 5AW3A 4GRIA 5AVXA 3K8QA 2R8RA 4RGQA 4ZD6A 2BSQA 1DC4A 3NTUA 3QU5A 3WZLA 3ZY6A 4LNUB 4LRWA 4PZAA 2CK3D 3BIXA 3T4UA 5ALNA 2AMJA 3L1JA 3D3KA 5HBRA 2B8JA 1USVA 621PA 5CUQA 4A23A 1XALA 2D5CA 4MQ4A 4NU8X 5H7XA 2O50A 5FORA 2O54A 3AR5A 1J1UA 1YRYE 1W93A 3WRYA 3NVMB 3LQQA 5EZSA 3D3WA 3NWOA 2CNKA 3UJ7A 5BOSA 1QKIA 2IWHA 1W581 5BN4B 3AEKA 4G0OA 2PMEA 2AOWA 3ZE9A 1Z3IX 4E5YA 2ETXA 4A36A 3OQJA 5IWAB 2ZIZA 5E0KB 2VO1A 1UJ5A 1V8OA 4O02B 2GPSA 3ZEAA 1ZVVA 1NUSA 4BVAA 2NZJA 3NGXA 3N70A 1RE0A 4PO3X 3DV2A 5JSUA 1XB2A 3L8EA 1C0LA 4RVNA 3ZWWA 4EDFA 5CA1F 2GNOA 3JQFC 4B81A 6CHYA 4MGIR 2PIDA 3B6ZA 2HWXA 2O8CA 4F71A 2ZRLA 4K40A 3RTEA 3TSOA 1DJQA 1WZCA 2QRGA 2ZSDA 5A3VA 3SDSA 5ALXA 4OCZA 3QE9Y 1XZAA 4C7OA 3OZTA 3BT7A 2GRAA 2YHAA 4HWRA 3RFCA 1JLRA 3U3JA 5KCZA 2ABWA 2C2YA 1VLHA 3N2YA 1SCJA 1WUIS 1L5VA 3GRYA 3Q3HA 2I0FA 4LECA 1SWVA 1HYQA 1KAHA 3QLVC 4Q7LA 5AJUA 3J7TA 1EUCA 1EDOA 1M1UA 1IOLA 2W0SA 2YWHA 4NQZA 1RBMA 3ECSA 3LG2A 5IKPA 3OCCA 3BKXA 1K7CA 2XHZA 1ECPA 1OT3A 1XEXA 2JFUA 3PUXA 2P67A 4V0RA 2AFIE 4JU8A 3BA1A 1EP1B 3R4VA 2GJKA 5K6RA 3EUEA 3L9WA 3KAJA 1E98A 3C3PA 3DUWA 2BWJA 2I34A 3ETJA 4JLDA 1KDZA 3NYRA 3F3SA 2EP7A 3QKRA 4B7AA 1GTSA 1BSVA 1MO5A 3GVIA 4C7MA 2ZWAA 4QSMA 3ANNA 1QSGA 4OBEA 2JBHA 4BY9E 1KERA 3BDVA 2WMOB 3T3GA 1P1RA 2NTNA 3E27A 1XQYA 2PRZA 4FEEA 5CU7A 1EIWA 1TD9A 2R1TB 4A0HA 2QMHA 1L4GA 1Q1AA 3OQVA 2UYGA 2Y0EA 3DZGA 4LHZA 3AIIA 4FX2A 3TLKA 4BB9A 2QDXA 4AF7A 5CCEA 1URPA 2OUKA 4GKKB 3EVDA 3ETLA 4Y30A 3ACDA 1N9ZA 2D5LA 4JOSA 4DJTA 4DYVA 2G17A 1SUSA 5FBVB 2OM6A 5TPWA 2B8NA 1U80A 4K5QA 1B8OA 3H3JA 1T1SA 4RQBA 4S1OA 4GBED 3BORA 2M1ZA 4F97A 3O82A 4QO8A 1RAEA 3IAHA 4QYXA 3DKRA 3F73A 3CEMA 4JYAB 1KC3A 1JXMA 2QRLA 4FBLA 1XZQA 2ZTHA 4IMRA 1SCQA 3I76A 5AXBA 4BIIA 5HDBB 3TOCA 1TRHA 3RS3A 4AO8A 2QW0X 4IIUA 1XRLA 4H0CA 3ITEA 1NPYA 4US2R 5B3JC 3A8TA 1GSHA 1W0JA 2XWBF 2MU1A 3H1FA 1OI4A 1XU4A 2IZ6A 2HWKA 4R9SA 4L76A 2NO4A 3B3JA 5MN6A 3W34A 4BMXA 2PX3A 4GICA 2FZGA 3C97A 4HVTA 4ZV9A 4K1LA 1QQTA 3RIYA 3R7WA 2CY0A 4CKEA 4DMUB 1N1EA 3H2HA 3ZVMA 3BQ9A 4N5MA 3B1FA 5FNZA 1OIVA 1ZBDA 3VYWA 3O2JA 2IP4A 4DJDC 4OGFA 1FP7A 2V6JA 5IANA 1BVYF 3FIUA 3HCRA 1Q1NA 1RP1A 3EMBA 3OZ7A 3EIHA 5H70A 3L1VA 3C7CB 2R48A 2EGHA 5GVSA 2KHZA 1IHOA 2HNBA 1GYRA 1A9QA 1Q7EA 1UINA 1T10A 5COBA 4AJ1A 2WSLA 3A1WA 3CNBA 5DHUA 1IONA 4D41A 4HNAB 1M0WA 1N0UA 2J30A 1DINA 4EPWA 4JV5B 1OW3B 1K68A 4NEHB 5LQSA 4FVTA 4DIEA 1QHEA 2PX6A 5CLGA 4AS3A 2A57A 3AQIA 3RSLA 2X0JA 1MAHA 4U7FA 1DXOA 4H77A 4XX1A 3VI3B 5KYKA 2AW5A 3J81k 1CUWA 5J4LA 2R11A 2G5GX 3FB1A 1M1NA 3GA7A 3LYUA 4Z3DA 1RQGA 2J41A 2WAMA 5F3WB 1DE0A 1LI5A 4RDHA 1PK8A 4P7KA 2VHZA 3AFNA 3LRTA 1WCIA 2I8CA 1W4AA 3DBHB 5IVDA 5AUQA 1EFPA 2FRDC 2VDRB 5DTEA 3UH0A 3TUIC 4QVGA 2QTLA 4MULA 3T8YA 2PPLA 5LNK6 5EUMA 3FOAA 3B82A 2ZT5A 3WGMA 1FNDA 2OHFA 3DEHA 2ZE7A 3R09A 5D7BA 2I33A 1JMVA 3PUKA 4BV9A 4DL9A 4AC9A 1ORWA 4LYGA 1TKRA 5ALDA 3MOGA 4QUKA 1LKZA 1MXHA 2CGEA 2G4CA 3DVSX 3LFTA 3LK6A 1JEOA 4KKXB 1XXHA 5FUVA 4ZYXA 2Y92A 3IUBA 2X1VA 3DMPA 3GEDA 2ZI9A 4QBIA 5GPBA 3RANA 4Q4CA 5DVZA 1HMYA 2RGXA 3L77A 5J4KA 5KNBA 4XM2A 4M21A 2JLXA 4YEDA 1PTKA 1PYOA 1P39A 5L3ZA 3K8YA 3PA6A 3LPNA 2P5TB 1U0FA 2N47A 2NO5A 2QT9A 2X58A 1LPOA 3N6VA 4CZ2A 5FTJA 4H59A 2JHPA 3IR7A 3ZH2A 4D26A 4XJTA 3CRMA 1HT0A 1E9FA 4O2BB 3SU8A 4Y2TA 5HS4A 4C3VA 5KYUB 4WXPA 1XZEA 4ZCQA 4DW8A 4ZDIA 1QUFA 4W1PA 1DOZA 4IEEA 1ISMA 3VGJA 1ZL0A 2L18A 4NABA 4I9FA 2OHGA 4CV2A 2M6RA 3A04A 4X54A 2HF8A 5HUQA 1PNOA 3BGVA 3RVQA 3PJRA 2V0NA 4G1EB 4RA6A 1A9XA 3AUYA 1E3QA 2I3DA 2WG1A 3G5UA 3KPYA 2RI1A 4K7JA 5EZ6B 1QAOA 3WIOA 3MTAA 3U61B 2B98A 4I66A 2UYQA 2B3TA 4W9NA 3KKOA 2Y67A 4EMUA 4AKHA 1W44A 3I8XA 1XPRA 2BHRA 2ODNA 2EARA 2QUBA 3A2MA 2WU4A 4YLGA 1LV8A 2O6LA 4MVJA 3WNVA 4R01A 1RI1A 1NVFA 3CXUA 3O93A 2BEUA 1BC5A 3OZCA 1J1IA 4ND8A 4Y6OA 2RAPA 3Q5EA 2SBTA 4D0SA 3TBKA 1NJGA 3VV3A 3H97A 1FYXA 3IMGA 2ZBDA 3FOBA 4PZZA 5THQA 1IXZA 3ZU3A 4BQEA 5DNUA 1Z83A 3D7SA 7MHTA 3ZXXA 3PFFA 1B1AA 2XJ4A 4NBNA 3VI4B 2A92A 3HYTA 5JSKA 1B2LA 2VJNA 1SCAA 1TO1E 3DEZA 3KAPA 4FWBA 4O25A 4PCAA 3CRRA 1WZ2A 3KT3A 2EEZA 1MJGM 1GDHA 3AJDA 3QM1A 1T8PA 1N3IA 3OOEA 1N1GA 2Q5HA 3DF9A 2IKSA 4BEJA 2X8BA 5DM70 3KQMA 3F7MA 3KEGA 4K9NA 1M2VB 1QOZA 4O8CA 3FKSA 2O8VA 3I1YA 3KJFA 3O2QB 4I4TF 3R9IA 1NLZA 3MUEA 4TV8B 4FE4A 3AKCA 4Q9NA 4EA8A 2H1OA 2PS9A 1H66A 2FVXA 3DSRA 2AQIA 4MUJA 2G63A 4KPFC 5DPMA 3KL2A 5BT9A 3HKDB 3IAEA 4BE9A 5JWRA 2RKOA 4CIXA 4PO9A 1NW7A 4I4IA 4IY1A 2TECE 2Q2VA 5DYIA 2QAGC 1PR0A 1SBCA 4QO7A 1C3JA 4D3SA 5BWBA 2PYZA 2YV3A 2PXHA 1OBHA 3U9LA 3STYA 4R1TA 2FN7A 1K3UB 2WQ7A 1H0RA 2ODBA 3BTUA 4J43A 3BEDA 2VDKB 2A1TR 1XMXA 3LC1O 4PX9A 2O6HA 4QG7A 1KPHA 2W2TA 3L06A 2FETA 1Q92A 4PZPA 1LPSA 5TY0A 4LK2A 3DTVD 2WG2A 2QD5A 3WRXA 2D2EA 3ZBQA 1U0TA 2QL5A 3F6SA 2G40A 5DX0A 3BWCA 5ECWA 3C3EA 4TYYA 5C7IO 1NQXA 1Z47A 3UVEA 2V59A 4G0NA 3GJ5A 2ZFUA 5B1DA 3QPUA 3WP1B 5JDCC 3VR5D 2AZMA 1D4ZA 1UWCA 1P2FA 1BRMA 3GP5A 1YFJA 1KJQA 2QRUA 3CRNA 3RJTA 4ZCLA 1HQDA 3GIWA 1IJBA 4I4TB 5AOVA 1NQUA 1VSBA 3OPQA 2AN5A 2COKA 1IG0A 2YFKA 3CLUD 1VMDA 3HU2A 5DDIP 3JQEA 1M8PA 1Q1GA 3BXGA 2K2WA 3E70C 3K4QA 3O94A 2WWYA 1ZN2A 2AYZA 3E48A 2QG6A 1SXQA 4US0R 4JC4A 3UOAB 4Z4HA 3RVSA 1WM1A 2B4TO 2ZSAA 4TYQA 2XUKA 3RYTC 4B2PA 3AR9A 3FWHA 5DBHX 1A8IA 4IZHA 4R1LA 1D4OA 3ZWPA 3BZWA 4S24A 5ES3A 2RDMA 3DL2A 4BLVA 2PWAA 4KQCA 2GETA 3KEMA 1TMOA 4OKIA 2IUFA 2HQ1A 5KYNA 3DMGA 4TTIA 2NO6A 3S68A 4ZPJA 3FNHA 1JYEA 2H4HA 4QASA 2JAXA 4OLHA 4W9RA 2QJTA 3W2EA 2F1JA 5DI3A 2JLZA 2VRCD 3A9WA 3D2LA 1ZW1A 3GF4A 1T0PA 4KYTA 2FWNA 1CUXA 3IHLA 4IXTA 1YONA 1G98A 2R1UA 2EG5A 1ZN9A 2VOJA 3GJYA 1FP2A 2AN9A 3LX5A 2INGX 1Y6QA 1RHQA 5F64A 5ELXA 3RE1A 4L3OA 4KDCA 5C5CA 1AVTA 4FS3A 5PNTA 4B6SA 1XUOA 3CLSD 4TTTS 4EW1A 1XD9A 5GWXA 4C4RA 4FOPA 1RBYA 2R9VA 3KR0A 1JTEA 3FHJA 3V5NA 4E30A 1E79D 2SCUB 1C4XA 4TTRA 4JLUA 2NO7A 4XUEA 3WX0A 3PFGA 3PPIA 4Y98A 5TS2A 2QN3A 1E5VA 2C5HA 5FTWA 3JQ8B 3M9WA 8ADHA 5C4GB 4M55A 3SIRA 2XSZA 4YFYA 3JASB 1L4KA 4Z1OA 1GR1A 4HXYA 4PAGA 4Z4CA 1XZLA 4DIKA 2J6IA 1TUBB 3GVHA 5F51A 1GNPA 1OAAA 3AP3A 1S2MA 2BMFA 3OQMA 4GP9A 1O58A 4YDRA 1NT2A 4FC6A 3PQ7A 4Y8VA 3M6WA 3SVZA 4CDMA 5L95A 2BLNA 1X1SA 1U2GA 1P61B 1RQXA 2C0PA 1M2HA 4HOYA 4MRVA 1Y8RA 3CPJB 3A6JA 3A6KA 2I1WA 2NYRA 1OHHD 5G0UA 3BDIA 4DR5B 1DQPA 3OKPA 2RGBA 1IJFA 1C7FA 1S8OA 5BVHA 2XMSA 4Y9DA 5LZ4A 3EXFA 3L6UA 2FX2A 5I8WA 4YK7A 5DXJA 2V9ZA 3TZEA 1MO6A 6REQB 3AX6A 1KH3A 2QP3A 3BMNB 5LDGA 4O4LF 2AFIB 4I99A 4X1KB 1TI7A 1WDMA 3HWRA 2OYRA 3W9SA 1NVUQ 2JIBA 2OCGA 3WISA 4YY3B 4RQAA 3MT8A 4ZXFA 3UHJA 1WTAA 2PPVA 4YT5A 1MOQA 2YWJA 1WMAA 1E0SA 4RCVA 2J6HA 4J3JA 4PLHA 1ZGAA 2DFDA 4D46A 1K7XB 2AE2A 3T52A 1OY1A 4H18A 2LV8A 5KTNA 1UKEA 2XMDA 5AXCA 5JLAA 4OUKX 3V7YA 4C01A 3T1VA 2P7IA 4BNJA 3IKMB 4RL4A 1W1WA 4DJEC 4D1YA 3UMYA 5BN1A 3Q8MA 1F1BA 5LB2A 2GCPA 5AW7A 1GCIA 1QBKC 3SHVA 3EWIA 2WM3A 2XF2A 3GGPA 4H17A 5KTSA 3FPEA 5LMUB 2Z0MA 3CF6R 2DHRA 5AI6A 4BFYA 3IMFA 5JY1A 1QONA 2B2NA 5CEFA 3ETDA 3A9RA 5B1SA 5T64A 2HIGA 4HAZA 5BRAA 3RT7A 2I2XB 2BISA 2CDBA 2JARA 2JZCA 4FZ5A 1BE6A 3EGOA 3O90A 1WVGA 1VBMA 2BEJA 3MJTA 1BH2A 3CNHA 1JL3A 1HDGO 1TLLA 1PGPA 4Q66C 4C7BA 4A2QA 2DGDA 4N12A 4P5PA 2PZJA 2XKJE 4RV5A 2GESA 4E14A 4FGWA 1PO7A 4PLTA 4P0QB 3BMCB 2HJWA 2FMKA 1O0BA 3CG0A 4NU0A 2JD1A 4RKFA 4ZT3A 1PDOA 4KK4A 3W8DA 4BFVA 3AY0A 2GARA 5JSHA 1GKUB 4KAAA 4MRPA 3ZX5A 2EGUA 3MC1A 3WB0A 2H1FA 1ODIA 3IQFA 3BICA 3QXJA 1QGED 3R0VA 2JAPA 1L1EA 4Z7NB 4JVSB 2ZI3A 3VNAA 1N75A 1I1NA 4REQA 4TT8A 1FXSA 1EAMA 4HLQB 1FIUA 3RDPA 3RPEA 4F9FA 1BOOA 1XEFA 2VZ8A 1CTQA 4LQDA 5G4KB 3E5RA 2ANBA 1TVKB 4BP1A 1CJSA 2HF2A 2VVTA 3O4IA 1XVAA 3NASA 4IDAA 4IIJA 2P9FA 2IYOA 3F0TA 3SQOA 1ZVMA 2DJIA 3QVUA 2FLKA 4DNOA 3E7FA 4U5QA 5B36A 2ZJ8A 2DWCA 3M3DA 5JALA 3PQ5A 1E9BA 2LNDA 2PZGA 5BOSB 3V9PA 5L45A 1N7JA 3WIUA 3LUCA 3CLUC 4DTCA 3LOPA 2R00A 2WJZB 4ER6A 4B4KA 5AKHA 3M81A 2OLEA 3G8DA 3H9EO 3WYBA 3SZMA 4FUQA 3KWMA 1JAZA 3O7MA 5FA6A 2DR2A 3V55A 2YW9A 1GV0A 4DLXA 3U5TA 1BNCA 2DEUA 1P4SA 3HJRA 2Z5LA 5LD2C 2W22A 3GWGA 1DDIA 5TT1A 5ARBA 4D4LA 2Z09A 5BN3A 4N5DA 4E7OA 3IOCA 2AR7A 4JA0A 5B4VA 1M2KA 1THMA 2HPHA 2BAGA 5HIMA 2D5AA 1N34B 1PZFA 3LUGA 1WETA 3MB5A 4PZEA 2QTMA 1K7SN 1QWOA 1UMCB 1FFAA 2BI7A 2OE2A 4CV1A 3QKRB 1NW3A 5DHTA 2VPIA 4XSGA 3TE6A 1AKTA 3F78A 4L22A 1RXVA 3TKYA 3AJEA 1T35A 5KQRA 1C8VB 4RETA 1YCDA 4R8VA 4DLTA 2PYIA 5I4CA 1RI4A 4JLPA 4YRBA 1TCCA 3P0JA 2H2FA 3BGWA 3MJHA 3FCXA 3Q1KA 4PYMA 4QXOA 1AKVA 1JTVA 2Y2UA 3LUFA 4MW0A 1N1MA 4O4LB 4PFQA 2JJ2A 3WK9A 3RTBA 3UJNA 2XUHA 3VRHA 1XTBA 1OA0A 3SOPA 4EL5A 4MDFA 3O95A 2BPOA 4RVOA 1WBDA 2WP8J 4MEAA 4M1WA 5T6BA 1LPBB 1U11A 4TSFA 5TVGA 1EEHA 1KZGB 1NI5A 3FDIA 2C2OA 4PXYA 1E18A 3S70A 2CDAA 3ZD6A 4Y0NA 1NNSA 4UAJA 1EX1A 3PD7A 1BDHA 3W4JA 1X1BA 3P4XA 2HBYA 5D6OA 4Y2JA 3JQ9A 3MLAA 5DIFA 3FRHA 3GPBA 3FJYA 1ZCBA 3C70A 3OLCX 1VSQA 1E2GA 1NXOA 4H7HA 4PICA 5KVQA 4DJFC 2ZIUB 4UBMA 3MMSA 4OIFA 4C9BA 1YULA 2VHUA 2WZDA 3VVLA 4MVJF 3B6JA 1ZK4A 4HLCA 3EIFA 4NU5A 4LFCB 1Q74A 2NW6A 4HKTA 1TYZA 4EF6A 1JI3A 4AULA 4J16C 5KS2A 1VPEA 3DTVB 3AXTA 3HXPA 4BO2A 1JWAB 4YCNA 2X6TA 1GWNA 1Z2CA 3H1PA 3KSUA 5A0VA 4RPLA 1AGXA 3EEIA 1EI9A 1MEEA 3HR7A 3DV0B 4HNQA 3LSYA 4IIGA 3KVYA 5KWVA 3OJ0A 3BCHA 4LRUA 1W6UA 3UV7A 4HTAA 1IBKB 4YAUA 3AKEA 2X0DA 1CZUA 1UDBA 3FGPA 4KUHA 4ZMBA 4KFSA 3RIGA 1Y3CE 3PNMA 2O2SA 3BIWA 1R9NA 2JIZD 3KUXA 2EJTA 4WFJA 3B2EA 4K6CA 1EVIA 3AR6A 1CNMA 2FN9A 3LKDA 1DUSA 2YQ4A 2GM9A 4JSRA 4WLNA 1GD1O 3LU1A 2PTHA 5DOVA 3GLIB 1PUJA 1AKMA 4HZUA 3ANLA 5EWJA 5JFTA 2PKQO 5T8KC 4IEFB 4RCZA 1GPH1 2WA1A 2G9UA 1PLJA 1IZ7A 4MEBA 3QG5A 3EAFA 1R0LA 2J9XB 4HQ0A 4WESB 2H08A 3J81A 2ETVA 2GDZA 1M34B 5ENDA 2Z2KA 2WQ6A 3UMFA 2VTDA 2DBRA 4AJPA 2O8BB 1ZONA 1MG0A 5JO9A 1YIAA 4M38A 3NGMA 1OREA 3H5RA 2Z3WA 3GFOA 2Q2NA 2J8ZA 4RZXA 4B43A 4JBXA 5I4KA 1BDMA 4NQRA 4LISA 1PRYA 3F8TA 3UENA 2AN3A 4LZWA 2JJ8A 2FPPA 3RQIA 3F96A 2CWWA 1VMAA 1W5SA 1E8DA 3HXKA 4WXRA 1ISRA 5AKZA 2C5AA 3OCXA 4JA2A 4UFPA 1P81A 2YL2A 5EJ7A 5L40A 2O57A 1KAGA 3PEEA 5KYTA 4X20A 3LP6A 4OUDB 3K9FC 3OZRA 1R0SA 3O8QA 4IIVA 5KUTA 1M1YE 5K8LA 2YUIA 1ZOPA 3PR2B 5EMHA 4D3YA 5JTTA 1NDQA 1LTQA 2PRJA 2X0KA 4AX4A 4BX0A 5G0TA 1IN4A 1TADA 3LRXA 2BHSA 1DIAA 3OPXA 1QR2A 3U3DA 1YRLA 4Q47A 2Z08A 3MJFA 5IG2A 4ZVLA 1O77A 2ZP1A 2Q7DA 1DJLA 5EZYB 2QIPA 2ZWIA 5F1PA 3KHKA 2YV5A 1H2WA 2APJA 2ORIA 3OQBA 4MWZA 5AHKA 3V4SA 4CLHA 2VJDA 1ABFA 1OBOA 3EBLA 1FOEB 3K35A 4KI0A 4DR3B 5CG2A 4XYBA 1X7HA 1FFDA 3PKZA 4YNBA 2OLKA 5HE9A 5G3YA 1E1NA 3RW9A 3LRPA 3CZMA 5F73A 2KE5A 1SCNE 1TMGE 3N05A 4OGLA 4P54A 3ZCQA 2FQ1A 1OF1A 5JISA 1T3SA 5JCPA 3EDCA 2ACWA 3DD1A 4N3AA 3DUFA 2FN4A 3ORQA 3E15A 1QCZA 1SJ9A 4OX9B 5K3BA 1JE0A 2YN0A 1BFUA 2E5WA 1NQAO 1K27A 1PUIA 2YOFA 5E7MA 3LGXA 1JKJB 3SZRA 1X7XB 1L5HB 1QNLA 3THOA 3DYVA 4EO4A 1KK1A 1OXKB 5CT9A 2XI4A 3WAGA 1Q50A 2H59A 5DI3B 3QRWA 1VSTA 4Z9YA 4F60A 1CQPA 5BRJA 4WT7A 3RHSA 2VPQA 4LBZA 3DLIA 1N32B 4P35A 2GPYA 2EL7A 1UQUA 2OD9A 1ZLYA 2HFKA 1D2HA 2ICAA 5BSEA 4S12A 2PSDA 1QG6A 4M6WA 5JADA 1WQ4A 1SXJB 1DX9A 1TQHA 1ZMBA 2QJOA 3AI1A 4L73A 5DCLA 1JQAA 4WY5A 3OLWA 3WFZA 3G88A 4JWTA 4TWAA 5KNBH 4HLUA 3E53A 3EF0A 4I6GA 5L7YA 4C0HA 3DHNA 3ZK8A 4FQ5A 4CFYA 1BTOA 1VRWA 4FHZA 4L6CA 2JFNA 2XUDA 2QTVB 5HCUA 2AI1A 1K2VN 2GFIA 2M32A 2ZJ0A 4MKIA 4N7RA 4XQGA 3UHPA 2PUDA 3JQ8A 2ZS7A 3N8DA 1CUFA 2A94A 3QYFA 4B7XA 4KQKA 3HZHA 4JITA 5TPZD 4V38A 3SF8B 3WGZA 2C00A 1I94B 1SUIA 2XUIA 1KBZA 1Y3HA 4LBWA 1X1TA 4CI9A 1TK9A 2ECFA 3EF1A 4FDTA 1FJGB 2ZYRA 2FPGA 4H35A 4LRXA 2V7EA 2W0MA 1VMKA 3MCUA 5SY4A 1UKBA 3TZHA 2B5OA 5A4MS 1PFWA 1Y81A 4KRGA 4YB8A 2FG5A 2OFWA 3R8CA 4TWRA 1NX9A 1PQPA 1C3LA 1YDGA 3RJMA 3WP0A 3ZWAA 1UBMS 1XZIA 1SURA 2P1DA 3KSAC 4KHPB 3D02A 3SHWA 3U17A 3DBHA 2QD3A 2OHIA 1FNMA 2X9GA 4AP6A 5F9MA 4DNFA 1IY0A 3E58A 3W06A 1HG1A 3MJEA 3CB4A 3O4RA 4CEIB 1H9CA 3DC7A 1D6MA 3CU5A 5H8WA 1HKHA 1IMOA 2EWMA 2YFYA 1HK7A 2CHUA 2F6RA 2XOKD 3LTEA 5B37A 3OOHA 2R5NA 4F2WA 2EU8A 3VPBA 1AHHA 4AMGA 1E8NA 3Q3EA 1LFDB 1RRMA 4K05A 3PCXA 1G21B 4GLLA 2Q4BA 4HEJA 5TR9A 4ACAA 1ND6A 4C0LA 8GPBA 4OAOA 1R88A 4U0KA 4I1OA 3TN7A 5B6IA 2B8TA 1IRXA 3FTDA 5T5QA 4FGSA 4PM4A 1JNYA 4C08A 3MJCA 4KAXA 3IT2A 4KMMA 4JJGA 5F1OA 3RBXA 5AD1A 4Q3LA 4DRXB 5K0JA 2Q7XA 1YAHA 2DH5A 2QUZA 4UTXA 2X7JA 4LC1A 1DBPA 4D8UA 4MQ6A 4Z99A 1D2RA 3UKDA 5FV4A 4XDHA 5CDYA 1NONA 3D8UA 3CZRA 3W7VA 1LF0A 5IT5A 1U9CA 1WSDA 3A31A 4EAQA 3EG9B 1JDSA 4MWSA 1ETHA 1UIMA 1IVYA 3ZHQA 4ZVNA 5BR7A 3QEOA 1KU6A 1LSJA 2X7HA 4LHSA 4LQCA 4Z9AA 1J0BA 4RYLA 5E6UA 5HZHA 5J1TB 1VG0B 4NJEA 1LLQA 4UC0A 5CDFA 2KW5A 2OZVA 4JX9A 2FW9A 3CURA 4ZRNA 5H4GA 3ADDA 2HKIA 4TKUB 2YWDA 5EQJB 3TINA 4CMCA 1AXGA 1SOWA 2WEKA 1HE2A 1UWLA 2IF2A 2VUUA 4M9UA 4Y0VA 4RY0A 1QRDA 3CNLA 2AOTB 4CFSA 4XB2A 3IXMA 1QC5B 3MCZA 2PR7A 3M4NA 1DC3A 4WADA 3S27A 5KTKA 1K0FA 1XZHA 1EP2B 3GLKA 3D6JA 3LKZA 4F3KA 1NVEA 3RJ5A 2IXTA 2I1VB 3MERA 4UDOA 4WJZA 1YE5A 5HQ3A 4JCOA 3IEPA 4URHA 1OU4A 1SKYB 4UZEA 3CW2A 3C5VA 4WINA 2BCGY 3AR8A 2C20A 1X1EA 4D82A 4D4MA 4RK5A 4ZZ2A 1U98A 1U9ZA 3P5SA 4ZJYA 3OIFA 4A16A 2CVFA 2VAPA 1S2LA 4RIHA 3NWPA 2R8BA 2GGSA 4MB2A 1NSFA 2K2QB 4F7DA 3NBUA 4OG2A 4OMFG 4F85A 2IS2A 2CW5A 4I6EA 4JJ8A 4KN9S 5B64A 1FF9A 3JYPA 4RO0A 1M6WA 2O1WA 1J56A 3JQCA 1I3MA 3ZWMA 4PN3A 4RTRA 3DPUA 3KTOA 5TEWA 1C4OA 1GOTA 2PKXA 2QY6A 1IHDA 5C8XA 4XIYA 3P20A 1OFUA 1BQ4A 2YOGA 3KDPA 2F62A 1E1DA 2GKOA 4Q4JA 3RK1A 1VRCA 2G07A 3C74A 3EZ7A 2J87A 2HBQA 3INYA 2Q3EA 4H4DA 4PY2A 1HWYA 2AN4A 1O08A 1HL7A 2P7HA 1A8PA 1P4JA 2NIPA 2PX4A 3NC0C 4P4GA 5C9ZA 4X85A 3BRWA 3L9XA 2NUTB 1Y7PA 2G70A 4FNAA 3UWSA 1NI4A 1AXRA 3FMOB 3L1HA 4HP8A 2QNBA 4MHOA 4UBLA 2YFQA 1KORA 4LXGA 5HQJA 2P2GA 3RODA 3O3CA 5DBFA 3TBHA 2J5QA 3S6JA 4P7BA 2BELA 1J2JA 5L3QB 1IQRA 3OEYA 1KTVA 2AS0A 2OQ2A 1QJCA 1Q84A 3LY5A 4QFMA 2HRQA 3L7JA 4EHDA 1EEXB 1OASA 4OQEA 2COUA 3AY6A 3KXPA 1MX1A 2BTQA 1HEYA 2LXNA 3AESA 4HF7A 2ZRJA 2WJIA 1K75A 4AUKA 5FEUA 3VR4H 3RREA 2IYWA 3VX3A 4JT8A 2SKEA 2QJRA 4F72A 1HDYA 1XF9A 1Z62A 3IPAA 3S3TA 4GGOA 2HD4A 4HUQA 5IHXA 2IKQA 4D80A 2I7TA 4Q9DA 3F3YA 2NN3C 1WS6A 3LUPA 4PPQA 4BPBA 2FPLA 2ZCJA 2FGKA 1DTSA 1OWOA 3E3OA 4JBIA 2E82A 3TIVA 3G82C 4MLZA 3PFKA 4PYJA 2ZYSA 1JG3A 3AG5A 2Q4EA 1XLVA 4OXQA 3DE2X 3O4FA 4OYRA 5K0CA 1AUQA 1K92A 2OXCA 4FDMA 5EFOA 3FIJA 3HDQA 2QMZA 4Y6RA 3PXGA 9ABPA 3AIKA 1MJHA 2QN9A 2ZTSA 4TVSA 4BIMA 4G25A 1T8YA 3E0XA 1CR4A 3QMMA 4P6VF 1HDXA 1ST2A 1ZH8A 2VHCA 4H1TA 5EKSA 3UGTA 2B9VA 2HRZA 1A27A 5CVVA 3PTAA 2EG9A 5E2AA 1YFLA 4Y2YA 1VG1A 1X7WB 3VISA 1XU7A 2LP4Y 2JIOA 4N1AA 2ANCA 1RJDA 1CBUA 5FHQA 3AETA 1N3BA 1RMTA 2NUBA 4NF2A 1U99A 2QX6A 4HEHA 5C35A 3DZHA 3IBGA 3RBAA 3H8SA 3KXKA 3LZ6A 5COAA 4AWAA 5H82A 2Q6KA 4EJMA 5L3SB 4DKJA 5BSVA 1PDVA 1EFHA 1M67A 3CZQA 3IXQA 5FFFA 5EJ6A 4J4HA 2VWPA 1GR0A 1SHKA 4OFZA 4RLFA 4FT4A 2B7BA 2ZSEA 3GLRA 3LYHA 2GD1O 3LQRA 2I7VA 3RGGA 3R75A 2A0WA 2HQSA 4EELA 4Y3UA 1J9EA 3OJFA 1NHWA 5C5IA 1QFSA 4BATA 2FQQA 4EABA 1V7ZA 2AKAB 2H85A 1SGWA 1UEIA 2X5JO 2XDYA 3IULA 5K3FB 3WKEA 3WQSB 1UFQA 1SOMA 3A4LA 2J67A 3ZNPA 1S9DA 4HL6A 2ZRAA 2NPFA 5L3QA 2QZPA 2OHOA 2AOUB 4G5OA 4BFCA 1DMSA 4Q4HA 5CFQA 4AZ3A 3N3BC 4MVCA 3TJZA 1JLLA 1LNQA 2J9GA 1ZCZA 4C7XA 3J7AC 1F12A 4W8OA 5ERYA 4E5MA 5DM60 2YVKA 3RUCA 3W5DA 4I8XA 2RMKA 1B7GO 2BUAA 2PUJA 4RIIA 4F6LA 1KEWA 2Y0PA 5LOVF 4IQGA 4IJVA 3HADA 4L4ZA 4RL6A 4YONB 1J5XA 5GTDA 3HJFA 3HA5A 5A4AA 2EJBA 1N5OX 3WRWA 4YCBA 4AP9A 2WYIA 1BW9A 3EGCA 3K32A 4HFMA 1G9XA 2PT6A 3C8HA 2H7YA 4PSVA 3FDXA 4PYRA 3C3KA 4WKBA 4YDHB 3D0RA 3OY7A 5GZ1A 2FLWA 3D2AA 5BW5A 4LV6A 3BWVA 3K1JA 4TLLB 4FZVA 4C0JA 2B1IA 2R8YA 5EINA 1IIBA 3P2OA 3NHZA 4AQDA 3PI7A 5BWMA 4CLRA 4G84A 3BXPA 4WEOA 2IYXA 1WAMA 3O1JC 4UW9A 2R66A 3PJFA 4ZVRA 5AVQA 4HNHA 3QLUA 5FEMA 3DMFA 2G88A 1QGOA 3QF7A 1L8QA 2B69A 2Q29A 5D3ZA 3TQFA 4BBZA 4YBRA 2VHQA 1X19A 3AEYA 3PNPA 5FXMA 4BO4A 3K96A 1KQGA 2QVLA 4UD6A 1CUAA 1KRHA 3KQLA 1NQ5A 4QATA 4UHDA 1L7QA 1OQAA 4YRJA 1XP8A 3DEAA 3RK4A 4LV8B 4RH0A 5ERGB 1M8GA 2KLBA 3N0RA 3OFSA 2QV0A 1EB8A 3AB8A 4AZ0B 1QIFA 3HUDA 4O0LA 2GZ3A 1R0CA 2HA0A 2BZGA 5KZMB 1J90A 1ZJYA 2PGOA 4M6WB 3KL4A 1WDWB 1J2UA 1KXZA 5JCJD 3CTMA 4RDCA 1I2BA 4HS4A 4DLBA 2Z2XA 5AICA 2D4HA 1L1FA 3IEUA 4IVRA 1QH1B 1EFPB 3K4PA 4YWHA 1MQ8B 1NX6A 3SD7A 3TTVA 3UBMA 3WC4A 4DGSA 4DMHA 2C8KA 2VQEB 3FM9A 4O4LA 2EW2A 4RFLA 2H2HA 3WNZA 5DNDA 3T1QA 3I5MA 2HL6A 3LDGA 3EJWA 3ZWBA 2PE5A 1I6WA 2BBOA 2A7XA 5TMDA 1X7XA 4HFNA 2JIDA 1QLJA 2ONJA 4OJMX 1DX6A 3TMYA 3P0FA 4LE0A 4K3VA 4NE9A 2EWWA 3QE3A 2XSZD 1VCHA 4B44A 1V8ZA 1MTZA 4QNNA 3X1WA 3O4JA 4LXHA 4Y2PA 3ONNA 1Q6ZA 3UB3A 3QUBA 1GPLA 3NLLA 1NP3A 1L5WA 1QYDA 4R1SA 2DKNA 4J0KA 2Q5EA 3DZ8A 1XLTC 1YA4A 4WFQA 2GCGA 2I2CA 4I6JA 2IYSA 3ZE7A 3BS4A 3IDAA 1NTRA 4EHKA 4UEOA 1U0SY 2ARKA 1XD2A 2XNSA 3SHQA 4R2WA 2A5LA 3VO2A 5LVAA 4DIFA 3CF4A 5FUYA 3RUPA 3WLJA 3ZKWA 3L49A 4U3JB 3UWPA 3RS7A 2CDCA 4BUJA 2YIMA 2Q0XA 1JHRA 2IYEA 4FMDB 4N47A 1HURA 1VIYA 3FNBA 1RCFA 4L9SA 1RKQA 1ZZEA 4MPPA 1QH9A 3PC7A 5C4MA 1P73A 4JEIA 4ZU1X 2QRZA 3WWCA 3WAJA 1KS2A 3PGKA 4PBTA 1MRZA 3KKNA 3NC1C 1XNJA 3MNFA 4UBNA 3M2PA 3TIIA 2GNPA 3GPCA 2KBFA 3KLBA 1FVOA 1DEAA 2XV1A 3PGLA 4D4HA 4CV0A 3ACCA 5FR2A 1NW4A 1THGA 1E4OA 3Q6NA 2C5FA 3GW8A 5BSHA 5KNBD 4I4NA 2IDMA 3BJIC 1H2RS 1J06A 1QB7A 3RBVA 2VP4A 2I80A 4ER5A 3K6SA 5U4QA 3QZUA 2FFQA 1WU7A 4H6PA 1NXXA 2VUHB 2P9ZA 3AU8A 4DIOA 1GM5A 3KLMX 4G5GA 4HAXA 2C1XA 1G8FA 2FEMA 1Q7GA 2ZI6A 2ZJ4A 1B41A 5BXQC 2UVPB 1T8UA 5EIBC 2QX9A 1RADA 3UMJA 4QRDA 1P33A 3TQHA 1LA2A 1HZZA 1GNSA 4E2WA 3QJ5A 3DDSA 2X3FA 3IH5A 4IQ4A 1OR8A 1QHXA 1EK6A 2MMGA 1DAPA 3ELBA 4H60A 4QARA 5E2IA 4B0PA 2ZWOA 4LYEA 1SXIA 1NXQA 1N2IA 1U3FA 3MMPA 5LNK1 5EE9A 3S81A 1M2GA 1XVUA 1Z73A 1ZIPA 1FSGA 3GBPA 4IUDS 4ZVVA 3MAGA 1YZTA 1NSTA 4EI7A 2XB2A 4YCLA 1ZCAA 3R9XB 4U7WA 4YUVA 1ORDA 4CTMA 1D09A 1G63A 3R23A 3GG9A 2Z04A 4TMTA 1VL6A 3SVTA 4MKZA 2CL6X 3ZCUA 2RKBA 3ID6C 4H15A 1ORVA 3FLAA 5GADl 1GADO 3RKSA 2I3AA 2O06A 4QDXA 5CDFE 5JNVA 3FZGA 5GJBA 4H3SA 2W00A 1LF5A 4JHXA 3X1KA 3KSDO 4H0FA 4RD6A 3T5AA 4WHMA 3GNLA 4O33A 1NATA 1QFZA 1U8AA 1ISPA 2GZ1A 4I55B 1PJLA 4I1YA 4BNZA 1P0FA 3ESCA 3I04A 3KE8A 2UYCA 5DYNA 3ZVLA 3AOGA 4I1PA 4TL9A 3TM5A 3W6NA 1JQ5A 3GAMA 1CG6A 2B34A 1XZFA 1DNPA 4GT1A 3SYKA 2EW8A 4ZYUA 3PG5A 3U1BA 2QN1A 2BDEA 3PIIA 5IVKA 2Q50A 1KZ6A 3KOUA 1SD1A 3CISA 5KYYB 2HYDA 3IAAA 4XR9A 4JI4B 2AQ8A 5I47A 5LQDA 2NYVA 1PEAA 1JQEA 3BYZA 1QK5A 2YXBA 4FGLA 5CA0A 1WMBA 1J99A 4YCSA 3JVIA 4Z54A 1W87A 2QSUA 3HCAA 1QP4A 3ZWXA 3A1DA 2AZXA 4X1OA 3OP4A 4LEIA 3GG2A 2X8LA 2PS3A 4TUYB 3K72B 1M2WA 2X0FA 4CKCB 1X42A 3D8SA 3G2PA 3R5TA 1CWUA 4GZ5A 4RH1A 1MH9A 2QRKA 1JH9A 1EA7A 4QL3A 4HQLA 1ZLXA 5AOCA 4UXHA 4KQIA 4TMVA 3W0LB 4NENA 5DT9A 5K6AC 3O9VA 3AOEA 4BWVA 1ZL2A 1QRUA 2R751 4QDTA 5TJ9A 2B4QA 5DW0A 3LM8A 2XZLA 3SE7A 4O5AA 1U5BB 4RJ2A 2OCYC 1F8GA 2I3ZA 3C7KA 3N2ZB 2OXFA 3H2ZA 3TD2A 1K4MA 3OVMA 3AVXA 2JGLA 2ZLBA 4L27A 2WKQA 1QCDA 2G36A 3ET5A 4N39A 4OQFA 4J3NA 4AF6A 2PZKA 5G53C 1NMXA 3IAXA 4BMZA 3C4VA 4BJ5A 4R41A 2IUSA 2QW1A 1L4UA 3A28A 5LR6A 3VR5H 4BGDA 2C99A 2ERXA 3IQWA 3N2GB 5CVDA 2OB1A 4HB4A 1KE2A 3WK8A 2X6RA 4XWGA 1QIEA 4QJ3A 5I7FA 3GJSA 1E1RA 4LZNA 2C5GA 2EC5A 4UDNA 1V7CA 4IHJB 4NEQA 2VDLB 3OZWA 821PA 4CEIA 4BX8A 2AZTA 1JF8A 3U7RA 1Y63A 1F20A 1OZGA 3EFBA 4KQ6A 3M6LA 4J0GA 3DXZA 2D8MA 4MRMA 2DFVA 5HILA 1XMQB 4P3KA 1OZAA 5KIAA 1ACLA 1WB6A 3SLKA 4GO1A 1O57A 2C92A 1DLIA 1OPXA 4MVYA 4O3MA 2XXAA 2NSJA 1EAYA 2AFHA 1X7WA 2WR8A 3AQ4A 4A6PA 2PNJA 1IXRC 3C1OA 1RHMA 2RARA 4XFDA 4KQEA 4MQFA 1E96A 2X1LA 1WF6A 4WK0B 2F55A 1TJNA 1UKZA 3AIMA 1A5SB 1HSZA 3GBSA 4G4SP 2I22A 4B9EA 5LKRA 3VSDA 2JJMA 3CF4G 2ZWMA 2BSAA 3JS5A 5BNTA 2MWMA 1NJ1A 1RHJA 3OQ6A 4K86A 4EBFA 1CP3A 2AR0A 4CLOA 4F86A 3IT0A 3IPLA 3KU1A 3H2JA 4PFSA 2JAWA 3WZMA 3X2SA 1AZSC 2H0QA 4DHEA 2X41A 2PRIA 1ISFA 3CINA 3TSCA 3SS8A 1CQWA 2QTZA 3CWZA 2HGZA 3TIFA 3ILHA 3KUKA 2CWDA 4HWKA 2VZ0A 2VDPB 1JDZA 4G8DA 4L0DA 5ESXA 3IVRA 1PR3A 3BJEA 3VM6A 2IPMA 2WDZA 3FI0A 1I3LA 4TYPA 1AZWA 4YC7A 1ZUD1 1CZHA 3ND8A 4I4TA 2P3SA 5FF9A 3SMVA 5C37A 1EX6A 4DGQA 4MKXA 4DARA 2G1KA 4XR4A 4MGKR 2Y1WA 5G0SA 2Z58A 4HFRA 4I55F 1H5NA 3HZOA 2PH1A 4RA9A 3VKFA 1I5OA 4LC9A 4XCVA 1CJCA 4YYZA 1QQ7A 3AKYA 2PUWA 3ZUGA 1D9XA 4AN4A 1OC2A 4OQNA 4DANA 2EJWA 3KKLA 2BEWB 4F9GA 1KZ7B 3ENNA 1FFXA 3GGOA 1KXJA 4GVXA 1ZNWA 2ZKLA 4KL8S 1IY1A 1E3IA 3PPVA 4CF4A 4V1CA 1F6WA 2X0EA 1W1UA 3ESXA 1NNEA 4R0NA 4ALIA 1OAKA 1WCIB 5AW8A 1M1YB 3QVKA 4RIFA 4Q7KA 4BNWA 1F4VA 4HQKA 1QLWA 3W8EA 1UMKA 5DBOA 1R6DA 5LQRA 4E09A 1NXVA 4G5YA 1UZUA 2C54A 4JJAA 4UJ3A 1MRSA 4KXFB 1L5NA 3KSZO 4I50F 4ENRA 1T3TA 1GPDG 4EW3A 1VCMA 2ZM6B 2PGLA 1CS0A 4XZ3A 4DT1A 3EC1A 3PR3A 4G4IA 2FR8C 1E3JA 2MDTA 4D4JA 1KOJA 1FSSA 2OPBA 2VP9A 4KXNA 4TGLA 3NBAA 2AVNA 2IU0A 5HXAA 1QF6A 1JEJA 1R0ZA 1U28C 4B4OA 2YJ6A 4ZYWA 1AN9A 1U6JA 3AFOA 1QHHA 2Y77A 5CVJA 2YJ3A 5I5EA 2H3EA 1ETUA 2W11A 4Q3NA 1LDEA 1XRPA 1UOPA 4YPVA 4URUR 3MS2A 2G8NA 3TXXA 4B6RA 1KIAA 1NBWB 2VQFB 2WB4A 1C3XA 4FHCA 1CY6A 2IBSA 2CJPA 1NM5A 3CEHA 1RHRA 4HEQA 3UFBA 3ZHBA 2ZREA 3ZWVA 5IU6A 2HRDA 1T9ZA 4AM8A 1QCYA 1OJ7A 4E22A 4H2DA 4ESVA 4DUPA 5EKTA 2F9FA 2XA9A 4P2BA 3IE1A 1AGRA 1V11A 2D7DA 1U02A 1YNSA 1U2RA 4XQ0A 4MUAA 4HUQB 4UQPA 1N57A 2AV6A 2IW1A 4R84A 4HC4A 5FI5A 5FOVA 4I8IA 1RYMA 4TLCA 2IHZA 4QHYA 3TVYA 4B84A 2QRMA 2WM9B 2WSMA 4Q3AA 2ZTMA 2CXNA 4WNYA 2OLJA 1DX4A 1U3TA 1XYYA 3Q40A 2JS7A 4IHQA 5GJVC 2ZKIA 2GEJA 1E20A 1T5OA 3C1TA 3ECCA 1BH6A 1GDDA 1M2NA 3O0TA 4BFTA 2BKAA 4EDHA 2O3RA 3IKTA 4P3NA 4YRKA 2WFMA 3EHDA 3K7EA 4G0YA 1R9MA 4I5DA 4WNAB 4RTSA 4IKPA 3NTXA 1E8MA 3BVPA 4ONEA 1YVUA 4TVKA 5F1KA 5TEVA 2M1XA 2W6IA 4WLOA 4ALJA 4ZC8A 2XOEA 1O94A 4IZOA 3U5ZB 4GOJA 2B6NA 4GPD1 4MV3A 4EM6A 1KKLA 1QO0D 4EFDA 1PWHA 3R3SA 1E6UA 3EZLA 3OJOA 3K09A 1RLOA 4KX3A 1FE8A 3AKZA 3LXXA 4N3CA 4ZN6A 3CIOA 1NWHA 2A5YB 3EA4A 4II7A 4XRRA 4YV7A 3JWIA 4JQOA 3ROGA 2Q3BA 1D03A 5IXYA 1Y5NA 4I36A 1UDAA 2BV3A 4XPIA 3K16A 4YAEA 1IQUA 1SVKA 4ZTZB 1K63A 4JEHA 1LI4A 4FIDA 3W1EA 2LW7A 3T35A 1ONOA 1NLMA 3LBHA 3U2QA 3K0CC 5HCIA 2BMDA 2CJXA 3EY4A 3GVPA 5GV7A 1UXJA 1CNEA 1DIOB 2EKDA 1EESA 1T5HX 2J7KA 2YMLA 3KPJA 3V7UA 4YRGA 1S7GA 3RR2A 4D81A 1MORA 1X1RA 3QY0A 2C9DA 4JKIA 3ZLTA 2QR2A 3ESYA 5IPFA 4UULA 1J2EA 3NO4A 1DPGA 4B2IA 5LUBA 1RC8A 4WGFA 1XEWY 3NOOA 2I1LA 3O4GA 2ZBPA 5J2UB 1ONNA 5L3SA 4MJLA 1IZ9A 1GG2A 3NVKI 4B32A 3WICA 1GZ6A 3F98A 2JAOA 4LC0A 5EZQA 3AF0A 4DIDA 3HN6A 2LIPA 4D5EA 3TSWA 2TMYA 3V00A 5FI0B 3TEJA 3TTTA 1RRCA 4GNKA 5ABPA 4EUNA 1PFYA 4OFWA 3ZPXA 4GLFA 4EJFA 3RU2A 3VNSA 4IIHA 2QX7A 3GGSA 3QFFA 3W5CA 3K0HA 5CCXA 1U7OA 4GXNA 1ZZGA 2WTBA 2IPNA 3EGXA 4MSUA 5G1OA 1AH2A 3A1VA 2CJFA 4YAJA 4K2AA 1DXHA 3L2OB 2C2GA 2GXUA 2ZBUA 3LF2A 4F2HA 4D8XA 1TIKA 3AF5A 2ZYVX 4RACA 3QX7A 2ZB8A 3N0VA 2XXJA 2PMWB 3D0OA 1U2TA 3NTLA 4N0DA 3ZK7A 4BZWA 3G89A 3PHLA 2XTNA 3AR3A 5I51A 3NFRA 4HSEA 3SMQA 5A9RA 2OD7A 4OHXA 2XB6A 2OT3B 5B1HA 3C3BA 3I9LA 1GN8A 1FDTA 3KCQA 4HAVA 4JJIA 3REOA 3PEYA 5FL3A 3HCWA 3V2IA 2JI7A 3A6GA 3LZDA 5AHOA 5D1NA 3DDOA 3VR6A 1C9EA 2QVGA 2HIAA 1CHDA 3BCRA 3CG4A 3C4JA 1YOVB 1DKPA 1JLKA 4MP8A 1OLXA 1W25A 1GYQA 1HDOA 4CM8B 3BE4A 2CMKA 2OFFA 2K5UA 1WB4A 1L8XA 2P11A 2R7MA 3S2IA 1AO0A 2QU7A 3MM4A 2WFLA 4QYWA 5BQOA 1GQRA 5FR1A 1RJGA 2I2FA 1C9KA 3UGQA 1EE9A 1TIBA 1FMCA 3TGWA 4AJLA 2H5JA 2GWHA 2YXPX 3U3XA 1UPXA 1R5JA 3DBLB 2XB9A 3ME5A 3WB1A 1WUJS 1OFUX 4M9RA 3O73A 2I78A 5AK5A 2J0QA 3WGQA 5H83A 2GM4A 1NFQA 5KWSA 1YFZA 3V6MA 2IXFA 3NRBA 1KYZA 2ZIWB 3SYRA 2FPSA 2AG6A 2DF8A 1ADGA 3D7MA 4AZVA 4F4JA 3CVJA 1E1KA 4DB2A 1DKLA 2HEGA 1Q14A 2D0IA 1KP9A 5IWCA 1EFAA 1IWOA 2GHQA 3CRVA 2ZBGA 3A6PC 1YDEA 4GLJA 4XX0A 2HREA 4JT9A 2J08A 2JBAB 2R62A 3F1KA 3R8XA 1OH7A 4YP0A 3MUNA 2Q2OA 1JW9B 2VDWA 4GDMA 2XITA 4JL6A 4MCAA 4PIPA 2NG1A 1XYGA 1JEYB 2YRXA 4AROA 1SWWA 2V3VA 2VNSA 1XRNA 5JPDA 4TS3A 3K1AA 3EE6A 4G24A 6GPBA 3GRRA 1KDYA 3WA6A 5FD8A 1RWWA 3WL3A 1YBFA 2IZ5A 4FYVA 5ECYA 1J4AA 5C1IA 3RUEA 1ZBQA 3VHXB 5KEIA 3ZIUA 1M0EA 1DAEA 5HRUA 4LBVA 2G77B 3ZC3A 2J7PA 4JYMA 4DAOA 2WF9A 3ET4A 3MWGA 1X3SA 1LB1B 3ER9A 1HFWA 5FQOA 1T8RA 2PA3A 4P3XA 2FZ4A 3RUIA 3SF0A 3VHQA 3QV1A 5AWFC 1V6AA 2I4OA 5B7GA 3D6FA 3EEOA 1ODCA 3GFVA 2EIXA 3PUIA 1R37A 1DO2A 4I81A 1NI4B 4M36A 1EZ4A 3A7DA 3FVRA 1I8TA 1IIRA 2M6SA 1F2TA 1WXDA 2VF8A 2W71A 3NHAA 1DWUA 3WO1A 2VJQA 3LKBA 3IP8A 3OD1A 1RZRA 3GRUA 1LRJA 3I23A 3WV5A 4EMTA 2G72A 3KDAA 4HDSB 5FNVF 3NBKA 4DZTA 3AV0B 1IBMB 4D9MA 4X71A 3BREA 5JQGB 3HYNA 2DP4E 5IBCA 4NFLA 3OSZA 4BECA 5G02A 5JG7A 3A4TA 3WR5A 2F3UA 4EMBA 1ZH0A 2XH8A 3FW1A 4MIOA 5A2GA 4ZVKA 2PSEA 1TZBA 1CUHA 2H4XA 1FRNA 5JZ9A 1C9YA 3L0DA 3RWMB 4NG5A 3SX0A 4JS0A 4OQZA 4ALKA 3A4MA 2UXDB 2ZYDA 3QVVA 5LLSA 1RJWA 5ESRA 2RGUA 4N3NA 1LBQA 4NAUA 3RSQA 2AVDA 3STVA 3DLTA 1ORIA 3F3KA 4AJNA 3QA3E 2XB8A 3W3ZB 5B57C 1JSCA 1A9PA 2HHCA 2W4IA 4UTNA 3K1YA 4DUGA 3SWWA 3INGA 5JO0A 2G5CA 1P6XA 1FNBA 2ZU0C 3GR6A 1Z82A 2EL9A 3CR7A 3H7AA 2I2WA 2AFVA 4NI5A 1A8SA 2P35A 5T3YA 4TKVB 3EPHA 3MWYW 3WKBA 2XRMA 2REQA 1Y8ZA 1DEKA 2ZYGA 2YY5A 1W8DA 1M1XB 4F45A 1VXOA 4WAUA 5AM2A 1NWCA 1Q57A 2CNWA 1VLVA 5TGZA 4QUBA 1XZMA 2B35A 2I99A 3WK7A 5EJ5A 2IIBA 1JT2A 1H6DA 2DR3A 4NU6A 3T1YB 1T5SA 2CEAA 1M83A 2GXQA 2YJTD 1L4HA 1XDSA 2VG8A 2ZBQA 1NN3A 3FLBA 4EB6A 2JHGA 1IZ8A 2VPWA 1FFBA 1OWNA 5A4DA 4PXAA 3ITKA 3I09A 3U4QB 3HDVA 1F6DA 3CE9A 5AKEA 1E2NA 1JFRA 3RM3A 2GK7A 1UPAA 2PD6A 1JLSA 3KLNA 4BKUA 5D51S 4ZJUA 3H3FA 4L5YA 4QXMA 4CU5A 1EUYA 1HTTA 3KTFA 4U2FA 1U2ZA 1S02A 4IFTA 5AXDA 1RRKA 4CI0B 2PIAA 3PSAA 3OQPA 4BZZA 4CF6A 1ESEA 1W75A 5IVPA 3DWFA 1DJNA 3GRPA 2FWMX 3FPGA 4HWPA 1TTHA 3SAJA 1U9IC 4RJJA 1F7VA 5IT0A 3EAGA 3RRBA 4G56A 3WNBA 1N2XA 2O3UA 1QK3A 5TGDA 3TZLA 4EAAA 4ZI2A 1IB6A 5IHPA 3MT0A 1A72A 1NOJA 4G9EA 4W5WA 3FOCA 3ZCPA 4B9AA 4C4PA 5CEJA 1GP2A 2DSNA 2VDUE 2WJPA 3F4KA 5JXWA 1LRLA 2HB6A 3L8CA 5K0NA 1GT6A 2R79A 2WF6A 5CM2Z 1TIPA 3W3AH 3MCVA 1E1MA 1YS2X 2QIOA 2JCXA 3A1SA 1IDOA 3FD8A 3M5PA 4IS2A 3S99A 3ED5A 1OYVA 2HHJA 1NSYA 3PNKA 4XGNA 1ZOLA 1Z06A 4RTNA 1X80B 2PD4A 2A58A 5HVNA 3ZWNA 1S4QA 4KAFA 5A3RA 1A2KC 2JLBA 5L3VA 4NESA 1SVLA 2XUZA 4NNOA 5ITSA 2IEIA 3WL4A 4YN3A 4J0QA 2Z4TA 1B93A 2EZ8A 1FQJA 1YGPA 5AJWA 1TU0A 4Q1EA 3KSMA 1CEXA 2GF2A 4HQOA 2BF7A 1UC9A 3AWDA 3KQWA 1NJFA 1IBRA 2XCLA 3L84A 3GDOA 4RKQA 1KI8A 4IOJA 3TQCA 4KQHA 2VZEA 3RROA 2OCDA 1IHPA 4L8YA 1JEDA 3EFHA 4PLVA 3G2NA 5EMNA 5GONA 2H0RA 3OKCA 1YO6A 3TTYA 5C8YB 1B00A 4XWKA 4M0KA 1SR8A 3SEAA 3A37A 5C32A 3E35A 1EGVB 1QGUA 1RQLA 3LXUX 1MT3A 3GLFE 4N5LA 3FTPA 3JQRA 2HXSA 1CLEA 4RJIA 4JJFA 5CM8B 1DOAA 1JHMA 2JA1A 3NIFB 5ITZA 3DMYA 2RCYA 1BS9A 2VAMA 3OZBA 2CXQA 4BASA 4DCUA 4H4EA 2D1YA 3GRAA 4OQMA 3H5WA 2YCBA 2R8OA 3HB0A 3FFTA 4FBGA 5AOBA 5HKAA 4M60A 1POXA 4FFWA 1OH8A 2MT9A 3Q7SA 1P5FA 1TTTA 1OFTA 4COKA 3DH0A 1IU9A 2IEAA 4L4SA 4JX8A 1Q0PA 1UP7A 1KQOA 1DOHA 3CKKA 4KR3A 4IMPA 3HJNA 3M9XA 3QVLA 2AR9A 1P1HA 3TUJC 5JHGB 1V3QE 3ZW9A 3IGFA 4TL8A 1O4WA 4N18A 3D0QA 4A5SA 4Z7OB 2OCBA 3AHDA 4ZFNA 5KPDA 4JUBA 3JRXA 4EKIA 1NQVA 1QU3A 2WVGA 2QTGA 1UBNA 1HNNA 2A5FA 5BUCA 4NS4A 1L5QA 2NQ2C 4R2MA 4KDEA 2XTMA 3N0TA 1GA4A 4LVUA 4HATA 3HUTA 4Y6LA 5BN5B 2I67A 1ZIXA 1VL0A 2P9HA 1WDTA 4TOIA 1PJSA 1M6YA 1MV5A 4J1TC 4EJSB 3VAAA 5KKNB 1T2DA 1ORTA 4KVAA 1Q12A 2VH1A 3H8WA 3NAMA 2DH6A 2W6MA 2ZATA 1YR3A 2WNHA 4MUNA 3C6ZA 1V8PA 2E5FA 2IV2X 1M75A 3AHJA 1AMOA 1FYFA 3LCJA 2HT1A 2Q8NA 1A97A 2R60A 2BTOA 4BX2A 1P6QA 3RVDA 3K5HA 2PU5A 2ZUFA 5CURA 3VDXA 5K3DA 2PGNA 1YJAA 1DPFA 2KX7A 3AKDA 3LUJA 1KMCA 4PYKA 5A5VA 1NVTA 1OLUA 5LLDA 4F6RA 3FTEA 1XIVA 4EGAA 1CF9A 1K1EA 1UR5A 3BJRA 4OD0A 4QUIA 5EPEA 2P2NA 3RWOA 2DHEA 4F1KA 3KKQA 4OAPA 5C34B 1QZZA 2XY4A 1YWGO 2O05A 3BX1A 2G7ZA 1NN5A 5CH3A 5H9VA 3UPTA 3VYVA 2GLTA 1B73A 3PEUA 4L95C 3F3MA 2YOHA 1L3CA 1H22A 1P4RA 4TV9A 2DFKB 2CEKA 1MJNA 1NDUA 2X23A 3OUUA 3ZDQA 4A2CA 4YQYA 1VHDA 5C81A 2HV9A 1NJ8A 2CF6A 1SUAA 3MS7A 4N5HX 5LBTA 3RUAA 3USCS 3FOFC 1BVHA 1ZYUA 1LPAB 2Q9AA 3PQ2A 1B74A 3NM4A 1JDBB 1CY4A 3H2KA 3PHGA 3B1WA 4RJTA 5L4NA 1M3SA 1XK7A 3GZTB 2GZRA 4RFSA 3MT9A 2ZBRA 2CMGA 3EW9A 3TI7A 4PIMA 3FCUB 3G9UA 1ZNQO 2H63A 3V9AA 1PYDA 1B6GA 5I48A 1HTWA 4P0TA 1P4AA 4LIPD 1YRAA 1AHNA 1TMKA 4FI3F 4JVMA 4X1YB 5FBLB 4CKWB 3DUFB 4YUAA 2DWQA 1SBIA 3WI7A 1PGQA 4UVGA 4D9JA 1D2MA 3LGAA 1T4GA 3SX2A 4CCYA 2IH5A 3KR9A 2FR1A 4IOMA 3HN2A 2DCUA 4YMSA 3AG6A 5WRFA 4TTPA 4F4HA 5F4BA 3K20A 4LY9A 4GVLA 1TF7A 3ABSB 2RH8A 3ZIAA 1XKTA 2XTJA 1T0JB 4IVQA 4JVLA 4I9NA 5SYAA 2X8AA 4JQYA 4U2DA 3ZG6A 1KZ9A 4CW7A 4WX2B 5CPFA 3OCVA 1WZEA 2CB9A 4ZZ1A 4ETIA 1SCBA 3QFTA 2R00C 1TAQA 2FP4A 2JRLA 2GPTA 1CCWA 4X95A 4CL3A 3NBXX 1YB2A 3UTDA 2ET6A 4QVIA 5DCUA 5ALIA 1QG2A 1G6KA 5KOJB 2HMWA 3LIIA 1H8ED 4DBLC 2HNKA 3TLGB 1LBSA 2G25A 1BN7A 1ZISA 1MNQA 2DUMA 1AKNA 2ZUDA 2BCEA 3EQ6A 3RIHA 4D45A 3F6BX 2NNLD 4QQFA 1SHUX 2QUKA 4KLNA 1ZD8A 3EK2A 4NAHA 1Y9EA 4DLPA 1XL1A 3UATA 2VQSA 4JUIA 4OMDA 5C31A 5CM9C 1DUVG 3NHYA 1M76A 1RXCA 4R0MA 2PRSA 3H2SA 1UJ2A 4BDSA 1XNHA 4OYHA 1JLLB 1G6OA 2HC9A 4NCAA 4ARBA 3JARB 1PZMA 3HYRA 5DGDA 4E4YA 1L4EA 3ZQUA 4YCCA 1WSWA 4I4LA 3RTCA 1PK7A 2KQUA 4RZHA 4WXMA 4EHLA 4DIBA 2D0OB 3KZNA 1SEVA 5LQCA 5E38A 2PVCA 2J3IA 4G9GA 3UH1A 4FNOA 2C82A 4XDYA 1G5IA 3V4ZA 1T4MA 2FWBA 2ZR0A 3OCZA 4UAVA 3UEOA 3HO1A 2BFDB 2X15A 3M33A 5LYJB 4HFJA 4GX1A 3QVGA 2Q6VA 3VTAA 2QRHA 3O0DA 1DAIA 1EFKA 2XA1A 4KMOA 2BMJA 3CUWA 4NECA 5CT5A 3I30X 1FL9A 1A71A 1JFVA 3UK1A 5BUSA 4DHWA 3UICA 1KFCB 3QLTA 2OMKA 3B20A 3EHEA 1W52X 4LRSB 4QGFA 3SIXA 3NR2A 1YB1A 1LZLA 1QRTA 1QE5A 2RD2A 2PFGA 3DOEA 3OLXA 3WBFA 1AN0A 1DBSA 1EA5A 3U80A 1ZSYA 2I4TA 4IYRA 2EQAA 4NH0A 4G26A 2WRZA 5HX7A 2OSVA 4Q93A 2ZJYA 2FN8A 4W5NA 3L01A 5D3QA 4ZQCB 2RONA 3HLTA 4UEWA 2OR3A 3CS3A 1OWPA 1ZM7A 1L4NA 2AG1A 4MVJM 3CLVA 4BEWA 5ES4B 2DUNA 4F3YA 3GEBA 1LD3A 1EBUA 2V5UA 4P33A 2C0CA 1NV9A 1FLVA 4J2HA 4BXOB 1YE3A 1H8EA 5M5BA 3V1KA 5IUJC 4K9OA 1HE4A 1Q7TA 1CJBA 3ADBA 2Z9BA 2QWXA 2BDTA 4YFVA 3OZAA 3KO8A 1O8BA 2QGFA 4GIBA 1ZJ5A 1BMFD 4O1MA 4YMVA 5K8IA 3LD9A 1EXDA 2Z6QA 1IN8A 2JCYA 1NBIA 4ZQFA 5EJEA 3C7DB 3H9CA 3U26A 2E48A 4MA5A 4DF3A 4FWTA 1Z7GA 4C5CA 1H94A 1JKMA 3MWLA 4IDFA 4ZOQI 5KJ6A 1HR0B 1UFKA 5F3RA 1SCUB 2BOVA 1CEEA 2AHOA 4NBLA 2Q62A 3SFZA 5C1BA 2W8BA 2BR5A 5K3FA 5K0SA 2HF9A 2OBBA 1E92A 4EF4A 5CFLA 4MINA 4LGYA 1E64A 5LXTA 1MB9A 1VKOA 3BMQA 1RWPA 4FEAA 3JYLA 1M0TA 2CUTA 1HORA 2WTEA 5E7QA 5JAOA 1TM5E 1P1CA 3O6VA 3WSVA 4RIEA 1QFXA 3G5LA 2VH5R 4UHKA 4J49A 5TQJA 1Z5WA 2LD4A 2O3SA 1ACJA 4I5EA 4U9HS 5E6RB 5JCJA 3GUVA 5SYMA 4R2HA 4D56A 3IL2A 3DEKA 1PJQA 3HXQA 1U2DC 1K98A 1SY7A 1Z4NA 1RYFA 4F4DA 3QGMA 2OAGA 1YGYA 4NBUA 2QROA 1W7AA 2FR8A 1JGTA 1V1MB 1V4BA 3LVFO 3RRMA 4U6SA 3W6UA 1MNAA 4MROA 4PAMA 1BHJA 1FPMA 1KMQA 1KH2A 2PDAA 3RSCA 3WK6A 3TRDA 4KMRA 4U63A 4ZQGA 2UUAB 3ANSA 4NFYA 5LA6B 4RU1A 1J25A 4X1IA 3FCSB 1I7SB 1IY2A 1ILEA 4QLOA 3Q10A 4Q4JB 4KITB 3A1UA 3RD5A 1U1DA 4WWHA 1MAUA 2O5CA 3ASUA 3VBCA 1MH1A 3KUCA 2NOAA 4PZCA 5AVJA 3VR5A 4BNDA 4IS3A 3IEVA 5DW3A 4KO8A 4C0AC 2CLOB 4FMBB 4L75A 1XXHB 5D84A 4M9ZA 3OU2A 3WV4A 2H1CA 4AG6A 3RLFA 1N2CA 1VKJA 2A14A 5IARA 2PFSA 2VK4A 3AM1A 1V37A 1QV7A 2O5VA 3QKWA 4OXXA 3ZE8A 4NJMB 4KBFA 2OCLA 4G0QA 3VYRB 3HR4A 1TUIA 1WUTA 1U0GA 1PYGA 4I5FA 4ARUA 6ABPA 2E4YA 2JVJA 3PSHA 3FZYA 1T2UA 3HP4A 4XSHA 4HNTA 2GTHA 4ER7A 2VKQA 1HQCA 3VZCA 5I7EA 1BGVA 1CLUA 2C4UA 4XD7D 1UOOA 4CR7A 3LOQA 4ID9A 2HMVA 1I9CA 4BMPB 3G0BA 1Z13A 3A1NA 4QDZA 1R8QA 2Q4TA 4ZICA 5A4JA 3GROA 3X3HA 2Y1GA 3I9OA 2LDBA 4KLCA 3RWBA 1ZRHA 4RMJA 3P9YA 3FYUA 3ZNOA 1KRWA 4OQLA 5MFPA 4ZO9A 3EZFA 2P1RA 3JQBA 3TEFA 2G06A 4KBYA 1WE2A 1IFXA 1KTIA 1FX0A 1RWKA 3VHXA 3IB3A 4LDAA 4AI6A 3T7TA 2D1TA 3AY3A 1W4BA 1AIPA 1Z0DA 4KWHA 1ZY2A 1GQFA 2RHOA 3G9XA 2QRJA 4X41A 4QZVA 1UQTA 3IRUA 4LX0A 3DAHA 1E79A 3QH4A 1HETA 2OO5A 3FF1A 3ELDA 4TV9F 1AHIA 3B3FA 1SOAA 5DMHA 4YRCA 2MR5A 3KVRA 1PSZA 3KE9A 3ESRA 4A0GA 2KB0A 1NQOA 3G17A 5FOSA 5CCDA 1W5EA 4FZRA 4YP5A 2Z8YA 4DXHA 4CT0A 3PX3A 2GERA 3WNCA 4HDSA 2IU3A 3H1EA 3MBOA 3NVDA 3OMLA 1JQLB 2HU5A 4V0SA 3P71T 1GT91 1YBHA 2ZJ5A 3CZ5A 1E2MA 2VJBA 1GGVA 1GEGA 4WMLA 3VYUB 5BMVB 4QNRA 4ZWNA 3D8TA 3LXRA 3F5DA 4G67A 2R3SA 1KVRA 4IG4A 2GS9A 1DV2A 1JH8A 2IOYA 2Z83A 4MRSA 3N8IA 3OFJA 2X3UA 3H5NA 1NVGA 4XE5A 4ZTBA 4CKEB 5JV5A 4C7OB 3OE5A 3DAOA 1LQ2A 1KR5A 3DZCA 2C2KA 3EZYA 1IEVA 1LDMA 5H3LA 3RUHA 4EY8A 5HZKA 3FZEA 3OSUA 3LLVA 3LDAA 2I4IA 3PNQA 1DQSA 4JGIA 1RWXA 2H07A 5EE1A 4W5TA 2ZS8A 4GC5A 3RVLA 2Q6IA 2R8ZA 3TNFA 1ULZA 2D8AA 3C48A 1X15A 3CLRC 3HA2A 2D3WA 1PL7A 4B35A 1TJPB 4L3WA 4ZA2A 1QGZA 2YYYA 4IFIA 2ZRFA 1E3LA 3WRYC 1DWQA 3GDFA 1EGHA 1ODLA 3EIWA 5BW4A 1QHYA 4D57A 2UYOA 4FU0A 2BONA 1N1DA 4ZRDA 4HNAA 5FPQA 3RSOA 4ZAZA 3EIOA 1FTNA 1V43A 2F1OA 2R6DA 3TLBA 1U2QA 3RC1A 3VBEA 1IXSB 1XTUA 4EX7A 1P7ZA 4XFKA 2B78A 3BJZA 3BQMB 3E05A 3NP7A 1SVWA 4D0GA 1SXJC 2G5PA 4ZO4A 1EG2A 3ZQJA 4F5DA 4PLYA 1XWFA 1P45A 1TGVA 1WEKA 4YDQA 1QTRA 3ROMA 3SJUA 2WJJA 5J9FA 3VNRA 3VDRA 2Q4RA 2ZSJA 4MNTA 3TLYA 3ABQB 1J00A 5DTRA 1ONBA 4HGYA 4DXAA 2P6MA 3DBLA 3CZCA 4XD2A 2Z3ZA 3TAUA 1G4HA 1X7ZB 4UEQA 1Q7CA 3ZGXA 3P9SA 1J23A 1XKQA 4DNPA 3VZSA 3UAGA 3L1IA 3TCNA 2HHLA 3G5AA 3NPAA 4M76B 2MSCB 4KXWA 1LEHA 3RUDA 4MV9A 3WQBA 4MRMB 1QYIA 1X39A 2REBA 2XEDA 4G41A 1PWEA 2AC2A 2I03A 2QM3A 1XMJA 4KQ1A 1FLNA 1KDRA 2JIPA 3N5KA 1NBHA 3E03A 1N2HA 4HRVA 1TE2A 2Q1UA 2C84A 2GZMA 4AJOA 4GW3A 1I80A 3IVGA 4RS3A 4HK4A 2CB0A 2WUGA 2FFJA 2EQ5A 2V6IA 3AVVA 2PH7A 1UADA 2HA7A 2V03A 3E9QA 3Q8XB 4FK8A 4DLLA 3C3AA 4WA8A 3KQQA 4IIBA 2PVSA 5AR1A 4D3ZA 1F2UB 3DFKA 1K0UA 2XMBA 2GO7A 3LBNA 3LT1A 1G2PA 4G8BA 3Q9LA 4INAA 3H0EA 3NDPA 4MCHA 1W36C 2XCTB 2IY9A 1RQ2A 2JD0A 3IEXA 4EGSA 4ARVA 1CF2O 2V6BA 4F4CA 1H4QA 1TT5A 3DNPA 2BFCA 2C3YA 3GH3A 1F5SA 4Y67A 3I8OA 3CN7A 3TX6A 3TPFA 2H54A 1I1OA 3H1TA 2X5KO 3DL4A 4JEUA 3SFVA 1EUDA 4F06A 1YS7A 4N03A 1GUYA 4GRAA 4JLMA 4TL7A 3IDFA 5CR9A 5FDFA 3QX8A 1GCUA 4XYEA 1HDZA 1Z7YA 2A84A 2GAJA 1R5NA 1JIUA 3C3JA 2NU7A 4MQUA 4N0PA 3V46A 1EM8B 3HWSA 4E70A 2FZVA 2PWZA 1QTIA 2H18A 2QRQA 3KLPX 1Z6YA 3CGWA 3CUEF 4RHUA 3DCNA 2WWRA 4JB3A 4HHEA 4L1KA 4MW4A 4LJKA 4OBBA 1OIWA 1TA9A 3N53A 3KFVA 5ULLA 1DIGA 4TV8F 5JJKA 3QQPA 1WXXA 3S4YA 5JD3A 3F47A 1KMMA 2NZUG 4ALNA 2W5UA 2OWDA 5DNWA 3G5MA 3A58B 2QRPA 3O4HA 5AI4A 1Y89A 3LLSA 3RT9A 4Z51A 1DWOA 3FETA 4KO1S 3PHCA 4DC9A 2O8CB 1JA1A 2XT0A 1G1AA 1Z5OA 5KWJA 1XU9A 3HKBB 1R6XA 1Y5IA 3CO5A 4C3OB 4W82A 2PS1A 4XJVA 4XLLA 2IK8A 4AURA 4OA5A 2H31A 3ZBPA 4HT3B 4YX9A 2XZOA 1R5OA 1QP0A 3GRFA 1E2IA 1V5FA 5L6MB 1U28A 4NCHA 3DNFA 2O8DA 4OFXA 4NFSA 2FKAA 1K7EB 2PUAA 4MYTA 1U8ZA 3PUYA 2QG4A 4QBTA 5BN5A 3JARA 1K6JA 5IMBA 3AYXB 3GWZA 4M1MA 1AUPA 5IULC 1NUTA 1RXUA 3I1IA 3L41A 1EVKA 2OAQ1 3DD5A 4ZAVA 4EL0A 3ZX4A 3DR5A 4R71A 2R7LA 2Z6AA 1F2VA 2Y68A 2BGWA 2VWQA 3LCCA 4TSFD 3K5PA 3DS8A 2HH9A 1KMHB 2HK7A 3BULA 3L7DA 3CH4B 5BSRA 4CIWA 1RLIA 3JYHA 4EF5A 3PX2A 1UFOA 4JGBA 7YASA 2GK6A 2J1LA 1LNSA 1T24A 2RG1A 1SZPA 1I3CA 1H2EA 5H02A 2VDWB 3U3KA 3ZXIA 1YUMA 3RV3A 1T13A 2VNJA 3MUFA 4QTXA 3P19A 4HDKA 2CK3A 2QLLA 2CXSA 3G8BA 1JG2A 4S2EA 2G8LA 3J80A 3MRTA 2ZE6A 4MPTA 1GRCA 1WPXA 3OOWA 3H1BA 4CMIB 2O2HA 4F2PA 5CYGA 2MINA 5I45A 3HS3A 3ORSA 3SHTA 5BPFA 2I76A 1Y82A 2Z8ZA 2VJCA 4KRFA 4L8WB 1P74A 4H0NA 1W5BA 2J3HA 4B74A 3T1NA 4DV1B 3A32A 5REQA 2X9QA 1PR9A 2G28A 1Y33E 4MZXA 2P91A 1E6WA 2F1HA 3EFOB 2WLSA 1P5HA 4EWLA 5MN4A 1LRKA 1A1VA 1GGEA 1RLJA 4M7PA 3GRCA 4YJ2A 1CVLA 2ZQYA 4GGPA 1GZ5A 3NHBA 1F0NA 2PKCA 1JJBA 3A11A 1ZOSA 2EEPA 4KUGA 4WLVA 1U3VA 5M04A 5DXAA 2WI8A 3R7SA 1JAIA 4EA9A 2UZ4A 1GTJ1 3I1JA 3T9CA 1ZJ4A 4KE7A 2AI2A 3DFUA 4EO9A 2C03A 5KQSA 5AVYA 2AT1A 1VL2A 4P5EA 4BS9A 4ON9A 2FPXA 1BX3A 1TTQB 3HDYA 4KYUA 3EEQA 4QSHA 3OG9A 3U16A 4QFBA 5BSKA 4DSTA 2Y1OA 1XVIA 4BUZA 4PG8A 1H9AA 1MZVA 2E0IA 3GELA 3LGSA 3W8FA 1PD0A 4GD3Q 5HPYB 4DDUA 4N41A 1VG8A 4MHSA 1K6MA 1WSAA 4C04A 5LD2B 3CF0A 4RZUA 2AFHE 2OFOA 1WXGA 4GBGA 1S2DA 2XVXA 3S2ZA 1RRGA 4EOGA