2C2MA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2mA00
1F1JA 1RWNA 4QU5A 3R7NA 4NOMA 4N7JA 4I1PA 1RHMA 4N6NA 4QUJA 1RHKA 4EHFA 3DEKA 2XYPA 5IBPA 2C1EA 1RWMA 2P2CA 4I1RA 1QTNA 1BMQA 2QLJA 3R6LA 4LSZA 3H11B 1JXQA 1I4OA 5IAGA 3H13A 3KJFA 4JQYA 4ZVOA 1RWPA 5LUAA 1NMEA 4EJFA 4ZVTA 2C2KA 4M9RA 3SIPA 2H48A 3KJNA 1GFWA 4QUGA 4DCOA 4QUHA 4JB8A 4EHLA 2J32A 1SC1A 3PD0A 5IABA 2C2ZA 1CVRA 2Y0BA 4IEFB 4N5DA 4PRZA 2H4WA 5IAKA 3UO8B 3DEIA 3V4OA 4FEAA 2C2OA 1K86A 1NMQA 4AWAA 4JQZA 3BIJA 3PD1A 4PS1A 5IC6A 3UOAB 2H5JA 5IASA 5H0IA 3DEHA 4EHHA 2XZDA 1IBCA 3OD5A 4ZVUA 2DKOA 3ITNA 5LU9A 1PAUA 4D3YA 2CJXA 5IARA 3GJRA 4FGUA 1KMCA 1K88A 1RHUA 2QL9A 1M72A 4EHNA 1RHQA 1SC4A 2QL5A 1QDUA 2H51A 1QX3A 2FP3A 5IC4A 2XYGA 4QTXA 3K7EA 4PRYA 3D6FA 4EHAA 4N7MA 4N6GA 1NW9B 1RWOA 1SHJA 2CNOA 5LU8A 2WDPA 3EDQA 2J31A 4FXOA 3GJSA 3GJQA 4JR1A 4EHDA 1RHRA 3H1PA 4ZVQA 3P45A 4QUAA 1ICEA 1CP3A 3D6HA 4QUIA 1NMSA 2C2MA 4D3XA 2FUNB 2QLFA 3PCXA 4NOKA 4QU8A 2J33A 3V6LA 4QULA 3R7SA 4PS0A 2QL7A 4NOJA 2CJYA 2NN3C 3DEJA 3V4LA 4HQRA 4AW9A 4JJEA 5I9BA 5I9TA 3R5KA 5K20A 3IBCA 3NKFA 3R6GA 3E4CA 5IBRA 3S70A 1PYOA 2QLBA 4JJ8A 4ZVRA 2HBQA 5LUBA 3R7BA 1GQFA 2FQQA 2XZTA 2XYHA 5IAEA 3GJTA 5IANA 4QU9A 2HBYA 1RHJA 1SC3A 4DCJA 4IYRA 1I4EB 4NOLA 4QUEA 2CNLA 5IBCA 3S8EA 2H54A 4ZVSA 3D6MA 3NS7A 2Y1LA 4AWBA 1I3OA 4HVAA 3H11A 1RWWA 3QNWA 4NBLA 4D3ZA 4NBNA 3P4UA 2CNNA 2H5IA 4HQ0A 3V55A 3KJQA 3IBFA 1I51A 4N6OA 3NR2A 3V6MA 4DCPA 2CNKA 5IAJA 1RWKA 4JR2A 4QUDA 1RWXA 5JFTA 2K7ZA 1RE1A 3H0EA 3R5JA 2AR9A 4NBKA 4QTYA 4QUBA 3V3KA 4QU0A 3RJMA 1F9EA 3EDRA 2H65A 4FDLA 4JR0A 2J30A 1SHLA 2CDRA 2HBZA 2HBRA 3SIRA 4EHKA 1RWVA 2H4YA 4ZVPA 4JJ7A
chains in the Genus database with same CATH superfamily
3EIHA 2A9PA 3VR3A 3AW9A 4R8LA 5HZMA 2A3NA 2W37A 3DBRA 3SR3A 5HJ5A 4N12A 1Z7GA 4U8GA 5AVYA 1U4SA 2W6ZA 3ABRB 4JA0A 4N47A 1BMQA 4PQYA 2Q4EA 1JXQA 1AKMA 3CF0A 2PUAA 1A96A 2X9NA 5AKJA 1C7RA 4C5AA 4E32A 1DXQA 3OPQA 3O9ZA 1T6BY 1GRNA 1X1AA 3HXPA 3JTEA 3K3PA 4Z1OA 2FLVA 4CN8A 1U9ZA 1TLLA 1N3YA 2CD9A 2IX3A 2HMYB 5BW6B 4V0MA 2ZVPX 1H22A 3EA0A 2C4VA 4OUDB 4FMPA 4W9NC 4WOKA 1Q1BA 2GGSA 1XGKA 3HKCB 3IVMA 3TDMA 1N3BA 5LOVA 3SQWA 1G16A 4YRCA 1NI4B 2WVHA 4ZCLA 4BVAA 1I7QB 2R8YA 1XUOA 1VM6A 3HH8A 3JQFA 3NEPX 4JZYA 3JW8A 3S1SA 3H6HA 4MPJA 2JLWA 1U1EA 1XSEA 2JBWA 1G20A 2DQKA 3HO8A 4J6EA 2Y4NA 1SPBS 3DUFA 1S4QA 3M9XA 1IM2A 1OIXA 2PM8A 3DBHA 3UMSA 1EUZA 5CVEA 2DWPA 3B5EA 4DREA 3VHQA 3AMVA 2DRIA 4JP5A 1Z17A 3D6FA 1E1KA 1CU1A 1EWKA 2PH3A 2QKYA 3I0ZA 2WU0A 4HS9A 4ZOLB 2PRKA 3BE4A 4GX0A 5FTNA 1XTRA 2N42A 4H3VA 2R751 2WW8A 1OXTA 2CXXA 3L93A 3R5SA 4J0JA 4NENB 5TR9A 3UGKA 4YAGA 5ICSA 4BFCA 2I29A 4PYMA 2I3AA 4Q9KA 2JIBA 3EGWA 3VHXB 1EX1A 4DR6B 3I12A 3DYIA 4JBHA 4KXFB 4A0FA 3U7FB 1RM0A 2WVAA 1XK7A 1RIFA 3U4DA 4B76A 2I2CA 2FRDA 2IIBA 5DF1A 3AESB 4N8DA 3RKUA 1B0ZA 2P0EA 1WPGA 1ECGA 4RKFA 1V7QA 1BHSA 1USVA 2R5NA 2WTXA 3NXKA 4WL0A 4Z0NA 5HYVA 1XTKA 2AF3C 1DLJA 3I5AA 4KGVA 1K8QA 2AFRA 1TA0A 3HDJA 5E0KB 2GPWA 3UJ9A 4YRAA 2C59A 1R2QA 1TU4A 3KKEA 4M9CA 5SY9A 3A27A 4N82A 3N0RA 1ODCA 3WGNA 1NVKA 1QE0A 2BFEA 4KQKA 3L40A 4GXRA 3TQCA 3CN9A 4AURA 1KQGA 1YB6A 5K4AA 2WMYA 5C8ZA 3GLRA 1K98A 2PN1A 4MVJM 2BGUA 3W79A 3CR7A 1VLVA 3KJQA 5FPYA 1SHTX 3L7DA 4YQYA 5ESRA 1IZZA 1DV2A 1GSAA 3EG9B 3KCNA 1XTJA 5HNKA 4Y2HA 4PCVA 1L3BA 2O3TA 3RUPA 2XKBA 2H5EA 1HLPA 2RHJA 3LRPA 1A9ZA 5COBA 4B3MB 3IPAA 1UWCA 4KKXB 2EERA 2GBFA 3R5JA 1FK8A 4YRRA 2YVQA 5HK8A 1D2GA 5K3DA 2I6QA 2A67A 1NNI1 4Q48A 1LVGA 4EFLA 1S1MA 3E9MA 5CEEA 4FIDA 3THWB 1T5OA 1BTOA 2ACEA 5B2ZA 3VC1A 1MJGM 1GTZA 2ZRMA 1QU3A 1Y3DE 4DQLA 2F64A 3NTOA 4UU7A 2RD2A 3V3TA 4IXMA 4OXNA 3UAOA 3ZN2A 3IQHX 5GONF 1GPWB 3KOYA 1HRKA 2PL5A 3QQPA 2WG2A 4UM8B 4CTOA 3TL2A 4I9HA 3G2HA 1U3WA 4PFQA 2HO5A 2FPLA 1ORDA 2VLIA 1OLOA 2OHHA 3D2BA 1UQRA 4I46A 4US2R 1K66A 3M5PA 4BGDA 2OWDA 3NUGA 4HATA 4TXNA 1RKBA 5KTSA 1U04A 5EUCA 1VBFA 3ZDXB 4QPPA 3PPWA 3EPHA 1AQNA 4EAQA 1Z4NA 3AM3A 5CM9C 1J0CA 1HSOA 4U0KA 3KJNA 1Q7GA 2Q07A 2VJAA 2AXEA 3RWOA 1MIOB 5H16A 3DAPA 5JZVA 2QT0A 4YT4A 1FUYB 2NSJA 4LYFA 1U1CA 3WMXA 2R2AA 2H4WA 2I4LA 3OEED 4MUMA 3BX1A 4URFA 2GEUA 1PBTA 3A6ZA 2QTAA 1OZHA 4YRNA 4WY5A 4IDCA 4J3NA 3IIMA 1CF9A 3E27A 2F8LA 4L50A 1ECBA 2R66A 2W7TA 2QX9A 1VE5A 5DCUA 2XMPA 3EDOA 3SKXA 2EZUA 4U7TB 2Q46A 1CE8B 4N5MA 4D26A 2AJTA 3A9RA 1GG2A 2C57A 2WAAA 1Z15A 4MUYA 3H4TA 5H68A 3FMVA 1Z0KA 4OPMA 3OZIA 4A8JB 3JQBA 2AYXA 3ZDCA 1ZH4A 4HNUA 2XYGA 4AQDA 2IYZA 2RK3A 1IHXA 1WXFA 4J2HA 3VDQA 1FSPA 4P8RA 1CEYA 1NR1A 4RZSA 9LDBA 3SVTA 1A69A 3MTEA 1UWKA 1AIPA 3LX8A 2CLMB 1JR3E 1LK7A 2VP3A 4YDSA 2QD1A 1Q95A 2FUG6 2I7DA 4M89A 5CP8A 3QTTA 2G80A 5FLKA 4BLOA 3DJFA 2JAHA 2YOHA 1F4LA 3D3NA 3GAFA 4S0ZA 3CWZA 4UHKA 2P8JA 2AC2A 5HCNA 4JI7B 2JLCA 5HF5A 3BXZA 2GVDC 3BMXA 2A3RA 4ALLA 3FYUC 4UASA 2YIJA 2MR6A 1VSTA 4LV8B 3GBVA 2ZTHA 4XDHA 4E08A 1OYYA 3ED1A 4R16A 1OGIA 5DGTA 2FZVA 3TSWA 3VSBA 2GZRA 3CH7A 3WJ7A 3WOHA 4BMOB 2VKQA 2WAMA 3EEQA 5IBRA 5HRCA 2IU4A 2A5JA 3E9YA 3HRKA 4G67A 3FB1A 5CLGA 4OLAA 1WUHS 1FRZA 4BNWA 1XHEA 2I76A 4JK3A 1VLMA 3K9BA 3LXRA 3R0VA 4JLVA 1R9GA 1X70A 3G9TA 4CWAA 3AR8A 3AHGA 1C9DB 4F86A 3A4VA 4C2TA 1QPBA 4WIAA 1JBKA 3KPUA 5DW0A 1IZ8A 2DTEA 3DBOB 4JFAA 4S2UA 1VZ2A 2JGDA 3LDHA 1KK3A 1XU7A 3FNRA 4KYUA 3X44A 1LC0A 5I7HA 5IFKA 1XZGA 4DB4A 5B3KA 4LF7B 1ZITA 3E3NA 4I9FA 4ZJPA 2P9QA 5F1PA 4ZVVA 1QF9A 4KREA 1PQPA 4DYDA 3A1UA 1NJSA 2VQFB 2GBLC 1H2EA 1R18A 2C84A 3L1UA 5F5LA 4OA8A 1TKCA 3RFUA 3RUAA 2QVYX 4BMYA 5LP6F 4AY2A 3WNDA 1AS2A 4Y1FA 1TVKB 1XTZA 2Z9CA 4LXQA 6ABPA 3KYBA 2L69A 1SY7A 1LDNA 2OV6A 1Y4ZA 3DZ8A 4X7PA 5J2TF 4ATNA 3I37X 3LF2A 3F3KA 2XUGA 4O2RA 2BSAA 2QTWB 3KVYA 2GK4A 1EU1A 2HX1A 1XRSB 2Q4BA 4YONB 2WIBA 4N0EA 2OORA 1KJ9A 4CVNA 4MQBA 4RPLA 1LZLA 1XCLA 1EINA 2R5WA 2QBYA 3FUWA 2D3WA 1T36B 2FMFA 1FS4A 2FMKA 4QJIA 4OQMA 4CYMA 4RDXA 3T9EA 1WCIA 1OCEA 2ZRGA 4KLAA 1EK6A 4XE5A 2ZBRA 5AP9A 1LQTA 3FSJX 1ZK0A 4TKMA 1ECLA 3EA5A 1OFIA 1XMJA 1VXRA 4WMLA 1AC5A 2XWQA 5I7WA 5TQ0A 5FADA 5K2MA 3E15A 1Q2XA 5BR7A 2BGMA 3U0BA 4MYHA 4PX5A 2FPIB 1NQTA 4G5SA 2Y0EA 4MW5A 1QG4A 5HXAA 2RGUA 4CQLA 2OXCA 5JI2E 5KOHB 1XTVA 3C1AA 3HDQA 3OPYI 5T67A 4B6QA 1U8UA 3M2PA 2WT8A 1LX7A 3HCPA 4QELA 4U6SA 4AJLA 4JQSA 4DHEA 3RFVA 4LSMA 4GKKB 5TARA 2QRGA 4EHNA 5L4SA 3B6JA 5HPYB 2CXRA 3AF5A 3KD2A 3GDWA 521PA 1PEAA 4U2FA 3LD9A 1K5HA 4FCCA 1CRZA 2VNSA 4HADA 4NQRA 3ZBTA 3IVRA 4C29A 4ZO6A 1M9NA 2WWYA 2OGSA 2EWMA 4PM4A 3ROFA 2DPXA 1CUZA 2I6UA 3KQNA 5D01A 2OK7A 1YIOA 2AS0A 2BEWA 4JBXA 3TAXA 2W58A 5DGIA 3ZE8A 1SC6A 4ND2A 1DI0A 4YFYA 2ZXUA 3QEBZ 3DWEX 2Y66A 1VL6A 4PXAA 2FN7A 2YVKA 3VKUA 4O4IF 3D0QA 4YJFA 3OZCA 2LDBA 3LUHA 4M9UA 4RKQA 1A3CA 3OPYB 3ZQUA 2YVUA 3L05A 4KE7A 1N5JA 2FSVA 4CM8B 3G8YA 3ONWA 1K68A 1RRCA 4G07A 1EM8B 1L6IA 2I2AA 3LYUA 3NUQA 3ZUGA 1EP1B 1F60A 1RAGA 1Q19A 1XEXA 3NQ41 1Q44A 3CF2A 3STWA 2WWWA 2OHVA 1Z6XA 3PI7A 1WOMA 4BYMA 2VRCD 3A7DA 1OJLA 2JGLA 3AKEA 4M49A 3RU3A 1AS3A 2ZS9A 4JUIA 2R8ZA 1I3MA 4FNGA 2QLLA 5HUHA 3EX7C 1JGTA 1ZCJA 4BZZA 1DSSG 2NU9A 3IBFA 1EWTA 3QJYA 3SXUA 2DFDA 5DT2A 4YT2A 3HXOA 1HLGA 1TZJA 5DV9A 2ASEA 3F6BX 3D43A 1Y81A 3PWKA 1U2SA 4TSFA 2DZDA 3DE4X 1U4NA 5DLDA 4ZEVA 3OEHA 5FL7A 4CCWA 4ZGWA 4MUNA 1ZS9A 1BS2A 3GNSA 2FZCA 2X13A 1DHTA 3V8MA 3ZHXA 2ORVA 1W1WA 2G8NA 3WK7A 4ALIA 3LOQA 4KHPB 4I1SA 1UKBA 2IIPA 5ITVA 4EUSA 2PFKA 3EARA 2XX3A 3WB0A 4Z3DA 5CDUA 4XTRA 2HRCA 1RWNA 3VR3D 4QU5A 3K5PA 4D42A 2GWRA 2XUQA 4GL4A 2BGGA 4MQUA 1UK9A 2MSCB 3PEFA 1NBMD 4HPJB 3VYSB 5CYGA 3VJLA 1AGYA 3DOUA 5B6IA 4KXNA 2EBUA 1CJCA 3EWSA 2IS4A 1OI2A 2NVWA 1I32A 4PZUA 4KQXA 1VC2A 5FLYA 1YIDA 1L7VC 2PZAA 1E77A 2RHGB 4UTXA 4DJEC 5A9SB 3DZFA 3L0YA 1GKLA 1U0GA 1ZRNA 5CW2A 4ENQA 2JI8A 3TW8A 3UW3A 4ZCRA 1IHOA 8LDHA 2X4LA 3FROA 3FOBA 1MEEA 1RBYA 2HN9A 4HX2A 1HRDA 3E0XA 3AM5A 2H1HA 2AJCA 4BN4A 2FCAA 4G5FA 4B7AA 5JLJA 2HGSA 4I4LA 2V5AA 4AY4A 5B7PA 5KEIA 2ZE6A 4KYVA 2V3VA 3MG9A 4HH0A 3BIJA 4RD0A 4IIBA 4FJ1A 2QV7A 2GN8A 2NSDA 3TQQA 4YV0A 2DJ5A 1D2MA 3E58A 4MHSA 1C9KA 2O19A 3ZVLA 2DB3A 4FFBA 4GGOA 1DCTA 2QYSA 4QSHA 3M4YA 2O8FA 3L8MA 2ZIXB 3MMPA 5DIFA 3H65A 1XAHA 3KFVA 1QQ7A 4L9WA 1RZ3A 3DBLA 1HV8A 1ZJJA 3KU1A 3VPGA 3ZWDA 1E4YA 3MT7A 2PMBA 3HCOA 3L2OB 4YRDA 4LWZA 1PBNA 2J59A 1V1RB 5EJEA 3AJRA 2A94A 4LRTB 5H4GA 1JXOA 4JLNA 5IT5A 2LBPA 1AHHA 3S7TA 1A9OA 1F2TA 1HA3A 3VR0A 5BQ5A 5K5EA 3BHJA 3M6FA 4XJTA 3ILSA 2W4QA 5D3ZA 5BSTA 1HSZA 2MU1A 5DCYA 1FDUA 1G21E 1H6DA 1GP2A 1NLMA 2B4YA 4M0LA 5JNTA 4XFJA 5EPOA 1NX6A 1YI0A 1UBLS 3M9WA 4UD6A 2O57A 2RGNA 4P9NA 5DTJA 3UAXA 3IV9A 3KB6A 5DNWA 4AROA 3HKEB 1YR9A 4RD3A 4MGEA 1PF7E 1PZMA 1W0JA 4RANA 4WZZA 5FNZA 2YZKA 3T4UA 1L5ZA 1TTHA 4JJEA 1FNMA 1N0HA 1QS0B 1RRPA 2CLFB 1JAHA 2VCYA 2KI5A 3CB4A 4RK5A 4MS1B 2Y1DA 4XCQA 3EF1A 3SQDA 4HDKA 5AKXA 5EMMA 2RHTA 4BE4A 2NX2A 1YRBA 3Q40A 1SD1A 4Y2QA 1JEOA 3I28A 5EZ6B 3A6DA 3BMNB 1NNUA 1R5BA 2JA1A 3O6VA 5ALXA 2W6IA 4HN9A 5F5XA 2BZSA 5TPWA 1T3TA 4C01A 5JYDA 5M29A 1RAEA 2VCEA 4I66A 4ND3A 2J3HA 2PLRA 2Q0HA 3BSYA 4FZ3A 4GE3A 3JQQA 4BNMA 5KHOC 1HF3A 3UUWA 3IVAA 3IE2A 1D4FA 2PMKA 4CN9A 3NHLA 4F9EA 5JS1A 5JWOA 1AMNA 5LQNA 5HQ3A 1X74A 3OPVA 1OBHA 3Q6MA 3D4PA 5IZ4A 4JEMA 4BP1A 5I9LA 4IOLA 2E9SA 4I8XA 5G0WA 1DKPA 1WXIA 6YASA 3T7IA 1D8AA 3QHPA 1TTTA 2R60A 1J42A 2C3OA 1Z7EA 3DLIA 4H4CA 2VAVA 2JI6A 3CKMA 3ZNQA 4I6JA 3K9QO 3LY9A 2J41A 1ZP6A 4K6HA 1W4LA 3WYEA 1UP4A 3FI0A 2XITA 4M0CA 3ZV5A 3GUHA 5C8YB 4P4GA 1BDHA 2BKLA 1U8EA 5EINA 4ZT6A 5DI3A 5TVKA 5JXJA 3E22B 1W30A 3E23A 3UK1A 1KBQA 1TRHA 4Y0AA 3RAEC 3JVEA 3HI4A 4BX2A 3Q2KA 5ADWA 2A86A 5I4IA 2QROA 4QRHA 4EPXA 1XELA 3A9TA 1XJ0A 1I6MA 1TYZA 1UIRA 1ZN2A 2XA2A 1OXKB 3DE2X 3HJUA 1GA6A 2I5PO 3C3CA 4Q15A 4DMLA 3K70C 1BCRB 3H8VA 1YZNA 1VJCA 3D6UA 3GF4A 2QI9C 3K2IA 3PWSA 3QU7A 5CFNA 1KRXA 3LC2O 1W52X 4NYMQ 2E21A 2E1PA 3ZLUA 1EEHA 1BQ3A 3E2IA 3KHTA 4KMRA 2VXCA 1VBKA 4PANA 4V02A 2B4TO 4F8EA 4YUYA 3RT9A 2WINI 3R77A 1F8XA 1IG3A 4RD6A 1UP7A 2OHXA 2ZJ4A 3LY8A 4DUGD 1K92A 3VISA 2HY7A 3QGMA 1HTTA 3SYKA 1K86A 3FPCA 1QPGA 2LXNA 3LX4A 4YEDA 5IDXA 2JLAA 4XDZA 1W93A 4C4TA 4PSCA 5BN4B 1WMBA 2B2NA 2PJZA 3EXAA 3G8AA 5E7IA 3PX2A 5EIHA 3RS0A 4AXBA 2PT7A 3LTNC 5SZHB 3X1WA 3DLAA 1W9HA 3AFHA 2PZMA 4LZNA 5BSWA 4DC1A 4G8JA 2F43A 3NC0C 2HJVA 4IJ6A 3SQOA 3UT5B 5GZ3A 2B7BA 4O4LA 1KDOA 3AERA 1L7MA 3FDIA 3JU3A 4IHKA 4F5DA 2BFBB 3K5WA 3WNVA 1TW2A 1Z26A 1GNLA 1XRQA 4PGHA 1ZNYA 3P2IA 1JR2A 1AK1A 4A2WA 3I3OA 3G0GA 3NYIA 4R6XA 3L6BA 1ODJA 3N07A 3X1KA 4ARUA 5B2FA 1SKYB 4IIVA 5C7YA 4OXKA 4M99A 1K9VF 5DGHA 1R8JA 2HYDA 2BHNA 1ODIA 4Z0HO 2ASVA 3PK0A 3GUCA 4HGOA 3QXXA 4NMWA 4OHRA 4PQFA 4WX2B 5LCXA 4H60A 4TTVA 1R0RE 2WU3A 4V38A 3ENNA 3R7WA 2AMVA 4PC6A 5I3ZA 1TJ5A 4JYZA 4TTSA 4EGJA 3E7XA 3L7BA 2AF4C 1HYQA 1TYBE 2HA7A 5C7LO 1AO0A 5C53B 3MLBA 3W6PA 4V0OA 3KQHA 3ABIA 4HGQA 5F51A 1HE1C 1PJCA 1EUDA 3TE7A 4DA0A 3BE5A 3A70A 2W6NA 1DAKA 1VP9A 3IBYA 3ZV3A 4F5ZA 4CV3A 2PXAA 1KDZA 3A10A 3CUKA 2DGDA 5FCDA 4K46A 1CB0A 1X9GA 3HJRA 1NE7A 4D79A 1XAGA 2Q5HA 4ZAFA 2CNNA 3GDFA 1GL7A 5TT0A 5CIYA 3C8HA 3L4JA 2W2KB 2IWHA 2HJGA 3A14A 4A16A 2Q29A 2AR7A 3VV2A 3ROQA 4D4GA 2G0AA 3AY0A 2VNIA 1N3IA 4CPDA 4R0MA 5CX4A 1FDVA 4TWRA 3BT7A 2ANBA 2FJUA 3PDIA 1S3SA 2YWEA 1JDNA 3PE6A 4RABA 3HU2A 4MZXA 5FTWA 1O9HA 1GPBA 2ODTX 1O9GA 3FNQA 1GG5A 1QIGA 4C08A 5DYGA 1HT0A 3I9LA 5ANRB 1BD4A 1P4JA 3OTGA 1PN3A 5I9SA 4L74A 2W70A 3S5UA 3THXA 3IALA 3L1IA 1FFAA 2HO4A 4JV5B 3IDQA 4WNCA 2H4YA 4KSCA 4YLGA 1NONA 1KZGB 4OM7A 5HS4A 1ZCAA 4BQQA 2G9NA 4B83A 1Z82A 2PWAA 1JHAA 4LKRA 1I2DA 2EFYA 1H2YA 3T41A 4TUYB 1ZJ6A 2V7VA 3BIOA 2E3JA 1D1SA 1E7RA 2R6DA 2AN1A 2C31A 3D8NA 1A8HA 2W2OA 2CNWD 4OQXA 1JDBB 1NL3A 2JHGA 2ZETA 4RJTA 5BR8B 3RBAA 2HSGA 2Q5OA 4RFLA 5FOWA 1ZHHA 4BKUA 3MSCA 4M8NE 2PBLA 3EZ2A 5F2NA 2ZSAA 1E32A 4OM8A 1IVSA 1XXHE 3TIGA 4EG8A 1Z4OA 3RUDA 3SDZA 4PX3A 4D0SA 3DMDA 4UPVA 4XX0A 5ESXA 5G4KB 4D9JA 2IBTA 1G9SA 5KNDD 5HIAA 1N5DA 3LF1A 5LB2A 5CD1A 1M34A 2AKYA 3DOIA 3ZJYA 3DTYA 1GNSA 2FCRA 4DT1B 4E5YA 5KSYA 3PD1A 2HK6A 3RJZA 4DMUB 2OHJA 3TLJA 2HUPA 3GLHE 2C1ZA 1EMDA 3PTAA 1ZOSA 3GRYA 3PGMA 1GZUA 1GR0A 4JYPA 1WMDA 1F0YA 3COVA 4KN8A 4WLEA 3UMJA 5IF3A 5IMBA 1T9BA 2FUKA 13PKA 3K1AA 2BHLA 3ETEA 1P1IA 2E4VA 1YNOA 2WYUA 5JO0A 4MRSA 2R87A 2ZUSA 3I64A 1I94B 2A0UA 3AIOA 4PU0A 4EECA 4P86A 1GO2A 2ORWA 2R8EA 4OQPA 4E6PA 1GT6A 3PFGA 1YVUA 1ZIOA 1QKKA 4L5IA 5ELLA 3LZCA 3BWDD 3KV1A 4WJLA 4CIYA 3DEZA 1E2QA 2W9XA 4LJLA 1KO8A 4BECA 4JR1A 2I2BA 2GUGA 1VCMA 4PG4A 2DFTA 3TFQA 2C96A 3W6UA 1Y5RA 2O2GA 5DHUA 4KWIA 4D0LB 2KB0A 3O3CA 3D4NA 4L3OA 3GJ0A 3T1VA 4YXFA 3WV5A 1W85B 4ZI7B 1IXYA 2AMLA 4E4YA 4M86A 1TM4E 4GWLA 1YRHA 3ST7A 4GRAA 1Y8RB 1JEYA 2DEUA 2I6GA 3KUDA 4MW1A 4ERNA 3L3BA 4F04A 1TYEB 1HDZA 1QIKA 5HM8A 1YQGA 3N0XA 3FTFA 2BKUA 3MXTA 4ZV7A 4JL5A 5C18A 4HFRA 2Q5CA 1L4GA 4P84A 4LMPA 3ECSA 3PFFA 3IELA 4F84A 1MQSA 2KE5A 4J94A 5A5EA 4RVGA 3RSGA 4ENUA 4B4OA 3CNEA 4FQ5A 1EFCA 4IPTA 2C8VA 4EGQA 4ZJYA 3G79A 3MAGA 3UV3A 4OHVA 3SG0A 3ZI0A 1T4CB 3I8SA 5AJYA 2QX7A 4L72A 3IGFA 4KPUA 5KPDA 1H1LB 3O31A 4U2KA 4IXDA 3OWHA 4U9UA 1AOXA 2PJUA 3HL4A 1AF7A 3BHIA 2KJQA 2C82A 4DMGA 2BOVA 1HL7A 2HA6A 5AHKA 1LPMA 4LSWA 3VPFA 3OEHD 1YKSA 3L7NA 3R3JA 5FL7D 2AV6A 2WEKA 2YYZA 2C2HA 1VMDA 2RGEA 4RMJA 3VVMA 5KU1A 1Q22A 4BPBA 1NXXA 1C8VB 2FU5C 4OMDA 1NUTA 2IUTA 2QTZA 4XIJA 4M46A 1JT2A 1U3CA 5EAIA 4ZEXA 1O4WA 3I92A 1OFUX 5BW8A 5HKBA 5JAHA 1MB3A 2QA5A 4NE2A 2VUHB 4P35A 2F2TA 4RK1A 3K09C 2FDXA 1ZWKA 3WDLA 1NF3A 2QZZA 2BWJA 2VP9A 5LQJA 3ED5A 3X1XA 2IKQA 3MSXA 3UH0A 1QRDA 2WYWA 4CLEA 4IY1A 3TDNA 3ZC3A 4I1UA 2DWCA 4PPNA 4KWHA 1TC1A 2IRWA 4S2EA 3TNDA 5GIOE 4UM9D 3ZI4A 1X1DA 2FPRA 3PFNA 5FFMA 1RWQA 1KWKA 1IXKA 4NXMB 1YFJA 4DV5B 1CQZA 1CLUA 1E2LA 1H5QA 3T7CA 4BB0A 4EUEA 2ZRQA 4LYGA 1RXYA 1XTPA 2UVDA 3CSSA 4GOLD 4Y6OA 1M67A 2DQ4A 1KEUA 4FINA 3JQ8B 2HMVA 1R4MB 2BGTA 3H99A 3NDRA 1IQUA 1W581 5PGMA 1KYYA 3A4LA 1U28A 1BE6A 4JKYA 4RMNA 2X8JB 5A6SA 5KTNA 3KKKA 4E1AA 2VPXA 3ZR4B 5ALLA 1XQWA 4CG2A 1W19A 1D4OA 1UBRS 4URZR 4BN5A 4D8TA 3F5SA 1T0UA 1IPEA 2FZ4A 4YAUA 4EKDA 2ZAGA 2ZI5A 3RBVA 1YGPA 3NVKI 2HRQA 3L49A 1Q0SA 4H6PA 3DEAA 4Y9RA 2VHUA 2EJTA 1QJCA 1WMFA 4G85A 1GPMA 1VMAA 2GERA 4URUR 1V1JA 5DBHX 2Z4SA 4C7KA 2QR5A 1TQ4A 4MIYA 1WQ1R 2BIFA 2C58A 4F5YA 1U0EA 1D3AA 1RKQA 1V37A 3DAHA 3NTLA 3P0IA 4KI7A 3TVYA 4Z7OB 5LQCA 4BX0A 4OCZA 3A6FA 3BDVA 2OV4A 2QAGB 5JY1A 1O97C 4NJEB 5KWVA 4JT2A 1E3TA 5FRDA 3MBKA 5IKOA 1LC3A 2IXAA 1OSNA 3MTIA 1O6GA 1P8AA 3I2KA 1V9CA 1UK8A 3JD0A 1HFKA 1W0JD 1YO6A 1B8UA 2JFQA 4I6EA 4D99A 3IKMB 3AEQA 1LBEA 5EJ5A 1U3FA 5AKLA 5AUQA 4DCNA 3UOWA 4DYHA 5FYQA 1QF6A 1R4NB 2UV8A 5JD3A 4JGGA 4Y2YA 4AJ4A 3LL4A 2ZU0C 5G53C 1I0LA 5B1IA 1MPXA 3SEAA 3ZU3A 4DFDA 4GXQA 4H9GA 3MRVA 1E1QA 5COQA 3V80A 1YVRA 9ATCA 4GXNA 3C3MA 2I7XA 3C2QA 3VH1A 4K7JA 3LPCA 4Z9AA 3K0BA 3SIWA 4LYYA 4GRIA 3QELA 2JFGA 2VL7A 3AZPA 3E7PA 1BN7A 3ZV7A 4Y1EA 1OYOA 2ZT7A 1QFMA 5IJXA 3SS7X 1MA0A 3OD1A 4OXXA 5HM6A 1CUHA 1U2ZA 2REQA 1Z37A 2ID9A 1U3GA 3RC8A 4OKSA 2JFWA 4UEQA 2P9YA 5T64A 2Z2IA 4CF5A 1HC7A 1P7WA 4WXYB 3B8EA 5D3MA 2AMYA 1YZHA 3QFFA 2R2GA 4YNBA 1QM5A 1MDFA 2N75A 3LIPA 4Q16A 3RS9A 1IWOA 5IJ0A 2FX5A 5EZYA 4Q47A 3OLWA 1FFXB 5F77A 3WADA 4EVRA 4UCXA 5FHQA 3SD7A 4EZIA 4DYVA 1X77A 1FFGA 3BL8A 1QTRA 1DCFA 3OFKA 4JDUA 3ZUPA 1CDDA 1F8UA 3KKOA 1WABA 5B5SA 1RHMA 3KT3A 3MB5A 1OAOC 3LX5A 4Z8YA 1AU9A 2FW6A 2V6MA 2CW5A 3MERA 3QQ5A 5LXTB 4ZDIA 1E3MA 2GHTA 3R5TA 5B1EA 2HHHB 4IWYA 4KR6A 4W8OA 1WB9A 3EIXA 1DDGA 5FR2A 1KHHA 5K4GA 2AXQA 4C05A 2AZMA 3MGBA 4MB6A 4ZGGA 4OXQA 2ZVJA 2X4DA 1YI1A 1FFYA 1RYMA 2P4UA 3KLNA 4DM7A 3VJRA 1FSGA 1PYGA 2O52A 1A9QA 1DBWA 2V0NA 4BQIA 3QP9A 6PFKA 2F59A 2QX8A 1TJ3A 2OTCA 3PQ6A 1I5OA 1VMEA 4PFKA 3SZOA 2IUSA 3C8UA 2FG5A 4G86A 3Q2IA 4MO2A 3RC7A 3VO9A 1NUAA 5K8TA 3IEXA 3CVWA 4WEQA 1H5UA 1VYUA 1C3OB 1XZQA 3OUZA 3E9RA 1BN6A 1OLSB 2B2XA 5LLTA 3CUVA 2IEGA 1ZSVA 2IYLD 2FE4A 1KEWA 5IZCA 5K09A 2Z9DA 2F9MA 2G36A 4LJRA 2XBMA 3V7UA 8ADHA 5L3QA 5FWXB 1ZY2A 1X7ZA 3ONEA 1R9NA 1DBRA 1S8OA 3VR4H 2O8CA 3L82B 3T3MB 5MHTA 4HYTA 4Y1GA 3DO8A 3ADCA 1WUYA 2WABA 4HNVA 4OI2A 2QIOA 4UARA 1JEQA 2GNPA 3R20A 4DLUA 4BMVA 3CS3A 3U80A 2IS1A 4JT9A 4AY6A 3B5JA 4MI1A 5EJ8A 4X3CA 3N2KB 1IAVA 2H4HA 4CIBA 1YBFA 2HU7A 2QSYA 2CL0X 2GXAA 1UK6A 1HTWA 1UM9A 1PNQA 4GPTA 2IW1A 2ZQZA 3P5BA 3UWOA 5H5JA 2UZIR 4DDTA 3A6KA 1O5TA 3PCXA 1YTUA 2IPOA 1XDZA 2ARKA 2J33A 3L7YA 4C0BA 4ZI2A 5JU6A 1LS1A 1ODTC 2GZHA 3ZK8A 1P62B 2CLEB 2PEZA 4MQ4A 5A03A 2C00A 1Z56C 3UICA 3CUWA 1XD8A 2AEEA 4U39A 3RVQA 5BR1A 2CUKA 1C3EA 2DHDA 2O3JA 4CLDA 4CV1A 2GUWA 2VIIA 3E3AA 2P9EA 4I5GA 3SI7A 1DWQA 4BQPA 4RTPA 1XA0A 1ZVJA 1M6VA 2B69A 1PJ4A 4X71A 2UYHA 3LY5A 1WLYA 2Z4RA 3S5JA 3I8XA 3PU6A 5AVVA 4C89A 5D86A 4LNAA 2SCUB 4INZA 4KH1A 5IULC 1LI7A 1XZBA 5B6JA 2C54A 4BKRA 2P5SA 3EB9A 3JZDA 2JLBA 3ZJ5A 4GP7A 4HX5A 3A36A 4DIDA 3GDHA 2EEZA 2Z2XA 3JWHA 4G8DA 4MGYR 1ONSA 4UQPA 4W1SA 3BK2A 1U0SY 1VMKA 5B58C 3UUGA 1JDSA 4J7UA 1QFZA 3CQ9A 4B6PA 1GY8A 1RBQA 1UMCA 2C61A 2J85A 2OXTA 3SHQA 1GPJA 2C29D 1YFLA 2FR0A 3A11A 1QDEA 3WLRA 1YDWA 5FEMA 4UUAA 1I4TD 3RJMA 1GV1A 4B75A 3B6ZA 4UUPA 1O6BA 2R6CA 3G1UA 1Y7PA 4BCDA 3DAYA 4MEAA 4DJJA 1RKUA 4V24A 3WKDA 4REOA 1VJDA 2CT8A 1ATIA 3QENA 3B5IA 4QT4A 1AQLA 4DRXA 3O8NA 3UPUA 4EY7A 1T2VA 2VSOA 3A0RB 3K4HA 1M6YA 4PN7A 3HO1A 3V1TC 2XNKA 2AC4A 2JJ2A 1OLUA 8MHTA 2ET6A 4Q34A 2Y77A 1GHTA 1NXQA 3R1IA 2P9CA 1Z5OA 2FZLA 3QMPA 4N9WA 4NIMA 2GQ0A 4M54A 3EGDA 2FPKA 3OTHA 3FWHA 4FLMA 4L0CA 2WDZA 5DHSA 4C0SA 4MRMB 1KKLA 3EXFB 1IVYA 3DCIA 1NMEA 5HUJA 1A77A 1JX6A 3ISVA 4NATA 5KTTA 2NO5A 3BEOA 3NTUA 5CAEA 3B7GA 2H48A 1R1DA 4URHA 5ERYA 5FFNA 3OJXA 2VKTA 2Q3BA 1L7QA 5EQJB 1H65A 1Q5PA 4GLJA 2XCRB 5FWNA 2HQOA 4DBVO 5ENDA 3GGCA 4DIOA 3LWZA 1U7WA 4DLTA 4F2GA 5AW7A 3DV9A 5JAOA 4EA9A 4NEGA 5TNXA 4XRGA 5H83A 1SIOA 4WOJA 1T15A 3F7TA 5F76A 5BUZA 3ZK9A 2HF9A 3NFYA 1H9BA 1NI5A 1MO4A 2PWZA 1E66A 3SEQA 3K8OE 2ZBGA 5LIPA 2OYRA 3PQ4A 1KMCA 4BV2A 1A5BB 2TMDA 2NUBA 3EIUA 3FDZA 4AWXA 1YCGA 2CLKB 1VSUA 4R3NA 1NBAA 2IXTA 2YWDA 3GGPA 3QXSA 3RWMB 2DKFA 3HXKA 4ZVNA 1I7DA 1TZKA 2WZDA 3CW8X 3K73O 2WDPA 2HSZA 3O8QB 5KQPA 5FH9A 4FE3A 3EAFA 1EDZA 4YCCA 1SU4A 3A4MA 3I3SR 5E9JA 3K70B 1CDOA 1XLVA 3K9LA 4P3XA 2J9GA 3HCFA 4FYPA 3UCXA 2AOUB 4MQFB 1O54A 4HCJA 2KYRA 2Q9UA 4JC8A 3DQPA 1Q50A 3C0KA 4KDEA 4R8SA 3WLTA 2Y1GA 2X40A 1UCFA 3RG8A 1J0DA 4HQRA 1KA9H 1PSZA 4QBTA 4WTOA 1LPBB 5BN1A 2ZE7A 4M7PA 3VVLA 5HKAA 5KJFA 1OZAA 3C39A 3VJMA 4D56A 1IEQA 2AN5A 3GJZA 2ZRPA 3CX6A 3FHTA 4OAPA 3I09A 3CSUA 3W6ZA 2ZYDA 3AHDA 1T1GA 2I33A 2ZXEA 4I6GA 4D9MA 3DMTC 3NHBA 2VF2A 2YFQA 4MKRA 4RLFA 5GVSA 5K0GA 5E2BA 3GPDG 2IV7A 2ZTUA 1SA0B 4FM9A 1GQ2A 4YLYA 4D3ZA 2LCIA 4IO1A 1CYDA 2E2WA 1K2WA 3AT1A 1FP4B 1A0OA 3I9OA 3OWOA 3P9CA 4HAIA 4LJ9A 4RZXA 3TPFA 3TOZA 3TR0A 3NOQA 4BXOA 3TN7A 3KU4A 5BV1A 4N0MA 3TGWA 4BU1A 5KUTA 5JJLA 4G0MA 2PH7A 1FNDA 3KYDA 3H1BA 3O8DA 2IELA 4HBGA 3EUFA 3I9JA 1ZO8A 3RM3A 1MOSA 4G25A 2A1TR 1IG0A 1B6SA 1P61B 3LL7A 4G4SP 3UAYA 1FQJA 3PVSA 3EF0A 2BEVA 4IGEA 4FOLA 5E6UA 3X1JA 1HM5A 1HWYA 3OX3A 2OLKA 2FMTA 3OZWA 1O8BA 5EJ2A 4MUHA 4E2FA 1O7JA 1E0JA 2P6PA 4RIEA 2W93A 4C4XA 2FWJA 3L4EA 2HPAA 4K9NA 3SSAA 3TIVA 4DQXA 3K6SA 4DR4B 4ZCTA 3TLZA 4MVJE 4UVGA 3KVVA 4XA8A 2FEPA 4H4EA 4B5LA 4L51A 1LJ8A 3WKEA 2ZUFA 2BR5A 5BOSA 2ZDGA 4GXTA 3IPCA 4IHJF 3A6LA 2BVNA 1OYVA 3WGJA 4YPOA 4PHGA 2G7ZA 1N5LA 4L75A 3ZVKA 3MELA 1F6WA 1M74A 5HZGA 1G60A 2P91A 3ETNA 3Q7TA 4M1KA 1NJ6A 3GY0A 1GDTA 1JJBA 5BXQC 4BFUA 2VF5X 1VI5A 2WJJA 3K9WA 2AX4A 2OBMA 4EL5A 4NU5A 2YTZA 1NMQA 3HKBB 1APBA 2OGZA 2H4JA 3DW1X 3ZEIA 5T3YA 2M6KA 1T2NA 2JHPA 3MIZA 3QE4A 2BUBA 3B7WA 4X0EA 1I4WA 1LLUA 2QD4A 4NCJA 2WP8J 1T3GA 3IKLA 2HPHA 4JU9A 4TKUB 3D7SA 4WADA 3K1ZA 5EWMA 4PG8A 5MN6A 1XPUA 2D7CA 2GD0A 2GB4A 3THRA 3L04A 3VH3A 1N9GA 3REQB 2PQMA 6REQB 2OSVA 1AKYA 3HR7A 4NLLA 4Q4LA 4TYMA 4UEJA 4XCVA 4O59O 1P33A 1VRWA 3AEXA 3OQIA 4OXIA 1M8FA 1KP2A 1P0CA 5F2KA 1IY1A 1GTJ1 1ZZGA 4WOCA 1YIAA 1V16A 3D6NB 3RU2A 5LM3A 1IBKB 1DUSA 1A2OA 4MW0A 4KMOA 2YOGA 5AOAA 2ZJ7A 3R3UA 4Y6LA 4OATA 1JHXA 2O2DA 5JCOC 1U2GC 1ICEA 2AC7A 2ZDHA 1ILWA 2AK3A 2Y9MB 3M9LA 5EIAA 2ZIEA 5AVKA 1X1CA 3K72B 1F8FA 4EDHA 4GOND 5BVGB 1DARA 3G2PA 3GNQA 3BXOA 3FUUA 5BMVF 1FQKA 1V3VA 2R7NA 5KSOA 1PJAA 2X2PA 4I9UA 3DDZX 3E4CA 4YJHA 3RRZA 3EXHC 3K8YA 3N6RA 1L5HA 2CLDX 4DLRA 1O4VA 1KJQA 3OURA 3RTCA 3AKDA 1GGFA 1QFYA 4QVGA 4ZPXA 1BXGA 2IL1A 3QLTA 5AK3A 4DCJA 2EXXA 3FWPA 2PD6A 5BSHA 1JAZA 1E1QD 4NV0A 3LBYA 3D3WB 4C14A 4X20A 3UXMA 3WE7A 1BWRA 1QTIA 2PPVA 2AKEA 1FDIA 3HUFA 3E70C 1EX7A 3FMGA 4DHWA 4AAYA 2P11A 3KG2A 2JKVA 3HVKA 3JYLA 4G63A 3T9FA 3IAM1 1ZN9A 3F3SA 3K53A 1L7DA 3IQDB 4WOPA 3KQKA 2EG5A 2NUPB 1T5HX 4GU5A 4MCIA 1Z75A 1KORA 2NU6A 1QCYA 2FXIA 2H1CA 2YIVX 2XCOA 3IHTA 3OZAA 2GPSA 3I1IA 2AK2A 4TV9B 2QW1A 5JNVA 3U39A 5JSKA 3Q3CA 4DV1B 2YW2A 1RW4A 2LPMA 2ZUUA 3PDCA 3F7NA 4XM1A 1YJ8A 2FG6C 3SHWA 4E3ZA 3TRJA 1PFGA 2DCMA 2YL2A 2Z3VA 1RRMA 1SUCA 1VRCA 2VWHA 3EXIA 4LRUA 4MR7B 5HKOA 2IOYA 4S35A 2X5OA 1JI3A 2QP9X 2CC2A 4G36A 3UQZA 5J4HA 1QGAA 1T1EA 2VDJA 4N6NA 3HVRA 5KBYA 3EQ9A 4E22A 5FJJA 1P5HA 4C3UA 2JIQA 1XKQA 1DAMA 2FSFA 4FNMA 3ET5A 3N70A 2RJNA 1KAGA 3WHKA 2CUZA 3SHTA 4RF2A 1Q0ZA 1XLUA 3KL4A 5I9MA 5CLJA 4WE3A 3HY4A 4QBKA 5CLFA 2RAVA 4KLZA 3PQFA 1XC7A 1QHHB 1RNLA 2F1IA 2X6RA 1OUMA 3PITA 4GBED 2VHWA 3CT6A 4ILEA 4R7TA 1LDMA 3GFRA 2ZJAA 1PO7A 4YQEA 3ZKWA 3ZU4A 3ZYZA 3UJNA 4S3MA 2EKZA 2HR1A 3L77A 3BMCA 1FFEA 1Z88A 2J46A 4J29A 4JN6B 4LGMA 5FWAA 3R3HA 4B47A 2EL9A 1OROA 2ZRIA 3T38A 2O5CA 2GAJA 2DPHA 1Z0JA 3LO8A 3LT0A 4AKTA 2YR0A 1WD7A 1HYGA 3GCZA 5K8CA 3KJEA 2VP5A 2HFKA 3NHMA 4WESA 2XTZA 3U19A 2O1SA 4NWIA 3CWQA 2PRIA 3F6SA 2HK8A 4L5BA 1BAPA 3IP8A 1E69A 1L4BA 1PDVA 3EE6A 4XLZA 1OOEA 5AI8A 1DOAA 1N6IA 1F2UA 1VKNA 3DMGA 3I73A 3I2IA 1SBCA 4PVCA 3WFJA 4BVFA 4Q1CA 1CG6A 3TVTA 3CHYA 3KLPX 2AOXA 3S2EA 3HZHA 1ZG3A 1YZQA 3AVPA 1UPUA 3JR3A 5I7UA 3FPLA 1LDYA 3H4MA 1CZLA 5BQFA 1J2YA 3C6BA 3M34A 1DZIA 5FUWA 3VXKA 2JHAA 3PC2A 2ISQA 1OBFO 4QULA 2IU0A 4A5SA 3QVGB 1GG9A 1UOQA 1JG1A 5DLYA 3PI6A 4K2AA 3OPNA 3QG1A 4L85A 1IDOA 3HJTA 4DA6A 2OGWA 4RTLA 5IM4A 5ER6A 3P9NA 4MZDA 4PQEA 3ZLJA 1REQB 4HH4A 1FNSA 3W5SA 3TZBA 1TAHA 5JSQA 5HE9A 1T6NA 4AD8A 4WECA 1QP4A 2HWWA 2IYRA 3CSDA 4NONA 5ECYA 4X60A 1DE0A 1FUKA 1MAHA 4JBYA 4L9AA 1AS0A 2VC2B 2Y1XA 3GLFA 2AFHB 2HHCA 5A05A 5LDDC 2HHLA 4PN3A 3OU7A 4HXYA 4ZU3A 4JP8A 5HEKA 2AMJA 3HLTA 3LZDA 4DA7A 5SZKB 1YU9A 4UJ5A 2J0QA 5DX1A 1YRAA 1OFUA 1TKBA 1Y80A 2DU8A 1Y3HA 3FFAA 2IPLA 2ZRJA 4J4BA 5B30A 3C7KA 3IQWA 2IPMA 3V97A 3ZLBA 3KUUA 1F7VA 2P9HA 1M2WA 2MYTA 1Y37A 2PA3A 3H1FA 4V1CI 2X6QA 4XVRA 2HA5A 1E4VA 4OIMA 4F7DA 2FMIA 2P6OA 1SOWA 2B8EA 4ZKEA 3VNVA 2TRSB 1AURA 1HDIA 3GO4A 3A6PC 1MFZA 2ODNA 4TOIA 3AETA 2ZIAA 3H0CA 2QDKA 3HDGA 4L76A 3FKJA 3ZJ4A 4BKPA 1UEIA 2B9EA 3A2NA 1SUFA 3BA6A 4GMHA 4BLPA 5C8DA 5LNK6 1O58A 2BSXA 2YZMA 3G5TA 1UDXA 2OT3B 5TMEA 5KAPA 3QV2A 1SUEA 4ZQEA 3TKAA 4YJ2F 3L5OA 3DE7X 3CW2A 3PPXA 2HLPA 4TXJA 3FNGA 4NEHB 4BJ5A 4DC9A 4WLFA 1P6UA 1WHTA 2G28A 3MQ2A 4IIJF 2C83A 5FO0A 1T25A 4MI6A 5DHAA 2HT1A 1EVKA 3G5UA 1SUBA 5IJZA 2EKLA 1A98A 1C4OA 4V1CB 3I01M 3PT9A 3N2NA 3AH8A 2V3WA 3E2MA 3H3FA 4QPJC 4QTZA 5COAA 4LBWA 1JKIA 3ZXIA 3ZCSA 1D2AA 2P69A 3CF4A 4P7GA 1A7UA 3UJBA 3V8RA 1EHCA 2D4AA 4P4NA 1B7GO 1D5CA 4Q1DA 3OCCA 2ZANA 3GQBA 3T9AA 3V2HA 5AWFC 1KH2A 1DRWA 2VHTA 4B4DA 5C1IA 5TMBA 3FNIA 3DV0A 4C1BA 4EKYA 5JBNA 1BDJA 1R12A 2QRHA 2NU8B 3E3LA 4KXUA 5IFLA 2JGEA 1DJLA 2IWRA 1BMDA 1ISIA 1PS9A 1W6UA 2CXNA 5GY7A 1OF1A 2QTBA 1ZCZA 4D0NA 4N7RA 3AR9A 1N2CB 5U4XA 2XB2A 2X0IA 4JD5A 1M2KA 2QRMA 3IKTA 2QRVB 4H7HA 2CZGA 3PFKA 2QM7A 5JOQA 1GQQA 1D6JA 1UMBB 1XZHA 2OHIA 1SUPA 4EF4A 2C04A 1KZYC 1JZQA 1MXFA 1DXYA 3N05A 1ZJ5A 4BV3A 4DLZA 3FGOA 3KPVA 2OZKA 1D07A 2CLHB 1OI7A 1HUQA 1R0ZA 1WZNA 3AG6A 1S9DA 4K8OA 2RJ3A 4Z4CA 1P1RA 3HKDA 4OHMA 5ARDA 1KXZA 1F17A 2XWPA 3G7SA 3SHVA 4D6PA 4EO4A 1IWBB 3Q3EA 3HR4A 2VG8A 3B9QA 4PCAA 2GOYA 4OI4A 4H0FA 4NICA 4ER0A 4FC6A 1JG4A 2DE0X 2ORIA 3RS8A 5EMHA 4CI9A 5AI5A 4LYHA 3V8PA 2IYYA 4GP9A 3A1CA 3AF3A 3EZ9A 1XRNA 1EXMA 4MR8A 5IANA 1H94A 2RHCA 3P52A 4QGFA 4RKEA 1FBNA 1DO8A 2DBZA 3PENA 5AI0A 2WPNA 3EWAA 3DQZA 3QLUA 1G7RA 5JVDB 3RYIB 4M8IA 4YAOA 2PEYA 4B2LA 4CG3A 1MOZA 4EBBA 1D04A 2H6EA 2VF8A 2W83A 4ISCA 4KQ9A 1V11A 1KIFA 1LI4A 1W87A 4KO1S 4BKMA 1VXOA 3MAJA 3HUDA 3G5AA 5DOVA 5KYUA 2WV9A 3DEFA 2IHVA 4ZAGA 4YUWA 3OETA 4K1LA 1GZ5A 4CKXA 1YE3A 4OJNA 1NZDA 2C94A 2B8TA 2QMOA 4Q4CA 4YAKA 1NMXA 3BKXA 4KITB 4RTNA 4L6IA 2PUBA 1SVLA 3DC7A 1BX0A 3T06B 4IKOA 3DDNA 1H0KA 1MRSA 2HADA 4XYBA 3RUHA 3FKQA 4K6CA 5AM3A 5H8WA 4R3WA 4ND6A 1YR2A 4JBGA 1L9KA 2OBLA 1LBTA 1P77A 1UMKA 2VA9A 3H05A 1Z6GA 4LBYA 4PLVA 1ULAA 4Q4HA 4GKBA 4YX9A 2NV6A 4LHXA 3TQTA 5CD9A 3KV3O 4RCZA 2PO7A 4N0PA 1OH7A 3UUFA 5H59A 1M10A 4RQBA 3ZWXA 1J8FA 1ESEA 1L5NA 4YAEA 3K9CA 3WI7A 1W2GA 1DC8A 4BVEA 5KYVA 1TZ2A 3P32A 4QFMA 3DFZA 4P0PB 5G3YA 3OPMA 4O2BB 3EGXA 3KHKA 1OH8A 4XWKA 1CUGA 5JZMA 3KYIB 2YV4A 2LW7A 3CR3C 4IDFA 3RC3A 1V2HE 3CLHA 1ZUHA 1WULS 2AQKA 2WJIA 5BY2A 1GZ4A 4RVSA 1GPNA 2YJ6A 4HTAA 4QDKA 1E6CA 5K6AC 3C48A 1M5TA 3N8NA 5DTMA 5EKUA 1U2PA 4AYTA 5BV8A 4DB2A 2FPMA 1L8LA 2DSNA 2GEFA 3AFMA 4LF9B 4TTQA 5FJIA 2WICA 4HZUB 5ICEA 1PDWA 4DEXA 2ZJ8A 2Q6LA 1YUNA 4B4VA 1NUHA 3INYA 1YCFA 2GX6A 2B61A 1WX1A 3WA7A 2GPJA 1JVSA 3W2IA 1B42A 3HTXA 3F1LA 1OLXA 2D1TA 3PLNA 2J6CA 4EA7A 2NZUG 4XYLA 2YV1A 3BJZA 3ICVA 6Q21A 4QZVA 1OAKA 2H52A 4P7KA 3N7TA 2AH5A 2ZYHA 4PLFA 1LBHA 1ZJZA 2CVQA 2OFOA 3THYA 4G24A 3OLXA 2K5UA 1TECE 3GIWA 3LH5A 4WDRA 1Y82A 5HOQA 3G0IA 4YDRA 4KXWA 5I47A 1UDCA 4FCVA 4AN0A 1TT5B 1T24A 4BMDA 1ZOOA 3AR2A 4G5YA 3OP4A 5A3SA 4BO6A 2VUTA 4TTIA 4MGHA 3EULA 2GKGA 2NU7B 5IXSA 2D7DA 3LT4A 5DMHA 4KBYA 5FA5A 3SFTA 4ZHQF 1C9EA 3TSZA 2G9VA 4MMZB 1AGPA 1E3QA 2P2ZA 3N1UA 1FL9A 4ZMBA 2V7GA 1WBBA 4UUNA 4POAA 4B45A 2JH3A 2XWBF 3I61A 4XAQA 1PFUA 4J7AA 1XD2A 2ZZKA 4JGBA 5JRZA 1ODKA 1TIBA 2JC3A 4MV6A 2F3QA 1SK9A 4XI9A 1YJAA 2FFQA 3NUZA 5F4BA 3RVNA 5DBGA 1JBQA 1DAHA 4I5DA 1Q83A 4R5MA 4YCLA 2HCRA 5EWJA 4J1TC 2HNAA 5I8WA 4HRXA 1SXJD 2Q8QA 3L02A 5IXJA 4J07A 1TUBB 1XVLA 3IUSA 1CRPA 1IRIA 2OKGA 5JZSA 5GOTA 1Y3AA 4NAUA 5K99A 4US1R 1YHZA 2Q6OA 3NHPA 1LV8A 4UHEA 1HOTA 3ZNOA 3AR3A 3HWWA 2FGKA 3BC1A 3OY2A 2PSJA 2QLMA 4FX2A 4ITRC 3K9NA 4X63A 4LJSA 1SH7A 2WHEA 4Z4GA 1N6LA 1QFXA 1TNDA 1L5WA 1U31A 3H0EA 5FI1B 3MYYA 3GGSA 3DKRA 2PMWB 4NMLA 2Z04A 3DPUA 5JS6A 1DG9A 1B0UA 1RLUA 3Q98A 3PC7A 4FZRA 2FKAA 1NZJA 3UZUA 4F3CA 3P2JA 1A50B 1EZ4A 3UCEA 3QVSA 1GM5A 4B48A 2ODQA 5I7AA 4PGMA 3LNCA 5CT9A 3FPHA 3NHSA 3EEBA 3MTAA 1VJRA 4IKPA 1Z28A 4Q1FA 4YRIA 4NARA 2NGRA 1MAWA 2XY4A 3M3HA 1U9JA 5AVJA 3AWIA 3NORA 3I76A 2C9BA 1E2NA 4ZOBA 2NVBA 3B9BA 1GTL1 2NQTA 2X9QA 1DU4A 1IM5A 1WW2A 3GLGA 3C74A 4WLOA 5HG0A 4BKOA 3I6ZA 1Z22A 1JFFA 3MJVA 1F1BA 1R8QA 5KX5F 4NVRA 2YS6A 4RHEA 1GKKA 4LNUA 4MIKA 1M5UA 1G8YA 3RYFB 1NWHA 1I4DD 4PV7A 1TMYA 2NTYC 4JYAB 1XT6A 3ZWBA 3I30X 3GFOA 4KX3A 3N74A 3QBEA 5JALA 1N2EA 2WAOA 3TLXA 3TZQA 3H83A 5KC9A 1YE8A 2CXTA 2FR1A 1DFIA 4WZ6A 3AEKA 1XYGA 3NOXA 2P68A 2SKCA 3KZ1E 3I9V1 4IJWA 4JQZA 3ZX5A 4BWYA 3LYHA 4M0FA 3PVCA 2P1RA 4UTVA 4G56A 1E98A 2IT1A 5IBQA 1DWUA 1CFJA 1IBRA 1MAAA 5BQPA 3RAJA 2CJWA 1BE8A 4RK7A 2A0WA 3BSFA 3GEDA 4P4SB 1XP5A 3U6BA 1AGXA 1YL7A 4GVLA 2VRWA 5AK4A 2JARA 3W5JA 4AK9A 4IYJA 3RUIA 1GKUB 3KQTA 1RLTA 4IGKA 2AFHE 1VHLA 2MYUA 2XUIA 2AFVA 3CBGA 3DCYA 4WKBA 1DKMA 2OE2A 5EKDA 1SR8A 4GX1A 2GBGA 1WD5A 3FCYA 4R98A 4WLVA 2J0SA 1XAIA 2ZJ2A 4JVOA 1C7IA 4RWEA 4X3OA 1QF7A 2XT9A 1Z29A 3EIFA 3PJEA 1OASA 2LVBA 4H7KA 3WWYA 3HB9A 1QGUB 1LFAA 3OF2A 3PKZA 4NPAA 3UMRA 3Q8MA 3FGPA 4BTVA 5C5IA 3G0DA 3I2YX 3EFBA 3AHJA 3P5SA 1X1BA 3R3ZA 5DH9A 1OGYA 2ST1A 3PD7A 3FVVA 5GMOA 1BH6A 5I9BA 1F4PA 1E1NA 2ZWMA 1PQYA 4R2LA 4Y18A 1ITZA 1J49A 2FSHA 4U2DA 1KE1A 3PQ5A 3GFPA 4KRYA 2WIJA 2H59A 1Z3IX 1SUSA 2PS9A 2R6HA 1U5AA 1E2BA 4WGFA 4ZYYA 1QQ5A 3QMVA 4ZWNA 1W5FA 1U0OC 1C0PA 1KI6B 2FOLA 3L8EA 3NS7A 4I55F 3S40A 2J45A 3LJKA 4DIBA 1I3OA 2CVOA 3D7MA 3DZKA 3HN7A 2EKBA 2G8LA 4NH4A 3FF4A 4EB6A 2A33A 1X7XA 1XZJA 3ZH2A 2QJOA 2HYIC 4O0LA 3UHAA 3AF6A 3QMMA 5L6LB 2XUDA 4PGAA 3RD5A 1ULHA 3B1JA 4BE9A 1GZHB 3PRYA 3WIDA 4BFVA 1F12A 3AKYA 4YROA 5LN1A 2JEYA 4ZCQA 4D80A 5EC8A 3EXEA 2B4KA 4W6QA 1Q2UA 4QUBA 2E0IA 4RTMA 2X77A 3BN3A 2JFUA 5JAQA 3EVCA 2EF0A 2UUPA 3IH5A 1QO0D 3A58B 4X7MA 3LDFA 3MUFA 4UU1A 3SBEA 2R62A 4MUIA 1IMJA 1DVRA 2WTBA 3IERA 4BNXA 2WIGA 2AOWA 2BKVA 2YYYA 3ORFA 3TCXB 4AXXA 4C87A 1T9HA 1RQLA 2JJ1A 4CUJA 1WW8A 3H1AA 4RHFA 4CMIB 4ZHSA 1OB2A 3TI9A 3H16A 1J9GA 5LA6F 4PAQA 2QY6A 4RF4A 2GASA 1TJ4A 3A25A 2IPAB 2CLIB 2G0TA 2VWGA 5FPKA 3EXHB 1X7DA 3AVYA 3BREA 1RYNA 2P9TA 1RSZA 4QARA 4LSZA 1U0TA 1EA7A 4DOMA 4ZTZB 1J9ZA 1W6RA 1XRLA 2RH9B 2QF7A 3C3JA 4PPYA 1RPTA 1SB8A 2O4CA 3HP1A 4PSAA 4QDZA 2UYCA 3LHKA 3ICOA 4ZVTA 5KHLB 1UAAA 1E6EA 1EHIA 1T8WA 3D5QA 2ZUTA 2A1UA 3CLTD 3H84A 3U26A 5AYVA 1DP4A 1F9AA 2SKEA 1QLWA 2QP4A 4QHSA 5B64A 2PT9A 4AJ2A 2MT9A 1DEKA 3EAQA 2P0YA 1NT4A 5KTYA 4GPIB 5EMJA 5GONA 3ZWOA 1LUAA 1QIDA 2VHXA 3H9JA 2GWHA 3K0CC 1M76A 1QKIA 2LUOA 2AYYA 3DS8A 3LW8A 4OQDA 3AKCA 2HT6A 3L43A 1PV1A 1MAVA 2RC6A 3FBGA 2YHSA 2BISA 4F2PA 5JNWA 4G09A 4GZ3A 4Z4HA 4XWTA 4FYKA 4M8SA 3DBRB 2C2GA 4H7EA 4DAOA 4YMUA 1QSGA 4W1PA 4KJZA 1NFQA 3CU5A 2H0AA 3HSKA 2GZDA 4MAFA 4PLZA 3GL9A 1QX3A 4Y1RA 2G76A 2GARA 4URWR 1HE5A 3KX2A 2JATA 4UXJA 2WAXA 5JYEA 1RU3A 1TL7C 4E4TA 3TNYA 1M3SA 1QO9A 5B57C 3ETDA 4TS1A 3DO6A 3FX2A 3HCEA 4PCUA 3H97A 1G19A 2ZYIA 3U3JA 2JVJA 4TTAA 1NUPA 3OZDA 4J49A 2PNJA 1XZIA 1PT8A 1TD9A 3P9XA 3A1SA 2IYQA 1QHSA 4FHEA 1G8FA 4PIMA 2G4VA 2HWUA 4L4SA 2ISSD 3FPAA 4YYEA 4R9VA 3IT1A 3LVRE 2I6SA 3MT9A 4WK0B 4KL8S 2C8JA 2ZUVA 1U8CB 1PR3A 5JDCC 5LOVB 3VZDA 3RFTA 1WVGA 2WUVA 4J1SA 4KK3A 4X44A 3PPYA 3L6DA 4C7BA 4EZBA 3OHMA 3ROGA 2NAPA 1MG0A 1HO3A 4IBOA 4JJ8A 4MEJA 2CJPA 2AKAB 2PZLA 5E2AA 1X1QA 3G59A 2XD9A 5TEWA 1G20B 3EASA 4Y8VA 2XYRA 1LWNA 4L02A 3DUFB 3QVVA 3P26A 4NV3A 3KLOA 2E1RA 1BVHA 4C1NA 4FFMA 2XTNA 4Q7EA 2TECE 3NJ8A 2FFJA 2EKQA 2X14A 4O2AF 1CY7A 3NBFA 1YXMA 2G72A 1K3TA 2DPLA 4JOCA 1CX9B 4NJOA 3LFUA 3LUBA 5DYNA 1VFNA 4OBXA 2R1TA 2Q99A 2OV2A 1FZTA 4CT0A 3ML1A 3ANLA 2O23A 1ES9A 4MLZA 3TECE 1MO5A 5AOBA 1JQEA 2IYTA 2P3QA 2DR2A 1A8UA 1EZ1A 2NTEA 1E96A 2OAEA 3D8RA 4TMKA 4TYQA 1G3QA 1QB7A 5K0ZA 1PV4A 3B20A 1KZHA 2V0GA 4TL8A 4YLEA 2IH4A 2DQSA 1DBIA 3RU9A 1W2WB 3VPAA 1XVTA 3AYXB 2XV1A 1T1RA 4AKIA 4P98A 3M6VA 4G9BA 2JB9A 1O94C 1ZH8A 2J30A 4UNSA 5JH7F 2ZJOA 3LPLA 3H9QA 3LQ4A 4Y2RA 3BTUA 4GBJA 1K7CA 2QRLA 2B7LA 3PXCX 1MGOA 2ZAMA 4FW8A 4G1CA 5C1OA 2VNHA 2R68A 3T7JA 3QUTA 1WXHA 2GNAA 2GO7A 1ZMXA 4TXHA 3STYA 2BFEB 2XNSA 5LQMA 2BGWA 3A8TA 2DBRA 5JMOA 1I14A 3B9RA 3U7RA 2VHVA 2OO5A 1VJTA 4PGGA 4UBOA 3T9CA 5AW9A 3E9NA 3NYQA 5ED4A 3G68A 2X41A 2XQVA 3WRVA 4LAFA 1II8A 4HUQA 5JSHA 3VKHA 1S02A 4GYKA 1QYCA 5JD5A 3KAKA 4WVFA 1WS6A 2NZYA 1UQTA 4XGNA 5C4GB 2PYZA 2Q3DA 1BVUA 3DHEA 1B15A 1P3Y1 3OFNA 4MUFA 5J2TA 3U37A 3E9CA 3V8NA 1RS0A 2QQ5A 2VPZA 2YMLA 4W8GA 5BUSA 2E5LB 1DLIA 2BW0A 3OLYA 4EJSC 5WRFA 3ZVNA 5THKA 4EAAA 1RYDA 4J03A 4PBSA 3TR5A 4AWAA 1ZXBA 2V54A 2X22A 2B3DA 2J3IA 2KM1A 3L92A 1NOJA 3I2FA 4GYYA 5EXPA 4KLRA 3SVZA 2PXXA 4BZWA 3SMVA 4DNOA 1JMYA 4YRZA 1WU7A 1D2RA 4QEDA 1PEDA 1NXPA 4MVJP 2NQ8A 2PAAA 3O82A 4QO7A 1SIUA 1HGXA 5ECDA 4N5NA 2V9CA 1QUEA 1PD1A 1UZNA 2IYUA 3KQSA 3LVFO 4IICA 4AKHA 3E6AA 4AJJA 2YJ3A 4MKFA 3SC3A 3NIGB 2QYOA 3B53X 1JLRA 2GN4A 2F1JA 2V7WA 1QK3A 2XVYA 3C15C 5FWDA 3ZWAA 4ZVLA 1EE1A 4GLLA 1ZQ1A 3AI7A 4C7JA 1AZLA 1IOWA 1Q0UA 1T5IA 2OO3A 3F9RA 4Q9IA 4XQEA 4AM8A 4AUKA 3OHPA 3Q8LA 1ZMBA 3W5AA 7MHTA 5BO5A 3WLMA 1JL3A 2BCJQ 3OZFA 1PFYA 1XOIA 1ZH2A 3AY6A 3G89A 1TVEA 3K6KA 1XRMA 3IP9A 3KYJB 4D3XA 3R7SA 1DQNA 4K9KA 1DBQA 4F3KA 4JYMA 3R9WA 1UBEA 1KAOA 4RLHA 2L18A 3DEJA 4MOWA 2CYCA 1U2DA 1P6XA 2I55A 2YC4C 1X9HA 2IE0A 3KT8A 1HQCA 3RK4A 2VHQA 2XE4A 3L8DA 5JEEA 4X6XA 1NBOA 1U02A 1V5FA 3CEPB 1MEJA 2ZJ6A 1M5RA 3CTMA 4RVFA 2CHEA 1ZEJA 1KR5A 2IY8A 4CI0B 1BDIA 4G2TA 4P54A 2OQRA 5DBOA 4YAIA 4PLGA 3L79A 2EGUA 1LPNA 3BVPA 4L6CA 3RVOA 5IBCA 1MTOA 1NDHA 4RKRA 5K4HA 3BGSA 4GOXA 4RQAA 3KPJA 1EFHA 1YRQA 4LYEA 3CE9A 3H11A 4H0CA 4R1LA 4DVJA 3Q9SA 4RPKA 1YH3A 3R6DA 2AVNA 3HEAA 3EF3A 1U80A 1ULBA 3V55A 1RWBA 3STXA 1XDBA 2ZSUA 4O4IA 3TQFA 2JIDA 1ZUNA 3D0KA 1Z6QA 1FDWA 3EMBA 3DFMA 2W22A 1IRXA 3WQBA 5K0CA 4DSNA 1XMXA 3QRWA 4PZ0A 2X8LA 3SU8A 5AXDA 1H2WA 3VPDA 3VR6H 3WX0A 1ULSA 3RH0A 1HEUA 3EH2A 1DWPA 1EFVA 2Z83A 3NWPA 4Y3UA 5E1BA 4G1UC 2MINA 1C0LA 1Y1SA 4RZ3A 3ES9A 3KTAA 3CT4A 5ECWA 3ZCXA 3P94A 2WI8A 4X24A 3H17A 2EV9A 3D6AA 4QBIA 3UMBA 3UANA 4TVSA 3BM5A 5IT4A 1LW7A 1MB9A 3QPVA 4JUDX 5KNCA 4GDFA 5CYFA 3ZDEA 4EYKA 4MVJF 1Z4MA 1IM8A 1QMGA 4HX9A 3JTMA 3DXFA 2DWQA 4ID9A 3WSVA 5JEDA 2GD2A 3N7AA 5IC5A 1XZCA 2JGDB 3ER8A 3FF1A 2EFJA 4NDAA 4P34A 5EJFA 2ZUEA 4ZT3A 3H9UA 4MYRA 4WXMA 4JUFA 2PGLA 4DA8A 1MF7A 1ZUD1 1ML3A 1QG0A 3EA4A 4F3YA 4ES6A 2XMRA 2Z2ZA 3IAAA 5AXBA 3D8TA 5DLEA 3H5RA 2PJRA 3H2KA 3P0HA 2AD1A 3SQMA 1A8SA 2QPOA 2FPGA 4QRIA 2XMDA 1UFRA 1C9JA 1T9CA 2DQZA 4OJMX 4V0LA 3IOEA 4FYWA 1F3OA 5K01A 4CM9A 4YIKA 4J43A 2H29A 2GRUA 2AD5A 2ODAA 3HYLA 5EJIA 4BNZA 5IDVA 4CKCA 3A3OA 3M3DA 4EHIA 2J5XA 5EJ6A 3UK7A 3LSYA 3MOSA 3PFIA 1QLHA 4Y2TA 2EKPA 2QIPA 1V1MA 4HYYA 4YHBA 1KEPA 4GGMX 4Z1MA 4KGDA 5GV7A 5BXYA 5JCPA 4JI8B 1E5XA 3P0JA 1WL8A 2ZTSA 1FFDA 2FP3A 4XD7A 4QYTA 5BSVA 4IX1A 2H1FA 3K4QA 3QFHA 3O4JA 1DRVA 3SM3A 5LMNB 2QBYB 4F4FA 2YX1A 1G4UR 2NACA 4YCDA 1T9GS 4JYBA 2NO4A 3LDAA 1AKEA 3NHAA 4GMXA 1NJ1A 1WCIB 1WRBA 1JPUA 1VJ0A 4YN3A 1XVVA 5KMGA 3INGA 3W2FA 1HE3A 3LGXA 4MICA 1YKFA 3BKWA 4M98A 2OQIA 3P45A 4JJ6A 3BPSA 1VYTA 3H9EO 1AUVA 1CP3A 1ACLA 4E51A 1XZFA 3IAHA 4DR3B 3LM8A 3CC8A 2RGWA 4R9RA 1ZMTA 3ZGZA 4Q9JA 1MO3A 1R4AA 2OCKA 3W8FA 3GV0A 1BJTA 4FCTA 4M0EA 1PI3A 3R7AA 1W0CA 4DCGA 4HB4A 1J0EA 4WBNF 9LDTA 5JRJA 4BVJA 2QAJA 3BQNB 1L5RA 3M6MD 2R00A 2QNBA 1D6MA 1K0FA 1UC9A 2DR3A 1BGVA 2HV9A 4Y6QA 1E8DA 1SMKA 3OIFA 4LRYA 4LKOA 4ND5A 4YI3A 5EXDA 1UDRA 4D25A 2YYSA 5TPZD 1EEXB 1DAPA 2I2XB 1K4MA 1ONNA 1ENYA 1IBSA 1SC3A 1HLDA 3CUSA 1TA4A 3OJOA 3PGVA 1CNFA 3T12A 4EBFA 5FTJA 1NXSA 2EW8A 1KI4A 3BICA 2LIVA 3UG7A 3ABSB 1K8YB 3OOSA 3T34A 2JFBA 5AKYA 3UPDA 4KTTE 3BFKA 2Q6VA 3IEPA 3OMXA 4ARCA 1IXZA 4YRBA 5HFAA 3ZYCA 2BEWB 1E2JA 3K94A 4OXRA 1C8BA 4LDRA 2YY6A 2E85A 2FUEA 3QF7A 4LIPD 3GRZA 3RTDA 3TLKA 1HEIA 3QKSB 5K3FA 1HQYE 1QCZA 1FMLA 2NPIA 1NJ5A 1XAJA 5TX7A 1Z2NX 2C5GA 4UMEA 4YJFB 3IMGA 1A95A 3GZTB 3BZUA 4Z2AA 2G1KA 1SAYA 2IY7A 4JSYA 2KWIA 3COSA 1YU6A 4ESEA 2F8MA 2JJ1D 2RB5A 1SG0A 2HWXA 4BGEA 1TCAA 2QE6A 3F49S 5C35A 2WLSA 5I4BA 5C3UA 1XEFA 1X7WB 3PE4A 1ESCA 1XEXB 2DFNA 3KQUA 2RGBA 1PL0A 2CZQA 5IBPA 1NBME 1V5WA 4DEVA 1T4DA 4PX2A 4M9ZA 4NCAA 1HZZC 5JZ9A 1H6BA 3PX3A 4AUNA 4QEKA 1RWPA 3R09A 3AB7A 4KUEA 2JBAA 2IGBA 2X42A 2ZSBA 2DPYA 2CV2A 1CF2O 4DMHA 2NU9B 3SXUB 1Y4AE 1O9BA 2VF4X 3QVJA 1BHJA 2WQZA 4IMJB 3UMYA 1P7VA 3VGPA 3OH8A 2V97A 1A8QA 1ORRA 5GVRA 1M1UA 1NN3A 3L7LA 1RPNA 3HY6A 3L8FA 4NYIR 4DDUA 4PRZA 4CLXA 2QU8A 1PR9A 3WXMA 2WNIA 4OYLA 4LGCA 2WSSA 4JENA 4PPFA 4EB0A 1CEXA 5EKXA 4HNTA 2ADOA 2VQ6A 3SHOA 2H7XA 3COPA 3FCUB 3SEZA 4B3IA 5FL3A 2OD2A 5JATA 4Q12A 3A6EA 4BRZA 1V4NA 3BB3A 4CG0A 2XMBA 1SVIA 5IT9A 5B3AA 4R81A 3DFFA 2J5QA 4EEZA 3AX6A 4ZKDA 2O59A 3WWOA 3NEYA 3ABOB 4P4UA 5HOEA 2CL7X 2IQIA 4AMGA 1U7TA 1NAHA 2EQAA 1P0FA 1QHNA 3GLQA 2W2NA 2VPQA 1FP1D 1EH5A 1XE3A 1ESNA 3PL1A 5KQSA 5LU8A 3FRJA 2OK8A 1MW8X 4HJRA 4C4YA 4D3DA 4UM9B 5C8VA 5J1TB 1HFWA 4GOJA 3R6TA 2EX4A 3ANSA 3F6CA 4HQLA 1U6IA 3P0FA 3RABA 3TW8B 2PQ6A 2E48A 2OAQ1 2V59A 3CZAA 5EGSA 3TINA 3TZLA 3VHRA 3I1JA 5HS6A 2BJHA 1E0SA 2YY7A 4W5RA 5B1DA 1D1TA 2PGIA 3ZGOA 5KVVA 1P4HA 3SSMA 2ZE8A 3NDIA 4CIXA 2VPTA 4KE6A 2IDZA 2EZTA 2I67A 4XD2A 3E1GA 1CIPA 1EKXA 1M6HA 1YZVA 4LRXA 3KWLA 4BTLA 3DD1A 2C88A 1S2MA 4JH0A 1NQWA 4M37A 1LPPA 1A27A 1OIWA 2XNCA 2EJBA 2HQBA 4FFBB 2GCIA 4JVSB 4KDRA 2XQGA 2PMEA 2O8FB 3H2ZA 3MS7A 4BC0A 2WTUA 3STTA 2O7RA 3AR6A 4NBSA 4H7JA 5FR1A 3F73A 1DCMA 3DBLB 3OF5A 4HQ6A 2JGRA 1KI3A 2OGTA 1QYVA 3HDHA 3KNZA 1TAQA 4EGFA 1XWFA 1PG0A 3U4IA 1P0IA 4DNQA 2OFXA 2C99A 3BBPA 1F2TB 2C77A 2EGHA 3GYGA 4NZYA 5TF0A 1W4RA 5FBQB 2YN0A 5JHGB 1ZHOA 1F7UA 1CHDA 1UMDB 3CRZA 1E20A 3UNXA 4RAOA 5JSFA 4U7FA 4FSHA 1E3WA 1TKAA 1IFXA 5AXCA 1PNOA 3Q9NA 3USES 1K7FB 4FOTA 1GZSA 3SLRA 3W5BA 4I0WB 2QT9A 4XM2A 1G5RA 4CUZA 3PNYA 2W6JA 3I34X 4LVUA 3RSHA 1GPLA 2GEBA 2QQEA 1X1RA 1TA9A 1TZBA 3PGKA 4RADA 4HDKB 2FQYA 2E49A 4DXDA 5TQJA 4DZRA 2ECQA 2JGIA 4C0XA 2A92A 5JT1A 1PW7A 5TPWB 1LW6E 3OLQA 2BZGA 1OU0A 1XTIA 1WETA 1FCJA 3GRKA 1G8PA 1E18A 2J08A 2D8MA 1YC5A 3IMCA 2ZJBA 4HQOA 2GJ4A 3B82A 4KAFA 5IAGA 5A7FA 2QMYA 9GPBA 1I7PA 2CVHA 4FWIB 3BK7A 1AXGA 4J16C 5THXA 3U62A 4UCWA 5HQ3B 1EB8A 3IHWA 1UDBA 3C45A 2E6UX 4E5NA 2WTMA 2BFFA 3SC2A 4FR0A 4TRNA 3QV1A 1GA4A 5HE8A 5JG7A 3ND6A 5L3VA 4CMEA 3RS3A 1LLQA 1DMSA 3EC7A 4NNPA 5I5GA 3S81A 2UAGA 1Z38A 1WKCA 1A4RA 2FPWA 2WC1A 3CCFA 3PWTA 4TMXA 4S1OA 5D5PA 1FDTA 1FSFA 1G2IA 3ZD9A 4F6RA 5F5NA 1SRRA 3R24A 4G5RA 1DT3A 2BFWA 4KE8A 1DFGA 1S3GA 1UPAA 4N3BA 1PVVA 4RV5A 5DI3B 3W5HA 2W6PA 3IPRA 1UXOA 3QVKA 4QLAA 3ZK7A 4WFKA 1ZH0A 4DM3A 3I6BA 4EG4A 3BXXA 1S96A 4M7WA 2P5UA 3SJAA 3E5NA 1O95C 2QUIA 3PUWA 3TTXA 1TFUA 2B3TA 3P7MA 3Q0TA 2ZJFA 2HDNB 2QRPA 4FT2A 1GPH1 1K06A 5JSYA 3UYLA 2Q2WA 3K8QA 4BQSA 4XOUA 3QLVA 2ZBVA 3LPDA 4MS3A 3TZEA 3NXSA 3WR5A 4LFCB 3B1FA 2QD5A 1K8RA 3H0KA 3ESBA 4LOKA 4RKYA 1T2EA 4C4RA 2EDAA 1MO2A 1PRYA 5LSAA 2ZB2A 1MQAA 4LWQA 1RM3A 2F62A 4OSOA 2XH8A 4A36A 2CJYA 2QN2A 3UJAA 4R0VA 1NQOA 1VKHA 3VKGA 1VKJA 1RKXA 5HX7A 5A4IS 4MVCA 1RLIA 2FSIA 5I7RA 1B43A 1H4TA 1XMIA 2IGTA 3H2IA 5E1OA 3T3PB 4EJ2A 1UBGA 3HJCA 3NH9A 1ZM2A 2ZM6B 4YQZA 4FHDA 1JQBA 3TD2A 1TYDE 3OX1A 3F8WA 3ENKA 4RZQA 2OFPA 5IKMA 3KB8A 2YJNA 2F43B 4E21A 4P7FA 2QZPA 4EZEA 4Q4DA 4O4LB 1K7SN 3OA2A 3AERB 3BCHA 4XR4A 4UU0A 1O77A 4NX2A 4AKEA 4Y2VA 4CKYA 3DBIA 3PX7A 5DHPA 3RT7A 1E9BA 2O8VA 4V2IA 1AA9A 1N9ZA 1SBIA 5AT1A 3LT2A 5J2UF 2I65A 2DFLA 3U3OA 3D7RA 1XDWA 2GRJA 2PUVA 2C9OA 4FFVA 4LNHA 4QBFA 1YA8A 4AJEA 2PUCA 3VU0A 3O83A 5FQOA 1E9EA 2WUDA 3PIDA 4S04A 2B34A 1OGJA 3TJZA 3RS7A 3NOOA 4X6YA 5BMOA 1J09A 2ADFA 1UJ2A 2RGYA 2WIFA 4NU6A 1JKJA 4OYHA 3W3ZB 1JIVA 4TVBA 2PX5A 3R7NA 2NXCA 2QGNA 1SFRA 1EUDB 3H5VA 5IMSA 2HK7A 3OKCA 5DHFA 2QAIA 3T3HA 2GHIA 4HRAA 5KNCD 2WE7A 1QVRA 2PRZA 3EY4A 5KYTA 3IEMA 3NGLA 4NRDA 1IC6A 4P3PA 4XUEA 1GNRA 3GN2A 3BULA 2GF0A 3IUPA 3K0FA 4K9QA 3CRW1 1N6KA 2NO6A 3FOFC 1R9JA 2G5CA 4PAOA 3FZGA 4WZBE 1BOOA 1G5QA 2JDID 4BJHB 4BUJA 3ZNNA 4IF6A 1W76A 3NHUA 3PDIB 4Y9SA 3E05A 1CUAA 5AVRA 1DMRA 4DG9A 4RM2A 5JFGA 3GP5A 4EO9A 5B4UA 4L0MA 3I0NA 4RJLA 3TKLA 1II9A 2CFCA 3TMKA 1GGJA 3AG5A 2VUUA 4CM9D 3THXB 3E9DA 4X94A 2BYTA 1BA3A 1P1HA 3CM0A 4JC5A 4JWTA 2P7IA 4OA5A 1PFWA 2BRUA 5HIMA 5BSMA 2G3YA 1N2SA 5BRAA 2QW8A 1NVAA 1DG1G 1H1DA 5CH5A 4FYMA 4CMJA 5JNLA 5F3RA 4Z1MD 3WGQA 3HVHA 1E2HA 4MPRA 4XD7D 3A37A 2PYIA 1XF9A 1MUUA 2X76A 3ZIDA 1O0SA 4YR9A 3I72A 1E0DA 2W8ZA 2EJUA 3OZEA 1NW9B 1AXEA 4KWTA 4U3JA 2XDYA 5CHEA 3VSAA 1K7XB 3W3AA 3WBBA 4TYYA 4Y2SA 3FTEA 2FN4A 2OBXA 3GQVA 3GOHA 3E8SA 3IXQA 2XDQA 1AX9A 3PA6A 4QTTB 1BVYF 5HBGA 1ECFA 1OFGA 1RFGE 1N7IA 4LHZA 4XX0B 3F4KA 2X0EA 3VJKA 3GVXA 4QU8A 1HNWB 2Z5GA 3T9BA 4OQNA 1X3LA 4PAWA 1M34B 4RPHA 2BMFA 4ZOAA 3NVAA 2BFOA 2XKJE 4X9XA 4ITVA 4KQWA 5I9TA 1SXJC 1OH5A 4TMVA 3PTLA 3GPCA 4MV4A 3L8HA 3TLEA 1OMOA 4KQ6A 2FR8C 3ZE9A 1YZKA 2CBZA 1C1HA 3A1WA 3OIYA 4HYQA 4PTLA 5IN5A 3RV3A 3PC8C 4OLBA 1XJQA 3ZE1B 4H6WA 1WEHA 1P2BA 3K1AB 1K0UA 3RIMA 1J39A 1JHMA 3OU2A 2AX3A 4I8DA 4R1UA 1UADA 4BMNA 3G02A 4M9QA 1RAFA 4MXDA 4HRYA 5ELMA 1V6SA 2IV2X 2J3LA 1KPGA 1W88A 3QUBA 4ZAZA 1JDVA 3PEYA 2GI4A 5CA0A 4LQDA 1EQAA 1E9AA 2P0AA 4EFMA 3TIIA 2QXYA 5GADl 3ZIUA 5JRDS 3UJPA 1YBMA 3MWEA 4P53A 1AV7A 3ADDA 3DPIA 3V3KA 4PYLA 3W5IA 4ESHA 3AO0B 4K0KB 2FYTA 2PV0A 4HEA1 4Z54A 1JEYB 2VLBA 4PG5A 1U99A 4G01B 3MIIA 4EH1A 1ZYUA 1VIMA 2J7KA 1TIKA 2AWNA 2OXRA 2FFBA 1Z25A 2IEAA 2CK3A 2XVXA 3SZ3A 1KOFA 1HKHA 1Y5MA 3W6NA 2YNMA 4CT5A 4YACA 4JI4B 5CBKA 1XCGB 4AICA 3D31A 1XXLA 4LRQA 3F97A 3DZCA 3TQIA 4ZYLA 3VKWA 2IP2A 3ZOZA 4ENPA 4FEGA 5DDIP 4FJ2A 3ERCA 2VI5A 5DNCA 3DFUA 3G0CA 2ZZNA 4KK4A 2LGJA 3PEEA 1S8FA 4QYSA 1Y98A 4ZC1A 1HE8B 2Z8ZA 4YJGA 3OE7A 1O6ZA 3B85A 1W94A 2QTMA 3FNFA 4UXHA 4ARZA 2BP7A 1Z5VA 4H3KB 1NQUA 3D8UA 1VL0A 3FR7A 3LQYA 3LT5A 4KFSA 2Z5LA 3HGMA 2J6IA 5AHXA 5EIFA 3UV7A 4CZ2A 4X45A 4HQNA 4F5EA 2GEKA 4PGFA 4RVCA 2ZB3A 3BRSA 4QA9A 2WSSD 1T5DX 1X1EA 2W4IA 2WMOB 1JH9A 1J00A 5T8KC 3N2GA 1T1JA 3BL6A 2Q1TA 1MG5A 4B2PA 1D1QA 3A6GA 4CLOA 1N5IA 1J2UA 3OY7A 4R2XA 3O93A 2Z6AA 2BL4A 1IAQA 4ZDKA 1A5TA 5EZQA