2C2MA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2mA00
3GJTA 2J30A 3EDQA 1K88A 2H4WA 1RWKA 2K7ZA 5IAKA 4QUGA 4EHHA 1I3OA 1BMQA 1SHLA 2QLFA 4QU9A 4ZVOA 4HQRA 2HBQA 4AWAA 4D3ZA 4ZVSA 3UO8B 3GJQA 4JJEA 2H54A 4N6GA 2HBZA 1RWXA 1RHUA 1I4OA 3KJFA 4NOKA 4N6OA 2CNNA 4QU5A 4QUIA 2QLJA 1RE1A 3NS7A 2P2CA 1NW9B 5IAGA 2NN3C 2QL9A 4N7JA 4N6NA 1QX3A 4PS1A 5LU9A 2FQQA 5IARA 1RHMA 4AW9A 1IBCA 4JQYA 3V6MA 2XZTA 2HBYA 4N5DA 1K86A 5IANA 4PRYA 3H0EA 3KJQA 3S8EA 4AWBA 2FP3A 4M9RA 4EHLA 4FDLA 2CJYA 3D6HA 3DEHA 4I1RA 2J31A 5H0IA 1CP3A 2QLBA 4JQZA 3V6LA 3DEJA 1GFWA 4D3XA 4PRZA 3RJMA 1PYOA 1I51A 2J33A 1PAUA 2C2KA 5LUBA 4D3YA 3EDRA 1RHJA 2FUNB 1RWMA 3IBFA 4LSZA 2H48A 4NOJA 4JR0A 4QUHA 4QUDA 4QUJA 3PCXA 1SC3A 2XYHA 4IEFB 4ZVUA 3R7SA 4EHFA 1I4EB 5K20A 3H11A 4NBNA 2H4YA 4JB8A 4QU8A 2QL5A 2CDRA 2WDPA 3QNWA 5IBPA 2H5IA 4NOMA 1RWWA 5IBCA 1ICEA 2C1EA 5LU8A 3NR2A 3R5JA 3S70A 3DEIA 4QTXA 4FXOA 2CJXA 2J32A 4FGUA 1RHRA 4IYRA 4QUEA 1NMEA 4I1PA 3OD5A 5IAJA 5IC6A 1QTNA 3NKFA 4N7MA 5I9TA 2H65A 1QDUA 2C2ZA 1CVRA 2AR9A 3H11B 4FEAA 4NBLA 3SIRA 4HQ0A 4JJ7A 3R5KA 2CNLA 2CNKA 4EHKA 1JXQA 1RWPA 5IC4A 1RWVA 3R6LA 2CNOA 5IASA 3DEKA 1SHJA 3R7BA 4ZVPA 2Y1LA 3IBCA 4EJFA 3BIJA 3ITNA 4ZVTA 3P4UA 3E4CA 4ZVRA 1KMCA 4JR1A 2Y0BA 2XZDA 3KJNA 4JR2A 5JFTA 1NMSA 4NOLA 4EHDA 1SC4A 4EHAA 4DCPA 5IABA 4DCJA 3SIPA 3V4LA 4HVAA 1RHKA 5I9BA 3GJSA 3K7EA 4QUBA 3D6MA 4QUAA 3H1PA 5IAEA 1RHQA 4DCOA 3V55A 2C2MA 2H51A 2QL7A 3UOAB 4QTYA 3R6GA 1RWOA 3D6FA 5IBRA 2H5JA 4PS0A 1NMQA 3PD0A 2HBRA 3PD1A 1SC1A 2DKOA 3V4OA 1GQFA 2XYGA 1M72A 3H13A 4JJ8A 4QU0A 3GJRA 2C2OA 1RWNA 2XYPA 4NBKA 1F9EA 3P45A 3V3KA 1F1JA 4EHNA 4ZVQA 5LUAA 3R7NA 4QULA
chains in the Genus database with same CATH superfamily
2DUJA 5JOQA 3V8PA 4FXPA 5JAIA 1ST3A 4NAVA 3A1EA 5IDVA 1WMBA 3A2LA 3EXHB 3P9RA 5JWOA 3I1FA 1UZMA 1V4BA 1XEXA 2WJIA 3EZXA 4FKBA 2EZTA 4QXRA 1B3BA 1V8ZA 3JYOA 4XH9B 1Z36A 4C6HA 3SQXA 1JXAA 1VJ1A 3KHUA 3KQYA 1U0OC 4RV4A 2AH5A 1JSCA 4QFBA 4EMTA 3I62A 3DOUA 1GUYA 1SRQA 2QGZA 2X22A 4MXDA 1W85A 3OP4A 4Z99A 2IODA 1B6RA 4L02A 3TR5A 2PMFA 3W8DA 1F17A 2QL9A 2Q3CA 4N6NA 4R1LA 1JI3A 2NUAB 4D45A 5JDIA 3GUYA 2Z2IA 5EWJB 2E4VA 5KDDA 4K2AA 3SC3A 4C0KA 1EA7A 1KMHB 1YE3A 2FZLA 4S1TA 4PEVA 4MEJA 4C6TA 5JWHA 3F8WA 3X2FA 1FLDA 2NOAA 3GEEA 3CKMA 3KL2A 1HDEA 1VPDA 1ULAA 3WTBA 3ZGXA 1QFSA 2JFFA 2V4MA 1T3SA 1ZKDA 4G86A 4DMMA 4ZYYA 3ZV7A 2P9JA 1HTBA 2YQ4A 2OORA 5AKYA 4R8KA 3ZU6A 2QTBA 5C52B 3HABA 3PDHA 2DQZA 3PKJA 3TZQA 4QOHA 3FGNA 3HDVA 1KOLA 3UC5A 3O38A 4LY3A 2XDWA 1USKA 5JLAA 3DMYA 2JBWA 2YH2A 2AOWA 1JHYA 3G1UA 3K6RA 4DJTA 4YP5A 5EZYA 1N1EA 1RQLA 5H1YA 3UHPA 2Q6KA 1E3JA 2WT8A 3JQBC 1YFLA 1UZAA 3CRMA 4QDOA 4PGAA 2VF4X 4BQEA 2M6SA 4N5HX 4W1QA 4F86A 1JDZA 2O8CB 3N70A 4R1SA 3FOBA 5CHEA 4O4LF 4PBTA 4CMEA 3X1WA 3T5PA 3QJ5A 3NPAA 4UNRA 2OPBA 3MINB 3U4IA 3QELB 3OKFA 1FSGA 2PUHA 4OLBA 2QRQA 4HEQA 2AEFA 3G6KA 4GIBA 5TQJA 3ZGZA 3T1HB 1EYZA 5F1OA 5AVWA 1C2TA 4UAGA 4QUKA 2VDRB 1WMSA 1CS0A 2VP9A 2VPPA 3IEPA 5C4GB 3RYHA 3AHIA 2O3RA 3WGQA 5CFPA 4BXOA 4KXXA 1M2EA 1PF7E 3NHYA 3VISA 2B92A 3CH6A 1W4AA 2PK3A 4RANA 3FBWA 3UB3A 4DV2B 2HO5A 4RACA 4UHBA 1B14A 1N7HA 3MINA 1G9TA 3QELA 2FSSA 4BCDA 5K6AA 1ND6A 2HKIA 2CLEB 4ZOEA 1SC4A 1XKXA 2QR2A 3E48A 3QVKA 4HFMA 4PLCA 3RTDA 1TKBA 4WLOA 2I29A 2GDJA 4EVIA 4RTPA 4CV2A 2IBSA 1I0LA 5GPBA 3KDAA 3BJIC 4P33A 3H86A 3LLVA 4EFLA 2GKOA 3MERA 2H5JA 3NTOA 3Q7IA 4LXHA 2RMKA 4Q21A 1L7XA 2AOXA 2IYOA 1NW4A 3KD2A 5C53B 2Z8YA 1L8XA 2XB2A 1RI2A 5LB4A 4NAHA 3RT9A 4DJEC 1E2PA 1Q5PA 1SU4A 2Y6UA 1R18A 1W5BA 2Z0MA 4NYJR 4IDGA 4DJAA 4QBIA 2NU7A 1G5RA 1PJBA 4C0AC 4EJ0A 1R88A 4MO9A 4RWZA 1E79A 5CA0F 1KP2A 1ES9A 2WMOB 2HDWA 3KYIB 2OHJA 3U62A 3ZV4A 3BF7A 3HCRA 2NZ2A 3EVAA 1B0UA 4P31A 2J6HA 4C76A 3JYLA 2TMKA 4NAUA 2Z4RA 4O08A 4QE3A 1IPEA 3KJHA 3OZBA 5F35A 2ZYHA 4B4UA 1NF8A 1N6IA 1BD3A 2BR3A 4OLHA 1WLSA 3HCOA 4C20A 3O0DA 1OZGA 1X7WA 4FC7A 1ZO8A 3A25A 3FPAA 1Y3FE 3RYIB 1NBWB 3ZHBA 1OV6A 3CR7A 1NE2A 3B70A 5F1YA 5FRDA 4B0PA 3EPLA 3HDHA 4OLAA 4LJSA 2J9FA 2FEKA 2I2CA 4BRUA 1K2WA 1ORWA 2E4XA 2OUIA 4UZFA 3SZUA 4ARAA 1GNVA 1TO2E 4J2TA 4UASA 2C2HA 1XP5A 4KNVA 7ABPA 1MQAA 1EX6A 3UPDA 3INRA 2WIKA 3DNMA 1LNZA 2R5NA 4Q0MA 4OJNA 1QVAA 2VIIA 4RFSB 3RABA 3K20A 5M2QA 4ZKDA 1WQ3A 3OBBA 4RK4A 3HV0A 4DT1A 1S2NA 3NGXA 2G17A 3QVUA 1NW7A 2HDHA 4K03A 2I22A 3JQDA 4HBGA 3TGPA 2H2WA 3GP5A 1W0KA 4IJQA 5KNDA 1M1NB 3WGGA 5LUBA 1LC3A 5E0OA 1JE1A 4D0NA 4DMGA 4BQRA 1JZSA 4OGLA 1ZBQA 5A5FA 1ZGGA 2SICE 1PFQA 1GL7A 3K53A 1XP8A 1NZJA 1H5NA 1E2MA 3PDJA 1UJBA 3H9QA 4DYDA 3O8OA 3VX3A 5B1EA 3RD5A 5SY6A 2PX3A 2ZYVX 3CMCO 5ERYA 5MGNA 3GLIE 1B8NA 1H85A 3MTIA 3DS8A 2CL7X 4JZYA 3VNAA 2I33A 1KS2A 4QT0A 4TV8A 1E1MA 2PSSA 1XVUA 3MWLA 4EABA 1N3BA 1NGSA 2WZDA 2Z2JA 3K0KA 1ECBA 1Z2PX 1EHIA 4G01B 4I9GA 4OI1A 1Q50A 4WCDA 4AN0A 3MD0A 4EUEA 2C4UA 4V1CB 1A96A 3IV6A 3VBCA 2Z2XA 3KZ1E 1J25A 2CXRA 2ID9A 3KR1A 1PJCA 4EKNB 3DAYA 3L04A 1ODCA 3AP3A 1QTNA 3DE0X 4QBKA 1DXQA 2Y0DA 1NI3A 4RVUA 3BZWA 3WZLA 4A1FA 5CDTA 4Z53A 2GS9A 1BH2A 2JH9A 4XASA 3S4YA 2CNKA 1X80B 4QICA 1KJIA 4QYSA 3DBHB 2IZZA 3DVAA 4RGQA 2G9UA 1T5IA 2XEXA 3R7BA 3HC7A 2P3SA 5CG2A 4NH0A 1P60A 3T52A 2IKQA 1Z82A 3EHEA 1AT1A 5DO9A 4J4HA 1Z35A 1G5PA 3MT7A 2XADA 4JT2A 3UAWA 3ZBQA 1WXIA 4BNMA 2PMBA 1RCUA 4D0SA 2Z8XA 3FNEA 4EECA 2EARA 5FWDA 1P33A 3O92A 1SXJE 4R8MA 2BGJA 4NL4H 3RRMA 2B35A 2NVOA 3W34A 1TFRA 3HNOA 2HPHA 3KD3A 4B46A 2YTZA 4M1QA 1EGMB 5LQKA 3OCWA 3A6JA 1R4MB 4QPJC 4TVKA 2GHIA 4AKHA 1BXRB 4L5CA 3R6TA 4Q7JB 5HIIA 3DZJA 4ZV7A 4EQZA 4YUYA 3OQ1A 5CT6A 1IPHA 3I34X 1XMQB 3UUFA 1EWVA 4OFBA 3CNHA 3G9UA 4OSPA 4QSMA 4M7RA 4P98A 4D9FA 1LTHR 1JU9A 3RUHA 2YRXA 3HUTA 2PMCA 4FI3C 3W4JA 2J9GA 3WA6A 3ZZ1A 5IJ9B 5IAAA 1KWKA 1OREA 4RX1A 3KR2A 2EBWA 3OM9A 1I7PA 3L7NA 5DK6A 4BQFA 5CG1A 3ANMA 3H4TA 3HGTA 4NNJA 1HG0A 4QGGA 1Z39A 3CUTA 3I30X 3WKCA 2I4NA 1V48A 2J85A 4FP9A 1V7PC 1GPLA 2CXHA 1N2CE 4JLAA 2JNWA 1E89A 4JYZA 3QWHA 4ETMA 1H6DA 4A0GA 1Z62A 1MX1A 3DAHA 3T3OA 4YCLA 3IB3A 1XWIA 4V2UA 1OE0A 1A27A 2X19A 4ZT5A 4NCXA 3ZD7A 2RH5A 4YMVA 1A97A 3VH2A 5CCEA 1L1QA 1C30A 2SCUB 2NO7A 2A9FA 2GA9A 3D2LA 4OXKA 4XUCA 2UVDA 1I14A 2VJAA 5F4ZA 1U3CA 4N8EA 3L7JA 5KYUA 5LP6B 3K9GA 1U0TA 3EVCA 2FHSA 3UG7A 2VQFB 3GF4A 4MUGA 1B8VA 3W7VA 1RMYA 1NHWA 4NIMA 4G0PA 2EW8A 5F7OA 2ZANA 3ZKWB 2ZXEA 2JGAA 3PNYA 4YJFB 2P27A 3MELA 4WLNA 1YZQA 1YWGO 5BSEA 1WMEA 5FTKA 3NX4A 4WKNA 2APJA 1ZRMA 1DSSG 3ZY5A 5KYWA 4KZPA 4I9HA 1ODSA 3H4MA 1T4CB 4QDJA 5DYNA 2Q3DA 1NXQA 4TMFA 2UUAB 4OCZA 1G6OA 3E9MA 3S7TA 1L8OA 5D2CA 4X41A 4F5EA 5TJ9A 2DTDA 4JVOA 4BNIA 1KDTA 4IKPA 1KF0A 2YHIA 2OHOA 1MPXA 2WHXA 1KDOA 2BGGA 3BXXA 4TVBA 5KUTA 2RCNA 3I42A 1C8KA 1QRAA 2RGGA 4E6PA 2OCIA 1CEQA 1B15A 1QOPB 2WHQA 2WHPB 4A8JB 2HK6A 5G4KB 4EG6A 4C7XA 2C9ZA 2PGOA 4C2UA 1O7JA 1B23P 1E7RA 4CEJA 3DBLB 4ND7A 4E5MA 3DT9A 1U1GA 3BXZA 3MLBA 4EGQA 4F04A 3TAUA 2CUNA 2ZJYA 5DM60 1W8DA 1PLKA 2I4RA 4UD2A 4OX9B 1GLVA 1I6MA 4KIJA 3PRJA 3FCSB 3SQOA 4RCZA 4YRAA 3HPQA 2BBTA 4UDXX 1CW2B 3GUVA 3ZWNA 4BO9A 2O2IA 1IM5A 3IBCA 1PEYA 1U5BA 4XX1A 2C7VA 4EMSA 4H1WA 5H9WA 3J81A 2WUVA 3LW8A 4ALKA 3ZU3A 4D81A 3N3AC 3G68A 3VOTA 2QRPA 5JFTA 2W2QA 3W5HA 3BIWA 4FB5A 3BTUA 4DCPA 3VSAA 4UBKA 3AWIA 1QQ6A 1YCGA 2BONA 2RGAA 3NDPA 4ZCQA 4YQZA 4YCCA 2IIBA 1MABB 1G5TA 2VAMA 1ZHFA 3C7CB 4WERA 2R6FA 1N6KA 4RAQA 4OYLA 2BMEA 3IR7A 3AT1A 1A9QA 1ZMBA 2ZJBA 2PBZA 1XRSB 1P6UA 2E37A 2DJ5A 3H5WA 4NZZA 2H07A 1PSDA 4C43A 3H13A 1D4ZA 2R7MA 1M34E 4P81A 2X0DA 1T1RA 1IQPA 5JSHA 2PEZA 4HQNA 2PANA 4I2VA 4QXOA 1Q0HA 1JFFA 1CZLA 2PXHA 3KFLA 4IF6A 4K9NA 4Y2XA 3K94A 4E13A 2YKGA 2H7XA 2J87A 4C6RA 3EIUA 4MVJP 3DE4X 4WLFA 1Z5VA 3KQLA 2H9AA 3DLAA 2LIVA 3DONA 1DTWB 4JLVA 4G9EA 2P4SA 2HYDA 1C0EA 1D7OA 3ED1A 2JKYA 3FYHA 5ALNA 3MWGA 2WSLA 5JDIC 4UOEA 1LJ8A 5L45A 5EMNA 1NRJB 3B1WA 5LZ7A 1JWBB 1D6NA 1KP3A 2J5RA 4DQUA 2Q0XA 2ODWA 2DH5A 3UM9A 3QEKA 3GG2A 3T7DA 1WABA 1Q2UA 2PM8A 1V2GA 2QZZA 3KKMA 4YUXA 1SZCA 4MUHA 2XB8A 3R1IA 4CQJA 3BGVA 2ZTSA 2JDIA 2ZRDA 3CZ9A 3V1KA 4L5YA 4UPEA 4KH0A 3ILYA 3O7MA 1FSFA 3SBEA 2DBVO 2X2EA 4MI3A 4MNTA 5I7SA 1E69A 1EFKA 1RKXA 1ENYA 1Z6XA 4DRXA 2XA9A 4X60A 2QRHA 1ZOPA 1XTPA 2DYKA 1WEHA 2FPXA 4YRKA 2ZDQA 1Z33A 2OHXA 4QOJA 5AVXA 4GS5A 4TMTA 3VTAA 4JITA 1KPHA 4B6SA 3RW9A 5J58A 4ZDJA 2DFNA 5K2MA 1IN8A 1M2NA 3Q12A 1QP7A 1A04A 4LYAA 2P9EA 3DUFB 2Q2NA 3TW6A 3AEQA 3TZLA 3OIDA 5MN5A 1VB3A 3OI7A 1SUSA 1D04A 2ECOA 3TZEA 3VHQA 1XJ5A 4HBZA 4MA5A 4RM2A 1E3TA 1QU2A 1ZLXA 3RTBA 4BUCA 5ICGA 2V9ZA 1SXGA 3GIDA 1G19A 5DYTA 4H1VA 2Y0CA 4JJGA 2HMVA 3EXEA 1Y1TA 5C5DA 4K6KA 4YMIA 4X1YB 4IICA 4XLZA 1N75A 2YJZA 1P62B 4GR9A 3IMFA 1A8PA 1D8AA 3WYCA 1G63A 4BGEA 1M1XB 2JLZA 4F12A 4O25A 4G25A 1ZJYA 4TUYB 4ZMBA 3U16A 3P9XA 5HKLA 3ML1A 3OVMA 4FXOA 1MF7A 3D0OA 3AOEC 1JTFA 1U3TA 2GXAA 1NHGA 2H4JA 3BXEA 3CA8A 4PRKA 2V1UA 4N76A 1BU5A 4YQEA 3ZHCA 1JTVA 1OQAA 3HEAA 4HGYA 4M55A 2VZ9A 3NM6B 3R3UA 1N5IA 4FE4A 2B9VA 3QEBZ 1Y4UA 2B36A 3Q9UA 1DTEA 3JQGB 2R4QA 2UUBB 4Q1FA 4X64B 3UJDA 3P0RA 4DA6A 2V7XA 4GPZA 3KETA 1M75A 3AETB 1DIBA 3GDGA 3FSRA 1L5FA 2D5CA 4MV9A 4V02A 4AJ9A 4BGIA 4J0HA 2QR3A 2DBYA 3F67A 1FMCA 1EVLA 4WHMA 5KYYA 3AF6A 1KR5A 3DDCA 4R9SA 3X1KA 5ELXA 3LFTA 1XX6A 3OIVA 1JAZA 4J16A 2GMWA 4IOKA 2FW9A 5CXUA 4LHWA 2PSJA 1H22A 4EA7A 3U81A 1KJ8A 3UCXA 3VR3A 3STHA 2CB9A 1TX4B 4G24A 2W83A 3DSRA 3GJ3A 4H1HA 4NR0A 3UOAB 9ATCA 1FS5A 1CUAA 3HFGA 3L7KA 1N6OA 5EE0A 5CYFA 5EINA 2PCJA 1JHDA 2HHHB 1T5LA 3NNNA 4ARCA 3ZCXA 3WQRA 3M3HA 1E59A 6REQA 1RW4A 2G36A 1Z18A 4I6EA 1P3JA 3A9SA 2OGUA 3NV9A 3RLIA 3SM3A 4EY6A 3MVEA 1TCBA 1U3FA 2VS1A 4PO3X 4UE2A 1T2CA 2COUA 4HB4A 4KOAA 4BECA 1WZ2A 5BN4A 2YFYA 3DMHA 2ZSJA 2G08A 1T15A 3STTA 5FWAA 1IEVA 4BZZA 4WASA 1EQ2A 4CFSA 3ONDA 3PQ7A 2O2XA 4MJ3A 5FOVA 3KZCA 3HS3A 2BL4A 2ILTA 2XVYA 3Q8XB 3EC2A 4YAWA 5CURA 4TZ0A 3OY2A 5AICA 2JIBA 5DP2A 1VLQA 2QUAA 5LBTA 3AJAA 3MT8A 1CF2O 1JHRA 1VHJA 5LWHA 3B1YA 1S8FA 2P79A 3UY4A 4DCMA 3FF4A 2WUDA 5HTKA 5TGTA 1OFUX 4BC1A 2AEJA 2VYND 1BIFA 2ZVPX 3B7WA 2PWBA 4B8WA 2KBEA 3BCRA 1K5HA 1Y6QA 2BUAA 1UKZA 2QLJA 2QXTA 5TMBA 3K0BA 4Q9AA 3NWEA 1EI9A 3FG9A 1MLDA 1YDWA 3R9IA 1M6HA 3KV3O 3PSHA 5DNWA 3FUVA 3UXYA 4Z8XA 1EFDN 3FYTA 3LOQA 5LL6P 2VKQA 2GXUA 4LBYA 5JZSA 2AVDA 3T4XA 3W5JA 2UUCB 3PJDA 1F06A 2I2XB 4XXHA 3ILXA 3ZWXA 1KTIA 3M6FA 4OM7A 1V5EA 3KZKA 1PZEA 1SUEA 4YECA 1K9SA 1VP9A 2ZIXA 2VYQA 4Z49A 1Z5UA 2OFOA 3VDXA 1X92A 4WI1A 3TOVA 4LJLA 3TSCA 1GJRA 1CWUA 1MB4A 3MCTA 5K0ZA 1AQLA 5I7FA 1M6NA 3MMXA 1RMTA 5IJXA 4HDKB 2VTBA 1ZONA 3RJMA 3TD6A 4N39A 5L9AA 1H9CA 3CW2A 5CW2A 1MDFA 1QFJA 4MWEA 1XZMA 1T3LA 2FP4A 4EHFA 4TYQA 4YV2A 5LOVB 5GV7A 3A04A 2CSXA 2O7VA 2Y05A 5A9TA 1JU4A 2XUHA 3P2OA 4X6LA 3MQ2A 2D8MA 3GJ7A 2AXPA 4FHFA 5DI3B 4ARUA 1S3IA 4F6LA 1P19A 2F67A 4WN9B 2DH6A 1XTIA 3TRKA 2Z9DA 1I7NA 3HRKA 3DEIA 4ZIRA 4DQDA 4M86A 2J08A 1NG1A 4B4KA 3U9SA 1P2GA 5LMUB 1GTMA 2I2BA 3WBBA 2AS0A 1G3UA 2D7JA 3OQMA 2FQWA 3W8FA 1BS2A 3LL4A 4FMBB 4WLUA 3F6YA 3LECA 1QONA 1N77A 1FNBA 4X1IA 3QEOA 4B2PA 1OLXB 1Z5NA 4HJXA 4DABA 1YS2X 2YV4A 5TMEA 3BA6A 1ITZA 5LIRA 2DERA 1DS6A 2JJ2A 2JVIA 3QG5A 3HK2A 5FO0A 1L4HA 1XAJA 4M22A 4JX8A 1LC0A 3C6BA 2FETA 1PFKA 1T1GA 1COWD 4UEOA 3F3YA 3OCVA 4BX3A 1AS3A 3G5AA 1QH1B 3F47A 3IEVA 3TUJC 1CUZA 1YR7A 2Y9MB 4DLTA 1QQ5A 4NJEB 2OBNA 1U99A 1J33A 4DCJA 4MVJD 4L0DA 1FFHA 1M1YB 4IGAA 1N6RA 1MRZA 3D6TB 2ZDHA 3L06A 4P08A 2L19A 1RR6A 4IDBA 2ZRGA 3IPRA 4RHEA 4MRMA 4QBGB 4F71A 2AFHA 4A15A 3KSZO 1NTOA 2ZRAA 2WP8J 1XZFA 4TQUS 4WZBB 1C41A 4BC0A 1VI6A 2DKOA 3D4OA 5FIUA 5EZYB 1ST2A 1BE0A 9LDBA 4QM6A 4OJTA 1DX4A 1F0NA 1P0CA 3MPOA 1WB5A 4RY2A 3KKPA 2B82A 4UUQA 3JWEA 5FOTA 5C1DA 2J3JA 2JJ1A 4MICA 1KYXA 1N2SA 3Q8MA 4BWGA 1G8KA 5DN6A 1AQYA 1PFYA 1X7DA 1XZNA 3OLWA 1S0UA 3OE7A 4HRXA 2DQSA 3VR4H 3EGOA 3F7OA 4HVLA 4A82A 3SQWA 1YOBA 1TUBA 4TL9A 4DV5B 5H83A 3DDWA 3WISA 1YC2A 1CRPA 1XNQB 3CNLA 4RVCA 2RGNC 3E03A 4FCTA 4W5QA 2FFBA 8ABPA 5JSZB 3RUEA 3EXFA 2PWYA 2WBLC 4TMVA 2AK2A 1YRQA 3W8NA 3ZEAA 3IP7A 4JGBA 3RSLA 4LF4B 3AK4A 4B2LA 1X7YB 2VK2A 4Q7LA 4R8LA 1RVDA 1IUNA 1KDPA 4U9HS 3VO2A 4JOQA 1Q1EA 5HCNA 2AEMA 3PUZA 2C7QA 1UDAA 3THWB 3IQZA 4LYHA 1SQSA 3GLGA 2FZVA 3KS9A 2PUBA 5BVGB 4UU1A 1YB6A 4CF6A 1U1CA 3OQIA 2IIQA 1VKHA 2XA2A 3N0WA 4JJZA 5KJ1A 2KE5A 1LPNA 1DJQA 1S2GA 3UMSA 3SY8A 2IZ0A 2O2DA 4ZV4A 1AKMA 5F7XA 2AQIA 3GFVA 2KB0A 1LY1A 4M0CA 5WRFA 1KU0A 2G5CA 2NQ8A 3OT1B 3RVNA 2OQVA 3MUNA 5DCLA 4F4FA 4ED9A 2MINA 4L75A 3GI1A 4B3FX 4F92B 1RKBA 5IVKA 3K05A 5F77A 2ODTX 3EDMA 1RP7A 1T0BA 3A1DA 5EJ6A 5JI2E 4J3FA 4XD2A 2IXDA 1P45A 4WY2A 4EITA 5IDQA 1F4LA 4PBRA 421PA 1DXHA 2OG1A 5I4BA 4GE0A 3DMGA 5ADHA 4ECEA 1I4EB 1RPTA 1KZGB 4MWCA 1SUDA 4X5OA 3GK3A 4BDSA 3KWMA 1DT3A 2Q9AA 3IVXA 3QW4B 2OPHA 3C6ZA 3S0JA 3GFGA 3TD2A 1RWWA 1GZVA 2DFKB 1GM5A 3LUBA 4FC6A 1JJAA 3RRXA 4X71A 4D9HA 3AHJA 4UHHA 3DP9A 3QXJA 3TLZA 4CM4A 2A1IA 3LY8A 6YASA 5GGXA 3OD5A 4TL8A 2ACKA 4IHAA 3SBOA 4N7MA 5IEJA 1EVEA 1DOHA 5CR9A 4BB0A 1C3VA 1PI3A 2ERXA 2BW0A 3JYQA 4UBMA 4X7BA 2O2SA 2FVXA 3H2YA 3KYJB 5C8YA 3EF1A 4ER0A 3QFRA 4O0LA 1NDQA 5AOVA 5J47A 5HRUA 5JBNA 2QVGA 4Q7KA 1WA5A 4OYRA 5EXDA 3WJ1A 1CJTC 2I6XA 3L4SO 2NZVG 4L6IA 3ABSB 4XQ0A 3RM3A 3IELA 3U4GA 2NYAA 3TSWA 3E9RA 1VP3A 2E4YA 3D0KA 3P0EA 3AYXB 3TEFA 2EW2A 2E5FA 2WA2A 3U19A 2NU8B 3IKTA 3SIPA 3B12A 3GUCA 4KVZA 1JPJA 1EWRA 2QROA 3K0SA 1VPLA 5BR7A 4KLNA 3CLKA 2GVZC 4G4GA 1GCGA 1NNLA 2CXSA 1DEHA 1JLSA 4X8MA 3W9UA 3ZI4A 2F3PA 4D4GA 1PCXA 1DMSA 4GOOD 3RS5A 1TZCA 1O89A 3CEAA 1W4ZA 1Q77A 3O3MB 4X65B 1NQVA 1LNSA 3DT6A 2MIIA 3HB0A 4B7UA 1CYEA 1DO8A 3EFHA 3P5BA 5LDHA 3R8XA 3DJYA 3OPXA 3A7EA 4D79A 3T3PB 4EI8A 3QKRB 2WM2A 4GOLD 2A0WA 3S2EA 4AM8A 5HQ3B 5I7HA 1E1CA 2O9JA 2ZJ0A 3OP1A 2OHVA 4M7PA 3E22B 3NBYC 2SNIE 4MWZA 2XJ9A 2YIVX 1KRHA 3GLFB 1BX1A 1NQUA 2IPXA 2GM5A 1R6VA 4R69A 5JMWA 2M2IA 3FN4A 4IMPA 4JUIA 1A5BB 5IAKA 2QYHA 4Y0NA 4C4ZA 1RABA 3C7DB 2A0XA 1KEUA 1DFHA 1UJ5A 4FIDA 3AFNA 4UE6A 4LHVA 4CEIB 1Z06A 3O1LA 1KH2A 1SHUX 1QJCA 2AW3A 2G5GX 2UVPB 4AMUA 2YXLA 1THZA 2VJYA 2Q1SA 4MRPA 3ICWA 4IX1A 1Y7HA 4XIIA 2XNJA 1DBIA 4LHEA 1YACA 4R1OA 3MNFA 1E6LA 5T57A 1A7JA 4YRJA 4DEVA 3ZOKA 4LAFA 5K6RA 4MKHA 4RH1A 1U7ZA 3JVVA 2R47A 5FHQA 3N7AA 3EC7A 4AI6A 5AKIA 2PZAA 1O4WA 2D3TA 4JQYA 3RFVA 3DUWA 5A05A 5J1TB 5BWCA 2BYTA 1R0WA 2VZ8A 4U3JA 1DQPA 4FX2A 3UWDA 1KKUA 3B52X 2HWYA 4QWWA 5JPIA 3G3EA 3RAGA 2WT4A 1LVHA 4IIYA 2X0IA 1YXMA 4J16C 4PONA 4B9EA 1JTEA 2FPRA 4UJ5A 4LF8B 5DSZA 4D9GA 1HQCA 3S2SA 3UJPA 3OEHD 4UUMA 2D4HA 2X6QA 4JBGA 4LEIA 3RK4A 4HI0E 2XI4A 3T7RA 2PT7A 4RH3A 3KE8A 3I6IA 3RK0A 3UFXA 4CN8A 1ANKA 3OT4A 5J5AA 1AO0A 4FFSA 4AN4A 1BJRE 4RV5A 1ZNXA 2QJWA 3UW3A 3PE3A 5ANRB 4Q5IA 2ORVA 3DVQX 3ETNA 1QIEA 4CCYB 3KQTA 4RPKA 2CE7A 2FRDA 1BS1A 1V8OA 2GGSA 3MUOA 3VC1A 4X1OA 3TTSA 4XDZA 4YC7A 1FJGB 1WVGA 2REBA 3INTA 2WF6A 2JIRA 3MS2A 2PMKA 3RFXA 1PFUA 2I62A 2RE8A 3N5KA 1T9ZA 2DPMA 4R1NA 4CUZA 1LGYA 3II6X 4K9MA 2A1UA 4Y2QA 1ISFA 3SR4A 4KQIA 5C8ZA 2PRZA 7ADHA 4EZIA 2G82A 4UM8B 2BFEA 2QN9A 3JAKA 2W6QA 3CS3A 5LZ9A 3BD7A 1SPBS 5CH8A 1GADO 1J90A 1HA3A 5E1DA 5HS6A 3T1QA 1ISHA 1NBIA 3F96A 3LA8A 1U1FA 3L8FA 4KZKA 4YALA 1L5LA 2EIXA 3KSRA 1TM7E 1GRVA 4R7TA 3DFUA 2QI9C 4MRVA 1DI0A 2YS6A 1VSUA 5EJ5A 4IMRA 4KLCA 3O91A 2Z98A 3B2QA 2FH5B 4E2WA 1IG3A 1CZNA 3ZWDA 5IUNC 2ONKA 4B48A 1LDNA 1XLUA 2WJAA 1U0GA 5H16A 1U3VA 3LUAA 4PTLA 5DLQC 1NVVR 1RI3A 1XPOA 3P20A 4MUYA 4E09A 3ZE9A 3EW7A 4G85A 4ZFNA 1DAFA 3THYA 1QBGA 3R0VA 3D8UA 3RVKA 4EA9A 4Y1FA 3K15A 3M34A 2D5AA 5CRIA 4BFZA 1WKVA 3LKVA 1JJ7A 5B4UA 2O0KA 1MJGA 4GC9A 4PGGA 2XR1A 4AY4A 3U37A 2XLCA 4EGCB 2V6BA 1MRNA 3ZGYA 1YKSA 4Y8VA 4C4XA 2NTJA 3D6AA 2EF0A 4FONA 2UVQA 4QJ4A 4XGNA 1A1SA 4YFYA 3TDNA 3W4KA 1N9ZA 3DFIA 4B7AA 1I3MA 1VZ2A 3SC2B 3DD1A 4LJKA 2V6GA 1O03A 1MO2A 1TO1E 2BSAA 2BAGA 2II6A 5EPOA 4CIYA 4DANA 4US2R 1WB4A 3ZBPA 1RM3A 4F9TA 4UQOA 2G6TA 2PJRA 2CCJA 2FAXA 1YVUA 3N2GA 4UHEA 4BVEA 3M9WA 2WFLA 2NZUG 3DV9A 3ZXIA 5HK9A 5TIIA 4OV6B 2CHEA 4NDZA 1LX6A 3E53A 1PK9A 3DO8A 4MWGA 1KR2A 2R8EA 3GROA 3WV5A 5F3WB 2WG1A 4DA0A 4WOCA 4LQ4A 3RKUA 1Y5IA 4NU0A 1Q57A 2RIPA 1EH5A 1GFIA 1KTVA 5FOQA 2P68A 4TN5A 5KOHA 1O6CA 1QWOA 4IJUA 4P7BA 5KQPA 4BFUA 3CJTA 1UEXC 4TKLA 5DYWA 5C8DA 1KMIY 2XDQB 2D6FA 1B00A 2JDID 2IUEA 1RYNA 2O7NA 4A0FA 1WIWA 5FJJA 2VYVA 3CR3C 4LWZA 5AHOA 5TV2A 3T3EA 4CMAA 5BOSB 1J07A 2L82A 2UKDA 4LIPD 3Q41A 1J2EA 4I5IA 3TLKA 4QRDA 2YJ6A 3G0DA 3FCYA 5DGDA 4CMBA 1TT7A 2RGRA 3PDIB 1B6TA 3I83A 4RD0A 4I9FA 3HJHA 3EUWA 3X1ZA 2C8LA 3I64A 4LXIA 4ZVUA 3RVJA 4D9EA 1TCUA 3C43A 3WLTA 4R71A 3AM3A 4RBNA 4CV3A 3KDPA 4TRRA 1WF6A 2BR4A 2I34A 1UBJS 4J9UE 1D1QA 5IH7A 2CCKA 2FK7A 2DFTA 5LP6C 4F3CA 4YJ2F 3DOHA 1P0MA 4U7PB 5BY2A 2ZM6B 3VR4A 3BK7A 2OXIA 2ZSAA 3COSA 3ME5A 4FDAA 4RVDA 3L4BC 4TV8F 4AY2A 4XWYA 4Z1MA 4GGPA 1EP2B 5H3CA 1FTQA 2AQHA 3X0DA 4CZ2A 5AW1A 3F6PA 4DFDA 2SCUA 3HPRA 4NBSA 3U39A 3MOIA 4FUQA 2W2NA 4D1YA 3VOBA 2PAAA 1R6TA 1PVDA 1YJCA 2Y76A 5TPWB 2PV0A 4JJFA 4MQEB 4FOOA 3PGJA 4KVFA 2EDAA 4YJ3A 3I05A 3K1ZA 1E5XA 3JW8A 4PO8A 4C0XA 4V0QA 5B58T 3U4QB 1BXKA 1G16A 3TR0A 3EH2A 3CVXA 2E0IA 3I9OA 5K3EA 4G1EB 5ISMA 4TS9A 2XZDA 1ZD1A 5G53C 4ON9A 1Q1ZA 1ENPA 3DKIA 4OMDA 1QQ7A 2DM6A 2TMDA 4MYUA 3PYXA 3RGGA 2UXBB 1HTTA 1PDOA 2CC2A 3NHWA 3ENNA 4UAJA 2F4NA 2FJPA 4ZJZA 3D43A 3FCXA 3FGOA 1WXDA 1RWOA 4TM7A 4YLYA 1Y8QA 4DA7A 2YYYA 3F46A 1YB5A 4MCHA 3WIBA 1TQHA 1X94A 1U8FO 1K4MA 5J4VA 5BW5A 3KB2A 4L76A 4Q1VA 5EIBC 4D4LA 5HIMA 4G5XA 1RWNA 3MFYA 3W8RA 2IZ5A 1UOOA 1F1BA 1ESMA 1P1FA 1CUBA 1QH0A 5DLDA 3UMGA 4P32A 3HUUA 1B73A 3PGMA 5IC5A 3VYRB 3P0FA 4ER7A 4ZOQI 1MG0A 1GNSA 4I5GA 2YHBA 1H2WA 5MFPA 4JUCA 4P93A 3ET4A 4FD2A 1PR9A 3PFGA 1ULTA 3RBZA 4OD0A 3ZX5A 3BWEA 4ZK6A 1PEDA 4F4HA 1UDBA 3PWTA 1WVIA 5LOVA 1JR6A 1TADA 3D3WA 4JBHA 5EMJA 5E1OA 1Z17A 2HRZA 3JALA 3KKEA 3N3BC 4OQNA 4D3DA 1FLNA 4WOKA 1QZUA 2VSFA 1HFKA 3AFMA 1N2CA 3L7OA 5ENDA 3VQTA 4PBSA 3ZK7A 2WUFA 4K40A 3VPBA 4DIDA 2P5UA 3E84A 2JANA 4ABYA 5KJFA 2P1RA 5L3RA 4R0MA 3RREA 2SHKA 1LSJA 2RG7A 2YC4C 4PCAA 1X9HA 1C0IA 4L28A 3ZIDA 2FPPB 5FLEX 2BF7A 4CL0A 3PX7A 2GEBA 3KLPX 4URYR 1GN9A 4C0WA 3QE9Y 2Y1FA 3GGPA 1UFVA 3W6UA 2YZ7A 4GQBA 1U7XA 4PHCA 5AIBA 1DL5A 1C3LA 1N5DA 3C3CA 4HMOA 5DTQA 2IS4A 2EP5A 3L1HA 5JH7A 1FS4A 3C98A 4TWBA 3QKTA 5BPHA 1JPUA 1QV6A 2NZYA 3KUCA 4UULA 5AJYA 4OA8A 1JV2B 1SVMA 2MSCB 2B25A 5JSQA 4ZT2A 2DECA 4N0MA 2JRCA 5TQ0B 5L7TA 2JEOA 4XUDA 4OTZA 1QRSA 1Q0RA 4Y2YA 2C99A 5HQTA 3K09A 2NACA 3FMIA 4GX0A 5FH9A 3O8QA 3PG5A 1UK6A 1YA4A 3KQVA 5A5DA 1ZI8A 1F2UA 4LDZA 5JECA 1N92A 3AZOA 1PWHA 2JIZD 1GNTA 4NYJQ 1G2PA 1ZM9A 2FPOA 4RJLA 1M2WA 1JIQA 2HMSA 3DTVA 1E3SA 4HYEA 5AVZA 1JKMA 4R1TA 2H0RA 1QE0A 3DFZA 5EZ6B 1CY4A 1ZZEA 4CMJA 1I3KA 5FOUA 3W04A 3G5UA 4MDFA 3ESQA 3EG9A 4DDVA 2OAQ1 1NKSA 1G9SA 3DXZA 1I6KA 4FJ0A 3REOA 3IVGA 3KK0A 1KI4A 3I9KA 1SKYB 4ZRDA 3ASVA 4YI3A 5E38A 3QKIA 1JXQA 1VBNA 2HC9A 3W1WA 3THRA 1KOGA 4ZD6A 3RYTC 3G23A 1NU8A 1C3OA 1ORDA 3JD1A 3PFNA 3DB2A 2CUTA 1RFGE 3TBFA 1JDVA 2H1VA 2G4CA 5AM1A 1PGNA 1U7WA 2AV6A 2NWQA 2EKBA 1J0DA 4NDAA 4B6QA 4ZCRA 5KOJA 1L7MA 1YF3A 4YO8A 4YIHA 4YXWD 1BWSA 1OWLA 2AUNA 2UYQA 1FFGA 2EXXA 4G0VA 3C5CA 1A4IA 5FUWA 3I32A 3MJHA 2BRUC 1BW9B 2ZBQA 3NG1A 3I0NA 4MVJA 5AJZA 5G1NA 3JQ9C 5CDYA 1C3OB 3H2JA 4IIVA 5DX0A 1VA4A 1WRBA 2B21A 5AUPB 4I55F 1V6AA 3UOWA 4RPJA 1EFRA 1W88B 3I9NA 4YR9A 1N34B 3MXOA 4Y3UA 1Z4KA 3S1AA 2ZVJA 4BDTA 2IE8A 1P8JA 1C81A 1O97C 2BGLA 1Q14A 1VJDA 3LF2A 1FTWA 4HATA 2M32A 4RQAA 5F9HA 2IXAA 3GVCA 4JLKA 1NWHA 4YAFA 1U7TA 3FCOA 3LC1O 3O1JC 3K8ZA 1FLAA 3OMXA 4OXXA 1THTA 1YMVA 4DY4A 4U7TB 2HQSA 4JBXA 1JLLB 1POXA 1TD9A 3PDUA 4G8JA 3RSCA 3HCFA 3EMDA 3W4IA 3CRNA 1BA2A 2VCYA 4XYGA 1XD8A 3IRUA 3MJDA 5K2OA 2EG9A 3WC4A 3AR4A 1T0PA 1TGYA 4MV4A 4LDQA 1LDBA 4RIHA 1UPFA 4ZPXA 5DTIA 3EEFA 2ZDGA 4FCWA 3GA5A 3DA8A 4C0JA 1YAHA 3HN2A 2PKXA 3GZ4A 3LRPA 4PS1A 3RC9A 3GZJA 4C29A 2FGJA 3QF7A 2A2ZA 3F78A 1RT9A 5TVGA 5JRDS 1J22A 1U81A 4W7SA 3ZNQA 3WMEA 2QIOA 2P1DA 1QK4A 3TL3A 1S02A 3JCZA 3NOVA 4RZ3A 3RADC 1JI0A 4BN5A 2ZS7A 1J5XA 4N65A 2C58A 2CMGA 2UYOA 1BROA 3F0TA 4KQFA 2X0NA 3T15A 1YDMA 5KS2A 4C87A 3RAEC 2EG5A 1JA9A 4IINA 2PGDA 2JAUA 3DVSX 5DGXA 3VX4A 1SUAA 2PBFA 2CZGA 1HXHA 2ZRHA 4M98A 3V8EA 3AG6A 2WV7A 3C15C 4KITB 2E9SA 3P94A 3IAM1 4MV0A 4ZXPA 4CW7A 5CB0A 2Y77A 2EJWA 2UYYA 3A9CA 2ICAA 3BF8A 4MUIA 2GZ1A 2OBLA 2AZDA 2AFIE 5IBPA 1Y9JA 4B83A 5F4BA 1MMFB 4DLYA 4HDMA 2BFBB 4XVRA 4YPVA 1FVOA 1DARA 2FR8A 3JQAB 2J32A 2P5TB 5CLHA 3CKLA 1W5AA 5G0SA 1WHSA 2QD3A 4XTCS 4PQGA 2OQIA 3OU2A 2WVJA 2BC9A 3RT7A 4KLZA 1VG8A 4M1YA 4XOUA 4OQZA 3NBFA 1CU1A 2DTXA 1XA3A 4QEDA 4NTZA 3K0FA 1TDJA 4KQ2A 4CV0A 1OGYA 1AS0A 4AU1A 4CR8A 2CL0X 3N8HA 5EXXA 4DV0B 5DLYA 1K3TA 1E3WA 4TROA 1ZVJA 4LZWA 4EPVA 1XRLA 1ADCA 1UC4B 4IAOA 2HF9A 2YZNA 2FQXA 4GX1A 3I23A 3TLGA 5AVOA 1DEAA 2NNWB 2YJGA 2CNBA 3K92A 2YUIA 2IYAA 3OJCA 3PE6A 1Z0JA 2IEAA 4I66A 3V1NA 3X1DA 5L4SA 4M37A 3UJNA 4ZQIA 4AUEA 2WQ7A 4D25A 4LZNA 1X8XA 1ZK2A 2HRCA 3LQ1A 2ZSUA 3TTXA 3IALA 1V1RA 4A4DA 2NVUB 4XWOA 2FMIA 5GJWC 3SMQA 3PFKA 1C0PA 1U9YA 5CVDA 2QT0A 3IEIA 4LS3A 4M83A 3G5LA 2A57A 4WNAB 4DNQA 2Y1DA 1E6UA 3LUGA 1OROA 1AF4A 4TX1A 1LB1B 3FSEA 3TLGB 3ZYZA 1A4RA 2J3HA 4R9VA 3JQ8A 1J09A 3MJEA 1LFDB 4GNKA 4R1PA 4BBAA 2DPLA 1B43A 1UWKA 2ODEA 2WM8A 2AWNA 3HFSA 2N42A 4HXFB 4ZO6A 3H42B 4A10A 4ZEXA 4FZVA 3DBRA 3TLCA 1QE5A 5KKNB 2OBXA 3RHFA 1II9A 3QBEA 1LBTA 4OB6A 2I0FA 1W4RA 2ZKLA 4PAMA 1JNYA 2ZJ4A 1Y4SA 4ZVOA 2ZJ2A 5K3AA 1ULSA 2J0VA 1HQDA 1X1CA 2RARA 3KKNA 3EGVA 3R5XA 4JJEA 3SEFA 5JANA 2C3OA 4R9UC 4WIAA 1T34A 4U6SA 1CDEA 3ZU4A 2O0JA 2OESA 1M1YA 4Y7DA 4YTEA 3NBZC 1V2HE 2LKCA 2XUIA 1E2JA 2HRDA 5KNDD 2Y99A 4Z9BA 3LYUA 4V2IA 1G1MA 1VMKA 3AQ4A 4BLVA 1ATIA 5H80A 1RXCA 2BFCB 1YRLA 3EIQA 4M9SA 1N3IA 4R6WA 2BGMA 1VSTA 4Q9HA 4YAEA 2AX4A 4WZBA 1VL1A 3CEPB 4XR4A 4PSUA 1X0XA 1TZKA 2CXQA 2IHUA 3L8HA 5AI6A 2OV8A 3VZSA 1GA6A 1XD2B 4UTXA 2RI1A 2J0SA 2JLAA 3QXXA 1VYUA 4JP3A 4FN4A 2PYIA 4BJ5A 4C4TA 3I73A 3IAUA 5DBEX 4S3MA 3RF7A 1XC7A 4IDEA 4CDGA 5AVUA 1M2OB 4BJ1A 3PQEA 4QX6A 3AERA 5T4FA 3WXMA 5L3SB 4RETA 4PX9A 2JKVA 1NBEA 3IDFA 4UUAA 2WLSA 3OZXA 4WGGA 5CFZA 621PA 1LPOA 3GA0A 2BHSA 2QUKA 3EPRA 3OMLA 1ISMA 3PCXA 3KOMA 3Q6NA 4LY0A 1R0KA 4OJQA 2CSUA 4UBOA 5EG5A 5HCIA 3ZH2A 4YYZA 4INOA 2FNAA 2WFAA 3OQVA 1BHO1 1L8LA 1YJ8A 3I04M 4PCUA 1GRRA 3HJCA 1YT5A 1GGNA 2A9RA 2V98A 4W7IA 3UK0A 3S99A 1PR5A 2FSVA 3NR2A 4MQFB 4C04A 4P1ZA 4KBFA 5E3JA 2A94A 3MT0A 5EQDA 5BW6B 1EINA 4EG0A 5A7HA 1Y63A 4CEIA 1VKNA 3MTBA 1DIRA 2JCSA 1PJAA 2VSQA 3VUFA 4JN6B 4AO6A 5A4JA 4ALLA 5BVGA 3NM5A 3PQFA 3A6LA 3FFTA 3SXPA 5JXHA 1YS6A 2H65A 1CR6A 4F8YA 1ISJA 2F1KA 1SCUB 2DY1A 4KUEA 3NYRA 4OHOA 1C4WA 2AZMA 4A92A 1FJHA 1O8BA 1T1EA 3ID6C 5A5EA 3GMDA 1M9NA 2DULA 4I4TF 1VIVA 4I55A 4NK4A 3Q5GA 5LQMA 4KQHA 1GTRA 3TEMA 1L4NA 1SCJA 2Y1CA 5HJ2A 1DO0A 1JR4A 1STOA 1UM8A 2CLCX 3B38A 4MVJF 4N40A 1J23A 4WESA 2YQ5A 5AJVB 3AVWA 4OYHA 3PENA 1JHPA 1EVIA 4Z2YA 5T5QA 3QU2A 2ANCA 4EL0A 3GPIA 1S9HA 2F43B 4P82A 5JPDA 2I1VB 4MQMA 5IAEA 3BCUA 2X5OA 3SYMA 5FAKA 4L8VA 4IDOA 2ACEA 3VYWA 3U44B 2G77B 5CB4F 1SC1A 4FGWA 1RLMA 1R0SA 3EIFA 3JV7A 3DZDA 4JBNA 1UUFA 4JL8A 2HQRA 2VJMA 1WHTA 2XYGA 4MITA 3SPXA 3MSXA 3TX6A 2Z6QA 4M46A 1S6YA 4XRRA 2E55A 3BWDD 5BR4A 4QODA 2GN0A 2LXNA 5HEKA 2WAOA 2XJ4A 3WP0A 2F4VB 4HWGA 1T4GA 3STVA 4L4SA 4O3FA 1Z7WA 4AY6A 2XRYA 3PICA 4NENB 2G76A 2TS1A 4MINA 5A7FA 5D86A 2Q0QA 4BP9A 3IP1A 5A9SB 1XXHB 5I9LA 3AVTA 3ILVA 2JHPA 1K88A 1WXHA 2QSYA 3A1FA 3D6JA 4AIRA 2Q3EA 2R25B 1RAGA 4EGJA 3DE5X 2EC5A 3V9PA 1R4AA 3I8XA 5JCZA 1K8XB 4KSCA 2XTAA 4KMOA 4IEIA 4KN8A 4YP9A 2OR3A 2IIVA 3UMJA 4BNGA 1QRUA 1QXSA 3AY7A 1P6XA 2ZT5A 3DMPA 1RM5A 4M49A 4RVNA 5HJ7A 3O1IC 2ZT6A 3NT2A 2FZCA 4UD6A 5IH3A 4NEHB 3JWJA 1W36B 1DKLA 1OAKA 2R60A 4ROTA 4I1VA 3HB4X 2B99A 3LT5A 1YL7A 2XOKA 1Z25A 1EHCA 4ZYZA 3OQBA 3PPXA 2G28A 4CKEA 4H7PA 1W5TA 1WB9A 1GCUA 1XQ1A 2BI7A 3E5MA 4LJ7A 4WFKA 5I9MA 4B7XA 4DSTA 4H27A 3DEHA 1H8ED 3QSGA 2DBQA 4X8LA 3R44A 5L53A 2O5RA 4UBJA 5J4HA 5BQOA 1Y9ZA 1PK8A 1IH8A 1TEHA 3DLPX 3UIEA 2F59A 1UFKA 2HJVA 4A6XA 3GNQA 5KSOA 4EPWA 4HOYA 3KUKA 1HE8B 4M9UA 2FPWA 4IEFB 1E94E 4LRSB 2YS7A 4Q82A 4RL6A 3T99A 5CDFE 1TIKA 5DHSA 1X1RA 3TIFA 2HCJB 1W34A 4AQDA 3I9LA 4ZAYA 1R9JA 2QD1A 4NV1A 2JAHA 3B9RA 3VPSA 1ONBA 1IXRC 2Q21A 1E2HA 3T1VA 5K51A 3ODPA 2Q5OA 4C4PA 3QF4B 5JAOA 5KINB 3JQ7B 4UBNA 2IDZA 3LPNA 5C7OO 1QZZA 4H7DA 2ZZKA 1I7LA 4Y1RB 2HJWA 3HYSA 1RKQA 4R4JA 3SE7A 3K0HA 1PT9A 2EJTA 2FZEA 2BHTA 3LXXA 5FX2A 1LS1A 2XECA 2FR0A 2CWDA 4KAXA 2B30A 1WQ1R 3A1UA 1HZJA 3EXHA 3GH1A 4I4CA 4JAVC 1XRQA 2XSZD 2FGKA 3DQPA 3QKSA 4PY2A 1OI4A 3AKZA 3ZX4A 2IRWA 4A2WA 3S40A 3EPPA 4URWR 4L4RA 2FX5A 3LSYA 1PQYA 1H3FA 4Q4AA 1A9XB 3EGDA 2IYXA 4YMSA 4ALIA 2NIPA 4Y1RA 5ILOA 1JMVA 3TQFA 4E7OA 3AEKA 3IC5A 2QPOA 3WDMA 3UKOA 3U7GA 1A9RA 3RS2A 1PS0A 4B3JA 5IM4F 2J7KA 4EZBA 1MIOB 1HFWA 1IN1A 2RAFA 1OI3A 1CJKC 1G291 2GZAA 5B64A 1CNEA 2OB1A 4TTRA 3K0AB 1L3CA 5HFJA 1M6EX 2V7PA 2BZSA 2P6NA 2XPCA 1EFHA 1WV1A 3HUDA 3UXHA 2ZETA 2PUTA 1SXJD 3OIUA 2R87A 1D0IA 1YB7A 4FS8A 3D7MA 3QLUC 4JL6A 4RD6A 4RTNA 4W5TA 4E3ZA 3HVRA 2O8BB 4RPGA 2GPYA 5FL7A 5LQDA 1L7EA 1DT5A 2BEKA 1WKBA 2RBEA 3KOXA 2CJWA 4RORA 3SDZA 1B8OA 2FX3A 3IAFA 4FIZA 1Q0QA 3WKAA 4DCNA 1RZRD 2R62A 3BILA 1OX5A 5AKHA 5JDCA 1M6YA 3TN7A 2R8PA 1H2BA 4BLSA 2J30A 2RD2A 2G72A 3UAGA 4FZRA 4BX2A 2XV1A 4GM4A 3CO0S 1IYZA 2ZREA 1LLQA 3FNFA 3LFUA 3D6VA 5EE5B 1SD1A 4IV5A 1XMSA 5JR3A 4JQOA 1ISRA 4H6VA 3RWMB 3KTDA 3L43A 4C4OA 3ODGA 3FF1A 3SX4A 3WLIA 3ZBUA 1H2EA 3M4JA 4L72A 1G3RA 4YCSA 1CB7A 3OFVA 4MB6A 5BQPA 2W42A 3A4VA 2W6ZA 3V7UA 4KQWA 2HTEA 3UJCA 1ZMTA 4ZC8A 3SYLA 2PA3A 3KQSA 1L5MA 2BZ1A 3GUHA 4MVJG 3IH5A 4BCBA 4FNGA 1JHAA 3BEDA 3PCRB 3P0JA 3DZIA 5ELMA 3V9AA 2BCGY 4KOEC 3HL4A 1P75A 5T3YA 3G2KA 5FCDA 1ABEA 5GONF 5K0EA 3ZWVA 2YYZA 3ORHA 4OHPA 5JYDA 1QHHA 4ZI7F 1SXIA 1TYAE 1GRNA 1L8QA 5EP2A 2W2MA 1OWPA 2QBYA 5BVHA 2Q5FA 2OUKA 3AH8A 4M53A 2WQ6A 3U4DA 1ETHA 1YKFA 1JBEA 4XI9A 3ZE6A 3VH4A 4Z0PA 4HO1X 1L5OA 2GRAA 3PR1A 2Q4EA 5ADUS 5DULA 3DMNA 1T8WA 4C06A 3SVLA 2A92A 5AXAA 1CEXA 2GPTA 5AK0A 5ALIA 1ZPDA 2IDKA 3FHOA 3REGA 3WHKA 3GFQA 1NBME 1AHIA 2MU1A 1PUXA 3LJKA 2CY0A 2WTEA 4HGRA 3WAJA 2VYNA 4BMZA 1VRWA 4CEJB 2HMWA 4QGBA 1F0KA 3B60A 1JHOA 5EXPA 4EW3A 5CDFA 3AEXA 4PW0A 4Q24A 4UU8A 4OIMA 1EFTA 3OQJA 4LJ8A 2YYSA 4YIKA 1MO3A 3AIKA 1GQ2A 3MYYA 4Z9FA 1LBEA 2XUJA 3KG2A 1J0EA 4B31A 4C30A 1E7WA 2WYWA 4MB2A 2O3SA 4LHYA 3W1VA 4F9FA 2XDQA 2A0UA 2G0TA 1IHUA 3IEXA 4D8XA 1MKYA 3EVGA 3KLNA 1WZEA 3MUFA 3G85A 4JFRA 4OH1A 3CRZA 5DGTA 5F51A 3PXGA 4BO2A 4HRYA 3TBHA 1XDBA 1Z6AA 2HAEA 2PH1A 1HKHA 2PQ0A 1LTQA 4JSRA 2G83A 3WSVA 4GKKB 4OMFG 5H5JA 3BYZA 3KJNA 5E8JA 1KJJA 1GZHB 5F5XA 2JLYA 5JVDF 1B76A 2DC1A 2CJPA 3SJBA 4LG1A 5ICEA 2EP8A 1D4AA 4ZJUA 1IEQA 5B4TA 1K08A 2AZ4A 2H51A 2Q5IA 2O48X 3U40A 1GXSB 3SBXA 4ENSA 1AGXA 4KV7A 2ACWA 2JIPA 4WW0A 1AURA 3I12A 2UZ1B 2ZSDA 2WAMA 1JHXA 1UH5A 4GKAA 1TQ2A 2OEPA 2YBDA 3UJ3X 1I01A 4S1NA 9MHTA 4KQ6A 1WVMA 1CK4A 1Z45A 3CJRA 3NRJA 2P9HA 1UC5B 3B85A 4WKPA 1V9CA 3B48A 3AR7A 2QD2A 3L0ZA 3LPMA 1HORA 1LX7A 2CLOB 2C3UA 1HNNA 3HXPA 3AFGA 3SN6A 3WWDA 1SKBA 5I5EA 4W1PA 1RSZA 2VDWB 4JYCA 3RVPA 5JAPA 3ER6A 2GHQA 3EZ9A 3KXKA 4MYRA 4TKUB 3GQVA 4K9DA 2X8WA 5A6VA 4RMIA 5CB4A 4HQRA 2PT5A 5CBPB 2I6QA 4M88A 2F62A 5FTWA 3W06A 2EKDA 5K3FB 3LC0A 2O3JA 2VRCA 1HE3A 2IHZA 3D8TA 3GT7A 1XVAA 1AQIA 3KSBC 3HDGA 8MHTA 3I4LA 4J4BA 3WLQA 4B3BA 5K05A 3CUWA 4KUHA 2ADFA 1WU8A 1J9ZA 4NZMA 4OP1A 4RJKA 3QTTA 2PX6A 1WBJB 1H23A 3JZMA 4LOLA 3UUWA 4CQMB 1I2AA 2ODBA 3BGSA 4MR7B 5DRYA 1DADA 1U4SA 3GT4A 3ZDQA 1IBLB 1Z5PA 1FRQA 2ZR0A 3VKHA 3GRAA 3VFDA 1NV9A 2R5FA 3GGOA 1I1QB 3A3YA 4P5PA 5KTRA 2JCVA 2CXNA 3NKVA 4ML3A 1K8ZB 3ZGVA 3D1LA 5L3ZA 5LB2A 1EM6A 4KTTE 4LRTB 1SOVA 5KKAA 3NHUA 5IULC 2PO7A 2GYWA 2V03A 1QG2A 2LUOA 3R0XA 1HTWA 2Y1GA 2J0EA 4PNHA 4QUHA 4R5MA 4CI9A 3QX3A 1W44A 2FZKA 4G09A 2H8KA 4WZAE 3S2YA 4EA6A 3TIGA 4DR2B 3RASA 1XDSA 1Z88A 2XQFA 1MORA 5YASA 4CM8A 4ENTA 3CZCA 1Z8FA 1XT6A 2GPAA 4ACBA 1JP7A 2X9VA 1YR9A 3IQIX 4CLRB 4E07A 1QHFA 3GA7A 1HPLA 1SY7A 1MJNA 3K5PA 1JL3A 3ENWA 1VL8A 3K30A 1C7QA 1Z16A 1Z8NA 5FNZA 1VL0A 3GDHA 2HMYB 3NTXA 3P9NA 4CM9A 3FRHA 4X3CA 2R84A 4WBNF 4DV1B 3F2IA 1CUWA 4O4LA 1U8TA 3ERCA 1VHDA 1Z5ZA 1GUBA 4QAQA 4X7MA 3CT6A 5DBGA 2QAIA 3WMWA 3HXTA 2IX9A 2XUGA 4K8RB 3R09A 1IWBB 3VHRA 1Y3AA 1XDGA 1UKVY 2PO5A 4L3WA 1ZDMA 3TSAA 3PYLA 4QLOA 5BNWA 3GFRA 5BWMA 3R23A 2R44A 1DAPA 3F5SA 2D7CA 2PH5A 3ZHVA 3KAKA 1T35A 3A6HA 3NYIA 1GPBA 2HNAA 4TKVA 3WYGA 3EXAA 2YFHA 4IGEA 4GKBA 5KNDH 2ZXFA 2VNSA 3WMXA 5JY6A 4HWOA 4RMGA 2VRBA 3PQ5A 3GY0A 3DW1X 1MC1A 2C59A 3BSYA 3Q88A 4RVFA 1UP7A 2YOGA 4EY7A 2CVQA 3JARA 4RLSA 4Q4JA 4HB2A 1E6EA 1NMQA 3OUZA 1OZAA 3NHJA 4PFSA 4LNUB 1CT9A 4OREX 3ENVA 2PZ8A 3L8CA 1I24A 3DKKA 3C7AA 5HR5A 3PC3A 4LJ4A 3HKDA 2GN9A 3GH3A 1ZN2A 3IAS6 5EMMA 2ECKA 1T2UA 5AVVA 3LOUA 4X0EA 5ALZA 4IGKA 4R54A 2VNKA 4JL5A 5LUAA 2XYQA 4RLFA 3D1JA 3G7SA 2X8JB 2FZ4A 3I28A 2VTKA 3Q1KA 1UMBA 1GPDG 4I3HA 4YT5A 5K5EA 3GCXA 1BD4A 2PTGA 3QYPA 4F1KA 2DHDA 1T36A 2ZI6A 3QRWA 4IOJA 1R0CA 1W94A 4Q1CA 4YRGA 1SHLA 3IP6A 4KWTA 2QTFA 1OLOA 2H9IA 1N25A 1F7VA 1YNOA 2WM3A 2AXEA 4PHHA 1HNXB 2IBMA 5K99A 2J3LA 3HFRA 3I4FA 4QG3A 3L18A 4KLRA 1ODFA 5KVAA 3HWSA 2KPOA 4HX9A 1RD4A 3UTCA 5ALVA 1FDSA 1TMGE 5GM2A 3CW8X 1MTZA 1OZHA 5HOEA 1MBZA 2JHFA 4S12A 2WHRA 3RVRA 1RHMA 1ZISA 3O4HA 4Q7EA 4UXHA 4B3XA 4LC0A 2BTQA 5HW0A 3MIZA 4J76A 1G2IA 2H1IA 5KNBA 2GJ8A 1DUVG 4O63O 1ZIXA 5KB3A 4ASUA 3F9RA 2YVUA 5FDFA 4CTNA 1AXEA 5DW3A 2BMJA 1SVOA 4QARA 1A4UA 3UHAA 2H4HA 2PX8A 3CVJA 1MZPA 1CQPA 3DLCA 1Z6GA 3OPYA 2GBFA 4HDRA 3U1TA 4BLTA 3IUNA 1E6CA 2HCRA 1UFOA 2AG8A 4X6YA 2H2IA 2J7PA 3PJEA 5FLXA 4MV7A 3WYDA 4HAWA 4EUHA 4Z3KA 4N03A 4C78A 3F4LA 5KJCA 4BLRA 2BEWA 2HRRA 5K03A 2OB2A 1D9XA 1R00A 4G2NA 4XGIA 4FS3A 3X1JA 4CCAA 1J70A 4ARSA 1FUIA 3DBRB 4DLZA 5KBYA 4QOGA 4B17A 3REQB 9ABPA 5CK4A 2EGHA 2IU4A 3AINA 4MDYA 5I6DA 1NQWA 3PI6A 1P74A 1U3DA 1JQEA 2FWNA 3URKA 3EFBA 1DHRA 1TU3A 2IEYA 3EIEA 3C4VA 5LZ4A 4H4DA 4PO1A 1UM9A 2LD4A 1V4NA 1CB0A 1TM1E 2OAP1 4BNJA 1YDEA 4LWOA 4D9KA 1EWYA 2XQKA 4ILKA 2NXEA 3BX1A 5B3JA 4A5SA 4AMGA 3GEGA 3EZ2A 5TX7A 3HVKA 5I01A 4Q3CA 3L8ZA 1KFEB 1PKEA 1XD2A 2WKWA 1XZGA 5KQRA 3CURA 1A82A 4X8HA 3I72A 1U5AA 2DKNA 4KV9A 4Q9IA 3W9SA 5A4KA 1JF8A 2O54A 2IY7A 4N5MA 2PMDA 3DAOA 3JVEA 3M0EA 1OT3A 3MGCA 4OBBA 5G1PA 4KPFC 3H5LA 1QGUB 2VJPA 3PNKA 4GYKA 3DE7X 5HILA 3ZNPA 4CIAA 5AK4A 2BFNA 3O4FA 3PUKA 4N5NA 5ALHA 2FG7C 2PT6A 3UF0A 1O95C 1JIIA 5KMGB 1SR8A 3B1XA 2XWBF 3NW9A 2FCRA 4MVJE 4CIBA 1NVAA 3VO9A 1AHNA 2FOLA 4TQGA 3TSYA 1H2XA 1VLJA 5EWLA 5EVJA 2P91A 3N0XA 3TKYA 3N58A 4Q37A 3H75A 4ANFA 5CYGA 5ARBA 1QHGA 1WZIA 5DNYB 4YQYA 2W00A 3L0IB 1YZGA 2C3YA 4XEHA 5AJTA 3UK2A 2UXCB 1AZSC 4CKBB 4AP6A 1ZJ5A 2CYAA 3AESA 2V5UA 1E8MA 1FQKA 3U1BA 1LSUA 2WIFA 3QVWA 1MENA 6NULA 4CEHB 4XSHA 4TYMA 5IKMA 5BWNA 1W5EA 1P0FA 1RQPA 1BEEA 1GO2A 3E7FA 3HR8A 1MUUA 3ZZUA 3AJEA 3G02A 3GLVA 3PPYA 3ZQ6A 5BYAA 1OD6A 1Y9AA 1R8JA 1A77A 4JVLA 1OKKA 2PD6A 4HLUA 4Y18A 4F72A 5JATA 1RZUA 1TE2A 3FPFA 4KNWA 4O4HB 3HYTA 5CVJA 4WESB 3V1YA 3WMFA 3KXLA 4A2CA 4P83A 3FPBA 1IHXA 2GPBA 4N54A 5EKSA 4J0QA 3WK7A 3ZWWA 4B3CA 4JOCA 1M74A 1EGQA 4G1FA 5G41A 5EUCA 5BV1A 4YBZA 2D54A 3HA7A 4Z4HA 3AF2A 2I6TA 3MRXA 3WGNA 4E1AA 4D0LB 3GGGA 4HNUA 4WNAA 1HDIA 4L8WB 4P5DA 4DPKA 3B3JA 3ELYA 2CJYA 3FFXA 5DNCA 5HNKA 1AKVA 1HMYA 2C9OA 3IKMB 4ARZA 2BFDA 3LU1A 3WLEA 3H9EO 3F90A 2QPAA 2HADA 5T6BA 3D4BA 2CV0A 4BMOB 3NBQA 3ZXUB 4TLDA 3ABQB 1LLCA 2XOXA 1RQ7A 3P26A 3K2QA 4LXYA 4P7KA 1VBFA 2OXFA 2R6HA 4HZUA 3AB3A 2ZRKA 2GDZA 2CLLB 4PLHA 1Q0ZA 2XVAA 2REXB 3TZBA 1IG0A 1M6WA 1NKTA 3COVA 2I4LA 2HPAA 3AO0B 3CB2A 4J1TC 1NNSA 1V7QA 2DR0A 1BOFA 2G3YA 3DOJA 5AWFC 3HZZA 2R7NA 3VKVA 1GSOA 4NFSA 4V1CA 5K3CA 5IHXA 2Q2OA 3CWQA 1OAOA 1C1DB 3EVZA 4PC7A 4Q3EA 1VPVA 4IUCS 3H3JA 2HPVA 2OBMA 1XV5A 2OCXA 2QX7A 1M2VA 2ODNA 1EXVA 4XWAA 1QU3A 5AJWA 1V0JA 4LHZA 4W6QA 3SIRA 1PW7A 1RYMA 1EUYA 3PGA1 1ZD5A 4BAUA 4U6NA 2FPUA 4BU1A 1LK0A 2ZE8A 4E08A 2DWPA 1EP9A 2C7BA 5HZKA 1TM2A 1JQ3A 4QHSA 4IDQA 1JVBA 3ZGNA 4RADA 1FYVA 4CDRA 2G4VA 4EMBA 3S1SA 1VJ5A 3QUSA 1JBKA 4G5HA 1C9NA 2P9TA 2IW1A 3OZUA 5DX1A 3IULA 3F73A 2H1FA 4FE7A 4E94A 2NZWA 2YICA 2ZAYA 2AZXA 4EGSA 2OHFA 1J5PA 3M49A 1V95A 3BJMA 1IULA 3ZK8A 1QO7A 3JWGA 4KSBA 1YVEI 4RS4A 1UMDA 1J0XO 1RCFA 2HA3A 1G3IA 2DVMA 2Y66A 1EM8B 1SOAA 4ZV9A 2ECQA 3GEDA 3IKJA 4DQXA 3UK7A 5LQAA 4HHEA 2HL6A 3H5OA 1IOWA 2AX3A 3AVXA 1QAMA 2H59A 1XHFA 3QV2A 1GPNA 1G6HA 4MGIR 5JFOA 2BM9A 4IIJA 3FSGD 1KNQA 3NP7A 2P6UA 4DLPA 2D00A 2QD5A 2DE0X 3OKCA 1VZ3A 2W2PA 5AW5A 2QAJA 3FYUA 1VI5A 1EESA 3RRNA 1C3JA 1E9BA 2P9QA 2Z6VA 3G2JA 3VM6A 1A69A 1WXQA 4DMKA 4Q3OA 4HDSA 4BB9A 1TEVA 3LW7A 1K8RA 1HZZC 1U0NA 4B5LA 5K7SA 3G7UA 1APBA 4HLQB 4OGGA 1R8QA 4RTRA 3SU8A 1RXIA 1K3UB 2XNSA 4FILA 4ES6A 1IFXA 2CBXA 5EIFA 3HJGA 3ZTTA 2XX3A 1Z15A 4UXJA 1W52X 4MCJA 3GRZA 3ZY2A 1P2BA 3K2IA 4V1CI 1I2DA 2VTEA 2O2HA 5HCUA 1QPBA 1ZI9A 4H77A 5KX5B 1C30B 4C6SA 5AIAA 4YEDA 1INLA 5TS3A 3ZLJA 3SXUA 3MM4A 1I6WA 3A1VA 4BKUA 4TRNA 3V8NA 1QK5A 1IEXA 2ARKA 1J4AA 1X1QA 1YR2A 1SKUA 3VSCA 1DC6A 1BDMA 2YJ4A 3OZEA 3DMFA 3QVVA 1K0UA 1PGJA 5AXDA 5E1BA 5E6SA 4TMWA 4QIHA 1L5HB 2I2DA 2C2BA 3E8SA 1JR2A 3OC6A 3TKLA 1YR8A 2XYVA 2XYHA 2XKBA 1KMHA 2Y8EA 1BG6A 2V6MA 1NLFA 1Q44A 2GZDA 2QTWB 1I33A 3LRXA 5D7NA 4AY5A 1PX2A 1Q15A 1Z4QA 3DL0A 1C3EA 3PGXA 4KE6A 1IHDA 3G8BA 3C3XA 5BSGA 3OTGA 1M10A 1KORA 1R0BA 4WEOA 1E7QA 3E3OA 1LTKA 1NY6A 1W46A 1LLFA 4MW9A 4BMVA 4HEA6 4ZI2A 4BFLA 1X2EA 4YJDA 4E2YA 4WOJA 1PT5A 2TMYA 4PGHA 4YA6A 4NH4A 5EIHA 5GINE 1SG6A 1PJLA 1XQ6A 2UZAA 2NYRA 3HBFA 4UPDA 4NG4A 1CY7A 1OAOC 4CUJA 4NJMB 2G1JA 3TZHA 4KPGA 4OH7A 1IHOA 2PKQO 4PFKA 4BEWA 4X54A 4XIGS 1IU9A 4YY3B 1UXIA 1NJGA 4RENA 3SSAA 3Q2OA 4K3UA 4N9QA 4YRFA 3R40A 4ZYXA 3IVAA 1F8GA 3GZNB 4XPIA 4ZDWA 1NY5A 3NAZA 5B1HA 3SLRA 4ZDIA 3ISJA 1WZNA 1U63A 2KS6A 2BE9A 3HLKA 4RZXA 4TLMB 1XVLA 3UG6A 1QYIA 1RZVA 2WJZB 1H93A 1LQTA 2XMDA 2HUPA 3O3CA 3OQIB 2GCNA 1AG9A 3SDSA 3BE4A 2X9NA 3FHJA 3BFJA 4CIDA 5JNUA 3ZCQA 1SVIA 4NLLA 3FIJA 1QLJA 2JI4A 3KSDO 5DWDA 3ZZTA 1UDWA 4I7EA 5DB4A 5JAZA 1RKVA 3D2CA 5T41A 2YRFA 3OIFA 4O2AF 5CYPA 4IIHA 3GJ5A 2CB0A 1XUOA 1T4DA 3L6CA 2RFLA 1T0IA 5C8XA 5IJ0A 1H6CA 2QJOA 1UMKA 3S6JA 4A0SA 2CN1A 4U2DA 5KJEA 4LJAA 1Z8HA 1BHQ1 1G5QA 4LRUA 4IXTA 3RLFA 4F96A 2XXAB 3WGHA 2AFIA 2VHWA 1ZH0A 1IQRA 3PXDA 2A0FA 1JS1X 3IBGA 4ICIA 1JLRA 5JU6A 2EERA 3B82A 3WGKA 1W25A 3A1WA 2W43A 3MFQA 2H6EA 1M0EA 4DR4B 2YWJA 5H68A 5EIWA 3H05A 3SKYA 3OQNA 5IRCD 5B7QA 5SZIA 3R4VA 1JJVA 4B75A 1U7HA 2ZRLA 2E48A 1WUYA 2VUTA 4K9SA 4DZTA 4NZNA 1UADA 3HEMA 1CJCA 1F0YA 4US1R 1SD2A 1WCWA 3OFKA 4GKVA 1JSLA 1XCPA 5AI0A 3SJAA 2A9PA 3OLQA 2WUEA 2CMHA 4UMVA 3TJZA 3KBOA 2QQ5A 3JWIA 3H7AA 2DHEA 2F3QA 5AVKA 1WPQA 4X94A 3UATA 3FLAA 2H92A 3FFAA 1NX6A 1MNAA 2JGKA 1SU8A 2ZJ3A 3FOEC 1FRVA 3PNSA 4JGGA 4D4JA 1EDEA 4PZYA 3W7BA 4PAQA 4Y98A 4HPWA 4OHWA 3JX9A 2P78A 4R2JA 1DDGA 2OV4A 3EXHC 5H0IA 1X42A 1C1XA 2FN3A 1GCAA 1MO6A 3RYFA 1BFKA 3WGIA 3OOJA 3CH7A 1TMKA 4NQRA 1QCDA 1FNSA 3QYFA 3W2GA 1P39A 4MCAA 4DC0A 1T6YA 2VBGA 3LI2A 3VR0A 1UXGA 4TL6A 3BXFA 3R0IA 3A11A 2X40A 1M6VB 3WHLA 1YRHA 2E4AA 3A0RB 3SC6A 1I9GA 4PSAA 2H4XA 4DCUA 2VQDA 1DG3A 2HOQA 2CXPA 3ZTYA 2EGUA 2F3RA 4H3VA 4PZEA 1P2UA 3I0ZA 1B1CA 1H1DA 1HQKA 3W5UA 3K9BA 1UPAA 2EP7A 2W2KA 3UK1A 5KIAA 1U28A 3O4RA 4GPEA 2KMLA 4N49A 5JD4A 2G1AA 2RHRA 4DV7B 1PVVA 4NCBA 4ND8B 4QD3A 2R1VB 1OLSA 3CFYA 2IYRA 2QI9F 3HJRA 4P2BA 4FFBA 5JT1A 1M6VA 3JQFA 1BFDA 1UK8A 2YHUA 4TWRA 2CNLA 2OCPA 2R5WA 4DCVA 3ZQUA 1U8XX 4GYYA 2AKEA 3A4IA 1W35A 3D4NA 4N47A 1OV4A 1WY5A 4Y2UA 2ZB7A 5AR1A 1F2DA 4QKQA 5ED4A 4QFCA 3AZPA 5J2TA 3DMTC 4EJFA 3KOYA 2IXFA 5JASA 1PBTA 3LUCA 2IYSA 1W75A 2R7KA 1J42A 4O2LA 4PZAA 1L7QA 4G5OA 4M0UA 5ALOA 3QQ5A 4FB4A 3WMGA 3D64A 3T95A 1ESCA 1NN5A 2WEKA 2XVXA 1JT2A 3D2BA 1WUJS 3K4QA 3LT0A 3IA7A 4TTQA 4IKEA 2YHSA 4NFHA 3KYCB 3I6MA 5FA6A 4Z0TA 4TTSA 1R4NB 4F6RA 4RHXA 1ONOA 1AUQA 1L8AA 2OCKA 1Y8RB 3INGA 2YVKA 3UJ6A 1W5FA 3BHJA 5HUJA 5CX1A 4EG7A 1KI9A 5AM3A 5H3LA 4UCXA 3EOBI 4JXKA 3WO0A 3CSUA 5LXTB 1SPXA 2IPNA 3FVQA 1L7OA 4MB0A 4WXYB 1J1IA 2B98A 2CL5A 1B0AA 3KLBA 4IM7A 1PJ3A 5EWMA 4JNCA 1T9GR 4J0FA 2B83A 1VLVA 2J6IA 5E3HA 5AUOB 4TQAA 4YRLA 3BTVA 3ZLTA 3NBKA 5EEGA 1KPGA 1KERA 3DJFA 4J1SA 2MWMA 2ORED 3GBSA 4K46A 4IX9A 1AM4D 3Q3IA 3AJ8A 5COAA 3UKJA 3WQBA 4Q39A 3R7DA 2CZQA 1VA5A 2FB9A 2IYNA 3AHCA 4WVLA 2EKQA 3C87A 1Q74A 3EBPA 3ORYA 4ZVSA 3AV0B 4JB3A 1QGYA 1Z6TA 4BZPA 1QQBA 1P61B 1RVV1 2V7TA 5DW0A 2GJ9A 1AS2A 2ZJOA 4MUAA 5AW4A 4ZREA 3B1ZA 3LYLA 3HG7A 1GZ5A 3EA4A 5INTA 2ZE6A 4NPCA 4N7BA 3K0EA 3V00A 5LU9A 1R7RA 3V34A 2FN8A 2XD4A 3CRVA 4DNXA 4GG1A 4MVJI 4BPRA 3E3NA 5I3CA 5DNEA 4R05A 3Q0EA 4V0MA 2DSTA 4EENA 2Y1XA 3PU6A 4WPGA 5MFZA 4HTFA 1ENZA 1MB2A 2XA1A 2QUBA 1NNEA 1L7RA 1TM4E 4DARA 5LP6F 3B6ZA 4NBWA 3F9CA 3S2UA 4ASUD 5I8PA 1F2TB 5KOYA 5CVCA 4DLNA 1JPVA 4S05A 1KZ1A 1ZITA 1U0RA 2R6AA 3A9VA 3BH0A 3D8BA 5FBZA 3IBSA 4WEQA 4JR0A 4RIIA 4HDQB 3ZWKA 5C37A 5ALQA 4F60A 5LQRA 4LMBA 3VGJA 4U2KA 3ZV5A 5LWQA 1E6MA 1GUFA 1GPAA 3OM8A 3LCVB 2QE7A 2P2NA 4ZHQA 2IOFK 4EZEA 3TJMA 5CB4B 4YO7A 5KAMA 4MWDA 4RJJA 4RL4A 1ZUNB 4GQIA 5FLYA 5HIKA 3IDSA 4ER5A 7REQA 4BVHA 4AP5A 4YXFA 1GD1O 2O5VA 3JS5A 5SYNA 3WLMA 2NXWA 3BRWA 3CZPA 3U3JA 4DEXA 2WZBA 1I2ZA 3DF9A 2V6FA 3ORFA 4PLGA 5LQNA 2GASA 2YX1A 1Q22A 2FMKA 2YINC 4YCMA 4R16A 3IB6A 2X3UA 5BPFA 4EW2A 1FOEB 3BKXA 1PL6A 3KZXA 3OCJA 1DXOA 3EE6A 2Q5JA 3E58A 5KVSA 1AC5A 2RHDA 1WW3A 4DCTA 2W2LA 1L1RA 2VNHA 3GDOA 3IHLA 4NNPA 3WE7A 1BHSA 2HZ7A 2XXJA 3IJ5A 3T94A 4UTRA 3CVVA 2SKDA 1O94A 3B9QA 2I7VA 4BEJA 2IOFA 5B1YA 1OH8A 2ZUFA 4PSDA 3EISA 3UMFA 3WLFA 1ZXXA 4IOMA 1XEXB 4YYEA 2QZSA 2AJ8A 3COZA 1N2BA 3EY9A 1NV8A 4FYXA 3Q9SA 4L74A 3VMFA 1SB9A 1ZM3A 2F17A 4GPBA 4H08A 2PX2A 4HDNA 1C9KA 3HGMA 1RS0A 2GVDC 5ICFA 1M5TA 1N2OA 3EZGA 5JHGB 3IEMA 2GJKA 1ZK4A 1OWNA 2WWGA 1VE6A 3KJIA 4WBSA 3R9WA 1DWQA 2A5FA 3F6EX 3LCUA 2WVAA 4MMYB 1KSGA 4KWEA 2VQ3A 1ZM4A 5ES3A 1RJWA 4YCNA 5TY0A 1D03A 2PZFA 4PLFA 3ZUPA 2VPWA 2EKLA 2PJUA 1TFUA 5BOSA 5IT5A 3BWXA 2NUTB 5UKDA 1OBCA 2QAGC 3AI2A 4JIMA 4QLAA 4QU0A 1H1TA 4IDNA 1QQAA 1NZFA 4EJSB 4NVRA 1P2TA 1R5NA 1Q16A 3R9KA 1KMNA 3KXIA 3EC1A 3LWDA 4MYHA 5JZ9A 2AKAB 5L95A 1PEAA 3GEPA 5BN5B 3PUIA 3RSHA 1JQ5A 2IE0A 2M9MA 3K5HA 1WE2A 3AUTA 1GG2A 1WMDA 2QTTA 4ZYLA 1SXHA 2JFZA 5F52A 1T5OA 2NO1A 3AVOA 4CM9D 3X1MA 2B78A 2H5LA 3N2LA 3EEBA 4FDMA 1MW8X 2MSDB 4UU0A 4ALMA 5E1MA 3NONA 1DKUA 3GRPA 4N6GA 3HMQA 2GF0A 1RHUA 3KJFA 1KI2A 4S2EA 4DWOA 3SS8A 2YZ2A 3TNDA 3NEAA 5GMOA 1M0SA 2FMFA 1BQ3A 1OFTA 1Y80A 2FA9A 1FVHA 2G67A 4BNWA 4KC0A 2BV3A 2H1RA 3QXHA 1UQTA 1HF3A 1SCAA 2C31A 2HX1A 5G3YA 4C01A 2GT1A 1AUPA 2IGBA 2ZUUA 4LDAA 3DL4A 1R6BX 5HKOA 1VCNA 4NMHA 4PN7A 2FYTA 2EEPA 3CUEF 3QENA 2F1RA 4PRYA 1T8UA 2B1GA 1A2BA 1NN3A 1JYFA 2AMLA 2C1XA 3B78A 3SIWA 2CDAA 3RWOA 4ZOLA 2PS3A 1HE5A 1NJ1A 2QQ0A 1C4KA 2YWEA 5LSAA 5IKPA 3T3HA 1QB7A 3LCRA 5B1DA 4IO0A 4KAJA 5E4JA 4Y6RA 1QF7A 1QVVA 4QNMA 4UVIA 3GP3A 5C9ZA 1T9DA 4WUVA 3USCS 4BX0A 3QI7A 3D31A 4QOFA 1ZKMA 4RS3A 2D5BA 4DRXB 2AF4C 2WMYA 4NZ9A 2IDMA 4W5RA 4OXIA 1P4HA 2PYDA 4R1QA 5FBKA 2Q4OA 1CE8A 2IZ1A 4C3ZA 2WD7B 4LTMA 4TUYF 1E3MA 4MR8B 4F5YA 3KIPA 1D2CA 3HO1A 4UHJA 3HP1A 1ORRA 3RRBA 4MV5A 4JI0B 4CM1A 5K0BA 2A9KA 2GHTA 5JCOA 4JV5B 4XW2A 2ZU0C 1O96B 1I4LD 3FWNA 2WTUA 2AR9A 4AFNA 4G9BA 3K0FB 1QV7A 3RB8A 3KOOA 1AGPA 4FFOA 1EU1A 2F1JA 1QUFA 2WTAA 4PYNA 5EESA 5ESDA 3TLYA 3MWDA 4G2TA 3WJ2A 4A03A 4DV4B 4X24A 1DAEA 5SICE 5HKAA 1E2DA 3DGFC 5J40A 4TUYA 2HWXA 2DZDA 3FNIA 4OFZA 1NX9A 4H7IA 3G0GA 3L0DA 2QGFA 5JEEA 1VMDA 5DX8A 5HZMA 4FWBA 5CD9A 1OWMA 2WJPA 3HB7A 1L7BA 3DYIA 2FVYA 1V16B 1Z5OA 1XDWA 2MSEB 1FP6A 2VCEA 3V8RA 2EL7A 3I45A 2H4FA 2QHXA 3TI9A 4Z6KA 1D1TA 1OC4A 3LVQE 1YJXA 1VGRA 4D2IA 1U1DA 8OHMA 3CPEA 3ZCUA 2REQA 3LXUX 1MEJA 1N5RA 4Y0VA 5AOBA 3ZLUA 4UM7A 1ZGBA 4RD4A 1XK6A 4C0QC 1AQ6A 2PXCA 2ZSEA 4LOIA 4OQLA 2H08A 4V0OA 4AKSA 5JW6A 3THOA 4A3SA 1ZCZA 3ECSA 3HY6A 1BN7A 2JD1A 4Y67A 1DIGA 4KQ9A 5LKAA 1TQ6A 1P2VA 4FNMA 1OI2A 3VHXA 3R8CA 3QFFA 2NO6A 2GCEA 1CUSA 3JYNA 1KQNA 1GGFA 1RPZA 2V5AA 1DLIA 2N3ZA 2ZRMA 2O4CA 3CKKA 5AVJA 3WLOA 2G1KA 3LLUA 4G81A 3KU4A 3BMQA 5FXMA 3AC0A 3O21A 1XAHA 5EIBD 3A70A 3WWZA 3U5TA 4FWIB 2A7QA 2UVPA 1EG2A 2WTNA 3ESCA 4GM1A 4L8LA 3VR2D 1YTLA 1L4BA 1RE1A 4KO3S 2VH5R 2ZYIA 3ABOB 5G3ZA 3RC2A 5JDCC 1U8UA 2QY9A 4JP1A 4X3PA 3URMA 3BMOA 2ATCA 4MUBA 1R2QA 3AHEA 4BFCA 1WXWA 3DZGA 1E96A 4A23A 1PWYE 3UMCA 1DX6A 2WJGA 1Y7IA 4JXJA 1LI5A 4WDRA 2Q2QA 3F4BA 1F8YA 1CY1A 3N75A 4PSVA 3F5FA 1E0DA 3ANXA 3WFIA 3I6YA 1F8FA 2H11A 4JLWA 4LNAA 4DHEA 4L7VA 5KOJB 1TRKA