2C2MA

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2mA00
2H54A 4D3ZA 4EHAA 4HVAA 5IBRA 1RHRA 1NMQA 4N7JA 1PAUA 4EJFA 1RE1A 3V6MA 3DEIA 5IAGA 2XYGA 3R7BA 1F9EA 4QUBA 1CVRA 1RWWA 3R6LA 2K7ZA 4QUIA 3H11B 2WDPA 5LU8A 2P2CA 3IBCA 3S70A 1RWMA 4N6GA 4JR0A 4ZVQA 5I9TA 2AR9A 3KJNA 4QU9A 5IAEA 2HBQA 1SC3A 5JFTA 4QUHA 4IEFB 1RWNA 5IBCA 1QX3A 2QL7A 4EHFA 3NR2A 3KJQA 3UO8B 4EHDA 3V3KA 2XYPA 3OD5A 1I4OA 5LUBA 2FUNB 2C2OA 3E4CA 1NW9B 4ZVTA 3R7SA 5IC6A 3NS7A 2Y0BA 5LUAA 3V55A 1PYOA 4IYRA 1K86A 3R7NA 1RHUA 4QUDA 3QNWA 4JJ7A 1BMQA 4PS1A 4FGUA 4HQ0A 2C2ZA 4PS0A 2CNKA 4FEAA 1QTNA 4N7MA 2QLBA 1I3OA 2CNLA 4NBKA 4QU5A 3S8EA 4NOKA 2C2MA 4QUAA 3KJFA 5IAJA 3BIJA 2H51A 4JJ8A 4FDLA 5IARA 4N5DA 2J31A 1I51A 2CNNA 2FP3A 5IC4A 4DCJA 2QL5A 1RHKA 3H11A 3GJSA 3K7EA 5LU9A 3R5JA 3UOAB 1RWOA 3SIPA 1RWPA 3D6MA 1SHJA 3V4LA 2DKOA 4N6NA 1SHLA 2H4YA 1IBCA 5K20A 1CP3A 3PD0A 2C2KA 3PCXA 4EHHA 5IABA 3V4OA 4QTXA 4ZVPA 2Y1LA 4ZVUA 2J30A 1KMCA 2HBRA 2FQQA 2CNOA 3GJTA 4AW9A 5H0IA 1RWKA 5IBPA 4NOLA 4JJEA 5IAKA 1RHJA 4PRZA 4D3XA 3D6FA 2J32A 4D3YA 3R6GA 2HBYA 2XZTA 3H1PA 1GFWA 1RWXA 1JXQA 3GJRA 2QL9A 2H5JA 2QLFA 4QU8A 4M9RA 1RHMA 3ITNA 4ZVRA 4JR1A 4JQYA 4QUGA 3EDQA 2H4WA 1GQFA 3P45A 4QUEA 4NBLA 2XZDA 4JB8A 5IASA 2CDRA 1M72A 4LSZA 2HBZA 4JR2A 1I4EB 4HQRA 1ICEA 3R5KA 3H13A 2CJXA 2NN3C 4FXOA 4DCOA 4AWBA 4I1RA 4EHLA 4EHKA 4PRYA 1F1JA 4NOJA 3P4UA 1NMSA 4NOMA 3V6LA 4DCPA 3DEJA 1SC4A 3DEKA 4JQZA 4N6OA 4QUJA 2J33A 4AWAA 2QLJA 3SIRA 4ZVOA 4NBNA 2CJYA 2H48A 5IANA 3D6HA 1RWVA 4QTYA 1QDUA 4EHNA 3NKFA 4ZVSA 3PD1A 4QULA 5I9BA 2C1EA 3EDRA 3H0EA 1K88A 3RJMA 4I1PA 1NMEA 3IBFA 2H5IA 3GJQA 2XYHA 3DEHA 1SC1A 1RHQA 2H65A 4QU0A
chains in the Genus database with same CATH superfamily
4GMKA 1LNZA 1PNRA 1IN8A 3M6LA 1SMKA 3HJGA 1TX4B 4ND8B 4URHA 2WINI 2ZIAA 2O54A 3QSYA 2VF8A 4MP6A 4UTVA 2IXTA 5KYXB 3CVYA 5C8DA 4IIXA 2AOUB 4ILEA 5KWIA 1CKEA 4AY3A 1Q7RA 2FUKA 3ENZA 2RHTA 2KE5A 4PG5A 5CDTA 3ULKA 4RTQA 3EPPA 3QW2A 3D4PA 2ZZKA 1AE1A 4QD3A 1NC3A 2GAOA 2YXEA 3IAUA 3PCTA 5JNSA 3DOOA 1S8FA 1L5HA 4D3SA 2C5GA 1FMJA 5FWXA 3TRFA 4D5EA 5ICMA 2PA3A 1A7AA 3CO0S 2G5GX 3KX2A 1V7ZA 4NICA 4QRHA 2PJZA 3HYLA 4R2XA 2O2YA 4XWYA 2GZDA 1IZYA 2WWXA 4QM7A 1NF8A 2H59A 1V11A 1JE0A 2GYWA 4TL7A 1YSCA 3NU1A 3VOBA 2AGVA 3J81A 1RXVA 2X9GA 2D8MA 4DMCA 3PEWA 4F11A 2XBUA 3KL2A 3CISA 2QVYX 5TC4A 1O96B 3PT5A 4MARA 3DZDA 3KOZA 4QQRA 2C4NA 3LPLA 3LKDA 4BAGA 2PR7A 2H4XA 4C7OB 3C41J 5JS7A 1FP7A 1JG4A 1IXZA 1R37A 4GX0A 4XRGA 1L7VC 4FMDB 5LLDA 2GS9A 3FYDA 3JZIA 4NCBA 2NSJA 3JAMA 2CMDA 1IB6A 1M2WA 4XXHA 3P2IA 4DG5A 1K8YB 3ZGYA 2F3RA 3B2NA 5ULLA 3TZCA 5CFZA 1OFHA 1ZMRA 3ETDA 1ZOLA 3J7TA 1TAQA 4MWDA 4XB6B 2OZLB 3LUJA 5EC8A 5SICE 4RPGA 5SZHB 2ZANA 1JDBC 2IYAA 2FMTA 1I1NA 1ZJJA 3PYMA 4J8PA 5LB4A 5C35A 1SXHA 4BEWA 3FD8A 3Q85A 3EPKA 4QDKA 2O4CA 1JSLA 4B7UA 1OFUA 1Q3KA 1RYFA 4IJMA 4AO8A 1Z29A 4YALA 1NKSA 4EQ6A 1FB5A 1E60A 4M22A 4ESEA 2VI5A 1NI4B 2O3RA 4HEHA 4R1MA 1EWYA 1M34A 4YPFA 5B53A 4AP6A 4LZNA 1PBNA 1Y8CA 1Z0DA 2DBZA 2QTNA 2QZZA 2YIDA 3HP7A 1JDUA 4HZUB 4OFXA 3VO8A 2ASEA 1N5DA 3T5CA 1VSBA 3WYEA 1CDEA 1DBPA 4LJ6A 1OKKA 3LTNC 2GN9A 1L8AA 1KZ9A 2WT4A 3ZWMA 1M72A 2VT7A 2O06A 3GHHA 3P27A 2WLTA 3KOXA 3U49A 2P90A 2A9FA 5B7GA 2RHMA 3UBMA 3RQIA 3LG2A 4XQCA 2XXAA 1DKLA 3Q3VA 4GMDA 3W9UA 4A23A 5L3SB 2AFIE 3K1AA 1NXOA 3OEHD 4D8XA 1HFKA 2RFLA 3AU9A 3RRFA 4DL9A 1I3MA 1JFVA 1IY9A 2NO6A 5LMNB 2WG1A 1Q2XA 4M1TA 3MQ4A 2PKCA 1VA5A 3KZCA 4GQBA 1DO0A 1SCBA 3E18A 3TWOA 2YIVX 1R4NA 3GLSA 2WDZA 4S0XA 1V25A 4F3TA 1L8OA 1ZOPA 2GTIA 5CDFA 3ZBPA 1XMQB 1BTOA 1GEEA 3NKVA 3AHJA 4C0QC 1BWRA 3I2JA 1GN8A 3KUXA 1G8FA 4LISA 4YWHA 1QIJA 3DHYA 3IUJA 4X7PA 5JUWA 5DEIA 3GJ6A 4PF1A 2NOAA 4TKZA 3T1QA 1Z4KA 5EZYF 4EHAA 3WHLA 4CG1A 2QN2A 3EBLA 5CVUA 4ETWA 4F1WA 1G0OA 1G5IA 1TZKA 3DTVA 1I13A 3MWKA 3DT9A 3L6BA 4HUQB 5E8JA 4DLYA 3UWMA 3RAEC 1P18A 1P80A 2CL5A 2X5JO 3EXHC 3GQVA 3I3SR 4JI4B 1WZUA 4C6HA 3A1SA 3E27A 1Y4DE 3N2NA 3H5LA 5IXSA 1ZMBA 1A9OA 3FNFA 2YJTD 1JKJB 1ISFA 3SSNA 3FNQA 2DETA 4G6ZA 3AI1A 5D3MB 5JU6A 3UO8B 3ZGVA 1R6DA 1AUQA 2I8AA 2I6QA 1Z6ZA 3I9KA 1M1UA 3I01M 1MIOB 3S7ZA 1DJMA 1M5TA 4GP7A 4DA4A 3BM5A 1K3TA 5JSUA 4YIKA 1U1DA 4KQ1A 2I4RA 4UNPA 2VXYA 5F51A 5U9CA 5JSZB 4AQYB 3GLKA 5I7OA 2YWHA 4FONA 1NQOA 1C4XA 2OHOA 5D3KA 4B4VA 4ZHSA 1T5LA 1MR3F 1MHPA 4EF5A 4ESVA 4MJXA 1YZQA 3T4EA 3PQ8A 4EVQA 1H0SA 2BISA 2C2ZA 2Z30A 3ANTA 3GDOA 3LPDA 2WVAA 3FTDA 3L01A 3IUBA 1Q5PA 3QLVA 4FEAA 3VPAA 3THXB 1E6WA 4RPKA 4ZOAA 4B1FA 2QA5A 2HF9A 3NUGA 3X2SA 5KDOA 3REFA 1TAHA 1KXJA 1C9YA 4YLEA 4RXUA 2FPGB 3NBMA 3EQ8A 4ZV9A 2WUVA 1DO2A 1RLIA 2AJLI 3LDFA 3VAAA 2IW1A 3EVNA 2HPHA 2ZLBA 5EHXA 3RANA 3BERA 1VSQA 3IPLA 3R3SA 4G24A 1LPSA 1SBTA 1L7QA 2Z3ZA 5JO0A 3IPYA 4WEQA 3ROMA 4R01A 3O03A 5TRTA 4I5FA 3G0GA 3NXKA 3ESZA 3TZEA 3RWMB 2PUHA 4L75A 4B8WA 2BJHA 1I7SB 2QSZA 4UULA 4J6EA 2JLCA 1LCIA 1ZN2A 4HGPA 4TVOA 4BVEA 3ANMA 3G9XA 2HU2A 2Y0CA 1P8JA 5K0NA 1EQUA 1Y63A 4R1OA 1FYVA 4NCXA 3S8YA 1COZA 1HX7A 1BH2A 3OIVA 3IIIA 4LGCA 3S2IA 3R0XA 2VNJA 1TT5A 1G2OA 2NGRA 1Q7BA 1PGPA 2Q49A 4EYSA 5TB5A 2IYSA 2KBFA 2WJGA 4YJ3F 4OATA 2VDJA 2C96A 1JG3A 4S35A 5F5NA 1NRIA 3G6KA 3CNBA 4BFSA 2ZAOA 3ADDA 2V54A 4YXFA 1HDGO 2Z3WA 4Q03A 1XCBA 1X77A 3RTGA 5CPBA 1MT3A 4OTZA 4CUZA 1XAHA 3A2MA 3JYLA 5FWXB 5HA5A 3CF4A 4YACA 1TMOA 3USCS 1UR5A 3SQLA 3WGUA 4M0UA 1KMNA 2IU3A 4PXYA 3MFQA 2JJ2A 4L28A 4QX6A 1EUYA 4K6HA 4RH1A 4LXYA 3AOGA 2VPXA 1FP2A 1YWGO 5H1YA 4TZ0A 1V11B 3F73A 1XQ1A 4PGMA 3KD2A 4JUBA 4QU0A 1FBTA 2QAJA 2GCPA 4WLUA 2GAIA 3DA8A 3N7AA 3M70A 1UBCA 3OF5A 4MH0R 3GLIE 2HSEA 2IPMA 5IAGA 1E2QA 2KWIA 3EF1A 3ST7A 1NDQA 3V7FA 5JSFA 3MJSA 5I7AA 3KEGA 3AIKA 5FULA 2JFVA 5CUQA 3KHKA 1Z6TA 2P9FA 3HN2A 1EM6A 2WF7A 4MGHA 1M2HA 1N2OA 1TM2A 1SU7A 1KEVA 1UJNA 1UMCA 1ZO8A 4N8DA 4W5NA 1JJBA 2YZKA 2R85A 4YRFA 3QKIA 2I4LA 5A4KA 1ZH8A 1X1CA 1CY4A 1K63A 2J5QA 4ENQA 4IKOA 4ZCTA 1OTYA 3VO1A 1R12A 5KQMA 4RK5A 1GPUA 4CM9A 3AVVA 1YCFA 4DPLA 3SVLA 2L82A 3KBOA 1H2RS 4DQVA 1DBVO 1GCUA 3CMMA 4WCFC 5DNVA 1X8KA 3G9TA 3S55A 3K70B 1YS4A 4EQ6B 4F1KA 6REQB 4DCTA 5EJ6A 1YB5A 3ZK8A 1M34B 3VZSA 1IQUA 2JIZD 5D1HA 5EP4A 3Q4GA 1T4DA 2ORVA 1GTSA 1XK7A 3SZGA 1E8NA 1X3LA 2JFQA 3QU7A 1FOEB 2IVFA 1MOPA 3WKEA 4KLAA 3JYPA 1KQPA 1P0CA 2J3MA 1JZSA 2H51A 3BIJA 4A3SA 4FIZA 4INAA 2CNNA 4YBRA 2XXAB 3C16C 5GIOE 2JCXA 1AZWA 3FZQA 3K1AB 3L7DA 5LQUA 1ZM2A 1I1OA 2GKSA 5IVKA 2P91A 3U3XA 1H4VB 3BZBA 3D7NA 3D6MA 2BD0A 3KP1A 1XJWA 5FFMA 5HF5A 4PEVA 4WZAE 3RLIA 1E1QD 3JWJA 5IABA 5IW8A 5DISB 4D0SA 1T24A 2FEAA 2CWWA 2DRIA 3S1AA 1DEXA 4KHPB 1KMCA 4FFSA 4XE5A 1TQ8A 1YZLA 2OKCA 2QQEA 1I6WA 2HBRA 3AFNA 3FMFA 4HEA1 4E5UA 5A5EA 4FGSA 2GF0A 4LYFA 2G9UA 2YOHA 3BJEA 4B6GA 2BCJQ 2AXNA 1U8TA 5KSZA 3DWGA 4MZXA 5EXPA 1DBRA 1LZLA 1RFLA 4EGAA 4G07A 4DADA 1N6IA 2BJWA 4NG4A 3DTVB 2CZCA 1GCAA 3TRJA 4KQCA 4KYIB 2IS4A 2MMCA 2P0YA 2YVLA 1Z7YA 8ADHA 5I4CA 4Z4EA 2ERCA 4KDRA 1GZ4A 2N3ZA 4GXTA 2B8WA 2VBFA 1M1NA 2XAUA 4XR9A 2BL4A 2UUPA 2IOFK 2C07A 4AJ2A 4W5JA 5KYXA 4DLKA 4BGDA 1WQ1R 4Z0HO 3B36A 5AVSA 1RYYA 4KGDA 3EZXA 3PDUA 2ZBDA 3NPAA 5CJ2A 5JAZA 3IQIX 2F8TA 1J1UA 5H02A 2MYTA 3UHOA 3SQOA 4EPRA 4J0CA 3TZLA 3KQUA 2BH2A 1DRVA 3T1HB 4A6XA 1JQ5A 3RFFA 1QDUA 1ZD4A 1O95C 3O73A 3HWRA 2VYQA 2AG6A 2QTLA 3R2JA 2DHRA 3RIMA 3IP8A 4IQ4A 4P0QB 1XD9A 3AB3A 3CSUA 2EIHA 3C8MA 3N3BC 1Z37A 2XUHA 4U7WA 4G1VA 3RS2A 4JKYA 4RTLA 2V7QD 3OSZA 3V4ZA 3PNSA 3SMVA 2NO0A 3RU2A 4C4AA 3R09A 4CJXA 4P81A 1RE1A 3IODA 4K9RA 3NWOA 5EJMA 1XVUA 4PNZA 5AI9A 5ITVA 3ZVMA 1GR0A 3FDFA 4AF8A 2BGJA 2HHAA 5F1KA 3RQSA 4I1YA 3DVQX 2BRUA 3O47A 5BWNA 3QP9A 2ZSFA 3ZEAA 1OFUX 3M4ZA 3WWPA 2YXNA 5B4TA 4DA0A 2WM9B 2QE7A 3FDXA 4D96A 3GPLA 3FOEC 2AW3A 3ILVA 3HJFA 5HHTA 1KYVA 1SVMA 1DIBA 1N8KA 1WZNA 1TXGA 4ZC1A 4Z9YA 3N2KB 4CLXA 4Q9NA 2J9FA 4JHLA 4RK0A 3M1YA 3D2LA 4ZT2A 4DBZA 3LH5A 1P7ZA 2IYFA 3QVMA 5LUAA 3V55A 1KKUA 3L0OA 4H7DA 1RPZA 4O33A 2ARKA 5C8YB 2ZZMA 3D2BA 1GFSA 3THYA 4N1AA 1TT5B 2B35A 1NP7A 3NBXX 2AI2A 5DVZA 4AAYA 1Z0FA 4F8EA 4ZYXA 3CPHA 2GN1A 3CWQA 2RJOA 2OO3A 4D5GA 4KHZA 4TQUS 3FGOA 1E5DA 2A4KA 4ND7A 4ND1A 4RSRA 4YJHA 1JHQA 4LMBA 1PQWA 5K7SA 5EVCA 5A0VA 2R5NA 1WRBA 2O2CA 4M37A 4BJ6A 1W2WB 1AMNA 3IAXA 4EHBA 3T7TA 4BO3A 1N92A 1TQ4A 2IX9A 4MP3A 2NNWB 3A0UA 1N6PA 3KB2A 2RGUA 5IH7A 1NWCA 1XDDA 2G6BA 3C3BA 4AJJA 2PKRA 1M33A 5KNCH 2Y6VA 5ERXA 4YRIA 3TMYA 1GQYA 3D3QA 4Q7LA 2BFMA 2H4FA 3PEVA 1XDWA 4R0VA 5CDSA 1F17A 1R3UA 2XOEA 4IWXA 3PGMA 5FBRB 1U8CB 3KVNA 3OECA 1A8UA 4CKBA 2LE0A 1XYVA 2B83A 3CEMA 4RD4A 2VQFB 3QNUA 5CD1A 1J97A 4X7BA 3WLKX 5EJ8A 4X3OA 4UBLA 1E3MA 3CX6A 3HFRA 1V7CA 3ZDDA 1QU2A 2BTQA 4LCBA 2QD5A 1FNNA 1I4TD 4XGRA 2QYOA 1P9LA 3IVMA 3N2EA 1WR8A 3O0DA 2I2DA 3PXXA 1ODFA 4H3VA 4JX8A 3CW9A 2Q3BA 3E61A 2GBGA 4YT4A 5DI9A 3QEAZ 2E55A 3V9AA 1J9EA 2D1FA 2E5FA 3TZBA 1ZN9A 3CCFA 4OEHA 1QKIA 2XQVA 1UMCB 1TVKA 5J5CA 2CMFA 3VKFA 1AHNA 5EMHA 3EDMA 4BTVA 1EG2A 4DAOA 1IY0A 1NXXA 4N18A 2XRFA 4MYDA 1YKGA 4H4CA 3GGPA 2DSNA 1D7AA 1TKAA 1FYDA 3AUSA 2J6HA 3K9GA 2IYLD 4KNYA 1ZD5A 3EF3A 4IHQA 2D5IA 1E2NA 4A26A 5AKJA 4DDMA 4E6PA 2XMCA 2E4XA 1AMOA 2IITA 1P4RA 3FAKA 3V3TA 1E9CA 4F4FA 3HE3A 3MOGA 3VPFA 3FPSA 4V39A 4CKZA 5L51A 2YWDA 3SLKA 5DHPA 5LYJA 4HH3C 2Z4RA 2JFPA 3SAJA 3CZAA 1IULA 1WB6A 4B6PA 3BSWA 3ND6A 3UYKA 4II7A 1NE7A 1V8DA 3ZK7A 1H3EA 3P9KA 2ORYA 2NYVA 3AX6A 2W11A 3NJ4A 1HNZB 2FN7A 2J46A 4PS0A 4XTCS 3ROGA 3UIEA 3R0IA 2QENA 5EINA 2PUDA 3VNUA 4OB6A 2PMBA 3IUQA 4H7JA 5F5XA 1SVSA 4IINA 2ALJA 5EJFA 3DL2A 3UVEA 5DB4A 1XRLA 2ZBQA 3UV6A 3Q87B 4JQSA 3VBEA 1NJ5A 4DLWA 5JTUA 3PI6A 4BECA 1WXGA 1EQAA 1F20A 3DE1X 2HNKA 4HMOA 3HL4A 4RNCA 2P8JA 4YRRA 1JN0A 2V6GA 3S1AB 4BRSA 4LJKA 3H83A 4XVHA 2NXCA 1KI2A 3WE7A 3WA7A 2CBZA 3IHTA 4LPSA 1DFHA 1ZIXA 4X7RA 1VG0B 4UM7A 1VL2A 3N1UA 4UUPA 1KHTA 1VG8A 2IZZA 3MF4A 4GLOA 5FUBA 3ZBUA 3KEMA 3RNOA 2W22A 3ZWWA 3KC2A 3PPXA 5DNAA 2E4UA 3SIWA 3V7NA 5HRCA 2O7NA 1I2DA 3F6BX 4Z51A 2VCYA 4HWTA 2IDKA 1SCUA 4FP9A 3NEAA 2FPPA 3U13A 3TW6A 3VGJA 5HNKA 5JS6A 4RIEA 1QP4A 4E11A 2Y8EA 4YQEA 2OCPA 1M1NB 2VPTA 4UEOA 1TLFA 1ZJ5A 1DI0A 1U0SY 2F9MA 2G80A 2IXBA 2PTGA 3F5FA 2EX1A 3G1TA 3Q40A 4NDAA 3KUDA 4Y6RA 5TEVA 5JFOA 2PT5A 4E22A 5JJKA 1BVHA 1PZHA 5F2KA 3C15C 1E8DA 5AW1A 1V5FA 1Y3CE 2D2EA 3PA6A 3U80A 3B1KA 3AM4A 4BE9A 4RD2A 3HVRA 1EXDA 3FOWA 3HACA 1EA5A 2Y3IA 3CC8A 4MPDA 4QJ5A 4ZK6A 3OH8A 4ZK2A 2FKNA 5B6PA 2VXCA 4P3PA 1GUDA 1IC6A 2X0EA 3EOAI 3EXFA 3FWYA 1N0VC 2FE4A 4FDMA 3SR0A 2PXAA 1M6HA 2HSWA 1PFVA 2O1EA 3L7YA 2FPSA 1J07A 3CZ9A 3RJTA 4CMJA 1Z18A 4DBVO 3H2HA 3VR3A 4TMWA 4FOOA 1R5NA 1SZPA 2F1RA 3TQFA 2Y68A 3GBPA 1BVRA 3PFIA 4QGHA 4YUWA 4I50A 3VKVA 3WYNA 2ZBFA 2GPNA 1NXTA 1V48A 1K3UB 2GEKA 2PV7A 4J6FA 2VFAA 4XB1A 3EVAA 2HXYA 3CRMA 4JS0A 4QXQA 5TE9A 2XKAA 3EXG2 3GLGB 1Z4QA 2IYUA 3GRAA 3OZRA 3VYVA 4KR3A 2F48A 3O4GA 4X6XA 2E6KA 2WM2A 3CHYA 1COWD 2E5WA 1PL7A 4M0FA 4UMDA 2JAUA 1U7XA 4PVDA 4LOAA 4OMCA 5CVEA 2QTCA 2P3SA 1IQRA 2R6AA 1M75A 2FWMX 2MINA 1K97A 3O7MA 5C5EA 3RTDA 2V97A 1PUXA 4I1OA 4X8MA 1EYZA 3A28A 4ZQEA 5FYQA 1BWPA 3N2YA 1GNSA 2J9FB 1UDWA 3ACBA 3I0NA 3ZHQA 1H8HA 4QPPA 2RSLA 3G49A 3BFKA 3CUWA 1N33B 4M99A 4MICA 4EHNA 2VL7A 4EABA 3QJYA 3BQNB 3I2HA 1A97A 4PV7A 3THYB 3CF2A 4PSAA 3TVDA 2O5RA 1SU8A 1M6EX 3CNEA 5LA6A 4KUHA 3IQEA 2XAAA 3W8FA 2C77A 3NDBB 4NE7A 4XCQA 1UKCA 3SHVA 1J8DA 5FI0B 2H54A 5TMBA 4C0JA 4YJHB 4RKWA 2MMGA 2P40A 1RHRA 4N7JA 1N2IA 3VM6A 5GM1A 1AA9A 1DBIA 2FZVA 4HOYA 2C4UA 5FPTA 2ZYDA 3OESA 4ZGWA 3BK7A 4YUXA 2HEGA 2JARA 5T67A 2CLOB 4I1SA 1B8VA 4MKGA 1ZAKA 1M8KA 1ZI9A 1O5TA 2ZXEA 5EXXA 1XA4A 2AG5A 3QLTA 4PLVA 2XRYA 3K1ZA 1C3LA 1SBZA 2DKNA 2P27A 1BWSA 1QX3A 3N05A 4L8LA 3U7QA 1XMSA 3QYPA 4ENSA 5FDFA 2HMTA 5JECA 5JT1A 4N82A 2XCRB 1VE6A 3WSWA 4CKBB 4M3NA 5G1PA 1QPGA 1AS2A 2O20A 2RAVA 4G8BA 1Y7PA 3UCFA 4B7AA 2Y77A 3TSWA 4U5QA 3HBFA 1Q7TA 2QAIA 2OHFA 3KVRA 3NS7A 4INPA 5EUBA 3T41A 5EJIA 2BTQB 5IN4A 2IZ7A 2Q3DA 2V9ZA 2P67A 3ADOA 3I01A 2YYSA 4MWGA 5DGIA 3LQFA 3NX4A 1Q7GA 4Q16A 3WYGA 3W05A 3II6X 4OUKX 1O6CA 2VSFA 4CI9A 2VLBA 5HR5A 2O07A 4OD0A 3ROEA 3TO5A 5CFNA 1M2FA 2QN9A 4UTRA 4RKQA 1LBHA 1NA5A 1TVKB 3K6KA 5JQGB 5DBFA 2RKBA 4ND2A 3SHWA 5ICSA 4JLVA 3EH1A 5LQJA 2CHEA 2ZJ1A 1Y48E 4EW3A 4LF6B 3I4LA 2P7HA 3TAHA 1FSSA 2FFJA 2K6GA 2RBEA 4LEIA 3ZV6A 4Z4CA 4ZN6A 2B6HA 5FUVA 3X1YA 2AT1A 4YJ2A 3HUEA 4ZVKA 2IHNA 1Q74A 3N2LA 3VHQA 3HS3A 1WQ4A 2YXPX 3UOAB 3LUKA 4UOEA 5FJJA 5GJWC 3PP8A 3S2ZA 3VO2A 3C4JA 3GFTA 1DAGA 4PQRA 3UK0A 3FETA 4EYOA 4ZANA 3LU1A 1HLGA 2BBTA 1JJVA 4PZEA 4BDTA 1DKMA 4Q3OA 3BSFA 2R8XA 5JZ9A 5KOJA 5CLQA 2ZVDA 1R6TA 2CLCX 1F2UA 4P3OA 2I62A 5G0SA 3TW8A 3OQ6A 3SP1A 4XARA 3WJ1A 4HAZA 5CHYA 5FBHA 1CPYA 2QSJA 3WDLA 3L4JA 1IDOA 4DC9A 1EVIA 2BELA 2K5UA 2J3HA 4KCGA 3EHDA 3ER8A 4AJ9A 3VU8A 3LMKA 1EEXB 3ABRB 5BQ5A 3ZU5A 5J2UB 4GMHA 2CVOA 3L1IA 2PZ8A 3AY7A 3DAYA 1SVOA 3HDQA 4Q4DA 4FWBA 1KE1A 1JTEA 5IASA 3DUWA 3HXLA 4X62B 3MJFA 1TYZA 2X9QA 1AKRA 3LLUA 1CNEA 4TTRA 4MGKR 3ZLTA 4R84A 3ONEA 3PGVA 4Y3UA 2X22A 3IKJA 3WXMA 3WAGA 2Y1GA 5HKKA 1PR4A 2BHTA 4DDUA 3OU2A 5IFLA 1ZGZA 3HU5A 2C7RA 2JLVA 4K05A 3EGWA 1W36D 3AT1A 1ESDA 4JDPA 3LJKA 1VCIA 3VJRA 4GOND 1UK6A 4HLDA 5I9BA 4ZT6A 1MA3A 1SCUB 1G9SA 2GN6A 1VDZA 3A0RB 2FPPB 4R9RA 1ZUHA 2PRZA 3ASYA 3G7NA 4LOJA 4AS1A 3PHJA 2V6BA 1SUBA 4YDQA 4JZYA 4MDFA 1AHHA 1XTPA 2AXQA 3B1YA 3AR5A 3T7IA 2J6IA 4W4TA 1XNRB 3PQCA 4OQYA 4AIRA 4F9TA 1Z7EA 1T1RA 1GRVA 1VJ1A 3A1WA 4YUVA 3VNRA 1PS9A 5K1ZA 4BQPA 4OHXA 5AH0A 5EE5B 5MGBA 2P3OA 1C8LA 1Y1QA 3KQKA 2LPMA 4JJKA 1D4FA 3RSQA 1VMDA 2HLPA 2PQ2A 3EBOA 5F21A 2SCUA 2EW8A 1F2DA 2XXJA 3D3NA 2BHNA 1L4LA 4KLCA 3EPHA 1MX9A 3CEJA 1E64A 4C6SA 2ZATA 1DINA 2FUG6 1F8XA 3PUZA 4KQHA 3WNVA 3LY8A 2HO4A 2X23A 3OCJA 2A0KA 2PUCA 1NY6A 1TI7A 3I58A 3I0MA 2D06A 2PQ0A 4M9SA 5CB4A 1GN9A 4DTCA 3EE6A 4Y2GA 4ZO7A 1K5HA 1B1CA 1O4VA 1NY5A 1EA7A 5EKDA 2FWNA 4HAOA 1RQ7A 5EP3A 5F23A 3K0EA 3DEZA 2XUGA 4I50B 3RVOA 5K0LA 2PZMA 4DCGA 3ZCSA 3RTAA 2Y1KA 3OO1A 4F56A 1FRQA 1MO6A 2HH9A 3TNDA 2PEZA 3HYTA 4AMBA 2X9NA 3VU3A 4WBNF 1GTJ1 3AI2A 3VKWA 1Z5UA 2PGNA 3QVUA 4EH1A 3K72B 3NHYA 2MR6A 3QFHA 4KWIA 5IJAA 2XRZA 1E7RA 1GUBA 1GM5A 1WTAA 4MI1A 1QFXA 5JZMA 3TQSA 3ZDBA 2WSSD 3EOZA 4LE0A 4ZCRA 1JAHA 2Q07A 1WULS 4P7BA 4W1PA 2IOFA 4L4SA 2MINB 3PEYA 1Z45A 3BJZA 3LS2A 4LGMA 4BVBA 1MRNA 5CFQA 1HT2E 5KCZA 2VQ6A 1DJQA 5J4VA 1RWPA 1U1IA 1Z5OA 4I9FA 1YU6A 4DM4A 4LF9B 2YOFA 2PPLA 3RHTA 5EZ6B 3WJ2A 2QQ5A 4CKXA 4F4UA 1T8SA 3WK8A 2RGYA 4KU4A 5LZ8A 1QVZA 1A9YA 1B7GO 2FX5A 2PL3A 3KAJA 2BSAA 4PQYA 4TM7A 2FPKA 1GFZA 5LA6B 5EJ4A 1FK8A 3GJTA 1I14A 1UKVY 1TO6A 3N8KA 1RYDA 2VH1A 4KQEA 2F64A 2O23A 4G9EA 3M4XA 3MSCA 1JRLA 3JYNA 3K73O 2R8PA 1VXRA 1JS1X 4CNBA 1PLLA 2XH8A 5B1EA 2QUIA 2G1AA 4EO9A 1UFKA 5JDIC 5A06A 4M36A 1LQTA 2R6ZA 2LV8A 3KQYA 1KH3A 3QX3A 4YJKA 3LUFA 2J7KA 1YR1A 4IO1A 4WKGA 1GSAA 1V16A 1LSOA 4KO3S 4Q37A 5CW1A 5BSFA 1MQAA 3ENWA 3U7QB 1W2HA 2XUIA 5CNJA 5JZVA 4H7KA 5BQPA 3AH8A 3KKMA 3BIOA 3F6EX 2FDRA 3FNGA 3JSXA 3E15A 4I46A 4JL8A 4BFCA 5BWCA 3HY6A 5FH9A 5EIAA 5E4TA 3WG9A 5JALA 2J6CA 1YRQA 1V5GA 2OKGA 1OGJA 4DEXA 5KDDA 4EDHA 2NLOA 2N75A 2ZQ5A 1GV0A 3CUUA 1GLVA 3UJ9A 1GCOA 2YFHA 3L4BC 1PQUA 4QYXA 2HZBA 4F60A 4FSDA 5AW2A 1EZZA 3UXEA 1AQIA 2EX0A 2D2XA 4NHEA 4XRRA 3ZHVA 2XVXA 4ZMBA 1HRKA 4YREA 1EVJA 2ZS8A 1SC1A 1Y7TA 2YRXA 1BA3A 3EPRA 3LGSA 4YRTA 3V1LA 1X7YA 1Z12A 1NASA 1ULSA 3EDOA 1S3FA 2Q7OE 1KEWA 2OXRA 5K6RA 2IHYA 3QX8A 1M67A 3VV2A 2CSUA 3LL7A 5ADWA 2XD9A 3OKFA 3UT0A 3BXPA 5JOQA 4XIJA 2YJZA 4EGQA 2BPOA 2P2CA 4YMTA 1YC2A 3EXHB 4NL4H 1DEAA 1C1YA 3BFXA 3DFKA 4WPGA 3UWPA 4O0LA 1RZRD 5CVVA 5DN9A 4CLDA 4DCSA 4DZZA 3PJEA 1K7XB 3LY7A 1JSCA 4UZFA 4ALNA 2QL7A 5KQSA 1AGXA 1XDSA 3GRRA 2VQDA 3IVAA 3E58A 4PLGA 3NHZA 3ZWKA 3L77A 1YA4A 5IJWA 1KR5A 1PEDA 5KOJB 1TKBA 2VEDA 2I2WA 2ZE7A 3WBJA 1Q0LA 1ZK3A 4I6EA 3ZV3A 5BNTA 4DLAA 4Q3DA 1F2UB 1Y1PA 1KAGA 3WTBA 1Y34E 3HCDA 3TW8B 1RC1A 4D9EA 1WUKS 4MAFA 2HHLA 1A5ZA 1RXWA 2ES4A 2O2GA 2YV1A 1JLKA 1U3VA 2FPLA 4R2HA 2PUAA 2W8BA 5KJFA 1UEIA 2ZW9A 3AIIA 1X38A 2XYVA 3COWA 3L8DA 4MVJI 2Y1CA 3IPRA 3DCNA 2CL0X 2JA1A 4QU5A 2IPLA 3TPZA 5HXAA 3D6VA 4HWKA 3BIWA 4IFBA 5DHAA 4AKEA 1IDN1 3BDAA 4U63A 3LCCA 3V8QA 4ZCQA 4I4NA 4NFHA 5BMVF 1JJ7A 2XDYA 1C8KA 1XZCA 7MHTA 3ZY6A 1YJXA 4Z4GA 4I5GA 1S3GA 3FOAA 4WOKA 2NXNA 3ETHA 5H9VA 4FGJA 4AKHA 4TRJA 1WJGA 4Q9AA 5EMJA 2XI4A 2EKDA 5AW3A 4BEVA 2D5AA 3PEEA 1HT0A 4E3WA 2VF4X 2ECQA 4LJYA 3QEKA 5LDGA 3BTVA 1AQUA 1MRZA 1DUIA 2BFEA 2V7PA 1SXIA 1DG3A 2H92A 2Q5FA 4PYIA 2ORWA 5ED4A 4H4DA 4H77A 2JJ8A 4L08A 3HU2A 2OD9A 4N5MA 4FYWA 4TM8A 3TUZC 1NC1A 2OD7A 5LQCA 3DNMA 4UDNA 2V98A 2XBLA 3OPNA 5K6AC 1AT1A 2YY7A 2WFAA 2BR3A 1W9MA 3EA0A 4UTNA 1JVSA 1DVRA 1QYDA 4FWIB 3ENVA 2H7CA 4IAOA 5J2TF 2ZE5A 3F7NA 3NONA 1CLEA 1S2DA 1ORTA 3FPFA 4KMOA 3RUEA 1NVTA 3RKSA 3PWKA 2GCGA 4DUGA 2SCUB 4PICA 3QOFA 3I6MA 1SCAA 8AT1A 3H3FA 1TB4A 2CDNA 4IP0A 4JUCA 4RHCA 1JYEA 1ACJA 4YNBA 4BMCA 1R64A 2VSNA 3LW7A 2C3YA 4F71A 1OB5A 1DPFA 1FNCA 3OIWA 3AJ9A 4LQLA 4LSZA 4EEXA 1P7VA 2Q5EA 1Y5RA 4C0WA 2ZE8A 4ZKEA 4HV4A 2Q4DA 5KTPA 5CB4B 2L2QA 3IXQA 4MI9A 3PXGA 3P32A 3ESRA 4HH0A 4FJ1A 2F1JA 1A9XA 3OEED 4DWVA 4ML3A 5A4DA 2FOXA 1PT7A 2IBSA 3QMPA 1V4BA 1N8TA 1T4BA 2V3CC 3I53A 2AI3A 2BBSA 3RT9A 3E2PA 2JI4A 5EWLA 1E4YA 4BNNA 3MWJA 4ZJUA 4N40A 2IPAB 2PXCA 4D9GA 2D5BA 5EMNA 1FFAA 4R1LA 4O3FA 3I92A 1YNSA 3C5WP 1T15A 2PVCA 4LPKA 3W4IA 4E03A 2IDMA 5GQSA 2FSPA 3A9WA 3WWZA 4MGZR 1RWBA 3O3CA 1ZIPA 4BP8A 3A1TA 5DW3A 2QKYA 2XXBA 3OT1A 4KB5A 2OPHA 3WL6A 4UHEA 1V96A 4CCYA 1PSDA 1E1RA 3QOYA 5F1PA 1YRWA 3FTQA 2YHUA 5HOEA 3WNQA 4WN3A 1L4MA 3EXG1 4D99A 1EP2B 2LWIA 1QO0A 3O21A 3Q5DA 3BYZA 3BILA 4GPTA 3GPDG 3TBHA 2QZ9A 5K8VA 2WD9A 5ALPA 3UT5A 5JMTA 4RETA 3ZUGA 5JZBA 5CEEA 4OUDA 2OHIA 4Y6OA 3AVUA 2DTEA 4NULA 2AKEA 4MUGA 4BNKA 5LUBA 2HV9A 3BB4A 3IT1A 4REQA 3PGKA 2R68A 2XHZA 1RJWA 5KCMA 2FGJA 4HATA 4RK7A 1IG0A 2EZ4A 1RM4A 2NG1A 4K8RB 4WCFB 3SE0A 3KQNA 2V6IA 3ENQA 2WQZA 1W46A 3TTVA 1C41A 5DNYB 3M82A 5ALOA 3UT6A 5HUJA 2DFVA 4G0UA 2OV1A 3LWNA 4A0SA 2ESRA 2I80A 1V16B 3H4VA 2FWPA 1CQIA 2A0FA 2YJNA 3FUWA 4EFMA 4FD2A 4P7GA 4DNXA 4MLPA 4WXRA 1KRXA 1KHHA 3O91A 3A3OA 1GT6A 1EP9A 2B2XA 4MO2A 4YRPA 1LFDB 2KLHA 3LW8A 1GLNA 4XM2A 3W6NA 4CKEA 3JRWA 4AM8A 4PX2A 2WRZA 3SIPA 4WLEA 4DQXA 1UXHA 1P2UA 3EQ7A 2G1UA 4B6EA 1SHLA 4EG1A 5CAEA 2CHVA 3L2OB 3OM0A 4NCIA 1T5HX 1KOGA 3DMHA 2WHQA 1XX6A 2OFFA 1X2BA 3OT4A 4KRXA 4ZVUA 4C0BA 1PS0A 2J30A 3YASA 4JYZA 3U4DA 1ODLA 1UPBA 4JIGA 5AK4A 2UDPA 2FK7A 5ALKA 3TZQA 4NQRA 2ZEJA 2Z6QA 2V7TA 1RHJA 1YL6A 1ZKMA 1X7YB 4NBTA 1C7IA 3BDVA 3SDZA 2C83A 4FE3A 2FEKA 5CBKA 3QUBA 4G85A 1SPXA 1VKHA 3AM1A 3PE6A 3GGCA 4ZAWA 4GG1A 5I6DA 2PXHA 5EZYA 4M9RA 5KVCA 4BFWA 2Y1XA 5AKYA 4D0NA 2AFHA 3PC4A 3QTBA 3O1IC 1WXIA 4Y0VA 5BSWA 5F52A 2HT1A 1MEEA 4HS4A 4AP9A 1HFJA 1RYBA 1QVVA 4E2YA 1C9MA 1UKAA 3E5RA 1ZD8A 3NYQA 4UU1A 5AUNB 3L02A 1B8UA 3HA3A 4J7XA 4MRVA 2HWKA 1QHSA 5JHHB 4OL9A 2F8MA 1U2PA 3BF7A 1YU9A 1D6MA 3FFTA 3OBIA 4NAUA 3UANA 3OOSA 3SWWA 4G81A 4LDZA 4O02B 3OP4A 2OBFA 1TK3A 3HM9A 3T5DA 3RSZA 1UPUA 1Z2CA 1DDOA 3S99A 2HJRA 2HV8A 2ZRIA 2W8BB 3H5NA 4RPHA 3B13B 3SYMA 5JJCA 4V0QA 4O25A 5L4NA 2PJRA 3UYLA 2ECPA 2W4IA 4QA9A 4WFJA 4MV9A 4RIFA 4Q34A 1FVXA 1QE0A 1UM8A 5D2CA 3UZUA 2AKYA 1YL7A 3DO8A 1KZGB 2PL1A 1PJQA 1AQNA 5JBQA 3PYXA 1UKBA 3GDHA 4UU7A 4YRDA 2E1PA 1JNXX 2BLLA 3DEIA 1T35A 1ZRHA 3MRTA 4R9VA 4BQQA 5CYPA 2X0DA 5TS2A 1WBBA 4BJHB 5K0TA 3WX0A 4I6GA 1YQTA 1RZUA 2OC4A 4XB2A 4XGKA 2WV7A 3TX2A 1U1EA 2C1XA 2GLXA 3PGLA 1JMKC 3ZJ5A 3UJHA 8LDHA 2VCEA 1NLYA 2WKPA 2UUOA 3B5JA 3PUVA 4NZ9A 3G82C 2VUIB 5DM2A 4GU5A 1THMA 1RWNA 1RU3A 2ZT6A 3L92A 4REOA 1JDNA 4J7UA 1Z26A 2BFEB 1XL1A 2C2BA 4WXHA 3UJ7A 4IOJA 1IEQA 3V33A 5I01A 3HGTA 2EV9A 4CMIA 2HDHA 1DLIA 3TLYA 2C7PA 1JKMA 1QVAA 1XVLA 2Y0BA 2QRUA 1RIIA 4I9HA 1KEEB 1FXWF 1UC4B 2PMCA 3D6TB 4GNRA 1QHIA 4OP2A 4Q18A 3TH5A 4EX6A 4IRUB 1JEOA 1LK7A 1Z0JA 3EC7A 2ZBPA 1HGXA 1VLZA 1CJMA 1L5SA 1JR4A 4MRSA 4Y2PA 4RMIA 5C3MA 3MXTA 5JAHA 5KTNA 4MZDA 2G0AA 1TYEB 1GNVA 1I3OA 1EFUA 5LXTF 3U09A 4MQEA 2DY0A 3A1CA 4A5SA 5BYBA 1KI9A 4UHDA 4X45A 1JMVA 3ETEA 1W76A 3B6KA 2PANA 2XUPA 4GUAA 5T6BA 3SZOA 2XCTB 3AVXA 1WEHA 3SQMA 4F06A 5FOQA 1A9XB 3L8MA 3N6VA 3UKJA 2XBMA 4QPJC 1JIVA 1WQ3A 3I6ZA 3HZRA 3HA2A 1K0UA 2OSVA 4C4OA 1U5BA 3G89A 4LY3A 1R8JA 5EWLB 3T7AA 1VE9A 1R27A 2XVYA 3PR2B 4QNRA 5CA1A 2GETA 3U4GA 2FFHA 4UE3S 1Z0SA 5E6RA 3NYWA 4OXYA 3VO9A 4GC5A 5J5VA 3V4VB 1AD2A 1I3CA 2GDZA 3PPYA 5F2OA 1ZONA 4AI6A 3COSA 3F6SA 4N49A 2W2PA 2HI0A 4FLMA 3SI7A 2DCUA 1CDOA 4K6FA 2IYXA 1TE2A 1NQAO 2ZYIA 5K2MA 4IQGA 3TAXA 5IG2A 3WGZA 3ZXUB 3V8RA 2AMVA 3WLHA 2QVBA 3QXXA 4GECA 4H60A 3UT5B 2O2XA 4DV0B 3NHUA 3PXBA 2WIBA 2ZRPA 2C4KA 4N5IX 3W7BA 1QRTA 3Q88A 4PTYA 1EFLA 3LZ6A 4OUDB 2FA9A 1CF2O 2FW1A 1C30A 3MCAA 2BP7A 1SUSA 1YZTA 1T9AA 1T6ZA 1A9TA 2D5LA 1SBCA 2VH5R 3GELA 1OWPA 3IDFA 2ZOSA 1RXSA 3PG5A 4LY0A 4U7TB 2ZRBA 4IF6A 4Q3LA 5ER6A 4LX8A 5HOQA 2XMQA 2Q45A 1C8BA 4K6MA 3EWAA 3V42A 3RIYA 4DCVA 5A02A 3E0XA 4RD3A 1HPLA 3G5LA 2OUIA 3GMSA 4YCAA 4IR7A 4BX2A 5LMZA 2NZWA 3GJQA 4OBWA 2E3JA 3VSCA 3OZWA 2O3UA 1TKRA 1CQIB 2K2WA 3M6XA 1GUAA 4CTJA 5CMLA 2Y27A 3PUIA 5GONA 3O0TA 5F3RA 5A2QA 3F4KA 1J5PA 3LIIA 1ISIA 3D02A 2GESA 1DLJA 1ZMXA 1ZY2A 1L1EA 1ML4A 1ZN8A 2VP5A 2WHPA 2L19A 3Q7RA 1LVUA 3KAPA 1SVLA 2EP7A 2VPZA 4OIFA 3MZ0A 1M7BA 5FYDA 1DIRA 4CKEB 2PIAA 5B2ZA 1G3RA 5AW9A 3KDPA 4ETNA 4FCWA 3E9QA 1XRRA 3L7LA 4ESHA 1C7ZA 2FNAA 2Y9PB 3K16A 3WBKA 2BGGA 2BCEA 2I78A 1RQGA 2GPTA 1A9RA 3Q3HA 1V3VA 3HBAA 4MHOA 3TG8A 1SBYA 1NYTA 3TMKA 2QT1A 1QFMA 2XMSA 1GRCA 3WV4A 3KYDB 4G8JA 5KTTA 5LIRA 2RJ3A 3HI6A 3OD5A 1EXWA 4X8HA 4BXOA 3HO6A 2EERA 3N74A 4MB2A 4XWOA 1DTSA 4ZVTA 1DHRA 4H17A 4MUKA 2X0JA 5K8TA 5GADl 2RJNA 4M21A 3ZDEA 5JI2E 3A25A 5EZYB 1CZUA 3HPRA 2CLMB 4M38A 4DR4B 4JOQA 3JSAA 4YAGA 5DK6A 3ZQUA 2AFHB 5ALTA 3GEDA 4LZAA 2Q5QA 5AQEA 5B58T 1P2DA 4PFJA 1FYWA 2GH1A 2H2WA 2JFHA 4NESA 5KYWA 1RQ2A 3U1VA 2H2AA 4LDQA 2PAAA 3KOWA 4ZDJA 1G291 2F62A 2KPOA 3L79A 1RD4A 2LBPA 2VJKA 4XJTA 3SK0A 1I2MA 2HB6A 4QT4A 4BV3A 4YAIA 2XTAA 3NM6B 4NMMA 2HHHB 1KQ3A 1RHKA 1KBOA 3QWBA 4G89A 3TG2A 1GXSA 3H11A 1KSJA 2BMWA 4V02A 5L53A 2DPYA 4D56A 5BOVA 3QMMA 4TUYF 5BN4B 2VRBA 5JVDF 1V47A 3EGEA 1KJ9A 4N8SA 2C54A 1X3SA 2NZYA 2JH8A 2VYVA 3GZNA 3ND8A 2ZWVA 3D3JA 1JYFA 2NX2A 4EG8A 4EMTA 4C5BA 4JC8A 5IBPA 5IVHA 4H18A 4FEYA 3M6IA 1JEAA 1PJTA 3QFRA 1W0KD 4PW0A 3NGLA 1AHIA 2YASA 3O2QB 2BE7A 1AC5A 4O2AF 5JO9A 3TSCA 5JPCA 3D8TA 5HQJA 5ILQA 2ZU0C 3TRIA 2QL9A 1YDWA 4L5YA 1JXMA 1VGRA 2FSSA 2EP5A 1DADA 4MWCA 4Q5IA 4W7HA 1C0EA 3AJRA 3DAHA 3MUOA 3BEDA 3NWBA 3UHAA 1UOEA 3SR4A 4BN0A 3NTQA 4WXYB 3TDKA 4O3MA 5F78A 3G59A 1YBFA 2C2GA 3DZ8A 3Q3JB 1MZPA 4R2WA 3FKSA 1DHTA 5TGDA 2I6UA 2VSOA 2QTBA 2F8LA 5KSWB 1L1RA 1H2XA 4MCIA 4Q0MA 1MH9A 4RS3A 4CMIB 3ZVNA 3IKLA 4IJQA 4ZMSA 2UZAA 3RFXA 1V39A 4NNJA 3DTVD 3W2GA 4QAQA 1XTSA 3G5TA 3S0JA 1RXIA 4S1PA 1Q1GA 1HSZA 4PN3A 3J7AC 3QPAA 3BAFA 1TIBA 3R0VA 4WCVA 4WNCA 3QYJA 2DBQA 3VR4A 3B7PA 3LVQE 2IS1A 3T54A 2PS9A 2R97A 1Y6QA 3T3GA 3L6EA 1RHQA 2UYGA 2PNJA 2AW5A 4MYCA 5HILA 4L8GA 3OU7A 4CTKA 4ENTA 2Q1WA 3D0RA 5DH9A 3RVNA 5I3ZA 4ILKA 2PKWA 2MCFA 3JQ6A 3P0IA 4B81A 3KO8A 4YJ3B 1R0LA 5JDIA 2IL1A 1SK9A 3BL5A 3H16A 3SEZA 2ZITA 1KY2A 2I7VA 4FSHA 4Q1DA 2H63A 4K5QA 3RK0A 3ZY2A 4KN8A 4BYGA 3W78A 1XE3A 2GBLA 3SE7A 3ZE6A 4CR6A 1UQUA 1Z13A 2FZCA 4WH0A 4KITB 1SXQA 1LVHA 1NU6A 2ZBEA 4RSGA 1V8FA 1U5BB 3LHSA 3ML1A 4D4KA 3IMCA 3ZBQA 13PKA 4WK0B 1B0UA 4J0FA 2W48A 2GYUA 2ZSIA 5C8XA 5E6RB 5EGSA 4DB4A 1XQVA 1AV7A 3ONVA 4V0OA 3LO8A 1F14A 4J75A 4MEJA 4TTSA 3C3CA 1W5SA 4W63A 4U0JA 4J3FA 3ZWDA 1U2SA 4DARA 4EVSA 3VC1A 4FFVA 1P1HA 4S3MA 3PQ4A 4X8OA 3V2HA 1O03A 4XQ9A 4I2VA 2XDAA 3QXJA 4TXLA 2IT1A 3LP6A 3PHIA 1K7FB 4Q6WA 4OB7A 3U0VA 2O50A 4EBBA 2PFKA 4F2DA 1XU7A 3L43A 5C4GB 2J3LA 3EDCA 1R4MA 4C4RA 2ZYAA 1K8ZB 3Q6MA 3SYRA 3F8WA 9GPBA 3ESYA 4U00A 2DWUA 2P41A 3NVMB 1NR1A 2J3DA 3OCZA 2FFQA 3U4IA 1A8SA 4GLLA 5AM0A 5JSYA 4M0EA 1C30B 2BP7B 4JT8A 4LX0A 3G3EA 3Q5EA 4EGJA 1G8MA 2P35A 2EKBA 5CH3A 3MBIA 1VB5A 1YQUA 4I7EA 1GAEO 1BU5A 4R6XA 2VJAA 4Z86A 1CDZA 3E05A 4RADA 4GEGA 1GOTA 1A5BB 2JIQA 3DR5A 2RAFA 4HDNA 2WE8A 3MD9A 1XTIA 1K27A 4N3BA 4OXNA 4D42A 2E6UX 1JHZA 4W8OA 1HYBA 2D2FA 1I6MA 1XQ6A 2EYQA 3DOFA 5D3ZA 1IIRA 4OI1A 5LL6P 1UBFA 1WSWA 1E99A 3K6RA 4NZOA 4YROA 1OZ0A 5H81A 4N03A 2KX7A 1NP3A 4ZTBA 5FOXA 2YVQA 1QPBA 1J1IA 3CWCA 3AFMA 2J32A 4AICA 1KJWA 4L0QA 4YJFA 4XD2A 5EIHA 4HDQB 4F04A 1GFWA 4Q4CA 2Q0XA 2R8YA 3H1BA 3JQGA 4KQJA 4QFDA 2OWDA 4K6GA 5IM4F 3WMEA 2OVBA 4DG8A 1K3FA 1WOYA 4FZ3A 4R9SA 4V0SA 1UBNA 2JGNA 1MOQA 3EQ2A 5F7JA 5C1OA 4EBFA 3EF0A 3HJNA 3HNRA 2JJ2D 4LOIA 2H2IA 4PPQA 4TV8F 4EMUA 5K0ZA 1I1QB 5H3CA 3FWKA 3VSAA 4CQLB 2ZRMA 5ES3A 1DX4A 1EQ2A 8MHTA 3GCDA 5IRCD 1KMHA 1U6IA 5F76A 4ZYLA 4XUCA 5I7FA 1LV7A 4FDAA 2PO7A 1VLJA 3ONWA 4JLSA 2VQ3A 1IXYA 4BXOB 2Y1DA 4YRBA 1SWWA 3KSUA 1YRAA 5H59A 2EBUA 3ZZMA 3H7AA 1J2RA 1XNGA 2H7XA 3ICWA 1WXXA 2ZAYA 1Q7CA 3CE6A 4L0CA 3OOWA 4CKYA 3WB0A 5FV7A 3JYQA 4ALLA 1DBWA 4D4HA 2WJ6A 1QB8A 2ZR9A 1QPZA 4KGVA 2REBA 5KYWB 2XZLA 4LKOA 2QM7A 4IDGA 1D2HA 1WU8A 2IXGA 3ED5A 3MUFA 4NMLA 4D97A 3ZIDA 1TEVA 2AMLA 2VT3A 4PZ9A 4RSMA 4IIFA 5TMEA 3U7EB 4Y30A 3KQOA 3VRHA 5EAIA 1E6KA 3WTCA 2JFGA 2OB1A 1FU4A 4JLDA 1GXSB 3H11B 3DKIA 5E4YA 2ETVA 4J2OA 3WADA 1WXFA 2YHSA 2XKKA 4RXTA 2O14A 1CRWG 1ESCA 3E1GA 2H07A 5JCJA 1NAIA 2DP4E 1VYHA 3P9XA 4ZO6A 5AM4A 4P98A 5G3ZA 5GGYA 1Z4NA 2V58A 2V45A 1XHFA 3TZHA 5KVVA 3NHKA 4QBKA 3WKAA 3GZNB 3ORSA 4O1IA 4EEKA 1EE2A 3V9PA 1N5KA 1OVGA 4C29A 1D03A 2EBWA 4KL8S 1Z06A 2QN6A 3N7UA 4EL5A 1WPXA 2J3IA 4YR7A 2VWHA 3UM9A 2Y93A 4AJOA 5DYWA 5AT1A 2ST1A 1I7LA 2DJIA 3BWMA 4AQDA 1Q6YA 4NU8X 4P3NA 3LHKA 4PAOA 2HRCA 2CCKA 5FO1A 2P2ZA 1BMQA 4QBFA 3WP1B 3NC1C 3UMSA 4GZLA 1Q84A 4O6VA 2DT8A 2VBIA 4GOJA 1AXRA 4HN2A 1PQ4A 3GJZA 4JJ4A 4DJ5X 1T9ZA 1YKFA 3GNLA 1O8CA 3ZZNA 1LD3A 3M49A 4LXHA 1WBDA 1UBSB 1ENOA 1E62A 2P2SA 4PZPA 4MJ3A 3VNBA 2I7CA 4RXMA 4FZVA 4ARUA 3KTOA 3MRSA 4DMRA 2YUIA 2CXQA 5C32A 2ZRAA 4R7TA 5I7SA 5KYKA 3ZWOA 4HQ6A 3I76A 4BASA 1WNFA 1P4SA 3U3ZA 3NAZA 4TWRA 4ZGGA 2WKWA 3HB5X 4G1FA 3BJRA 3R5JA 4L5AA 4ZYYA 2F4VB 1RXCA 1S9DA 4FBLA 4PZLA 5F2NA 4X84A 2B25A 1ENYA 1KFCB 3UCXA 4YMLA 1GEGA 3HEMA 5DZSA 2BM8A 5LBIA 1FUKA 4OHFA 5TGTA 3DAPA 5DP1A 5T4BA 1IWOA 1GDHA 4URYR 1A76A 1MX5A 1UM9A 2MDTA 2B4AA 2QJWA 2X86A 1GADO 3K0AA 4G5RA 4RJLA 5L9AA 4LWOA 1VFNA 3SPXA 2EGGA 3K0FA 4L51A 2HKIA 2FW6A 2Z09A 2WA1A 3C6QA 4R2KA 3S44A 3ZE8A 2VK8A 3DMDA 2I4IA 3AUAA 3H87A 2JGRA 3RS8A 1TECE 1DQNA 3DOUA 1DQRA 1MAWA 1X2EA 2XEXA 1RJDA 2HQ1A 4JR1A 4N5LA 4LK3A 4BJ3A 2IEAA 1KO5A 1VHLA 2X76A 4IZ6A 5E9AA 3UUFA 4AO7A 1OBHA 1SURA 3GPBA 2H06A 2OCXA 1YT5A 2A88A 3F6CA 1JSRA 1PFYA 2BKAA 3H3JA 4RVNA 1KK2A 1OSNA 1OWMA 1WZIA 4Z1MA 3RM3A 3VHRA 3FHTA 3PJRA 2HN9A 4N3GA 2GUWA 3INRA 3KAKA 3Q10A 3Q3GE 1JR6A 4ZYUA 4V0MA 1T2AA 3WICA 2G1JA 4OSEA 4ACAA 4CIAA 4OK3A 1YR8A 4RA6A 4TRNA 1BD3A 3JD1A 1Q2UA 1WL8A 3UENA 2EL9A 5A4AA 2DG2A 2Z1DA 3QK7A 2XMRA 3CKKA 4A0GA 3S81A 1R4MB 2QMUA 2JBWA 1QQTA 2JAOA 2W90A 3EPJA 4GFDA 1J9GA 4O2RA 4ZREA 3N7TA 1QYWA 3ZW8A 1XZPA 2C94A 2Q99A 4JLPA 1ORDA 2L18A 2PUJA 3PXDA 5LZ9A 2NTJA 2MYPA 1LDYA 4TKMA 5LOVF 3KOOA 2C9DA 1HDIA 1B76A 3QQPA 4B2PA 2G76A 1X74A 4PHCA 5AVUA 3UAWA 1O5OA 1Z2PX 2PX6A 4X97A 1JR3E 1Q50A 4I5EA 4HDNB 2JLYA 2GM4A 3NHLA 1E2EA 4G63A 1C7FA 3LT2A 4A6DA 4Z6KA 1RQRA 3D3EA 3ELYA 5ALIA 2II6A 1VCHA 4W8HA 4FHFA 1T8WA 3A9TA 3RBXA 3MT7A 3RFTA 1FFDA 5GJVC 2EX4A 4MQUA 1ADBA 1CU1A 4CW7A 5EIBD 3EXAA 3E35A 3IUYA 3MAJA 2E9SA 1UEXC 2I66A 3DQZA 1LV8A 3MUNA 1DDIA 1U9JA 4RS4A 5DYYA 3H5TA 2WAOA 1TCCA 3IQXA 4YJFB 3SBXA 2IHUA 1ECFA 1KBQA 1NJFA 4GX5A 3OIYA 3JQGB 4FILA 2VZLA 1O77A 3IUPA 1QZZA 3CG0A 2WKRA 5HS6A 1NSFA 1TFRA 1QAQA 5JMWA 2QY9A 4X60A 3AC0A 2GJ4A 3B6MA 3EUWA 4NPHA 3A9UA 4F2WA 4UHHA 4Q02A 1A4XA 2EG5A 2FN3A 4B3SB 3VPHA 3VDXA 5BNZA 2REOA 3GEEA 3RABA 4GBJA 2QIOA 5CBPA 1KMHB 5CNIA 1TFUA 2RHWA 3RRBA 2QLTA 3H17A 3DGEC 4I6JA 3PUHA 2QSYA 4HBGA 4D80A 3J81k 3ZQ6A 3O8NA 2ZRLA 1VL8A 3DLCA 4ZFNA 1XKQA 2JATA 3N39C 4K3UA 3JQBC 3H97A 4MYTA 3LV8A 2M1ZA 5AOBA 4BO0A 1T43A 2VZ9A 2MYNA 4XWGA 5EMKA 1K92A 3BZUA 4LZZA 1R00A 4TVSA 4IDOA 4JASB 1G6Q1 2ODPA 4PQEA 5FPSA 3ZBTA 4ZQBA 4B0PA 1EKXA 1ANKA 2VTVA 5ARCA 2PD4A 2QTZA 2VAWA 1JWAB 5HFJA 1ACMA 1YQDA 3JVIA 3JZMA 4DV7B 2WF9A 4LJ7A 1FMCA 4PE5B 4Y2RA 4OK6A 1Q0ZA 5MN4A 5TF4A 2Q29A 3KUKA 1WW2A 1TJ3A 1SOVA 2R8RA 721PA 2IU6A 1C1XA 4I19A 4D1YA 2R86A 3G9QA 4CHGA 1YR2A 1JTVA 4YP9A 1A5AB 1E5QA 4B5KA 3BGWA 3IE1A 4CM5A 1PL0A 1QMPA 4TLLB 4J1TA 4P86A 2WQ7A 4FX5A 1QRAA 4V24A 3JD2A 3FDZA 4DBLC 1D6NA 4DE5A 1NSTA 4K7JA 2HT6A 3OM1A 3KYCA 4FTWA 3NV9A 1WD7A 5TDHA 3KXPA 5IJXA 1PLJA 3D0OA 1XG5A 2QVXX 2CLFB 3A6EA 4FX2A 1G66A 1V26A 4I8IA 4AWAA 4EIWA 4B8YA 2Z2ZA 2EU8A 4RVGA 2W37A 4CV0A 1HMYA 5DF1A 3WR5A 2FMHA 4WOJA 2IXDA 2ZRDA 2ZJAA 4NNOA 1ZZEA 4B87A 1L4KA 4R1PA 1K6IA 4XDHA 1J09A 2HWWA 3BHJA 3GCGA 4PZAA 1IAVA 2X2PA 2ZRCA 3WHKA 2ODEA 4WBNA 3TGLA 2H65A 2PH3A 2X5XA 3CRVA 1F51E 3PICA 4WFKA 5IKXA 4M1OA 1DKUA 2H1LA 3DXYA 4MPTA 5AW4A 4GNKA 3MB5A 3EOBI 2AMFA 2QR2A 3NOQA 5IVDA 1VYTA 1XVAA 3HA5A 4FFPA 1YOVA 4LDJA 5K4AA 4IXDA 4LJ8A 1CEYA 4N6GA 2FU5C 3ZWXA 2V1XA 4FNGA 3UJ3X 1SWVA 1TM4E 3NHBA 1Q17A 1J22A 1K7CA 5E6UA 4M46A 1DDGA 2XADA 2XWBF 3DH0A 4Z54A 5FORA 2ZXUA 2RIPA 1OIVA 2OO7A 1L4GA 2A9KA 4R2IA 3T4UA 1Q12A 2AEFA 5DV9A 2CVQA 2RHDA 1XFAA 1PJ3A 1ZZGA 3VZQA 4ERNA 1PT6A 1UM9B 2WKSA 3K0AB 4IZHA 4BFUA 2Q4TA 3IEPA 2A86A 3OF2A 2SBTA 2VWQA 5LBTA 2L0XA 3MGCA 3NOOA 2XT9A 2A5JA 1XAJA 3JQ8A 4KQFA 5K3BA 1LW6E 3ZLVA 5JEDA 2UU9B 1E3EA 1OI2A 5ELXA 2UV8A 2O3JA 3AFHA 2PKQP 4KXXA 3IVCA 2JLQA 1L7XA 3C7AA 3FF1A 3OQ1A 3KOMA 4Y0AA 5JADA 3QVTA 2A58A 4ZI7F 1ZBDA 3JQRA 4PHTA 5FTKA 2CE7A 4G8CA 2OGTA 1KE2A 3TNFA 3DP7A 1C5KA 3GLFA 2W4MA 3B1ZA 3MG9A 3TE7A 4EPXA 3KIPA 3KJFA 4US2R 1VG9B 3VR3D 5AW0A 1EFTA 5CB0A 3AHFA 4C2AA 1M8GA 1W5AA 2C4WA 3GXOA 1XFDA 3FYTA 4RGBA 1CQJA 1VI5A 4BX9A 1L4NA 3IXLA 1PJBA 3DTNA 3G85A 3L93A 4U7PB 3A1EA 2D7DA 4POAA 1E0SA 3EWSA 3DTYA 1RVV1 1W8IA 4A1FA 3AZOA 4LI3X 4RL6A 5FBZA 4FWTA 4YFYA 1FU7A 1U5CA 1YE8A 1NHWA 2ZQZA 3GDFA 4OQFA 4YDRA 3UJ6A 1I01A 4A4DA 1IXRC 2HHCA 3TL2A 4B3JA 1XCMA 1G1MA 2B1GA 5JCXA 2OYCA 4I0WB 2PKXA 2LTAA 1MCZA 1KDPA 4X8LA 4RO0A 4E46A 1B8PA 5DN6D 1GYRA 4DV3B 2QVGA 1QGDA 2FW0A 4HR7A 5KJEA 3L04A 4OQ4A 1H8HD 4MS1A 4ZVRA 3CJQA 2IWRA 2QJRA 2VPPA 1FU8A 2DC1A 4JOBA 5JASA 5CU7A 3EDQA 4JJAA 1GQFA 1RC0A 2BMFA 421PA 1XMOB 3GRCA 3I8SA 4JLAA 1RLTA 2JI8A 3IEKA 3RG2A 3QKSA 1FFSA 2ZSKA 3L7JA 1U7UA 3HDHA 3NO4A 1HE2A 5A3VA 4CN8A 1CJBA 1Y3HA 1SOAA 2GPWA 2VJBA 5AVKA 5KNCA 2PR2A 4NOJA 1ES9A 4QVGA 2WIFA 3HO1A 3V6LA 4IQ8A 1PJ8A 3SFZA 1KDZA 4OJKA 4MI6A 5LYYA 4NXNB 2ZJ2A 1NR7A 1WV0A 4WY8A 1BOOA 1X7DA 3JD0A 4RC9A 4CFYA 3IDAA 3WMFA 3K9NA 3WRXC 2WUGA 3Q1KA 4DTIA 3M6WA 3DD5A 1LSUA 4FNOA 2CXTA 5GOTA 1N9KA 3CSDA 1UOPA 1XQWA 4HHEA 1GU0A 4J90A 1NMQA 1CJVC 4BFTA 3PR3A 5K03A 1MORA 3U81A 5CBPB 4YV1A 1OB2A 1AX9A 2X1VA 1IN4A 1JQEA 5DMXA 2WE7A 1PE0A 1PWXA 2BOVA 1N6HA 4JC4A 5DE3A 3L7MA 5BMVA 2OHHA 4LRTB 2HJHA 4ZI5A 4JL5A 2HLDA 1U0EA 2VT6A 3LQRA 4PPGA 4BLUA 5JCPA 1MG5A 1O3YA 1WKVA 1E2HA 4QWMA 5P21A 4GKKB 3HKCB 2ISQA 2GXQA 3T7KA 5L6LB 1CR2A 4BCBA 5J1SB 2W83A 1A9SA 3BPSA 1NN0A 5LBUA 4E33A 2BFBA 1Z82A 5ALZA 5LM3A 2HQBA 1UINA 1WAMA 1M73E 1QM5A 5DGCA 1JR3D 2ZKLA 5DTMA 3RJZA 1GRQA 1GKUB 1IWBB 1QJCA 2JD0A 4RGVA 5K3SA 5HM8A 4RTNA 4NK5A 4MHTA 3NRBA 3BE6A 2DFNA 2WPDA 1C1XB 2B92A 4NV3A 3A70A 5E7IA 5JS2A 5F1YA 1DGQA 1EFPA 4QVKA 3V80A 5J2TA 2BJVA 3JAWA 4NBKA 5BSUA 2EQAA 1KK3A 1U3GA 1C7RA 3NTOA 2EGUA 3Q7TA 3IE2A 5AVOA 3NLLA 1O87A 1U4NA 4P93A 3FDZB 4G0XA 5JY1A 1OY1A 1XTJA 2MSWA 5LKRA 1ZH0A 3KYCB 1ORRA 1K8XB 3W5SA 1AM4D 2DKOA 2OZVA 4M98A 4PZUA 2HF2A 5KNBH 2UXDB 5L45A 2QU8A 4D9NA 1E5LA 1JQAA 3DO6A 3ELUA 4OH1A 3GRUA 3PF9A 4HYYA 1WSAA 1ZLYA 2JD2A 4YB8A 2O8CB 3KU1A 3E84A 1LY1A 3RODA 1ZOOA 4WBNB 3K0CA 1EWKA 3GJ0A 1NF9A 1RJEA 2J3EA 1G5PA 3OQVA 3IS3A 1QV7A 4ARZA 2HCBA 4DLXA 4YCSA 5L3QB 3ERCA 1ZEMA 1GAWA 1RWXA 1FDRA 4I9GA 2YYYA 1NW7A 1UBMS 3ABIA 3K32A 3LYUA 3OAAA 5HKKD 3IP1A 1YOVB 4MW0A 1E77A 1PNQA 2QAGA 3I5UA 2XSZD 4KWTA 3TSOA 1BN6A 3GFFA 1PZMA 4XCVA 4R8KA 1JALA 5SYNA 4FYIA 2GPJA 3OM9A 4QBIA 4E51A 3CLUC 3BB3A 2ERXA 2FTKE 2ZT7A 4WY2A 5E6UB 4WD3A 3UK6A 3CPSA 4RJTA 4LVUA 1FYEA 5C7IO 3RAJA 2OECA 4OYLA 4RQTA 4ABTA 1ECCA 4KJZA 2JEOA 3PQFA 2JJQA 3I2GA 4YYEA 2A8YA 4EY8A 1PU2A 3C6BA 1PZXA 3ET4A 4Y6GB 2X0FA 1MEOA 2EFJA 1XKLA 3FR7A 2HSGA 3KK0A 3TOCA 3MSXA 5GGXA 4PPFA 3EX7C 4ZCMA 3W9BA 4K28A 5K45A 2HMAA 3TB4A 3JQ8B 4ECAA 1YDGA 4ZVOA 3ZX4A 1BDHA 2QTTA 2HYIC 4WGGA 4Q4LA 5AHKA 5B7QA 3R3JA 1JVBA 4F91B 4R1QA 3G7UA 1UJCA 2O05A 3T0IA 3G2OA 5EJ9A 3U39A 2PD3A 1Q0SA 3LOUA 1LJLA 1XD8A 1OLOA 3Q12A 2JIRA 4OMFG 4W82A 1W49A 1N6KA 3A4IA 4TVKA 3WKBA 3GLFB 1NBOA 2P6RA 4FW8A 3LGXA 2QRPA 3O2NA 4G0OA 1Z6XA 3UPUA 4Z3KA 4DSUA 5IUNC 2IF0A 1KZ1A 1JKXA 3F9IA 2AOVA 3DWIA 3ICCA 1LH0A 3KR0A 2BIFA 1RPTA 1CQJB 2V7UA 2ONYA 2FAXA 2OZPA 3KJGA 5D86A 2AVDA 4QQFA 5DXFA 3T9FA 4Q01A 3WGNA 5BUCA 5ES4B 2PAFA 4G37A 1H2EA 2A3RA 2FZLA 2NO5A 4RY8A 4MQBA 4BEJA 4IIEA 4NARA 2HRZA 5HYVA 1TCUA 2CFTA 5GZ1A 4GRIA 4HWGA 4LRSB 4BLRA 4RGQA 2RONA 2PT9A 3RC9A 3AFIA 1H1LA 2YZ2A 3OUUA 3GVPA 4QXRA 4R2MA 4BFZA 1Y8ZA 2EF1A 4NY1A 3HCPA 4S2EA 4Q9HA 1E9AA 1T0JB 2OAGA 5F5LA 4BBJA 4BPBA 2R48A 4MUNA 1AQYA 1PR5A 1EVYA 2FV8A 2V5AA 2I91A 5JYCA 1TOAA 2JJYA 2GF2A 1QCYA 4OLBA 3GZTB 3KR2A 3QNWA 4MS1B 4MSUA 1NBAA 1H05A 5FOSA 3PNMA 1QVWA 3O3MB 4HXGA 4P4LA 1MVOA 1TM7E 3N8DA 3VDRA 1NONA 1U80A 3ZHZA 3CBQA 1QFJA 2AFHE 2GM3A 2WEKA 1K8RA 2C29D 3QKSB 4J7AA 4PGGA 4R1NA 4N54A 4AUNA 4U0KA 3RYIA 4JA0A 4EGSA 1SNYA 3IO3A 1RRKA 2J5BA 2CXUA 4DA6A 3HYCA 1DIOB 2DWQA 4DR5B 1WE2A 2FF7A 3EIOA 3FPLA 3OTHA 4AZVA 1CQPA 4MINA 2NADA 3LKBA 4KPFC 2I54A 1BXGA 3KHUA 2VK2A 3MCVA 3NBUA 3RIHA 1NMYA 2OVFA 2QRKA 4RV5A 1DRUA 3A7EA 5K3AA 4DB2A 2WJPA 3BGDA 3G2LA 3UN1A 1G4UR 2WHEA 2PX8A 5TVGA 2ZXFA 3DMPA 1E8MA 1EM8A 1TW2A 2FSUA 4US0R 1USKA 1PKEA 1U65A 1EZ1A 4DQ0A 4RFLA 1DBSA 5BYKA 2EJCA 2XPCA 5KYNA 3IAM1 3IGFA 1BGWA 1P7CA 2PHZA 3GD7A 3ITEA 4OJMX 5B1YA 3CVXA 4XIGS 1DJLA 1FDIA 5FNVF 1OZFA 2B61A 5AIAA 5CK4A 4LV8B 5EE9A 3FF4A 3FSJX 3KSZO 3TR5A 3AK4A 5T4FA 3RUCA 3QJGA 2ZSJA 1TF2A 5BMVB 3MCUA 5F7XA 2ZB3A 2VAVA 5EQJB 2H6EA 3RC2A 3H0CA 4G0YA 3RS5A 5BPFA 1YI1A 4OIMA 4UTOA 3AY6A 1JX6A 2JLAA 3UQZA 1A5SB 3AETA 3EJ6A 4GM1A 1Z68A 1E9EA 3SHTA 4OHWA 4JR2A 3P71T 4DRYA 1LNSA 2GZRA 4KRGA 5EQTA 1YS7A 4FXOA 3RBVA 3TAUA 3QFTA 4AZ0A 1LBIA 2G67A 1MIHA 3PD7A 2ZWIA 4GT1A 2YY6A 2BFBB 2Z8ZA 2KHZA 2VBGA 2HREA 4F4DA 1RSZA 2NV6A 1SQFA 2C95A 5FUMA 4CEHA 1IJEA 4ZCLA 1J5EB 1IEXA 1UPXA 3IAHA 3QIVA 3A2LA 2H3EA 4GM4A 1VPLA 4K9NA 4D9KA 4UFOA 5JXWA 1EFPB 1I80A 1OIXA 3IMKA 1FXWA 3A1DA 5J2TB 3FTEA 3BS4A 5CM2Z 4I1UA 1UQTA 3A6ZA 3JAWB 4IG9A 1NXSA 4P36A 2QRJA 2ZJYA 5A0FA 3QHQA 2GEFA 3OLVA 4M89A 4ZAGA 2E4VA 1NXWA 2C0PA 3DSRA 3MPOA 4YAWA 3TQOA 5LXTA 3NNNA 4HJXA 1SELA 4IIYA 4E5SA 2FRDA 5HRUA 3IDSA 1K7YA 1YE3A 1KNQA 3IEXA 3K8OE 5I9TA 4LF5B 1FZTA 1GPAA 3T34A 2J48A 4MVJE 4CL3A 4JAVC 4L5CA 1Q0QA 2JD1A 1U8EA 3N86A 4DLLA 1KYQA 4Q7MB 4RY9A 5D00A 1M2EA 3NOXA 4MQLA 4GMGA 4ZOCA 4KSYA 4YIHA 2JA2A 2OLJA 2BKUA 4X66B 4QPNA 1QORA 2DWOA 1TYCA 2D59A 2IKSA 4HAUA 5JAOA 2RBKA 4ARZB 1EZ4A 3IVRA 3ZDQA 1QP8A 1A7KA 2XNCA 4XSHA 5GOZA 1WTCA 1M6NA 2QAGB 1GCIA 3CRQA 1L6RA 1S4MA 1V2HE 1L5ZA 3GR6A 4A8JC 1SQGA 1Z75A 3T3NA 1GL7A 3JU3A 2H16A 4NENA 1NRJB 2IP1A 3PUYA 3VYWA 4F7DA 2C42A 4KOEC 2C9MA 1LBSA 3E7DA 3HC7A 1N2ZA 4KH1A 3K09A 3B3AA 3KB1A 1NW8A 1I3LA 1TQHA 2EC5A 3C3EA 2PRIA 3DBLA 3MGBA 1L8QA 3X44A 2WTXA 4AN4A 3ZHTA 3OLXA 4ZCIA 2FMFA 1YZFA 2VF7A 5CT5A 3DCJA 2WNIA 4L16A 5EL0A 3S2YA 1H42A 4DUGD 3UEOA 2I22A 1DAEA 4NHOA 4B84A 1M2NA 3CUKA 2GNAA 4LN1A 2XUFA 1WPGA 1SHZA 4L4ZA 2A78A 4IDDA 1Z38A 1Z6QA 1R88A 5LR6A 4ZYTA 2H1RA 4K0KB 4NU6A 4S24A 1SXPA 1XQYA 1J2JA 1MC5A 1JA1A 1T2EA 1A04A 4KGZA 2YW9A 4L4UA 2HF8A 1LDGA 3ABQB 2H5JA 5H83A 2A7QA 3DKVA 3UAOA 4A10A 4CIYA 2GD0A 3WL3A 5H4HA 2JFBA 1NL3A 1RKVA 1NUHA 4YX9A 3COJA 1KVUA 2B9EA 2D5CA 2Q27A 4HH4A 4HP8A 1ADJA 1EGVB 2DCMA 4NDNE 1Q16A 1MZVA 4GVXA 3GGGA 3O5AA 5K8JB 2B6NA 2IELA 1LI7A 3DHWC 2CL7X 3NT5A 1RC8A 3D8RA 5AVQA 1H1LB 1HL7A 2HWUA 3F3YA 5CPFA 9MHTA 4MJ7A 4H2DA 3UMFA 2XCQA 3P4UA 4Q3AA 5BSHA 2PQ6A 1MGOA 1HNWB 3W3AH 2GM5A 5FTNA 3JQBA 1C14A 1RDFA 1ZSNA 3MB8A 4U2KA 2OBXA 2XA1A 1K08A 1Y1LA 1GARA 3C3JA 4QDOA 4UQPA 1F0PA 2G04A 1QO0D 1DQPA 3OOJA 4CL2A 4PQGA 1QZXA 1EHCA 1GGJA 4Q48A 4C2TA 2INGX 3NBZC 3TRKA 1CD5A 3EWNA 1CIPA 2PA0A 2YYZA 1OXKB 2A35A 3DF7A 1X7HA 2G5CA 4FINA 3E22B 3UY4A 4EJFA 1UIMA 1SG0A 1V6SA 2PRSA 4FFLA 4EENA 1OBVA 3JQFC 1VE5A 3WBFA 2O5EA 4W7SA 1XLWA 4BV8A 1DX9A 1WO8A 4HD8A 5AJTA 1BXGB 1R0SA 1G8YA 1NLMA 1D8AA 4Y67A 4LNHA 4X20A 3N70A 4JZKA 4TUYA 4AF7A 1RE0A 5JVDA 1EM8B 1X0XA 3LCJA 4WOBA 2Y99A 4EUHA 4UAGA 1GA6A 4OO3A 2PXXA 3MAGA 2IPXA 3CV3A 4DEYA 4EYQA 1B15A 2NACA 1G8GA 3X1KA 1XHLA 3AB8A 1BDBA 5F64A 4B6RA 3U7IA 3JAKA 4BWFB 5FA5A 4MDEA 4Y18A 2I7DA 2YV2A 2BGRA 1RHUA 1J33A 3TL6A 1ZINA 2F17A 3DT8A 4O2AA 2F3UA 1P0IA 4KRFA 4F8YA 3R40A 2C8VA 2Q5CA 4TMYA 4KR9A 1HT1E 1KSHA 1KVTA 3DYVA 1HK7A 5KI6A 2GILA 4G1MB 1MO4A 4KLZA 4A9AA 5I7WA 1J8MF 1IPHA 1ZNXA 1X1TA 1F2VA 2I1LA 3AETB 4MLZA 3CVJA 3DC2A 4RHUA 4RESA 1VB3A 2IODA 2XT6A 3O90A 3TW4A 2J31A 1KDYA 3QYFA 1BYIA 3UAYA 4AZ0B 5CCBA 5EN4A 2ATIA 3T4PA 1N2XA 3ZNQA 3TDNA 3R7LA 3FLMA 5DHSA 3MLAA 3F7MA 4NK4A 2AMYA 3H18A 1PW5A 1ZJWA 5ED0A 4CEHB 4QASA 3SHFA 4HS9A 2ISSD 1JL3A 4AECA 2PZBA 3F67A 3AF3A 2EBFX 4P3XA 2G70A 2QJOA 3R3ZA 3A37A 2ZU6A 3M3PA 3DCIA 4BNZA 1QUFA 1MP0A 1N7GA 1VRVA 4F84A 1NOIA 1S2IA 4H16A 3SEQA 1RMQA 2QPTA 5G4KA 3C1OA 2QVCA 3CBGA 1T6XA 4FOTA 2HFJA 5EPEA 3BHNA 4OM8A 5LXTB 5A3QA 1KI8A 1H9BA 4L4XA 1K5PA 2ZPAA 1Y5NA 3AINA 2ZYVX 1YRHA 1E5TA 1H6DA 3JASA 3K6JA 3L07A 1U2DA 1C3JA 4YASA 5GP1A 3T3HA 2A14A 1VPTA 4BS9A 4DIUA 1S01A 4QUEA 3T1YB 1EH5A 1R15A 2VP9A 3ROKA 4DLRA 5JNWA 3CH7A 4MKHA 3Q98A 4X7MA 1LDBA 3RVRA 3T0GA 4RFSA 4S12A 1RNLA 4NH4A 2WJZB 2QR5A 4OKNA 1KK1A 4IIDA 3CZCA 4HZIA 1W5TA 4AZWA 4GS5A 1KEUA 1DAFA 4PC1A 2F1KA 4ZHQF 3D8NA 3IH5A 1YDFA 2HXSA 3PNOA 1RXEA 1YJCA 2VDVE 3I9NA 1KK0A 1AF7A 2LIPA 2R7LA 3N07A 4DT1A 1MDBA 2YJ3A 3L40A 5TQ0A 3GT4A 1Z5VA 2AL7A 4C4PA 5ICEA 4PSKA 4EA9A 3EDRA 4Q7JB 1OI4A 1LKZA 4CGYA 4W5RA 1F6WA 4RE5A 2ZSEA 2RK6A 1XVTA 3HBLA 4NENB 4G26A 1XGKA 2WF5A 4UMFA 5DI3A 2ZUCA 4JB0A 3WP0A 1JJIA 3LC0A 3LPMA 1BE6A 3RFVA 4KQXA 3RASA 5L4LA 3K9WA 4CMGA 2CWDA 1GQQA 1TF7A 2FWIA 2A67A 2FHPA 2QLMA 4HNRA 4KYTA 2V0NA 3DBLB 1FRVA 1T36A 2AR9A 2GVZC 1SXJA 2AA3A 1XZNA 1UBRS 4OMDA 4L07A 4LGVA 4CE6A 1Z2EA 1EDBA 1YZYA 3W8EA 4JI0B 1P31A 3FGNA 4A91A 4HX9A 2W70A 5IULC 3QPCA 2GZ2A 5L7YA 5BNWA 3I9V1 2D54A 3FUCA 3HSKA 5EFOA 4BNDA 2WIDA 1OT5A 5TQ2A 2J9XB 3HU1A 2FJUA 1GIAA 3IILA 3NKLA 3OZCA 5FL7A 1E0AA 4RDCA 2EHDA 1XT6A 3PRYA 3NM5A 5CM8B 3RHFA 5IDQA 4MVJD 3R9IA 1P7YA 1YD7A 3KJEA 1UIRA 1XA3A 3AR9A 5J40A 2OMEA 2JGKA 1OC4A 1WUTA 4QBGB 3L1KA 1RMTA 3M9LA 2VTKA 3NWJA 4E4YA 5EKUA 1P2GA 2ODTX 4UBIA 3RT7A 4J0GA 3TJZA 5IM4A 3D4BA 5E2AA 2ACVA 3U9SA 4C7XA 5GJBA 4X95A 2FR0A 4CDMA 2HCTA 2ZJOA 5IARA 4H35A 2HA6A 2QGNA 2PIDA 4RFVA 4U7HA 3SDSA 4TV8A 5BW6B 1UJ2A 3JWIA 3FUUA 3E23A 1GPKA 4XM0A 2ACWA 1DKNA 2NU9A 2O3QA 2DULA 2PZKA 3Q7EA 3GUHA 1Q21A 3MFYA 2Q5JA 1XTUA 1L0BA 1UDXA 3AOEA 4WHMA 4IL5A 3ELDA 2HSDA 1ODTC 2FQQA 2O2ZA 1KGDA 2HK8A 3GMDA 4HDCA 4BLQA 2JLZA 1O94C 3MMXA 5FFNA 4BKMA 4TYNA 2QNBA 5ESXA 4AJKA 3H1EA 4IZIA 1HQKA 1GTZA 1YACA 2XZTA 1WLSA 3C1AA 3FG9A 3GUYA 1EX1A 1N8NA 2GTPA 3FR8A 4BL5A 1LX6A 4G86A 3I5YA 1NIPA 2HUPA 3JATA 1U0OC 4UOQA 1HNNA 1N57A 1SO8A 1KFKB 1KWKA 4FIDA 3AV3A 4WA8A 3F9CA 3ETGA 4XH9B 2E18A 4LZWA 3TUJC 1Z8FA 4RHYA 3G9ZA 3KQTA 1JI3A 3NNSA 4X20B 3UK1A 5CHEA 3KV1A 3VKGA 1EB9A 1SKMA 4TUYB 2WW8A 1RAAA 1ODCA 3KWFA 5JVDB 2HBZA 2H1WA 2JFNA 3I6BA 3IESA 1CBUA 2Q2NA 2ZUBA 3BXHA 1EBUA 2AUTA 1AVTA 1O0SA 3BMQA 4OF4A 3HK2A 2GBCA 3C7TA 3E2MA 1WP9A 3GXBA 3KVYA 1TO1E 3QF4A 5FUXA 5BURA 4M0PA 1IVNA 5DNUA 5HPYB 4BFVA 2C9YA 5JPDA 1OBOA 3L3BA 3M89A 4P2GA 1IEWA 5KSPA 3W5BA 4JI8B 5JJLA 1CUCA 1OT3A 4QM6A 3SGLA 4BQSA 2GM9A 3AY0A 2RARA 3CEAA 4RH0A 2DH5A 1NZDA 2CF5A 1OAAA 2WJ3A 3PQEA 4O2AB 4Z3DA 1DWOA 1J8VA 4C43A 3UGJA 1KPGA 1YB1A 4L4YA 4UFNA 1DAOA 3VVBA 3VPXA 4YO8A 5CAEB 2VR1A 5DLYA 1J6UA 5FI3A 1UDCA 3NAGA 3STTA 5CJJA 1U0BB 1CULC 1BDIA 5KAMA 1QG0A 2IZ6A 2RC6A 3GAZA 1SG9A 2IRWA 6LDHA 1JI0A 1K98A 1CQWA 4MUIA 1N7JA 3FPKA 1PVVA 1G7CA 3THRA 4PPYA 2ZB4A 5TARA 2FR8C 3F97A 1DIAA 1G59A 1D2RA 2HRQA 3NHPA 1YI0A 2C9CA 1WBJB 5AM5A 1PF7E 1CJCA 5ECWA 2ZZNA 3K5IA 3M1IA 1FFXA 4RELA 4XSGA 1XDGA 2AR0A 1YR6A 1BMFD 1FUUA 2DKFA 1V8ZA 2O2SA 1IONA 2GOYA 2PQMA