2C2MB

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2c2mB00
2C2OB 1BMQB 1SC1B 1RWMB 1PAUB 4JB8B 2CNNB 2XYHB 1ICEB 3SIPB 3IBCB 3KJNB 1RWNB 2HBYB 4ZVPB 3P4UB 1RWWB 3R5JB 4ZVOB 3R7NB 2CJXB 2CNOB 3D6MB 1GFWB 2C1EB 1RWOB 3RJMB 1RHJB 2H5IB 2XYPB 1PYOB 3D6FB 3R6LB 3GJQB 4ZVUB 4ZVQB 1QTNB 3GJTB 2QL5B 2CNKB 1RHQB 2H4YB 2H4WB 2H5JB 2Y0BB 4ZVTB 1I51B 1RHKB 3D6HB 1RWPB 3EDRB 3GJRB 2P2CB 1RWXB 2QLBB 1RHUB 2C2MB 3R7BB 3GJSB 2QLFB 2HBZB 4DCJB 5IC6B 3QNWB 2CJYB 2XZDB 3IBFB 4ZVSB 4DCPB 1F9EB 2HBQB 3EDQB 2H54B 2CDRB 3R7SB 2FQQB 2C2ZB 1I3OB 1RE1B 3KJQB 3P45B 2H65B 2H48B 2C2KB 2CNLB 1NMEB 2QL9B 2Y1LB 4LSZB 2H51B 2HBRB 2QLJB 4DCOB 2XYGB 2QL7B 4ZVRB 1RHRB 1RWKB 1QDUB 3NS7B 2DKOB 1SC4B 2XZTB 5K20B 1RHMB 1SC3B 3R6GB 1RWVB 3KJFB 1IBCB 5IC4B
chains in the Genus database with same CATH superfamily
2WAQD 5KG0A 1RAEB 4EU0A 3J81j 2LCWA 3PO5A 2CKWA 5KFCA 5HMYA 3SCKE 5D0RA 4IFYB 1MN7A 3EVOA 1R7IA 4ZCIA 2EFOA 4LRBA 2FGCA 4JI7F 1CS4B 2XEXA 4H4OA 4TN2A 2RDJA 1LW2B 4C8MA 3EE3A 1HNIA 2Y0BB 4ED5A 2F40A 2YPYA 4J90A 2RHQB 3HPOA 4QW9A 4E0DA 4C48A 4DJBA 2I38A 3GJSB 2NPFA 2YKAA 3K5MA 1JLQA 3HMJG 2F9JA 3M8YA 1S97A 3KLGA 4MMOA 3TAPA 4RNOA 1JXEA 1KWMA 1TZ0A 2YVSA 1SVDA 2DB1A 3KTQA 2AT1B 1C4AA 3DMJB 1CJKB 3PHEA 1VQYA 4B3SJ 2CYYA 2DCUB 1N36J 3HHLC 1S9EB 3NCQA 4WCEQ 2LEAA 2FLNA 5L1KA 3CIZA 2FD2A 4CCHA 3M32A 4LR7A 3CC7S 3C15B 4F4WA 2LXIA 2IM0A 3MCOA 4RWXA 3VQSA 2VPXB 2LQJA 4R0EA 3THPA 2J0WA 2VBXA 7FD1A 3B8HA 2LDYA 3CB4A 4MK9A 1C1BB 5DG9A 4EMDA 3RRHA 4O44A 3LGNA 1KVJA 5KFBA 1FRMA 3IR7B 4BS2A 2VONA 3AODA 1U1MA 1EHWA 3WIVA 2GO8A 3IR5B 5H9EJ 4U8VA 1FXRA 3D28A 2K1RB 2WK4A 2FZCB 1Q0NA 3AQOA 3VVTA 2Y1LB 5CXTA 1FHTA 1VHFA 5CYMB 4K2XA 4F4YA 3NGDA 2IA0A 2IJFA 2LP4A 4CTAB 1KR4A 2NQPA 4DQPA 2HFZA 4RLEA 3G4SS 2L9WA 4LSNA 2GHVC 2ZBCA 3GSIA 2UVUA 3KJNB 2Y1IA 2JNJA 2OD6A 5JVHQ 4F50A 3J7YI 4DL4A 1YK9A 2FC8A 4DR2F 4TU9A 5DDRC 2KO1A 3M2UB 2ZH8A 1RAAB 2KYZA 4IG0A 1Q95G 3HT3A 3Q0AA 3BO4A 2NSBA 3OBIA 3MTKA 1C0TA 2E1PA 4FDFA 2D74B 5DZ7A 3TARA 5L39A 3RGIA 4FXVA 4RWWA 1TL5A 1VDHA 4ZIWA 1WEYA 4B9SA 2OPPB 2FHJD 5F3ZA 2CQCA 1QAJA 2D3O1 4MTPA 2J8AA 1BQNA 2IM2A 3OHAA 3TRGA 3TQEA 4DV4J 3U27A 2C28A 1AB8A 2EPIA 4TNOA 4DV7J 4HACA 1KP6A 2C42A 1RGVA 1Q8IA 1VQKS 2LECA 4QIVA 1GT8A 3KLIA 1HYSA 4PCQA 2P8IA 5GAEI 4J9LA 3PR5B 1FVSA 1WG4A 2D41A 4DHVA 2R8JA 2CJ9A 3R9LA 2GZOA 2VKRA 4IDKB 4N8NA 2BE2A 3BPDA 2MB0B 3RZAA 3M2VA 1WWHA 3R5CA 1FKAF 2HGNA 3FMWA 1S9GA 1PBUA 4Q2MA 3NBPA 3I31A 3B78A 4G65A 1SV5A 2R7WA 2CXEA 3DU6A 3R5DA 1WC6A 5BYRA 1ELOA 3MEGA 1S0MA 4C3KA 2Z2MA 1E6YA 2IMOA 2CQHA 3MDFA 3WDOA 3K89A 2XMVA 4ZN3A 4CZCA 1TFWA 5HVGA 3FSIA 1GK8A 1IKXA 2DNMA 4O0IA 3DLKB 2PFDA 1B4SA 2WOMA 3AOBA 1RHRB 3HVTB 3R6GB 3NAHA 4ECWA 4OX7A 4FPIA 4O3QA 3OL6A 2MGZA 3ILIA 3BREA 5B0FA 1FJGJ 4EYIB 1XBWA 3AD8C 4CLFA 1QD1A 2ASLA 2V6AA 2ZZNA 4YMEA 3TEHB 1M1GA 2BJ9A 3Q23A 1F60B 3UE2A 3IG1B 2YY3A 1N5TA 2K7JA 1S99A 1Z2LA 3RB4A 1T9WA 3KLHA 1U1QA 3QAEA 4DQRA 1L3TA 2W9AA 1W26A 2E66A 2RSQA 1MWYA 2HWIA 1KFSA 3FCWA 3QT5A 2ZD1A 3GV5B 3PYDA 1WI8A 3OJUA 4LIWA 2AEMA 5ETOA 5G0RB 1M1HA 2FZKB 4DR1F 4KFBA 1G2EA 3T9NA 3O44A 1U02A 4FYXB 2D3UA 4F2RA 2DNLA 1RAGB 1CS4A 1PJ6A 2CQPA 4IO1A 4DLGA 4QCLA 2XHCA 4DL6A 4DPTA 1I6JA 3OR1B 2BYCA 4CM0A 5DDQC 3RAMA 2UZAA 4QQBA 1HI8A 4L3KA 2BV3A 4JI3J 5KFEA 4ECUA 2X7IA 5IM0B 2VBZA 2XZTB 4A8SA 4URGA 5IT4A 3P4UB 4NLSA 2K06A 5E3RA 1T9XA 4JB8B 1F9HA 3NG8A 3FZ2A 2DNKA 4I69A 3W2WA 5KFAA 4I0WA 2DR8A 1CJKA 2HIYA 1RADB 5DLGA 5KFWA 2NUHA 4CYUB 1S9EA 2NXJA 4FYWB 1DQ9A 2X3DA 3B6BA 4GC6A 3QATA 1YSJA 1HMVA 3HM9A 1LOUA 4H4MB 1PCAA 4WIIA 4B3MF 3QSIA 3HSGA 5AE1A 3C15A 5F41A 2DITA 4WU3A 7FDRA 3NOCA 3UI3A 3R7BB 2AV5A 2MZTA 3F44A 1NJXA 4Y65A 2X1FA 2HBZB 2VPZB 5G4DA 4M5HA 2N3LA 3KDNA 3MGJA 2KH9A 5A76A 4A8XA 5GAEU 1S7IA 1FRJA 1WJ9A 2FYXA 4DR5J 2CPJA 4ZA1A 2EI5A 4PG8A 4M5LA 4OZ2A 4Y2CA 3UW1A 1YBAA 3BS9A 5KG3A 4YEAA 3CJRA 2BXJA 2YNGA 2MEWA 2DNPA 5M2RA 2GHWA 4MIBA 4AE5A 2ADBA 7AT1B 3RBXA 4KKOB 1N0VC 3VTIA 4HTIA 5CYMA 3QGGA 4F8RA 1R6YA 2DO4A 2ZJQQ 1YJ7A 2DTJA 2RRAA 4HL9A 3NP5A 1PSDA 3ZZTA 2W4CA 1QAIA 1OPZA 3BYPA 3POTA 4ZVQB 4ES3A 2KT5A 1R3NA 1TVRB 3FUYA 3TYTA 5F8IA 1RP5A 4OYMA 3OUYA 1VQ6S 5LJ3Y 3I82A 2ROPA 1FDAA 3WIUA 4ANEA 4WYWA 4XK8C 3M2UA 2M3DA 3CJ4A 1SJFA 2KDOA 1LWCB 1VOMA 3M8RA 5J2QB 2LFVA 1RTJB 1TUGB 4QR2A 3CUNA 3KLVA 2OPPA 3BR8A 5B7WA 2KB2A 4Y6IA 1XMQF 2OSQA 1PYTA 3M7VA 3T9ZA 4DR4F 3VAHA 4GRSA 3DFEA 1D3WA 3FBFA 2E29A 4DFMA 4M5IA 2HFUA 1H38A 1SJ4P 3NGSA 3VAGA 4PYAA 1T11A 2DGXA 4Q5VA 2UUCJ 4K2JA 3PXGa 4P71A 4URSA 3IWXA 1RBLA 4JI1J 4K4SA 4ZOSA 4IDKA 4DR6F 2H5JB 4FF1A 4M5GA 2JLFA 4NX9A 2QV6A 5IXUA 1FK9B 4E2FB 2YWWA 1OMSA 3IBWA 4YB7A 3CCRS 2CQ2A 1APSA 1KQGB 1HBMB 4ZN1A 2V8VA 2HRTA 3KJVA 4DSEA 2HNYA 3I5AA 3VZIA 4PPDA 2QEXS 1LV5A 1T03B 4A8QA 2LU1A 3KK1A 1YJWS 3HKZD 2HYIB 2JEGA 2Q3PA 3TZZA 3DLEB 3LH2S 3MM8A 3PZPA 1EARA 1ITPA 2E5LJ 2AU0A 4O4GB 4KBIA 3L95X 3VWSA 2HFOA 5BJRA 3HVTA 3FNNA 1RSCA 1NJIT 2GGPA 3OL7A 3KHGA 1B3TA 3KHLA 3DYAA 3WQPA 1I51B 3C14B 1H98A 4Z7YA 2QO3A 3ENQA 3IG1A 3JB9k 4MK8A 1SB6A 4CO1A 1TKTB 3MAAB 4ZKAA 1VR6A 3GV7B 2MKCA 2W7PA 3QIPB 2DGVA 5F8GA 5GAHI 2E5IA 3D5MA 2H54B 3MMBB 2LEPA 4RL1A 4RPFA 2L9NA 2ABYA 4OYPA 4B9TA 2HHHF 2OP5A 1T02A 4MIWA 4ZVHA 1PKUA 1VQOS 4RW6B 5GAGU 4CO4A 3THVA 3W65A 4GMKA 2O3DA 2BJ7A 3M9OB 3U1MA 3NOGA 4RW9B 3MPUB 3N01A 4IOAQ 2GCFA 2G0IA 1U26A 3RBEA 3SIPB 4GKJF 1T9VA 3Q2SC 3BQ1A 2CZ9A 4BWJA 1FVQA 2ROGA 3I6PA 1RA6A 5KAKA 1NDPA 5IM0A 5KG2A 3VGUA 1RTZA 2ZKUA 2GQ2A 3GJQB 3RBZA 3FEXB 4C6AA 3L09A 1RJJA 4P7TA 4B17A 1BUXA 4E98A 2B4PA 2WHOA 3CCMS 2HHTA 4Y00A 1M5OC 2WB4A 3MF5A 3CD7A 4DSFA 4ZP6A 1FRXA 1N6QA 2UUWA 5KFFA 3ILJA 3T3FA 4UUWA 2YTCA 1VQNS 2CVIA 2V8DA 4H4MA 1DBDA 3PW4A 2PMWA 3H5SA 4OX9J 2FZGB 1UFKA 1XK8A 3NCRA 2BKNA 3BYRA 4IO9Q 3CVKA 4WE1A 2DKOB 5BR8J 4ECSA 3CXCR 2K2PA 1RAIB 3PEJA 2E9RX 1RZMA 4UT4A 2OEMA 4RNMA 4NOHA 4YN3B 2B7CB 2NYIA 2A6MA 4EBEA 4WFYA 1UJ4A 5HJYA 4KHMA 1R0CB 3O1LA 4TXSA 5DJBA 2MZSA 2Q6BA 1S10A 1SJ1A 3NNHA 1HR0F 4KKOA 5BYSA 2NYHA 1TKZB 2ZH1A 2WW8A 2FJAB 1Q8KA 4ZVTB 1D09B 1UZHA 2IVFB 1NK9A 3ENAA 4LF1A 1PG5B 3I56S 1SBRA 2VBYA 4ZLNA 1SL0A 1F5CA 2RMLA 3W9JA 1JLAB 5HP1B 3NEKA 1RBOB 2ZHOA 1IBKJ 1RKJA 4MK7A 1XN9A 3LP1B 3M4XA 2PD1A 2AQ4A 5EDWA 2GVZA 2J9CA 4C3MA 2BOPA 4JYAJ 2W1BA 2B0GA 3MR5A 1NKEA 1SQGA 3HVAA 2CQIA 4P75A 1LWCA 4WZQA 4OYIA 1FWPA 3R2DJ 5E0OA 4C0BA 1FJEB 3KXDA 2WONA 2C2OB 3VAIA 2IHR1 5F0UA 2VA2A 1XMOF 4KTQA 3OTCA 1YZ7A 1UWBA 1RTDB 3GFXA 1U1NA 1CPZA 2MY7A 3LGMA 4RUBA 1HBNB 1MNEA 2DPJA 3JQKA 1Y3KA 3FSYA 1VISA 2JWNA 1N32J 4QWCA 1KKHA 4DV5J 1CLFA 1WHXA 2R2UA 3EDRB 4QW8A 4FPRA 3DOKB 1AXQA 3QJJA 5GAHU 4Z37A 4CO0A 4CH7A 4WKYA 3AFGA 4AL7A 5K8MA 3Q86A 5HROA 5LMNF 2OTLS 3IP0A 3QBCA 4F36A 2AEFA 1FK9A 2EW9A 2DXFA 3W9HA 2XO6A 4K50A 2K8GA 4P2MA 2BJ3A 3GIMA 2EFVA 3AOCA 4YDDB 1BD6A 2ALYB 1RHMB 2MTLA 2E9TA 1RYSA 4DU8A 2NR0A 3ITHA 4LRDA 2RRNA 5LT5A 1WORA 5FDLB 4KSEB 1T03A 4NXMF 5EX3A 1RCXB 2CPIA 1S0NA 2PIIA 3MM6A 5E3CA 3DLEA 2R8HA 2IVMA 1PIEA 1KN6A 1S4FA 3MOZA 4O4GA 3HULA 1TELA 4JV1A 4NYPA 3RYLA 2NXUA 1S0VA 2ERRA 4PG7A 4PG5A 2CFXA 3HSJA 2W4PA 2V2KA 4Z2XA 5F9NA 2QGFB 1OY8A 1JWWA 2A0FB 5C25A 3ICLA 1MMLA 2JRSA 4JI6J 2W2MP 3V4IB 4Y34A 2M7SA 3BM7A 2YX7A 3M6UA 2CADA 3C14A 3FJ2A 2Q1LA 1PBAA 2PDAA 3NGUA 4LSZB 3OXLA 2J7KA 2BACA 3HX9A 5J2MB 3CW2C 4KE5A 5K8PA 1TKTA 3MAAA 4WP3A 4I7FA 2JZ5A 2BQUA 3QZ8A 5M2PA 3MMBA 4ILLA 2XY6A 2AX0A 2XULA 2KG0A 1K9MT 2P6TA 3OR2B 1JJCB 1GMVA 4GKKJ 1HWLA 1GAOA 3H90A 3OFEA 4P9SA 2RQMA 4RW9A 2DGOA 1N5SA 4NLUA 4YR3A 1ZZNA 4J9MA 2JSXA 3A4TA 1U0SA 4X65J 3FBCA 1T9YA 1KBRA 2P2CB 3Q89A 4O3NA 3M8QB 1SC6A 3CCES 1VS3A 2DGTA 1SJRA 2O66A 3N79A 2FLOA 1FE4A 3PKMA 3B54A 3SEOA 3WC2A 3KYLA 1K8AT 3OLBA 3OD2A 3R27A 4LF7J 2M70A 1JQGA 1RAHB 3AD7C 3BB5A 2EG2A 4PWDB 4JV0A 1FDNA 5SZTA 2DR5A 4K5RA 5CD4A 2ZVIA 3CJKB 3PVXA 1P8GA 2BRLA 3V6DB 4JI5F 3ZO7A 1HQ2A 3M8WA 1CQNA 4U7UD 2V8PA 2QIFA 1VRQC 2EC2A 5KFJA 3ONQA 5HANA 3OW2R 2AJQA 2IFXA 1SJ3P 2QA2A 2DISA 1SPBP 1SKRA 3QFWA 4RW7B 2POKA 4ED2A 4DR2J 3T5LA 1UTAA 1FRIA 2AZ1A 4UY8T 2DO0A 2XG8A 2V4QA 5A6WA 1R27B 2U2FA 2KM8C 4WZMA 5L38A 4ZVGA 3A8KA 1TKZA 3UDLA 4DI6A 1CJVB 3HT0A 2GVDB 1D1UA 1U0HA 1RT1A 4A8OA 1WOSA 4R8UB 2ZC4A 4FXWA 3Q83A 3US5A 1ZM2A 4X4SA 2HVZA 2E7WA 3H2VE 1GXLA 1JLAA 1YLXA 3IR6B 5HBMA 2FVCA 3CCQS 2HRUA 4WFZA 2HEKA 2ZM6F 1U2CA 3LUYA 4CLWA 2M8DB 3NWRA 2EVZA 1QSSA 4PUOB 1VBKA 4QU6A 1M0SA 3MM9A 3WZ0A 4LF6J 4LFAF 2DNRA 3EGWB 4DBQA 2LLZA 3QT7A 5AJ3J 4ZLJA 1NHKL 3CJQA 3VHQA 2AGPA 3GSDA 2V4JB 2XQCA 1S48A 2E7XA 1NB2A 3PFOA 3CTRA 2B5JB 2R3VA 2ALZA 4O3OA 2KFYA 3W1YC 3D66A 2A10A 1VQPS 2IDLA 2P9CA 5E7OB 4QR0A 1Q8LA 3S6EA 1Q1KA 1O8BA 4NA2A 5BYQA 3R97A 5MAOA 2AJFE 1JX4A 2VKZG 1WTBA 2L41A 4LR8A 1OQ6A 5A8KB 4K4UA 3GILA 2HHWA 4QYZJ 1DZ5A 1RT2A 1FCAA 4WK3A 3TO8A 3A3PB 4KGKA 5T7LB 3MMCB 1U49A 2DR9A 3J7ZT 3NLCA 1HKAA 1Y00A 3B4DA 2RJZA 4OI2A 3UCGA 3K5LA 3JXOA 3RR7A 2GX8A 3NL0A 2LDIA 4P7VA 2CNNB 4WTOB 1TR0A 4FVCA 2ATLA 2HQCA 4V19X 2OHDA 1EP4A 4OX6A 3RB3A 2F63A 4ANCA 2OPSB 1TL3A 1DQAA 1R8BA 5DO2A 4P6QA 3JAMY 1UJ6A 4ZPWR 2HQFA 4KHRA 4X62F 2UV8A 2MDAA 4CO2A 3ETOA 1Q16B 4AL6A 3UDEA 3NCPA 2MZQA 4JI0J 4OZNA 1RT5A 3L7PA 4NE9C 2R2SA 1OO0B 1S1WA 4X4OA 5KFYA 3ADAC 1YJNS 2AWZA 3MEEA 4NXNJ 4I2PB 2O1PA 1RE1B 4JUZA 1G6BA 1UFLA 4ED1A 1SCJB 2DJWA 1KQSR 1WC1A 3CJ8A 3IGNA 4DS4A 1ZS6A 2CG8A 1RXOB 1UMJA 3V4IA 2AD9A 3GYNA 2JOQA 4DL5A 5IOLA 3SSRA 1IN0A 4FNHA 1RWWB 5J2MA 2MKYA 1UETA 1EAYC 1U1LA 4F0MA 3GMGA 3RTVA 4Q8FA 4L73A 5A6PA 2ZUGA 4BCAA 4HT7A 3ET6A 1Q53A 2KI2A 2GIFA 4YQWA 1P9YA 1FERA 4LFBF 8ATCB 1UAWA 2VU5A 4R5PB 2MQPA 3SFGA 3V81B 1UVKA 5IV4A 4N56A 4CLKA 4NLWA 3ENWA 4AQYF 4IRKA 3LF0A 5B0GA 2FHMA 1JMTA 1EQMA 3LQVA 3V2UC 2QYCA 4J9VA 2G9OA 3R5GA 3MAHA 1DRZA 3M8QA 1LWEB 4LFCF 4DL0C 3JTPA 2MYFA 1K1SA 4QWAA 1AT1B 6FD1A 2HS0A 4D3HA 2I5JA 1MU2A 4UOHA 3KUGA 3P5TL 1HI1A 1N34J 1SC1B 1TTHB 4DSLA 2XYHB 1Y5NB 2VG6A 1UW4A 4CI0B 5KG5A 2V8GA 3MUMP 1L3UA 3A8JA 4J9NA 2BX6A 1PC4A 5I3UB 4ZVFA 4AUKA 2PI4A 2FVQA 1S1TB 3GE9A 1YI2S 3PO4A 1NJWA 4A48A 2CZVC 4NMXA 4OHWA 1F5BA 5AE2A 4V19J 4I6WA 2D3ZA 4OHXA 4ES2A 1QE1B 3VV2B 5IC6B 1HFEL 2QMXA 2FJDB 3VGSA 5KG7A 3EPIA 4DFJA 3GFZA 5HN0A 4ZLPA 4DV3F 4RU2A 3J81Y 2MHEA 3EGZA 1AUSL 4KIAA 4F4AA 3C8YA 2Z57B 2UUBJ 4KO0B 1FFGB 4MKAA 2VFRA 5JUMA 5L8RC 4R25A 3I96A 2EKNA 1SC4B 2EFPA 3P5BP 3GONA 5CH7B 2HRYA 4HI2A 4YHHF 2QX0A 3TVKA 3AJ2A 1XMQJ 3OV7A 4DMZA 4H4KA 3GIKA 2F4VF 4TQRA 1S76D 1GFWB 3HP6A 2IY5B 2VA3A 2CVEA 3MTJA 4EI2A 3ELHA 4MKVA 1RWXB 2ZE2A 2C3PA 3QGHA 4XTTA 2CPHA 1TL7B 1B7FA 5D3GB 4EO8A 1TL4A 2LU2A 2V4JA 4B3TJ 5D78A 4K4WA 2L9DA 1F9FA 5K9FA 4CWBA 1BQMB 1YHQS 5GMEA 2R8KA 1KLNA 3TUJC 2CDRB 2KJWA 3T19A 3EXCX 3D1OA 3GG1A 1HHTP 1C0UB 2F3JA 3QWUA 2QL7B 1ZBTA 1JLGB 2VDIA 5I4MA 1NK4A 3QLHB 5LL6d 2V9WA 4NRTA 4PKDB 1CVJA 5A8KA 3KFWX 1FXDA 1T95A 1WOOA 1OPIA 1RWMB 2ZKTA 2ZH2A 2LMIA 3UNGC 5LSRA 4E8UA 4ICLB 4JI8F 2BE7D 5T41A 3GZ7A 4HH0A 2DNHA 1H73A 4Q8EA 1X4BA 3EXYA 3K5PA 2R42A 1RT6A 5D77A 4IKAA 2P6SA 4OZ0A 4Q0BB 1RHUB 4K4VA 2OPSA 5DLFA 1VRTB 3TUPA 2IVYA 3ZNUA 1NHUA 1SKWA 5DETA 4DX8H 2ZOMA 3UN2A 3BJYA 3Q8UA 4EYHB 1XNRJ 1TAQA 2M8HA 5L1IA 2C2ZB 3M9MB 4LF4J 3CWJA 2C2KB 4LVOP 1FRKA 1OY9A 1NDCA 4ECTA 1WD6A 5J2NB 2B9YA 3H2LA 1Y5IB 3MEDB 1HQEB 3CCJS 2J7WA 3BN4A 1PJ5A 2C3MA 3LPEA 1GMUA 4OHZA 2YPZA 2XY5A 2I2YA 1MLAA 4NRUA 1FRLA 1B99A 3MUVP 2VJUA 4IFVA 1BGXT 1YZ6A 4OLOA 2GC8A 3S7RA 1VRUB 2C1EB 2MZRA 4PWUA 1PILA 2KT3A 3JYTB 1IBMJ 2IYGA 1VBXA 2CNKB 4X64J 3T5JA 3M05A 2V34A 3GJRB 4WXWA 4EZ6A 3EX7B 4G1IA 4PZVA 1DAXA 4PPZA 1WG5A 1WKJA 1UEVA 3G2XA 3KUEA 1H0HB 2RB7A 5HJXA 3RAXA 4F02A 1FWKA 2VG7B 3UD4P 1M5HA 3V81A 3NMAA 5J1PA 3P6YC 3W8PA 4DQQA 1R0BG 4CQ1A 3UD3P 5CZXA 4YDXA 2WVCA 4U95A 5C24B 4JI2F 4KT0C 3VAMA 2DGUA 4EK2A 1JJHA 3W2VB 1S1VA 2CPEA 1SUQA 2EC0A 2VBWA 2F1FA 4IG3B 1HPZB 1GEHA 1ZETA 1PC5A 1XTZA 3EUNA 3SQOP 5LMUF 2CNOB 3SI8A 3HFZB 3GCWP 1ZM3A 3MXHP 3M2RB 3GIRA 4HHUA 2MQMA 1RUSA 2HNZB 2QT7A 2VB6A 2I0XA 4LF8F 4C11B 3MD3A 3U1NA 1NSQA 1UVLA 1VMBA 1RWPB 4FF4A 2AGOA 4LF9F 1YBUA 4M5KA 2OEKA 3GIJA 1WDTA 3PM9A 1E6VA 2Q66A 1LK7A 2CJYB 3D3BJ 2FHOB 4F67A 1XNQF 1I94F 1S1TA 5FJ4A 2IBKA 3HK2A 1KOOA 4HHHA 2BQ3A 4RU9A 5KT5A 2VDHA 2DY1A 2J6UA 1TUVA 2HG4A 2H51B 1QE1A 4EWTA 4J9QA 1WEZA 1RT4A 8AT1B 1LWFB 5HAOA 2CPFA 2HFSA 2UXBF 1BQXA 1A6LA 3PY8A 3MECB 2AYBA 5LXYA 5LOQA 1X5TA 1XC9A 4ZPTR 2L3MA 4F3OA 1VC6A 3DLJA 2ZH7A 3PRVA 1V5IB 2C3YA 3AXMA 2VZ9A 5D4NA 1GXTA 3ZFVA 1XWLA 1UW9A 4LRFA 3TA1A 4C9DA 1H7XA 4ED7A 1D9DA 2EBEA 2G2ZA 3DDIA 1R43A 4Q44A 4DUYJ 4NASA 5LXRA 4DV0J 1K47A 1S1XA 3LA0A 4USIA 1FJ7A 5JXSA 3GG0A 1MG7A 3GYGA 3M30B 2GJFA 2J9DA 3AH6A 2UP1A 2FLPA 4KYZA 4J9SA 2Z2LA 2KHCA 5L1JA 4WXOA 1N0UA 3RRGA 2AZ3A 1S6PB 3W3SA 1Q78A 1MWZA 3D1HA 3T1YF 3OL9A 2U1AA 5D3GA 1XR7A 5D4OA 4CNZA 1NM2A 3NY0A 3CJ5A 2AMCB 1S72S 2Z4PA 3OTOF 1MMNA 3OL8A 3S1TA 1PAUB 1X4FA 2AYEA 3I5CA 5L46A 1TU0B 2V2ZA 5A2QY 2HBYB 1YJVA 1JLGA 3FFIA 2WVFA 4BWMA 3QLHA 2CIMA 1SQFA 4ZPAA 2OPQB 2YKMA 2OJ3A 3MMAB 4ZVUB 3KLFB 3UPFA 3PACA 3MPVA 5A8RB 3PV8A 2PMZD 2CJAA 3MI7X 2JJ4D 4PABA 5CYQB 3HHLA 5KFVA 4O0NA 5KG4A 2D9PA 1D8YA 2JVOA 4YP3A 3C6UB 2KVIA 2W9CB 3IS9A 5LJ5Y 1KTVA 1QSYA 1WG1A 4OV1A 2HHVA 2M9KA 2RU3A 4N5SA 3JQMA 2BM1A 2JEJA 2QZ8A 3IM9A 3CPWR 2YNFA 4IR1A 3W62A 3E51A 4DR7F 1WKKA 2BQRA 4AFFA 4ED4A 5IC4B 4LJMA 2HNDB 4HDGA 3PIOQ 1AFJA 3BZQA 2KTQA 3DDNA 3I55S 3GPAA 2DRDA 4K4TA 2HSEB 3I0SA 2MLZA 1YJUA 2HGMA 3MEDA 4KQZA 2IRYA 3Q8YA 2OLWA 2QLXA 3FEYB 1KD1T 1M5PC 4KH1B 3PJ9A 1NB7A 1IBLJ 2NREA 1X4CA 5K14B 4DQSA 1SKSA 1X9SA 2E5HA 4L74A 3JYTA 1BE4A 3KNAA 1NPKA 3FK4A 2RF2B 1PGZA 1CJUB 5IS2A 1FD8A 4KC5A 2Q6CA 3QRRA 2DCLA 1NZAA 4YB6A 1RAJA 1KVKA 2VJVA 4Q43A 1G7CB 3X1LB 3RB6A 4B3SF 1FKOB 1KLMB 1N36F 1M5VC 5HVFA 2VG7A 1GMWD 2MKJA 3RRKA 1WHYA 1J2VA 1QAYA 4YB5A 3TJ9A 3WHIA 1SL2A 2DYAA 3HD2A 4KR0B 4UTGA 1YWXA 5A0YB 1VQSA 4NLOA 3DRRB 3DOLA 3OPKA 2V69A 4NI2A 3X3UA 1U25A 4IG3A 1HPZA 2BE9B 4K4XA 4U7CA 4NYOA 3V5RA 4B9LA 2YNIB 1S77D 2QC3A 3THTA 4ID8A 4TU7A 3CDUA 3G8SA 4HTJA 5EGYA 5CHCB 3IBFB 2R8IA 2OAUA 2JDJA 3GU0A 4C11A 2XGPA 2QA4G 3ILOA 2IPOB 5M2UA 2Z0GA 2BJ1A 5FLXY 2E9ZA 2MJUA 3A3OB 4IH7A 5KFTA 3DLBA 2OIHA 4YFUA 3HCXA 3ZZ0A 3N28A 5K20B 3L3CA 9RUBA 2KT2A 3K59A 3FDSA 3HVRA 2N7YA 3BPSP 4EUVA 2RNEA 2Y1JA 4ZP8A 3D9BA 2PEHA 3TOQA 4CLTA 2VQEJ 3Q2TC 5IT9U 2R7RA 1SKUB 4RNNA 4OZ3A 1LWFA 1VQ7S 4FVMA 4X84A 2QSWA 2B51A 4CH0S 1HNVA 5KFMA 1QSLA 4TY8A 3MECA 3T1HJ 4FNIA 3DRSB 2IAJB 4Y2MA 1DHMA 4MFBA 4LUBA 1VLYA 3CD6S 4FF3A 1TL1B 1XIQA 5DZ6A 4L75A 3N6NA 4ZK7M 2ZH4A 1T8EA 3D2WA 4DV4F 2FGOA 1NPRA 2C3OA 5GADU 3TAMB 4OI6A 3JTNA 4DV7F 3PX4A 1RWUA 5KFZA 3O8WA 2AJ0A 3U02A 3NGTA 2BOAA 4ZHRA 1U1PA 4WFAQ 5CA5A 2XBPA 4CO5A 4YY3J 1FX4A 2IRUA 1R0AB 4CLUA 3F56A 3GR0A 2C2EA 3EGNA 3BSAA 2KG1A 2WTFA 2DR6A 2FVPA 5DM7Q 3DC2A 1QY7A 3W5ZA 3U7JA 3QO9A 4WFNQ 4DFPA 1ZM9A 2ZNZA 2RU9A 4F3MA 2YKNB 3CJTA 3JS9A 5KFNA 3FEZA 2CJQA 1CQMA 3I9ZA 3TZWA 3DI6B 2BJDA 2CQ3A 3VCDA 5I42B 1WC0A 4CP5A 4M63A 2ZBRA 1RISA 4I2QB 5DDOC 2VFSA 1U1OA 1RK8A 4MKBA 2C2MB 3DN9A 4FBUA 3SQGA 2B9WA 2W2PP 1J5OB 1RLCL 3MD1A 3MMAA 2DHGA 3KLFA 2BEFA 4C8LA 4C0OC 5A8RA 3BKUA 3FBBA 2QJ3A 1WHVA 2W2OP 2YH0A 5CYQA 2PMHA 1RDRA 1URNA 1REGX 5ITHA 4URQU 2HKEA 2G4BA 3C6UA 4KAIA 1KNZA 3IWLA 2BANA 4LMZA 2Y1RI 3PRBA 2J5AA 3SCJE 4OQJA 1FJGF 4ZS6A 1HNZJ 4JOUA 1N48A 1YQHA 1TMJA 1YJRA 4DV6J 2UU9J 4ZPCA 3BBFA 3CJSA 3T6JA 1Q79A 1RT3A 2CQGA 3QRPA 1NRKA 4WYLA 1CC8A 3QJPA 4NLGA 3LP0A 1S4EA 2OSRA 2HWHA 3GLJA 4KV8A 1U6ZA 1EZZB 2KU7A 3SMZA 4DSJA 3MFHA 1YG0A 1W25A 3H5UA 5F8NA 4DG1A 5D0HA 4CIOA 5KT6A 1N5VA 4CM2A 2DIVA 3KK2A 3LP2B 5I3QA 2HZVA 3VAJA 3PR4A 3AQPA 2H65B 1WSRA 1S6QB 1HNXJ 3E2EA 2LQBA 2DHXA 2MQNA 5K14A 4JI3F 3M6WA 2DGSA 3BGOP 2GHPA 4CT8A 3QSYB 1U8SA 1KRPA 4M8LA 3ZZZA 2R7QA 1H3DA 3N6LA 2A1BA 3JSMB 3MM7A 3BBBA 4G3IA 1SH2A 1FNOA 2UUAJ 1BHNA 4ENOA 1N5YB 4YR2A 4BDPA 2CJBA 3K57A 2ZC3A 3HHNB 5LM7E 1FDBA 1HBUB 4J9RA 4Q7AA 4WF9Q 1RAFB 4GVBB 3TI0A 3F73A 5DQIA 3R5AA 1NU4A 2DEJA 4DCJB 2Z58B 1SH3A 2VD3A 2ZNYA 2G1HA 3OTDA 2JFKA 1OY6A 4USKA 4OYWA 4ED0A 4RW4B 4DR5F 1S1UA 4QWBA 2YNIA 4RW8B 2DD8S 2V63A 4OX8A 4DPXA 4L72B 5ETMA 3KLEB 2FJWA 1EETB 4ZJLA 5AT1B 1OSCA 3J80U 3L7UA 1T05A 5KFKA 1DLOB 2HZAA 5ETTA 3R8YA 3OTBA 1TK0A 5D8HB 2G2YA 3HXMA 2FHKA 1HW9A 1H2VZ 3MCNA 3CF5Q 3C19A 2DPIA 3PEHA 1F3VA 4AXIA 1TV6B 2WW4A 3H7HB 4IFYA 4PWWA 1Q86T 3T1AA 1ROFA 4W4MA 1U48A 1GX6A 3UQSA 3EVWA 2QYGA 2W4DA 1LW2A 3VR1A 1KONA 3AJDA 4ELUA 4LR9A 2V9KA 2DNGA 2PO4A 4QYRA 4X66J 1WACA 3PDNA 4WTYA 2ZZMA 3PKYA 1X5PA 2HBQB 1PAEX 2MHNA 2EXUA 2LA4A 3DRSA 2IAJA 3FKBA 3G96A 4QZVB 1ZTWA 3NGKA 1AW0A 3KWMA 4LRAA 4PG6A 2JC0A 3DMJA 3MPDA 1VBYA 5BXIA 4XO0A 1SC3B 2R2TA 3ISND 4JI4J 3IWNC 3AY0A 1RYRA 4B3RJ 3UN5A 2ZUAA 3TJAA 2IIHA 4K0KJ 3E01B 2MPUA 1MWQA 2B6AB 2H1YA 3HJVA 1MROB 4NL5A 3OHBA 5C2GA 2UUCF 1R0AA 3ZZRA 4DUZJ 3KKFA 4LBHA 5DM6Q 4O3SA 2VICA 5GVQA 3FRYA 4IRCA 3HJFA 4DSKA 3RU0A 4JI1F 4ECQA 2OELA 5K8NA 5IQQA 2CA9A 2XTJP 3DXSX 2YKNA 4C4WA 1S0OA 1I1GA 1C1BA 2KXNB 3PYEA 4B9MA 2SXLA 2JEFA 1KOHA 3DI6A 1UPPA 4DV1J 5E41A 5I42A 1KQFB 4DCPB 2RDDA 5RUBA 4HDHA 3DRXA 3CE8A 3C16B 2CQ4A 4I2QA 3VALA 3DLLQ 1RT7B 3H25A 5GAGI 5HVHA 3A13A 4DXLA 2K1RA 4IH5A 3G8TA 3LANA 1TKXB 2XCPA 2WSFC 5J1EB 4RNHA 4LF5J 5H9FK 1UA0A 2E5LF 4CTAA 4NZ0A 1IKYB 3Q22A 4DF4A 3AAWB 2FIUA 3QFHA 2F9DA 1HHQA 4IR9A 4TU8A 2HLTA 2V5HG 3G8QA 3QT8A 2C2NA 2DRBA 4DX6A 1P9QC 1VLOA 2QA1A 1QVFR 1UFWA 2RIJA 3Q8VA 3M1VB 2EFQA 2D9OA 3HI9A 4QWEA 4P2FA 1CG2A 4DV2J 4H54A 3EM1A 4ZDNA 1RI7A 1TMMA 4RNFA 1VQMS 1S9FA 2AHOB 3G6VA 1IKVB 2IM3A 4ZCMA 1L5UA 2V2VA 3IC1A 4XIUA 2J0QD 3SSQA 2R9LA 2AYGA 5HSPA 1Y5LB 3FZBA 4N47A 2MSSA 3C66A 1P1LA 4OI1A 3CDBA 3I4PA 3LALA 2KVQE 3OVAA 2XMAA 2QLJB 2CQ0A 3EWGA 1GTHA 2KM8B 3KOAA 1NK6A 2KKHA 5IT9Y 2ZZTA 4WKRA 1KTQA 2CQ1A 4ED3A 1EB0A 2KJVA 2FDNA 4DS5A 3ZTQA 1Q4RA 2XI3A 3R1LA 4OJ3A 3M32B 3HO1A 2GMHA 2HQ3A 1HBOB 2CQBA 3SV4A 3OTEA 4USTA 1SH0A 1X9WA 3HDSA 2J8SA 2P5VA 2MZ1A 3HF5A 4GC7A 4NZ7A 2N7CA 1HL6A 1R8HA 5SUHA 4OHYA 2RS8A 1ZPVA 4X4VA 4O44B 1K0VA 1L3VA 1N5YA 4DQIA 4A8YA 2FHJA 5LSOA 1LQ9A 3CCTA 1GXUA 1HWKA 1UJ5A 1HBUA 4U8YA 4UQTA 2DXDA 2AP6A 3PIPQ 4OZ5A 5KFDA 1SIWB 4OX9F 2EWHA 4JV5J 2BABA 3DLKA 2ZBIA 4USJC 5J1NA 4K4ZA 3IGVA 5BR8F 4LSNB 1LK5A 4J9OA 4NLYA 4RW4A 1X5OA 2ZH5A 3DXBA 2OFGX 4RW8A 1TK8A 4W98A 1EETA 4I6AA 1WOPA 4MJKA 3AJ1A 3CT9A 4O3RA 2UXDJ 1FA0A 4CT9A 4C98A 3TA2A 3O2IA 4NYZA 2AKWB 2LXUA 1N33J 2JX2A 2DNZA 2KZZA 4USVA 4Y2AA 3LW5C 3QWPA 3S8SA 3FQKA 5DGBA 1TV6A 1NLKL 2MZJA 3ZC4A 5K5MA 5G0RA 1BQNB 2W7AA 2YKPA 1GNKA 1DQ8A 5EHHA 1MSWD 3WX8A 3BDPA 3P49B 4HACB 4DN9A 1IBKF 4RBVA 1IQZA 1HARA 4AD6A 1REVB 1N54B 1WELA 4JYAF 1HYSB 1UVJA 2HFNA 4K8RA 1XEZA 3OR1A 3ILLA 4OV6A 2AF6A 2K3KA 1Y10A 1FESA 2UXCF 2XI2A 2NZCA 3IFEA 1BMQB 4K59A 2BE2B 5KG6A 5DRKA 3BO3A 5DGAA 1DTTB 5B08A 2QFIA 3GR1A 4YUDA 2G1DA 3NBPB 2RUSA 4HKQA 1PJ7A 1BC6A 4ECVA 2ACYA 3P8BB 3A3NB 3OTOJ 3D1QA 3MEGB 2K3IA 2KL8A 3JAMU 3QMQA 4CYUA 2VOOA 2PA3A 2BZ2A 1E6YB 1N32F 3EZ5A 2KFZA 1H6KX 4DL7A 3E01A 2ZHBA 4GO5X 4DV5F 2RS2A 4WPAA 1MROA 4NCGB 3G71S 2EG1A 4ZPBA 3PJXA 2E1CA 4OZ1A 5C42B 1XMBA 2MSTA 1WF0A 5B0BA 1IKXB 4IOCQ 5IWAJ 3SCIE 3OSPA 5ADZA 1CSJA 2CPZA 4ETZA 1TUWA 5JJBA 2G0CA 2MKSA 2WOMB 4O3PA 4WJBA 3LWLA 3DGPB 3LAKA 4ZVRB 4PQAA 1HNWJ 1VK8A 2VASA 2YNHB 3D7SB 3A8EA 2HLUA 4KHPJ 5HL7Q 2MGZB 4TYBA 2OH2A 3D54A 2XZWA 1RT7A 5KFGA 1Y9OA 2NPIA 1Y3JA 3TX8A 1TKXA 3VQTA 3DU5A 2CJXB 3KLHB 5J1EA 2FJVA 2HMIB 4ELTA 5F8HA 2NXNA 1DTQB 1IKYA 3OFFA 2ZD1B 4NEYA 3KHRA 3BN7A 3BSNA 1TVRA 2FJEB 4KFBB 3LO3A 2DK2A 3K2YA 4LSLB 3MM5B 3TJ8A 4F2SA 3K58A 3M1VA 4JI6F 3M8ZA 5DDPC 4ANDA 3J80Y 1KDNA 1GH8A 5J2QA 1RTJA 4EO6A 1S6OA 3KMSA 1S59A 1FE0A 4J9KA 2RT3A 4I56A 2FJBB 1V6HA 4IYQA 4DEZA 4X4TA 1IKVA 4J9UE 1TQLA 3CIMA 2AYMA 4RR5A 3IXQA 3IRWP 3W2WB 2DY9A 4I64A 2MY8A 1RWNB 2ZH9A 4NCBA 2VQFJ 3W60A 3KG4A 4GKKF 3IMQJ 2XCAA 5CAAA 4ED8A 3RUBL 5THWA 5ETPA 1HMVB 2GAGC 1YRXA 1TKDA 3J7AN 1NKCA 2O67A 1KSPA 4X65F 3UCUP 4DX7A 3NXZA 1HBOA 2F5GA 1Q5YA 2KFNA 1NK8A 2WB1D 2B43A 1HBMA 3V6HA 2R7VA 1X4AA 3J81U 2X1BA 4LF7F 5KFSA 1XERA 2BM0A 2GQCA 3VGVA 2NLWA 2ZBPA 5AXMA 1F1BB 4DPOA 2YNGB 2FVRA 2B8PA 1R8CA 1RTHB 3Q24A 2MQOA 2B4OA 2H3EB 5HMXA 1CC7A 3QJLA 2KN4A 2YWEA 2YXLA 5B0AA 2W2NP 2CAJA 3NNAA 2NZ4A 4J7CA 1RWOB 1X7VA 3POTB 4JI7J 2JHEA 3OUYB 3CULA 4Y2IA 1M1KT 5HO4A 3CCLS 2CPDA 4OJHA 2VOPA 2V0NA 3QZ7A 3CCZA 3OLAA 1IWGA 2DHSA 3MWBA 1LEOA 2IBOA 1JLCB 1YBTA 2DHAA 4F04B 4UF4A 4HH1A 4HI1A 2DVIA 1LKZA 2R7TA 3O6QA 3QIPA 4QJVA 1U6FA 1Z2ZA 3BR9A 3RW6A 1S79A 4WBFA 2XMTA 2B9XA 3OQ2A 4OYOA 1VBZA 2Y3YA 4RW6A 4FF2A 5EWEA 4PYDA 2E44A 1REVA 2W9BB 1NO8A 4A8WA 3LTOA 3K17A 3C46A 4LBPA 4ZMMA 4LF6F 4DDFA 1S6UA 3D0GE 2B7BB 5ETNA 4QOTA 3KK3B 4QR1A 4DZDA 5AJ3F 2P9EA 1RTIB 5IT0A 4QIGA 4S0MA 3H0PA 4ES1A 4OYXA 2ZWPA 2HIQA 5GMKa 2VH7A 3MURP 2GV1A 1UKUA 1S12A 2M2BA 1IJEB 1CULB 1DTTA 5KFLA 4NLPA 1B64A 2A2DA 3AHPA 4ID5B 3DLHA 3ISNC 1QAXA 5JMNA 2V94A 2CZ4A 2BW2A 2DXEA 2N3OA 1FFWB 3GP9A 2VG5B 3NS5A 3AXKA 1N8RT 3KJVB 2HNYB 3SYZA 2N82B 2ATCB 1VQ4S 4FYDA 5KT2A 3AB4B 3KK1B 3MR3A 2G2OA 4NCGA 2HBRB 2DEIA 5C42A 1FWLA 3MM8B 3FBEA 2X1AA 1B7YB 2JL9A 1PO6A 2DIUA 3UO0A 2A2CA 4K4YA 4WP8A 1H7WA 4X4PA 1ICEB 5KFRA 2FJXA 3DGPA 2Z30B 1Y4ZB 3G6ES 4CRJA 2YNHA 4L3NA 1ACMB 2LQ5A 1YVFA 2AX1A 2NUUG 4YR0A 2H5IB 3GTYX 2DR7A 2XYPB 1FT8A 4TVAB 2MLYA 3N4WA 2GGPB 4USUA 3DYAB 3FMBA 3MR2A 4F3QA 3OVSA 3W7BA 2J6TA 1X4EA 4Y0FA 4JI0F 1X0PA 2A3JA 2HMIA 1VJWA 3SBMA 1RU2A 3V6KA 1IKWB 1DTQA 3IN5A 1MW7A 3EJMA 5HP1A 1EQ0A 5IQ6A 1H72C 2ADCA 4NXNF 3LP1A 1VI7A 2V67A 1FD2A 3HFVA 5DS7A 2VUGA 1UP1A 1SI9A 4LSLA 3MM5A 1M5KC 2NSCA 1FI4A 4RJVA 4WP9A 4V1Ak 5CCLA 4LIRA 5KT7A 4UZCA 2XSJB 2YKQA 3PX6A 4C8NA 2XMMA 5HMZA 2KZMA 4ZLLA 2H5EA 1WDDA 4ZVPB 2YBVA 2R7SA 2Q79A 4AT1B 2E1MC 1RTDA 4Z7CA 2ZH3A 1R31A 2DNYA 1B0TA 3TVZA 4Y3CA 3S01A 4UOCA 3J7YU 2ZBQA 1HBNA 1K44A 3BSOA 4F4XA 2MLXA 5B0CA 3CDWA 1RQ0A 5DQGA 2HHQA 1N6QB 1NNDA 2X1GA 2YWFA 3DOKA 4USWA 2YQ3A 3D0IE 1WC5A 1NEEA 3TUIC 4C7QA 2GA7A 1VHIA 3NS6A 3NAIA 3JTOA 3IAS9 3KJQB 2APOA 2FB0A 2Z8QA 2IRXA 5AE3A 1X4GA 4WE1B 4CLYA 3FCVA 2CPYA 3NRBA 4Q45A 3BEGB 2PEBA 1KEKA 1WC4A 1N34F 3LPYA 1EIYB 4C8YA 1R8AA 4OYAA 3FCHA 2E7VA 5FDLA 4NLXA 3ZZUA 2LA6A 4ZJQA 3FGVA 4ZCLA 1HI0P 1UCNA 4P2XA 1RTHA 3TW0A 4J5OA 1NHVA 1RHKB 2XMJA 4DR1J 1X8DA 1SQEA 1V3ZA 3I4HX 5F8MA 1V3RA 2M0GB 5KFUA 1HD0A 4CO3A 2BUNA 2AJ2A 1URRA 3JSYA 2GVZB 2ZWOA 3AT1B 3EDQB 1P6TA 3R7SB 3D6TB 2DGQA 3CO9A 4ITSA 2YQ1A 3HLUA 4TQSA 2UUBF 2XYGB 2NCKL 4OL8A 2XGQA 1J5EF 4Y2KA 2XLJA 1JLCA 2FTRA 3EZOA 2WONB 1FDDA 5KG1A 1ZYQA 3ENVA 2QG9B 1UWBB 5E3AA 5A2QU 4XAKA 1NSKL 3IA0A 2HQIA 2GMLA 3ZTSA 4DL3A 3OR2A 1KHVA 2ZEJA 3QPIA 2RQKA 1WC3A 2W9BA 5EN1A 3RB0A 1VYAA 6FDRA 2RVJA 4B3MJ 3PHTA 2DBBA 1G3OA 4M5NA 3KK3A 3A8IA 1U47A 1F2GA 3HHDA 1RTIA 4RO0A 4FKYA 2OO4A 1KVIA 4B3TF 5HROB 2J76E 5D15A 2WSCC 3A12A 4N76A 1WUUA 5E2QA 1CULA 4I68A 1HWUA 2OFHX 4ILRA 4ID5A 4KH0B 4C3LA 2VC0A 2Q43A 4LRCA 4PWDA 2W7OA 1U2FA 2FPHX 1OSDA 3MPYA 4P72A 3WBZA 1QUPA 3V4MA 2ZITA 2VG5A 3ITHB 4TLQA 3CJKA 1VQ8S 2RQ4A 3V6DA 2ASYA 2D69A 1ZAXA 4PQUB 3QIDA 3MM6B 4GVLA 5E3PA 3R7NB 3CD0A 4G1QB 3KDOA 3O5TB 1Q7YT 2LYVA 3MCMA 1N52B 1RCOB 1U7LA 2F7VA 1RHQB 3W8GA 2XB2D 3CNQP 3I87A 4RW7A 4ER8A 1FEEA 2Y0SD 3JSRA 5C25B 2XS5A 2ZVSA 4KGMA 3SFUA 4NLDA 3ZNJ1 1NZ8A 2KRRA 3ULHA 3QT6A 2BKPA 1XNRF 1CJTB 3B82A 4AXJA 5KFXA 2J7UA 4DLEA 3UR3C 4LF4F 1CJVA 2GVDA 1N88A 1C2PA 4YS2A 2M52A 2WSEC 5CCMA 4R8UA 4DR4J 3C2PA 4I7FB 2MMYA 1LFWA 1IKWA 1SXLA 3R1HA 4B9NA 5L9NA 2HVIA 2C2DA 1NDKA 3ETMA 3AD9C 4ZP7A 3W64A 3CJ3A 3G82B 4PUOA 1UVIA 4JV2A 2VF3A 1OQ3A 2QE5A 2RD5C 1NBEB 2OI2A 2XMKA 4WK1A 3L7OA 1WTFA 2XSJA 4B02A 4XDCA 1IBMF 5GMDA 1HW8A 2OPRB 4X64F 4DR6J 3MZIA 5CQGA 3K5NA 2B5JA 3D6HB 1FNMA 3DRPB 1YJTA 1ZAVA 3OJSA 4B9VA 2I1RA 1TFYA 3EVMA 1D0EA 3FC9A 1NPPA 5MLCV 2DH9A 3TP2A 5F0WA 3Q8PB 5FLXU 1TK5A 1I3OB 4M94A 3BKTA 2F8HA 3F41A 5T7LA 3MMCA 1NK0A 4F4ZA 3EMTA 2IJNA 4KY3A 4LT6A 3BH6B 5LSLA 1HQUB 2XHWA 3PW7A 4OLPA 1Q7LB 3BQ0A 3CCUS 3E3XA 1N56A 2CDQA 5HLFB 2GAHC 4A8MP 2LVWA 1BXNA 2V2QA 3NKYA 3UD5A 4LBIA 3MUTP 3J7A1 4U7UK 3MOJB 4NLQA 3GJTB 1C1CB 1YRUA 4CLLA 2GNKA 4IRDA 2E1RA 2FC9A 4DPUA 3DM2B 5DQHA 2Z2YB 1IVZA 4NPOA 4UOGA 4W92B 4J9PA 2ZH6A 3C3LA 5FIIA 2HS3A 4I6YA 3H59A 2PE8A 1U0HB 2OUGA 3H8YA 1RT1B 4CLZA 4MKYA 2GIQA 2IDEA 4I2PA 2J9EA 2HHHJ 1LFPA 5H9EK 1QTMA 4DCOB 1NK5A 5HBMB 4ZCKA 2KXFA 4XPEA 2VIHA 1ZPWX 3AA8A 4ILMA 1UA1A 2I6WA 2BR0A 2ZOFA 1UPMB 4WU2A 3MM9B 1XJWB 2WZ1A 1SIZA 4NLTA 3TEGA 4GKJJ 3KHHA 2EBGA 2CUYA 4QIWD 2BKOA 4D3GA 4X2BA 2XMWA 3I32A 2UXCJ 3AB2B 2UUTA 4A46A 3AA9A 2GMJA 3RAQA 4DPYA 1C4CA 2FVSA 2QL5B 3OFHA 4P73A 4DUYF 3K8WA 4DV0F 1VGYA 5ETRA 2DH7A 2DT9A 4R5PA 1FFSB 4RUAA 3P96A 1F0XA 3JQJA 3BSCA 4FBTA 5KT3A 4FKXA 1I5OB 1LW0B 3PTWA 1RT2B 2NXEA 1FEHA 4Y28C 3RBDA 3L9ZA 4RX6A 2OD4A 1CBKA 3O3LA 4UOFA 4RZRA 1FF2A 1U1KA 2K7KA 4NWBA 3UR0A 1LWEA 1QVGR 1D9FA 1D9AA 2AEJA 1F3FA 2HVEA 4BC7A 1WF1A 3NWGA 4PXBA 1HWIA 5EUHA 1RU1A 1R89A 1YITS 3N6MA 2DRAA 1HD1A 1EP4B 4O23A 4QWDA 4F0HA 2MJNA 3E8OA 1TL3B 4X4RA 4FZVA 4OJGA 1RB0A 4EZ9A 4USMA 1DURA 4W90B 5CYJA 4R0JA 4EEYA 1T0TV 4U6PA 5I3UA 2I9SA 5HATA 1HR0J 2HK2A 4BBYA 4WFBQ 3HZEA 2RE1A 2IMWP 1RT5B 1JJ2R 4PQUA 2WBRA 2RQCA 2KYXA 2B4UA 1GQEA 4G1QA 4DR3F 4LQ3A 2QLFB 1S1WB 2J0XA 4ECYA 5C2CA 5L9XA 3QNWB 3IM8A 1JKHB 2R7UA 9ATCB 3MEEB 4UUXA 1NUEA 4B3OB 4OIXA 4HVZA 2DH8A 3UWTA 4NCAA 2M5YA 1N4LA 2JC1A 2GJ2A 1OWXA 2XNRA 2QLWA 4I1TA 4KO0A 1QM9A 2M88A 3ZTOA 1QUVA 4KRWA 2YH1A 2MQLA 1CJTA 1XMOJ 5HK4A 3G86A 5ETSA 1L3SA 2XMUA 1JLFB 2IJRA 2JLGA 1JB0C 3OXFA 5EWFA 1YDLA 1FTRA 3A1YG 3ET6B 3GYXB 3I5BA 4KPCA 4MAKA 1VC0A 1Q81T 1IM6A 3G82A 3FVYA 4KGZB 1ZAWA 2QLBB 2VFTA 2JH3A 1IBLF 1XR5A 1FTCA 1QJHA 3IAM9 2XSFA 1TL7A 4UW2A 3MHYA 5EX0A 2OPRA 5LMNJ 1JK9B 1PYSB 4XPCA 1BQMA 2J6SA 1A7GE 3DRPA 2JFDA 4AYBD 1MMDA 2VPYB 1ZTTA 2PT0A 3HFKA 2XS2A 1LWXA 1C0UA 3H2UB 2FY8A 4C2MA 5H9FJ 2QMWA 3SDEB 2I5JB 4X4NA 1MU2B 5E33A 1P1TA 3P3DA 2O01C 3T5HA 4JP8A 3RR8A 4AL5A 1JXVA 2QN6B 4FS1A 4F0KA 3H42A 3CCWA 2VG6B 3K0JA 3V6JA 3ZZPA 4NXMJ 3UNYA 2H9ZA 1JLBB 5IZHA 2YX1A 1JLEB 3NNCA 1HQUA 4ICLA 4LQ9A 3KG1A 4U9RA 4DFKA 1ZZFA 3EZUA 3UFCX 3PX0A 1IWAA 2ZFHA 3SZ2A 2KHDA 4HEA9 5B09A 3DLGB 1NSPA 4QBUA 4ECXA 1IR1A 2EKYA 5HLFA 1RLDA 3QGIA 4Q0BA 2XWYA 4PXEA 3QRQA 2BBEA 1A0OB 5GADI 2CG4A 1VRTA 2RDIA 3D4JA 2UVWA 3BV8A 1C1CA 2J9DE 4B08A 2N4DA 1B0VA 1TP7A 5ETQA 3CD5A 4FXDA 1X5SA 2R2RA 4A8KA 3H4BA 1FX2A 3DM2A 4CNYA 5J2NA 3OT9A 3EICA 4ZVEA 1W2IA 4M5DB 2NS1B 4YOEA 3TANA 2W8KA 1O51A 1HQEA 1X31C 4DZ6A 2R8GA 4K7QA 2HHSA 3CCVS 4F25A 2VQEF 5J2PB 1VQ9S 2OGUA 1LNQA 1IR2A 3VF0B 4I67A 1VRUA 2D7SA 2GW8A 3GFHA 3T1HF 1MN9A 4EGLA 1IXKA 4NZ6A 2F4FA 3PCOB 2ZE2B 1U8WA 1TAUA 1OYDA 5B0EA 1XR6A 3H5XA 1U1RA 1AYEA 3BDEA 1GTEA 3CMES 2LQ9A 1WNEA 1GX5A 2QRRA 3EPGA 3D3CJ 2O5DA 2VV5A 1V3SA 3I0RB 4DWIA 4P52A 2D1CA 4YY3F 4OMFG 1VJQA 1M90T 3CCSS 2CWKA 3W61A 1LW0A 2YWKA 5KOXA 4FS2A 3Q8QB 1ZM4A 1NXIA 5C24A 3TAQA 1B0PA 2UV8G 3W2VA 5U47A 4A47A 4JI5J 1QLNA 2GFFA 2CWXA 1CEZA 3SXLA 4PXCA 1UVNA 3VAFA 4CDIA 1AZSB 1FKPB 2R4FA 4PEOA 3VGTA 1XQIA 1IR0A 5IFMA 2MQ8A 1BY9A 2C3UA 2A6OA 3ZZOA 4RKUC 4RUCA 3M2RA 4IQMA 1RT6B 3BBCA 2CPXA 2HNZA 2HVDA 4ZP9A 2H4WB 4UQGA 3I9V9 3UDVA 3CDEA 2ZOGA 1DY3A 3KG0A 2N4CA 4LREA 3BF4A 3PYGA 3CO0P 4FYYB 4CLPA 2GO9A 2XM3A 2P9GA 2RKIB 1EKRA 3D0HE 3BGLA 4M5JA 1A9NB 1VK3A 2LQ8A 1T3NA 2IA6A 2KXHA 3VAKA 3H40A 1JKHA 3C6TB 3TA0A 1RA7A 4B3OA 1K0TA 2ZM6J 2GIRA 4X4QA 5FD1A 5KTQA 1HLWA 3GWCA 4LFAJ 1HNZF 3L4BC 4IFVB 2QSFA 4O4RA 3HKWA 2YWGA 1OYEA 4DV6F 3Q8RB 2GQQA 3IO1A 2UU9F 2MKIA 2DNNA 2L48A 2HAIA 2D3OR 1NH8A 4KGXB 4N7TA 5KFOA 5IV3A 1EJ7L 1LXJA 2VFVA 3T5KA 2GS8A 3MPWA 4UZBA 1JLFA 1YTYA 4FN5A 4MYUA 4P2SA 4K5SA 3IRXB 1FRHA 1YKWA 4C97A 2LXFA 2AJ1A 4ETXA 3TQ1A 4L6V3 4BHQA 2OMOA 3M30A 3JSBA 3TVYA 3FQLA 2VFUA 1T9TA 4ZPDA 3P45B 1VQLS 1NMEB 5C7PA 1NSAA 1HNXF 1S6PA 3H4DA 3PJWA 1FXLA 3NS7B 4X4UA 1S1VB 1SUQB 1FNXH 3GIIA 2W01A 1RABB 1IBCB 2HHPA 1Y7PA 1YRTA 2XWXA 4LF2A 2B9EA 1VQ5S 1BWVA 2QFJA 3CJ2A 1ULRA 4PAAA 2UUAF 2XNQA 3SDEA 1KQKA 4KJIA 3BH7B 2BJ8A 5D6GA 2OPQA 4X62J 1QTNB 3N0VA 4ALZA 3VVUA 2HK3A 2QA4S 1U09A 3DNCA 3PFEA 2EEYA 1JLBA 1E6VB 2FLLA 1D8ZA 1U4BA 1JLEA 2X51A 1F2HA 4G1PA 5HQMA 2BJEA 4ZIVA 2AW0A 4UY85 2WBMA 3CC2S 2G0JA 1NJYA 1O0PA 2HGLA 1W2BR 1U45A 3MEKA 3MR7A 1UL3A 5F3TA 3MFIA 3DLGA 2W9CA 3KMQA 3OFGA 4LVNP 2VL1A 5DG7A 4IH6A 1RT4B 3DKDA 3DRYA 1O5JA 2RILA 4QU7A 1RACB 3KJFB 5H1SV 2V50A 4IOBA 2B8QA 1JJ4A 4PG4A 3DHWC 4IQXA 2IC3B 5HQLA 2OKQA 4F4KA 3UVJB 2HNDA 2G13A 1SL1A 4MT1A 2PC6A 1UZDA 1J5EJ 3ISZA 4M5DA 4ZJOA 1AROP 2VHGA 1Q5VA 5L1LA 4NLVA 4TLRA 4C8OA 2WVDA 2X3GA 2F8EX 3SV3A 4OFZA 4XDDA 4QPTA 1S1XB 4MH8A 4LFBJ 1WSVA 3HHLD 2PFFB 2AJ4A 1O6XA 2C22A 2EK1A 5J2PA 3TWZA 3TX0A 2V4RA 4X66F 1HIYA 5T14A 4AQYJ 3QYYA 2RAQA 5HQ8A 1FO1A 4QPXA 2RF2A 3BGRB 1WHWA 1CJUA 2AIRB 3CEDA 4OJ1A 4ELVA 2J0SD 2ACMA 3PG9A 4U96A 4LFCJ 1VFJA 4USHA 2OTJS 2PA8D 3K7RA 3TUZC 3J7Z5 2HZCA 1Q8BA 4JI4F 1FKOA 1KLMA 4B3RF 1HHSA 1NAQA 4U67Q 1HA1A 1IM4A 4HLBA 4K0KF 3I0RA 3IBCB 3LAMA 4B9UA 2CRLA 2JLEA 4FP9A 2JEIA 3FFIB 2E5JA 3R5JB 3W66A 1F5AA 4DUZF 4OZLA 2YKMB 2HQDA 3RJMB 3CJ0A 2BA9A 2FY1A 2ILZA 4OI4A 5A0YA 2RH3A 4ATNA 5KFHA 3DRRA 5CD4H 2B4VA 2PSZA 4C8ZA 3D68A 3G87A 3HHLB 2C2RA 1AZSA 1FKPA 2AGQA 4A8FA 4J37A 3DOMB 1Z1ZA 4GO7X 3HHKA 1KS2A 4DV1F 4J91A 3FSXA 1JIHA 3IS9B 3W5YA 3PW5A 4DV3J 3MCSA 2H48B 2GJIA 4RBUA 2YWHA 1S57A 2QL9B 4PR6A 2YNFB 1RWKB 2RUGA 3WC0A 1NKBA 3HHEA 4MIAA 4P74A 4LF5F 1RWVB 2HFVA 5DG8A 2RKIA 2Z2ZA 2IM1A 3UCZP 4YHHJ 1R8PA 1K73T 3G6XA 3TZYA 3M8PB 3G6YA 3I0SB 1GMWA 1UEUA 2UVRA 2F4VJ 4QIEA 3CGIA 2F8MA 5AXLA 2XY7A 2LKZA 4ECRA 3MR6A 4NMLA 3C6TA 1PYOB 2VPWB 2CQDA 1T9UA 4C8KA 5ETKA 4DV2F 2EK6A 4NA1A 2V8HA 2ZJPQ 1YJ9S 3W63A 1DFDA 3WX4A 2VC1A 3RG6A 3KNGA 3BKFA 1TL1A 1S49A 4N77A 2KRBA 3VZHA 4M5MA 1RAOA 4NLRA 1NJZA 3TAMA 5B0DA 4ZPVR 4KGVB 1T7PA 2WRMA 1ZA1B 1AUDA 2OMLA 3IRXA 1X4DA 3PYFA 1Z4UA 3SCLE 2XLIA 3RW7A 3T41A 5CZVA 2JVRA 4PRFA 1N5QA 1YGYA 5A8WB 2ZJRQ 3BO2A 1IJFB 2CJKA 4DN0A 2YX4A 1X60A 3CMAS 4G6VB 1WF2A 1NDLA 2Z56B 4ZVOB 2ZDOA 3ZTPA 2W8LA 4JI8J 3D6MB 4DPWA 1V9OA 4DOZA 1RHJB 4OHVA 5EWGA 3DOLB 1G4CA 4NI2B 3D67A 3ZZYA 1BLUA 5CABA 1J27A 2PI5A 3SSSA 1OIAA 4BLGA 3H5YA 4ED6A 2DGWA 2ASJA 4DU7A 3LOUA 5F8JA 3F0NA 3H20A 4NEZA 3G9CA 4H4KC 1J5OA 1F9EB 2MQQA 3AOAA 2WVEA 2HAFA 2ROEA 2BRKA 2ILYA 4L76A 3DCAA 2Y8WA 4JV5F 4EFAC 4KB7A 2DHHA 4WWSA 1JNRB 1DJ0A 3K8VA 3K5OA 4H4OB 4OYBA 2R7XA 3TR5A 1HNIB 4RBTA 3OXGA 2ZHAA 5I3PA 1UVMA 3M6XA 3PNIA 3R2CJ 2HHUA 2E1AA 1U6BA 1S5ZA 1DARA 3DDKA 4WIQA 1Y11A 4EBCA 4MYTA 2UXDF 1B70B 4Q2LA 2E5GA 1NCLA 4C0HA 1HNVB 4TY8B 1JLQB 3R3TA 1Y0HA 3R6LB 2RHSB 5HI7A 2HHXA 2IC3A 3KLGB 5F9LA 1N33F 3UVJA 4MFBB 3T6BA 3CDAA 1RBAA 3GV8B 5KFQA 4P10A 2W25A 2MXYA 4ZITA 4DUTA 3HSZA 3BGFA 1U2RA 4ZHRB 3LP2A 4N8OA 2RRBA 3QAUA 3W5XA 1S6QA 3ZTRA 3PW2A 3GB0A 1KHWA 3GQCA 1R6VA 4JI2J 3QO9B 1W7WA 2I8EA 3BGRA 4IUFA 2BDPA 5C5JA 1P27B 4OI0A 1VIXA 3H98A 3B4MA 3JSMA 3GCXP 2YKOA 4TKTA 5LMUJ 4YB1P 4ERDA 2QMUB 3ZXWA 1LXNA 4TY9A 1JNZB 1V5VA 4I4BA 1ZA2B 2XLKA 3OSNA 2QTWA 3UDCA 3D6FB 2WVBA 4LF8J 1AA1B 2H4YB 2EFGA 3PW0A 2BVZA 1AFIA 4DL2A 2M4MA 2A18A 3MMJA 1ZOTA 2W2QP 5D0EA 5KFPA 3SQGB 4LF9J 2HW3A 3Q8SB 3LGHA 4DSIA 4GVBA 1H2TZ 1JXLA 3OVBA 3N5BA 4ZVSB 1X4HA 3MAQA 2B3TB 1BWEA 5IWAF 1I94J 1XNQJ 2HVHA 2DNOA 3CSKA 5ETLA 1RKIA 4PXDA 3TNVA 3GFYA 4DR3J 4QYZK 3DOMA 2PGCA 1HNWF 3DHXA 2NXCA 3KLEA 4TYAA 5D0GA 5KFIA 4KHPF 2UXBJ 2BANB 4IG0B 1KC8T 4ECZA 1NH7A 1DLOA 4OZJA 1C0TB 2ASDA 1WKLA 1UWAA 3QQCD 1X0FA 3BGUA 3HZGA 1UEKA 2VODA 5AXNA 4NA3A 5E3QA 3QGPA 2COLA 3HD1A 1RT3B 4QIFA 3NMRA 3BQ2A 4HHJA 1F6TA 2HQGA 2HWTA 5KOWA 3M8PA 4DX5A 1ZH5A 3LP0B 3NGRA 8RUCA 4KV8B 5F8LA 3FRZA 2YQ0A 2EFNA 4FYVB 3KLIB 1L3KA 4HYKA 1T94A 4DG1B 4M95A 2HS4A 2F65A 2L08A 2XZDB 4CLSA 2BW7A 3KK2B 2Y9HA 2V68A 2R7OA 2Y8YA 3R5BA 4EBDA 1H74A 4N41A 2UVVA 1OS5A 3M2VB 1NK7A 3T1YJ 4M1KA 1VIOA 2FUG9 1S9GB 1IQTA 4JBCA 4OYZA 4F26A 1U24A 4OI3A 4BC9A 2MKKA 1SV5B 2XS7A 3EGVA 4DF8A 3CC4S 2BMBA 1HWJA 5AXKA 1H2UX 1Q82T 2ZDPA 1T3OA 3W9IA 3MM7B 3HSDA 2WCXA 1VC5A 1X9MA 4A4JA 2VQFF 5E5NA 1WI6A 4CH1A 3M8SA 2B6AA 3N9UC 3UN3A 3M6VA 1YIJS 1VCTA 2XO7A 4HT5A 5A8WA 3M9NB 2LEBA 1WEXA 3HVWA 5K8OA 2B56A 1FJCA 4HR2A 2HURA 1EX8A 2IYIA 2MKHA 1S7HA 3U1LA 1YX2A 4WFXA 4RUHA 3DGVA 5ETVA 1M5SA 6AT1B 1SJQA 3KUHA 5JVGQ 2HPUA 5HMWA 1EKSA 5D4PA 1S1UB 5KT4A 3C16A 2OEJA 2FQQB 2XC9A 2W24A 2CNLB 3N5FA 1G1XA 3CMQA 2PN6A 1OJ4A 2DNQA 4KPYA 1QDUB 4F7VA 1KFDA 3TZXA 1T05B 3EYZA 1IUJA 5D4LA 1K1QA 4DR7J 3PRDA 3LWMA
chains in the Genus database with same CATH topology
2C2OB 1BMQB 1SC1B 1RWMB 1PAUB 4JB8B 2CNNB 2XYHB 1ICEB 3SIPB 3IBCB 3KJNB 1RWNB 2HBYB 4ZVPB 3P4UB 1RWWB 3R5JB 4ZVOB 3R7NB 2CJXB 2CNOB 3D6MB 1GFWB 2C1EB 1RWOB 3RJMB 1RHJB 2H5IB 2XYPB 1PYOB 3D6FB 3R6LB 3GJQB 4ZVUB 4ZVQB 1QTNB 3GJTB 2QL5B 2CNKB 1RHQB 2H4YB 2H4WB 2H5JB 2Y0BB 4ZVTB 1I51B 1RHKB 3D6HB 1RWPB 3EDRB 3GJRB 2P2CB 1RWXB 2QLBB 1RHUB 2C2MB 3R7BB 3GJSB 2QLFB 2HBZB 4DCJB 5IC6B 3QNWB 2CJYB 2XZDB 3IBFB 4ZVSB 4DCPB 1F9EB 2HBQB 3EDQB 2H54B 2CDRB 3R7SB 2FQQB 2C2ZB 1I3OB 1RE1B 3KJQB 3P45B 2H65B 2H48B 2C2KB 2CNLB 1NMEB 2QL9B 2Y1LB 4LSZB 2H51B 2HBRB 2QLJB 4DCOB 2XYGB 2QL7B 4ZVRB 1RHRB 1RWKB 1QDUB 3NS7B 2DKOB 1SC4B 2XZTB 5K20B 1RHMB 1SC3B 3R6GB 1RWVB 3KJFB 1IBCB 5IC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2O B;  1BMQ B;  1SC1 B;  1RWM B;  1PAU B;  4JB8 B;  2CNN B;  2XYH B;  1ICE B;  3SIP B;  3IBC B;  3KJN B;  1RWN B;  2HBY B;  4ZVP B;  3P4U B;  1RWW B;  3R5J B;  4ZVO B;  3R7N B;  2CJX B;  2CNO B;  3D6M B;  1GFW B;  2C1E B;  1RWO B;  3RJM B;  1RHJ B;  2H5I B;  2XYP B;  1PYO B;  3D6F B;  3R6L B;  3GJQ B;  4ZVU B;  4ZVQ B;  1QTN B;  3GJT B;  2QL5 B;  2CNK B;  1RHQ B;  2H4Y B;  2H4W B;  2H5J B;  2Y0B B;  4ZVT B;  1I51 B;  1RHK B;  3D6H B;  1RWP B;  3EDR B;  3GJR B;  2P2C B;  1RWX B;  2QLB B;  1RHU B;  2C2M B;  3R7B B;  3GJS B;  2QLF B;  2HBZ B;  4DCJ B;  5IC6 B;  3QNW B;  2CJY B;  2XZD B;  3IBF B;  4ZVS B;  4DCP B;  1F9E B;  2HBQ B;  3EDQ B;  2H54 B;  2CDR B;  3R7S B;  2FQQ B;  2C2Z B;  1I3O B;  1RE1 B;  3KJQ B;  3P45 B;  2H65 B;  2H48 B;  2C2K B;  2CNL B;  1NME B;  2QL9 B;  2Y1L B;  4LSZ B;  2H51 B;  2HBR B;  2QLJ B;  4DCO B;  2XYG B;  2QL7 B;  4ZVR B;  1RHR B;  1RWK B;  1QDU B;  3NS7 B;  2DKO B;  1SC4 B;  2XZT B;  5K20 B;  1RHM B;  1SC3 B;  3R6G B;  1RWV B;  3KJF B;  1IBC B;  5IC4 B; 
#chains in the Genus database with same CATH topology
 2WAQ D;  5KG0 A;  1RAE B;  4EU0 A;  3J81 j;  2LCW A;  3PO5 A;  2CKW A;  5KFC A;  5HMY A;  3SCK E;  5D0R A;  4IFY B;  1MN7 A;  3EVO A;  1R7I A;  4ZCI A;  2EFO A;  4LRB A;  2FGC A;  4JI7 F;  1CS4 B;  2XEX A;  4H4O A;  4TN2 A;  2RDJ A;  1LW2 B;  4C8M A;  3EE3 A;  1HNI A;  2Y0B B;  4ED5 A;  2F40 A;  2YPY A;  4J90 A;  2RHQ B;  3HPO A;  4QW9 A;  4E0D A;  4C48 A;  4DJB A;  2I38 A;  3GJS B;  2NPF A;  2YKA A;  3K5M A;  1JLQ A;  3HMJ G;  2F9J A;  3M8Y A;  1S97 A;  3KLG A;  4MMO A;  3TAP A;  4RNO A;  1JXE A;  1KWM A;  1TZ0 A;  2YVS A;  1SVD A;  2DB1 A;  3KTQ A;  2AT1 B;  1C4A A;  3DMJ B;  1CJK B;  3PHE A;  1VQY A;  4B3S J;  2CYY A;  2DCU B;  1N36 J;  3HHL C;  1S9E B;  3NCQ A;  4WCE Q;  2LEA A;  2FLN A;  5L1K A;  3CIZ A;  2FD2 A;  4CCH A;  3M32 A;  4LR7 A;  3CC7 S;  3C15 B;  4F4W A;  2LXI A;  2IM0 A;  3MCO A;  4RWX A;  3VQS A;  2VPX B;  2LQJ A;  4R0E A;  3THP A;  2J0W A;  2VBX A;  7FD1 A;  3B8H A;  2LDY A;  3CB4 A;  4MK9 A;  1C1B B;  5DG9 A;  4EMD A;  3RRH A;  4O44 A;  3LGN A;  1KVJ A;  5KFB A;  1FRM A;  3IR7 B;  4BS2 A;  2VON A;  3AOD A;  1U1M A;  1EHW A;  3WIV A;  2GO8 A;  3IR5 B;  5H9E J;  4U8V A;  1FXR A;  3D28 A;  2K1R B;  2WK4 A;  2FZC B;  1Q0N A;  3AQO A;  3VVT A;  2Y1L B;  5CXT A;  1FHT A;  1VHF A;  5CYM B;  4K2X A;  4F4Y A;  3NGD A;  2IA0 A;  2IJF A;  2LP4 A;  4CTA B;  1KR4 A;  2NQP A;  4DQP A;  2HFZ A;  4RLE A;  3G4S S;  2L9W A;  4LSN A;  2GHV C;  2ZBC A;  3GSI A;  2UVU A;  3KJN B;  2Y1I A;  2JNJ A;  2OD6 A;  5JVH Q;  4F50 A;  3J7Y I;  4DL4 A;  1YK9 A;  2FC8 A;  4DR2 F;  4TU9 A;  5DDR C;  2KO1 A;  3M2U B;  2ZH8 A;  1RAA B;  2KYZ A;  4IG0 A;  1Q95 G;  3HT3 A;  3Q0A A;  3BO4 A;  2NSB A;  3OBI A;  3MTK A;  1C0T A;  2E1P A;  4FDF A;  2D74 B;  5DZ7 A;  3TAR A;  5L39 A;  3RGI A;  4FXV A;  4RWW A;  1TL5 A;  1VDH A;  4ZIW A;  1WEY A;  4B9S A;  2OPP B;  2FHJ D;  5F3Z A;  2CQC A;  1QAJ A;  2D3O 1;  4MTP A;  2J8A A;  1BQN A;  2IM2 A;  3OHA A;  3TRG A;  3TQE A;  4DV4 J;  3U27 A;  2C28 A;  1AB8 A;  2EPI A;  4TNO A;  4DV7 J;  4HAC A;  1KP6 A;  2C42 A;  1RGV A;  1Q8I A;  1VQK S;  2LEC A;  4QIV A;  1GT8 A;  3KLI A;  1HYS A;  4PCQ A;  2P8I A;  5GAE I;  4J9L A;  3PR5 B;  1FVS A;  1WG4 A;  2D41 A;  4DHV A;  2R8J A;  2CJ9 A;  3R9L A;  2GZO A;  2VKR A;  4IDK B;  4N8N A;  2BE2 A;  3BPD A;  2MB0 B;  3RZA A;  3M2V A;  1WWH A;  3R5C A;  1FKA F;  2HGN A;  3FMW A;  1S9G A;  1PBU A;  4Q2M A;  3NBP A;  3I31 A;  3B78 A;  4G65 A;  1SV5 A;  2R7W A;  2CXE A;  3DU6 A;  3R5D A;  1WC6 A;  5BYR A;  1ELO A;  3MEG A;  1S0M A;  4C3K A;  2Z2M A;  1E6Y A;  2IMO A;  2CQH A;  3MDF A;  3WDO A;  3K89 A;  2XMV A;  4ZN3 A;  4CZC A;  1TFW A;  5HVG A;  3FSI A;  1GK8 A;  1IKX A;  2DNM A;  4O0I A;  3DLK B;  2PFD A;  1B4S A;  2WOM A;  3AOB A;  1RHR B;  3HVT B;  3R6G B;  3NAH A;  4ECW A;  4OX7 A;  4FPI A;  4O3Q A;  3OL6 A;  2MGZ A;  3ILI A;  3BRE A;  5B0F A;  1FJG J;  4EYI B;  1XBW A;  3AD8 C;  4CLF A;  1QD1 A;  2ASL A;  2V6A A;  2ZZN A;  4YME A;  3TEH B;  1M1G A;  2BJ9 A;  3Q23 A;  1F60 B;  3UE2 A;  3IG1 B;  2YY3 A;  1N5T A;  2K7J A;  1S99 A;  1Z2L A;  3RB4 A;  1T9W A;  3KLH A;  1U1Q A;  3QAE A;  4DQR A;  1L3T A;  2W9A A;  1W26 A;  2E66 A;  2RSQ A;  1MWY A;  2HWI A;  1KFS A;  3FCW A;  3QT5 A;  2ZD1 A;  3GV5 B;  3PYD A;  1WI8 A;  3OJU A;  4LIW A;  2AEM A;  5ETO A;  5G0R B;  1M1H A;  2FZK B;  4DR1 F;  4KFB A;  1G2E A;  3T9N A;  3O44 A;  1U02 A;  4FYX B;  2D3U A;  4F2R A;  2DNL A;  1RAG B;  1CS4 A;  1PJ6 A;  2CQP A;  4IO1 A;  4DLG A;  4QCL A;  2XHC A;  4DL6 A;  4DPT A;  1I6J A;  3OR1 B;  2BYC A;  4CM0 A;  5DDQ C;  3RAM A;  2UZA A;  4QQB A;  1HI8 A;  4L3K A;  2BV3 A;  4JI3 J;  5KFE A;  4ECU A;  2X7I A;  5IM0 B;  2VBZ A;  2XZT B;  4A8S A;  4URG A;  5IT4 A;  3P4U B;  4NLS A;  2K06 A;  5E3R A;  1T9X A;  4JB8 B;  1F9H A;  3NG8 A;  3FZ2 A;  2DNK A;  4I69 A;  3W2W A;  5KFA A;  4I0W A;  2DR8 A;  1CJK A;  2HIY A;  1RAD B;  5DLG A;  5KFW A;  2NUH A;  4CYU B;  1S9E A;  2NXJ A;  4FYW B;  1DQ9 A;  2X3D A;  3B6B A;  4GC6 A;  3QAT A;  1YSJ A;  1HMV A;  3HM9 A;  1LOU A;  4H4M B;  1PCA A;  4WII A;  4B3M F;  3QSI A;  3HSG A;  5AE1 A;  3C15 A;  5F41 A;  2DIT A;  4WU3 A;  7FDR A;  3NOC A;  3UI3 A;  3R7B B;  2AV5 A;  2MZT A;  3F44 A;  1NJX A;  4Y65 A;  2X1F A;  2HBZ B;  2VPZ B;  5G4D A;  4M5H A;  2N3L A;  3KDN A;  3MGJ A;  2KH9 A;  5A76 A;  4A8X A;  5GAE U;  1S7I A;  1FRJ A;  1WJ9 A;  2FYX A;  4DR5 J;  2CPJ A;  4ZA1 A;  2EI5 A;  4PG8 A;  4M5L A;  4OZ2 A;  4Y2C A;  3UW1 A;  1YBA A;  3BS9 A;  5KG3 A;  4YEA A;  3CJR A;  2BXJ A;  2YNG A;  2MEW A;  2DNP A;  5M2R A;  2GHW A;  4MIB A;  4AE5 A;  2ADB A;  7AT1 B;  3RBX A;  4KKO B;  1N0V C;  3VTI A;  4HTI A;  5CYM A;  3QGG A;  4F8R A;  1R6Y A;  2DO4 A;  2ZJQ Q;  1YJ7 A;  2DTJ A;  2RRA A;  4HL9 A;  3NP5 A;  1PSD A;  3ZZT A;  2W4C A;  1QAI A;  1OPZ A;  3BYP A;  3POT A;  4ZVQ B;  4ES3 A;  2KT5 A;  1R3N A;  1TVR B;  3FUY A;  3TYT A;  5F8I A;  1RP5 A;  4OYM A;  3OUY A;  1VQ6 S;  5LJ3 Y;  3I82 A;  2ROP A;  1FDA A;  3WIU A;  4ANE A;  4WYW A;  4XK8 C;  3M2U A;  2M3D A;  3CJ4 A;  1SJF A;  2KDO A;  1LWC B;  1VOM A;  3M8R A;  5J2Q B;  2LFV A;  1RTJ B;  1TUG B;  4QR2 A;  3CUN A;  3KLV A;  2OPP A;  3BR8 A;  5B7W A;  2KB2 A;  4Y6I A;  1XMQ F;  2OSQ A;  1PYT A;  3M7V A;  3T9Z A;  4DR4 F;  3VAH A;  4GRS A;  3DFE A;  1D3W A;  3FBF A;  2E29 A;  4DFM A;  4M5I A;  2HFU A;  1H38 A;  1SJ4 P;  3NGS A;  3VAG A;  4PYA A;  1T11 A;  2DGX A;  4Q5V A;  2UUC J;  4K2J A;  3PXG a;  4P71 A;  4URS A;  3IWX A;  1RBL A;  4JI1 J;  4K4S A;  4ZOS A;  4IDK A;  4DR6 F;  2H5J B;  4FF1 A;  4M5G A;  2JLF A;  4NX9 A;  2QV6 A;  5IXU A;  1FK9 B;  4E2F B;  2YWW A;  1OMS A;  3IBW A;  4YB7 A;  3CCR S;  2CQ2 A;  1APS A;  1KQG B;  1HBM B;  4ZN1 A;  2V8V A;  2HRT A;  3KJV A;  4DSE A;  2HNY A;  3I5A A;  3VZI A;  4PPD A;  2QEX S;  1LV5 A;  1T03 B;  4A8Q A;  2LU1 A;  3KK1 A;  1YJW S;  3HKZ D;  2HYI B;  2JEG A;  2Q3P A;  3TZZ A;  3DLE B;  3LH2 S;  3MM8 A;  3PZP A;  1EAR A;  1ITP A;  2E5L J;  2AU0 A;  4O4G B;  4KBI A;  3L95 X;  3VWS A;  2HFO A;  5BJR A;  3HVT A;  3FNN A;  1RSC A;  1NJI T;  2GGP A;  3OL7 A;  3KHG A;  1B3T A;  3KHL A;  3DYA A;  3WQP A;  1I51 B;  3C14 B;  1H98 A;  4Z7Y A;  2QO3 A;  3ENQ A;  3IG1 A;  3JB9 k;  4MK8 A;  1SB6 A;  4CO1 A;  1TKT B;  3MAA B;  4ZKA A;  1VR6 A;  3GV7 B;  2MKC A;  2W7P A;  3QIP B;  2DGV A;  5F8G A;  5GAH I;  2E5I A;  3D5M A;  2H54 B;  3MMB B;  2LEP A;  4RL1 A;  4RPF A;  2L9N A;  2ABY A;  4OYP A;  4B9T A;  2HHH F;  2OP5 A;  1T02 A;  4MIW A;  4ZVH A;  1PKU A;  1VQO S;  4RW6 B;  5GAG U;  4CO4 A;  3THV A;  3W65 A;  4GMK A;  2O3D A;  2BJ7 A;  3M9O B;  3U1M A;  3NOG A;  4RW9 B;  3MPU B;  3N01 A;  4IOA Q;  2GCF A;  2G0I A;  1U26 A;  3RBE A;  3SIP B;  4GKJ F;  1T9V A;  3Q2S C;  3BQ1 A;  2CZ9 A;  4BWJ A;  1FVQ A;  2ROG A;  3I6P A;  1RA6 A;  5KAK A;  1NDP A;  5IM0 A;  5KG2 A;  3VGU A;  1RTZ A;  2ZKU A;  2GQ2 A;  3GJQ B;  3RBZ A;  3FEX B;  4C6A A;  3L09 A;  1RJJ A;  4P7T A;  4B17 A;  1BUX A;  4E98 A;  2B4P A;  2WHO A;  3CCM S;  2HHT A;  4Y00 A;  1M5O C;  2WB4 A;  3MF5 A;  3CD7 A;  4DSF A;  4ZP6 A;  1FRX A;  1N6Q A;  2UUW A;  5KFF A;  3ILJ A;  3T3F A;  4UUW A;  2YTC A;  1VQN S;  2CVI A;  2V8D A;  4H4M A;  1DBD A;  3PW4 A;  2PMW A;  3H5S A;  4OX9 J;  2FZG B;  1UFK A;  1XK8 A;  3NCR A;  2BKN A;  3BYR A;  4IO9 Q;  3CVK A;  4WE1 A;  2DKO B;  5BR8 J;  4ECS A;  3CXC R;  2K2P A;  1RAI B;  3PEJ A;  2E9R X;  1RZM A;  4UT4 A;  2OEM A;  4RNM A;  4NOH A;  4YN3 B;  2B7C B;  2NYI A;  2A6M A;  4EBE A;  4WFY A;  1UJ4 A;  5HJY A;  4KHM A;  1R0C B;  3O1L A;  4TXS A;  5DJB A;  2MZS A;  2Q6B A;  1S10 A;  1SJ1 A;  3NNH A;  1HR0 F;  4KKO A;  5BYS A;  2NYH A;  1TKZ B;  2ZH1 A;  2WW8 A;  2FJA B;  1Q8K A;  4ZVT B;  1D09 B;  1UZH A;  2IVF B;  1NK9 A;  3ENA A;  4LF1 A;  1PG5 B;  3I56 S;  1SBR A;  2VBY A;  4ZLN A;  1SL0 A;  1F5C A;  2RML A;  3W9J A;  1JLA B;  5HP1 B;  3NEK A;  1RBO B;  2ZHO A;  1IBK J;  1RKJ A;  4MK7 A;  1XN9 A;  3LP1 B;  3M4X A;  2PD1 A;  2AQ4 A;  5EDW A;  2GVZ A;  2J9C A;  4C3M A;  2BOP A;  4JYA J;  2W1B A;  2B0G A;  3MR5 A;  1NKE A;  1SQG A;  3HVA A;  2CQI A;  4P75 A;  1LWC A;  4WZQ A;  4OYI A;  1FWP A;  3R2D J;  5E0O A;  4C0B A;  1FJE B;  3KXD A;  2WON A;  2C2O B;  3VAI A;  2IHR 1;  5F0U A;  2VA2 A;  1XMO F;  4KTQ A;  3OTC A;  1YZ7 A;  1UWB A;  1RTD B;  3GFX A;  1U1N A;  1CPZ A;  2MY7 A;  3LGM A;  4RUB A;  1HBN B;  1MNE A;  2DPJ A;  3JQK A;  1Y3K A;  3FSY A;  1VIS A;  2JWN A;  1N32 J;  4QWC A;  1KKH A;  4DV5 J;  1CLF A;  1WHX A;  2R2U A;  3EDR B;  4QW8 A;  4FPR A;  3DOK B;  1AXQ A;  3QJJ A;  5GAH U;  4Z37 A;  4CO0 A;  4CH7 A;  4WKY A;  3AFG A;  4AL7 A;  5K8M A;  3Q86 A;  5HRO A;  5LMN F;  2OTL S;  3IP0 A;  3QBC A;  4F36 A;  2AEF A;  1FK9 A;  2EW9 A;  2DXF A;  3W9H A;  2XO6 A;  4K50 A;  2K8G A;  4P2M A;  2BJ3 A;  3GIM A;  2EFV A;  3AOC A;  4YDD B;  1BD6 A;  2ALY B;  1RHM B;  2MTL A;  2E9T A;  1RYS A;  4DU8 A;  2NR0 A;  3ITH A;  4LRD A;  2RRN A;  5LT5 A;  1WOR A;  5FDL B;  4KSE B;  1T03 A;  4NXM F;  5EX3 A;  1RCX B;  2CPI A;  1S0N A;  2PII A;  3MM6 A;  5E3C A;  3DLE A;  2R8H A;  2IVM A;  1PIE A;  1KN6 A;  1S4F A;  3MOZ A;  4O4G A;  3HUL A;  1TEL A;  4JV1 A;  4NYP A;  3RYL A;  2NXU A;  1S0V A;  2ERR A;  4PG7 A;  4PG5 A;  2CFX A;  3HSJ A;  2W4P A;  2V2K A;  4Z2X A;  5F9N A;  2QGF B;  1OY8 A;  1JWW A;  2A0F B;  5C25 A;  3ICL A;  1MML A;  2JRS A;  4JI6 J;  2W2M P;  3V4I B;  4Y34 A;  2M7S A;  3BM7 A;  2YX7 A;  3M6U A;  2CAD A;  3C14 A;  3FJ2 A;  2Q1L A;  1PBA A;  2PDA A;  3NGU A;  4LSZ B;  3OXL A;  2J7K A;  2BAC A;  3HX9 A;  5J2M B;  3CW2 C;  4KE5 A;  5K8P A;  1TKT A;  3MAA A;  4WP3 A;  4I7F A;  2JZ5 A;  2BQU A;  3QZ8 A;  5M2P A;  3MMB A;  4ILL A;  2XY6 A;  2AX0 A;  2XUL A;  2KG0 A;  1K9M T;  2P6T A;  3OR2 B;  1JJC B;  1GMV A;  4GKK J;  1HWL A;  1GAO A;  3H90 A;  3OFE A;  4P9S A;  2RQM A;  4RW9 A;  2DGO A;  1N5S A;  4NLU A;  4YR3 A;  1ZZN A;  4J9M A;  2JSX A;  3A4T A;  1U0S A;  4X65 J;  3FBC A;  1T9Y A;  1KBR A;  2P2C B;  3Q89 A;  4O3N A;  3M8Q B;  1SC6 A;  3CCE S;  1VS3 A;  2DGT A;  1SJR A;  2O66 A;  3N79 A;  2FLO A;  1FE4 A;  3PKM A;  3B54 A;  3SEO A;  3WC2 A;  3KYL A;  1K8A T;  3OLB A;  3OD2 A;  3R27 A;  4LF7 J;  2M70 A;  1JQG A;  1RAH B;  3AD7 C;  3BB5 A;  2EG2 A;  4PWD B;  4JV0 A;  1FDN A;  5SZT A;  2DR5 A;  4K5R A;  5CD4 A;  2ZVI A;  3CJK B;  3PVX A;  1P8G A;  2BRL A;  3V6D B;  4JI5 F;  3ZO7 A;  1HQ2 A;  3M8W A;  1CQN A;  4U7U D;  2V8P A;  2QIF A;  1VRQ C;  2EC2 A;  5KFJ A;  3ONQ A;  5HAN A;  3OW2 R;  2AJQ A;  2IFX A;  1SJ3 P;  2QA2 A;  2DIS A;  1SPB P;  1SKR A;  3QFW A;  4RW7 B;  2POK A;  4ED2 A;  4DR2 J;  3T5L A;  1UTA A;  1FRI A;  2AZ1 A;  4UY8 T;  2DO0 A;  2XG8 A;  2V4Q A;  5A6W A;  1R27 B;  2U2F A;  2KM8 C;  4WZM A;  5L38 A;  4ZVG A;  3A8K A;  1TKZ A;  3UDL A;  4DI6 A;  1CJV B;  3HT0 A;  2GVD B;  1D1U A;  1U0H A;  1RT1 A;  4A8O A;  1WOS A;  4R8U B;  2ZC4 A;  4FXW A;  3Q83 A;  3US5 A;  1ZM2 A;  4X4S A;  2HVZ A;  2E7W A;  3H2V E;  1GXL A;  1JLA A;  1YLX A;  3IR6 B;  5HBM A;  2FVC A;  3CCQ S;  2HRU A;  4WFZ A;  2HEK A;  2ZM6 F;  1U2C A;  3LUY A;  4CLW A;  2M8D B;  3NWR A;  2EVZ A;  1QSS A;  4PUO B;  1VBK A;  4QU6 A;  1M0S A;  3MM9 A;  3WZ0 A;  4LF6 J;  4LFA F;  2DNR A;  3EGW B;  4DBQ A;  2LLZ A;  3QT7 A;  5AJ3 J;  4ZLJ A;  1NHK L;  3CJQ A;  3VHQ A;  2AGP A;  3GSD A;  2V4J B;  2XQC A;  1S48 A;  2E7X A;  1NB2 A;  3PFO A;  3CTR A;  2B5J B;  2R3V A;  2ALZ A;  4O3O A;  2KFY A;  3W1Y C;  3D66 A;  2A10 A;  1VQP S;  2IDL A;  2P9C A;  5E7O B;  4QR0 A;  1Q8L A;  3S6E A;  1Q1K A;  1O8B A;  4NA2 A;  5BYQ A;  3R97 A;  5MAO A;  2AJF E;  1JX4 A;  2VKZ G;  1WTB A;  2L41 A;  4LR8 A;  1OQ6 A;  5A8K B;  4K4U A;  3GIL A;  2HHW A;  4QYZ J;  1DZ5 A;  1RT2 A;  1FCA A;  4WK3 A;  3TO8 A;  3A3P B;  4KGK A;  5T7L B;  3MMC B;  1U49 A;  2DR9 A;  3J7Z T;  3NLC A;  1HKA A;  1Y00 A;  3B4D A;  2RJZ A;  4OI2 A;  3UCG A;  3K5L A;  3JXO A;  3RR7 A;  2GX8 A;  3NL0 A;  2LDI A;  4P7V A;  2CNN B;  4WTO B;  1TR0 A;  4FVC A;  2ATL A;  2HQC A;  4V19 X;  2OHD A;  1EP4 A;  4OX6 A;  3RB3 A;  2F63 A;  4ANC A;  2OPS B;  1TL3 A;  1DQA A;  1R8B A;  5DO2 A;  4P6Q A;  3JAM Y;  1UJ6 A;  4ZPW R;  2HQF A;  4KHR A;  4X62 F;  2UV8 A;  2MDA A;  4CO2 A;  3ETO A;  1Q16 B;  4AL6 A;  3UDE A;  3NCP A;  2MZQ A;  4JI0 J;  4OZN A;  1RT5 A;  3L7P A;  4NE9 C;  2R2S A;  1OO0 B;  1S1W A;  4X4O A;  5KFY A;  3ADA C;  1YJN S;  2AWZ A;  3MEE A;  4NXN J;  4I2P B;  2O1P A;  1RE1 B;  4JUZ A;  1G6B A;  1UFL A;  4ED1 A;  1SCJ B;  2DJW A;  1KQS R;  1WC1 A;  3CJ8 A;  3IGN A;  4DS4 A;  1ZS6 A;  2CG8 A;  1RXO B;  1UMJ A;  3V4I A;  2AD9 A;  3GYN A;  2JOQ A;  4DL5 A;  5IOL A;  3SSR A;  1IN0 A;  4FNH A;  1RWW B;  5J2M A;  2MKY A;  1UET A;  1EAY C;  1U1L A;  4F0M A;  3GMG A;  3RTV A;  4Q8F A;  4L73 A;  5A6P A;  2ZUG A;  4BCA A;  4HT7 A;  3ET6 A;  1Q53 A;  2KI2 A;  2GIF A;  4YQW A;  1P9Y A;  1FER A;  4LFB F;  8ATC B;  1UAW A;  2VU5 A;  4R5P B;  2MQP A;  3SFG A;  3V81 B;  1UVK A;  5IV4 A;  4N56 A;  4CLK A;  4NLW A;  3ENW A;  4AQY F;  4IRK A;  3LF0 A;  5B0G A;  2FHM A;  1JMT A;  1EQM A;  3LQV A;  3V2U C;  2QYC A;  4J9V A;  2G9O A;  3R5G A;  3MAH A;  1DRZ A;  3M8Q A;  1LWE B;  4LFC F;  4DL0 C;  3JTP A;  2MYF A;  1K1S A;  4QWA A;  1AT1 B;  6FD1 A;  2HS0 A;  4D3H A;  2I5J A;  1MU2 A;  4UOH A;  3KUG A;  3P5T L;  1HI1 A;  1N34 J;  1SC1 B;  1TTH B;  4DSL A;  2XYH B;  1Y5N B;  2VG6 A;  1UW4 A;  4CI0 B;  5KG5 A;  2V8G A;  3MUM P;  1L3U A;  3A8J A;  4J9N A;  2BX6 A;  1PC4 A;  5I3U B;  4ZVF A;  4AUK A;  2PI4 A;  2FVQ A;  1S1T B;  3GE9 A;  1YI2 S;  3PO4 A;  1NJW A;  4A48 A;  2CZV C;  4NMX A;  4OHW A;  1F5B A;  5AE2 A;  4V19 J;  4I6W A;  2D3Z A;  4OHX A;  4ES2 A;  1QE1 B;  3VV2 B;  5IC6 B;  1HFE L;  2QMX A;  2FJD B;  3VGS A;  5KG7 A;  3EPI A;  4DFJ A;  3GFZ A;  5HN0 A;  4ZLP A;  4DV3 F;  4RU2 A;  3J81 Y;  2MHE A;  3EGZ A;  1AUS L;  4KIA A;  4F4A A;  3C8Y A;  2Z57 B;  2UUB J;  4KO0 B;  1FFG B;  4MKA A;  2VFR A;  5JUM A;  5L8R C;  4R25 A;  3I96 A;  2EKN A;  1SC4 B;  2EFP A;  3P5B P;  3GON A;  5CH7 B;  2HRY A;  4HI2 A;  4YHH F;  2QX0 A;  3TVK A;  3AJ2 A;  1XMQ J;  3OV7 A;  4DMZ A;  4H4K A;  3GIK A;  2F4V F;  4TQR A;  1S76 D;  1GFW B;  3HP6 A;  2IY5 B;  2VA3 A;  2CVE A;  3MTJ A;  4EI2 A;  3ELH A;  4MKV A;  1RWX B;  2ZE2 A;  2C3P A;  3QGH A;  4XTT A;  2CPH A;  1TL7 B;  1B7F A;  5D3G B;  4EO8 A;  1TL4 A;  2LU2 A;  2V4J A;  4B3T J;  5D78 A;  4K4W A;  2L9D A;  1F9F A;  5K9F A;  4CWB A;  1BQM B;  1YHQ S;  5GME A;  2R8K A;  1KLN A;  3TUJ C;  2CDR B;  2KJW A;  3T19 A;  3EXC X;  3D1O A;  3GG1 A;  1HHT P;  1C0U B;  2F3J A;  3QWU A;  2QL7 B;  1ZBT A;  1JLG B;  2VDI A;  5I4M A;  1NK4 A;  3QLH B;  5LL6 d;  2V9W A;  4NRT A;  4PKD B;  1CVJ A;  5A8K A;  3KFW X;  1FXD A;  1T95 A;  1WOO A;  1OPI A;  1RWM B;  2ZKT A;  2ZH2 A;  2LMI A;  3UNG C;  5LSR A;  4E8U A;  4ICL B;  4JI8 F;  2BE7 D;  5T41 A;  3GZ7 A;  4HH0 A;  2DNH A;  1H73 A;  4Q8E A;  1X4B A;  3EXY A;  3K5P A;  2R42 A;  1RT6 A;  5D77 A;  4IKA A;  2P6S A;  4OZ0 A;  4Q0B B;  1RHU B;  4K4V A;  2OPS A;  5DLF A;  1VRT B;  3TUP A;  2IVY A;  3ZNU A;  1NHU A;  1SKW A;  5DET A;  4DX8 H;  2ZOM A;  3UN2 A;  3BJY A;  3Q8U A;  4EYH B;  1XNR J;  1TAQ A;  2M8H A;  5L1I A;  2C2Z B;  3M9M B;  4LF4 J;  3CWJ A;  2C2K B;  4LVO P;  1FRK A;  1OY9 A;  1NDC A;  4ECT A;  1WD6 A;  5J2N B;  2B9Y A;  3H2L A;  1Y5I B;  3MED B;  1HQE B;  3CCJ S;  2J7W A;  3BN4 A;  1PJ5 A;  2C3M A;  3LPE A;  1GMU A;  4OHZ A;  2YPZ A;  2XY5 A;  2I2Y A;  1MLA A;  4NRU A;  1FRL A;  1B99 A;  3MUV P;  2VJU A;  4IFV A;  1BGX T;  1YZ6 A;  4OLO A;  2GC8 A;  3S7R A;  1VRU B;  2C1E B;  2MZR A;  4PWU A;  1PIL A;  2KT3 A;  3JYT B;  1IBM J;  2IYG A;  1VBX A;  2CNK B;  4X64 J;  3T5J A;  3M05 A;  2V34 A;  3GJR B;  4WXW A;  4EZ6 A;  3EX7 B;  4G1I A;  4PZV A;  1DAX A;  4PPZ A;  1WG5 A;  1WKJ A;  1UEV A;  3G2X A;  3KUE A;  1H0H B;  2RB7 A;  5HJX A;  3RAX A;  4F02 A;  1FWK A;  2VG7 B;  3UD4 P;  1M5H A;  3V81 A;  3NMA A;  5J1P A;  3P6Y C;  3W8P A;  4DQQ A;  1R0B G;  4CQ1 A;  3UD3 P;  5CZX A;  4YDX A;  2WVC A;  4U95 A;  5C24 B;  4JI2 F;  4KT0 C;  3VAM A;  2DGU A;  4EK2 A;  1JJH A;  3W2V B;  1S1V A;  2CPE A;  1SUQ A;  2EC0 A;  2VBW A;  2F1F A;  4IG3 B;  1HPZ B;  1GEH A;  1ZET A;  1PC5 A;  1XTZ A;  3EUN A;  3SQO P;  5LMU F;  2CNO B;  3SI8 A;  3HFZ B;  3GCW P;  1ZM3 A;  3MXH P;  3M2R B;  3GIR A;  4HHU A;  2MQM A;  1RUS A;  2HNZ B;  2QT7 A;  2VB6 A;  2I0X A;  4LF8 F;  4C11 B;  3MD3 A;  3U1N A;  1NSQ A;  1UVL A;  1VMB A;  1RWP B;  4FF4 A;  2AGO A;  4LF9 F;  1YBU A;  4M5K A;  2OEK A;  3GIJ A;  1WDT A;  3PM9 A;  1E6V A;  2Q66 A;  1LK7 A;  2CJY B;  3D3B J;  2FHO B;  4F67 A;  1XNQ F;  1I94 F;  1S1T A;  5FJ4 A;  2IBK A;  3HK2 A;  1KOO A;  4HHH A;  2BQ3 A;  4RU9 A;  5KT5 A;  2VDH A;  2DY1 A;  2J6U A;  1TUV A;  2HG4 A;  2H51 B;  1QE1 A;  4EWT A;  4J9Q A;  1WEZ A;  1RT4 A;  8AT1 B;  1LWF B;  5HAO A;  2CPF A;  2HFS A;  2UXB F;  1BQX A;  1A6L A;  3PY8 A;  3MEC B;  2AYB A;  5LXY A;  5LOQ A;  1X5T A;  1XC9 A;  4ZPT R;  2L3M A;  4F3O A;  1VC6 A;  3DLJ A;  2ZH7 A;  3PRV A;  1V5I B;  2C3Y A;  3AXM A;  2VZ9 A;  5D4N A;  1GXT A;  3ZFV A;  1XWL A;  1UW9 A;  4LRF A;  3TA1 A;  4C9D A;  1H7X A;  4ED7 A;  1D9D A;  2EBE A;  2G2Z A;  3DDI A;  1R43 A;  4Q44 A;  4DUY J;  4NAS A;  5LXR A;  4DV0 J;  1K47 A;  1S1X A;  3LA0 A;  4USI A;  1FJ7 A;  5JXS A;  3GG0 A;  1MG7 A;  3GYG A;  3M30 B;  2GJF A;  2J9D A;  3AH6 A;  2UP1 A;  2FLP A;  4KYZ A;  4J9S A;  2Z2L A;  2KHC A;  5L1J A;  4WXO A;  1N0U A;  3RRG A;  2AZ3 A;  1S6P B;  3W3S A;  1Q78 A;  1MWZ A;  3D1H A;  3T1Y F;  3OL9 A;  2U1A A;  5D3G A;  1XR7 A;  5D4O A;  4CNZ A;  1NM2 A;  3NY0 A;  3CJ5 A;  2AMC B;  1S72 S;  2Z4P A;  3OTO F;  1MMN A;  3OL8 A;  3S1T A;  1PAU B;  1X4F A;  2AYE A;  3I5C A;  5L46 A;  1TU0 B;  2V2Z A;  5A2Q Y;  2HBY B;  1YJV A;  1JLG A;  3FFI A;  2WVF A;  4BWM A;  3QLH A;  2CIM A;  1SQF A;  4ZPA A;  2OPQ B;  2YKM A;  2OJ3 A;  3MMA B;  4ZVU B;  3KLF B;  3UPF A;  3PAC A;  3MPV A;  5A8R B;  3PV8 A;  2PMZ D;  2CJA A;  3MI7 X;  2JJ4 D;  4PAB A;  5CYQ B;  3HHL A;  5KFV A;  4O0N A;  5KG4 A;  2D9P A;  1D8Y A;  2JVO A;  4YP3 A;  3C6U B;  2KVI A;  2W9C B;  3IS9 A;  5LJ5 Y;  1KTV A;  1QSY A;  1WG1 A;  4OV1 A;  2HHV A;  2M9K A;  2RU3 A;  4N5S A;  3JQM A;  2BM1 A;  2JEJ A;  2QZ8 A;  3IM9 A;  3CPW R;  2YNF A;  4IR1 A;  3W62 A;  3E51 A;  4DR7 F;  1WKK A;  2BQR A;  4AFF A;  4ED4 A;  5IC4 B;  4LJM A;  2HND B;  4HDG A;  3PIO Q;  1AFJ A;  3BZQ A;  2KTQ A;  3DDN A;  3I55 S;  3GPA A;  2DRD A;  4K4T A;  2HSE B;  3I0S A;  2MLZ A;  1YJU A;  2HGM A;  3MED A;  4KQZ A;  2IRY A;  3Q8Y A;  2OLW A;  2QLX A;  3FEY B;  1KD1 T;  1M5P C;  4KH1 B;  3PJ9 A;  1NB7 A;  1IBL J;  2NRE A;  1X4C A;  5K14 B;  4DQS A;  1SKS A;  1X9S A;  2E5H A;  4L74 A;  3JYT A;  1BE4 A;  3KNA A;  1NPK A;  3FK4 A;  2RF2 B;  1PGZ A;  1CJU B;  5IS2 A;  1FD8 A;  4KC5 A;  2Q6C A;  3QRR A;  2DCL A;  1NZA A;  4YB6 A;  1RAJ A;  1KVK A;  2VJV A;  4Q43 A;  1G7C B;  3X1L B;  3RB6 A;  4B3S F;  1FKO B;  1KLM B;  1N36 F;  1M5V C;  5HVF A;  2VG7 A;  1GMW D;  2MKJ A;  3RRK A;  1WHY A;  1J2V A;  1QAY A;  4YB5 A;  3TJ9 A;  3WHI A;  1SL2 A;  2DYA A;  3HD2 A;  4KR0 B;  4UTG A;  1YWX A;  5A0Y B;  1VQS A;  4NLO A;  3DRR B;  3DOL A;  3OPK A;  2V69 A;  4NI2 A;  3X3U A;  1U25 A;  4IG3 A;  1HPZ A;  2BE9 B;  4K4X A;  4U7C A;  4NYO A;  3V5R A;  4B9L A;  2YNI B;  1S77 D;  2QC3 A;  3THT A;  4ID8 A;  4TU7 A;  3CDU A;  3G8S A;  4HTJ A;  5EGY A;  5CHC B;  3IBF B;  2R8I A;  2OAU A;  2JDJ A;  3GU0 A;  4C11 A;  2XGP A;  2QA4 G;  3ILO A;  2IPO B;  5M2U A;  2Z0G A;  2BJ1 A;  5FLX Y;  2E9Z A;  2MJU A;  3A3O B;  4IH7 A;  5KFT A;  3DLB A;  2OIH A;  4YFU A;  3HCX A;  3ZZ0 A;  3N28 A;  5K20 B;  3L3C A;  9RUB A;  2KT2 A;  3K59 A;  3FDS A;  3HVR A;  2N7Y A;  3BPS P;  4EUV A;  2RNE A;  2Y1J A;  4ZP8 A;  3D9B A;  2PEH A;  3TOQ A;  4CLT A;  2VQE J;  3Q2T C;  5IT9 U;  2R7R A;  1SKU B;  4RNN A;  4OZ3 A;  1LWF A;  1VQ7 S;  4FVM A;  4X84 A;  2QSW A;  2B51 A;  4CH0 S;  1HNV A;  5KFM A;  1QSL A;  4TY8 A;  3MEC A;  3T1H J;  4FNI A;  3DRS B;  2IAJ B;  4Y2M A;  1DHM A;  4MFB A;  4LUB A;  1VLY A;  3CD6 S;  4FF3 A;  1TL1 B;  1XIQ A;  5DZ6 A;  4L75 A;  3N6N A;  4ZK7 M;  2ZH4 A;  1T8E A;  3D2W A;  4DV4 F;  2FGO A;  1NPR A;  2C3O A;  5GAD U;  3TAM B;  4OI6 A;  3JTN A;  4DV7 F;  3PX4 A;  1RWU A;  5KFZ A;  3O8W A;  2AJ0 A;  3U02 A;  3NGT A;  2BOA A;  4ZHR A;  1U1P A;  4WFA Q;  5CA5 A;  2XBP A;  4CO5 A;  4YY3 J;  1FX4 A;  2IRU A;  1R0A B;  4CLU A;  3F56 A;  3GR0 A;  2C2E A;  3EGN A;  3BSA A;  2KG1 A;  2WTF A;  2DR6 A;  2FVP A;  5DM7 Q;  3DC2 A;  1QY7 A;  3W5Z A;  3U7J A;  3QO9 A;  4WFN Q;  4DFP A;  1ZM9 A;  2ZNZ A;  2RU9 A;  4F3M A;  2YKN B;  3CJT A;  3JS9 A;  5KFN A;  3FEZ A;  2CJQ A;  1CQM A;  3I9Z A;  3TZW A;  3DI6 B;  2BJD A;  2CQ3 A;  3VCD A;  5I42 B;  1WC0 A;  4CP5 A;  4M63 A;  2ZBR A;  1RIS A;  4I2Q B;  5DDO C;  2VFS A;  1U1O A;  1RK8 A;  4MKB A;  2C2M B;  3DN9 A;  4FBU A;  3SQG A;  2B9W A;  2W2P P;  1J5O B;  1RLC L;  3MD1 A;  3MMA A;  2DHG A;  3KLF A;  2BEF A;  4C8L A;  4C0O C;  5A8R A;  3BKU A;  3FBB A;  2QJ3 A;  1WHV A;  2W2O P;  2YH0 A;  5CYQ A;  2PMH A;  1RDR A;  1URN A;  1REG X;  5ITH A;  4URQ U;  2HKE A;  2G4B A;  3C6U A;  4KAI A;  1KNZ A;  3IWL A;  2BAN A;  4LMZ A;  2Y1R I;  3PRB A;  2J5A A;  3SCJ E;  4OQJ A;  1FJG F;  4ZS6 A;  1HNZ J;  4JOU A;  1N48 A;  1YQH A;  1TMJ A;  1YJR A;  4DV6 J;  2UU9 J;  4ZPC A;  3BBF A;  3CJS A;  3T6J A;  1Q79 A;  1RT3 A;  2CQG A;  3QRP A;  1NRK A;  4WYL A;  1CC8 A;  3QJP A;  4NLG A;  3LP0 A;  1S4E A;  2OSR A;  2HWH A;  3GLJ A;  4KV8 A;  1U6Z A;  1EZZ B;  2KU7 A;  3SMZ A;  4DSJ A;  3MFH A;  1YG0 A;  1W25 A;  3H5U A;  5F8N A;  4DG1 A;  5D0H A;  4CIO A;  5KT6 A;  1N5V A;  4CM2 A;  2DIV A;  3KK2 A;  3LP2 B;  5I3Q A;  2HZV A;  3VAJ A;  3PR4 A;  3AQP A;  2H65 B;  1WSR A;  1S6Q B;  1HNX J;  3E2E A;  2LQB A;  2DHX A;  2MQN A;  5K14 A;  4JI3 F;  3M6W A;  2DGS A;  3BGO P;  2GHP A;  4CT8 A;  3QSY B;  1U8S A;  1KRP A;  4M8L A;  3ZZZ A;  2R7Q A;  1H3D A;  3N6L A;  2A1B A;  3JSM B;  3MM7 A;  3BBB A;  4G3I A;  1SH2 A;  1FNO A;  2UUA J;  1BHN A;  4ENO A;  1N5Y B;  4YR2 A;  4BDP A;  2CJB A;  3K57 A;  2ZC3 A;  3HHN B;  5LM7 E;  1FDB A;  1HBU B;  4J9R A;  4Q7A A;  4WF9 Q;  1RAF B;  4GVB B;  3TI0 A;  3F73 A;  5DQI A;  3R5A A;  1NU4 A;  2DEJ A;  4DCJ B;  2Z58 B;  1SH3 A;  2VD3 A;  2ZNY A;  2G1H A;  3OTD A;  2JFK A;  1OY6 A;  4USK A;  4OYW A;  4ED0 A;  4RW4 B;  4DR5 F;  1S1U A;  4QWB A;  2YNI A;  4RW8 B;  2DD8 S;  2V63 A;  4OX8 A;  4DPX A;  4L72 B;  5ETM A;  3KLE B;  2FJW A;  1EET B;  4ZJL A;  5AT1 B;  1OSC A;  3J80 U;  3L7U A;  1T05 A;  5KFK A;  1DLO B;  2HZA A;  5ETT A;  3R8Y A;  3OTB A;  1TK0 A;  5D8H B;  2G2Y A;  3HXM A;  2FHK A;  1HW9 A;  1H2V Z;  3MCN A;  3CF5 Q;  3C19 A;  2DPI A;  3PEH A;  1F3V A;  4AXI A;  1TV6 B;  2WW4 A;  3H7H B;  4IFY A;  4PWW A;  1Q86 T;  3T1A A;  1ROF A;  4W4M A;  1U48 A;  1GX6 A;  3UQS A;  3EVW A;  2QYG A;  2W4D A;  1LW2 A;  3VR1 A;  1KON A;  3AJD A;  4ELU A;  4LR9 A;  2V9K A;  2DNG A;  2PO4 A;  4QYR A;  4X66 J;  1WAC A;  3PDN A;  4WTY A;  2ZZM A;  3PKY A;  1X5P A;  2HBQ B;  1PAE X;  2MHN A;  2EXU A;  2LA4 A;  3DRS A;  2IAJ A;  3FKB A;  3G96 A;  4QZV B;  1ZTW A;  3NGK A;  1AW0 A;  3KWM A;  4LRA A;  4PG6 A;  2JC0 A;  3DMJ A;  3MPD A;  1VBY A;  5BXI A;  4XO0 A;  1SC3 B;  2R2T A;  3ISN D;  4JI4 J;  3IWN C;  3AY0 A;  1RYR A;  4B3R J;  3UN5 A;  2ZUA A;  3TJA A;  2IIH A;  4K0K J;  3E01 B;  2MPU A;  1MWQ A;  2B6A B;  2H1Y A;  3HJV A;  1MRO B;  4NL5 A;  3OHB A;  5C2G A;  2UUC F;  1R0A A;  3ZZR A;  4DUZ J;  3KKF A;  4LBH A;  5DM6 Q;  4O3S A;  2VIC A;  5GVQ A;  3FRY A;  4IRC A;  3HJF A;  4DSK A;  3RU0 A;  4JI1 F;  4ECQ A;  2OEL A;  5K8N A;  5IQQ A;  2CA9 A;  2XTJ P;  3DXS X;  2YKN A;  4C4W A;  1S0O A;  1I1G A;  1C1B A;  2KXN B;  3PYE A;  4B9M A;  2SXL A;  2JEF A;  1KOH A;  3DI6 A;  1UPP A;  4DV1 J;  5E41 A;  5I42 A;  1KQF B;  4DCP B;  2RDD A;  5RUB A;  4HDH A;  3DRX A;  3CE8 A;  3C16 B;  2CQ4 A;  4I2Q A;  3VAL A;  3DLL Q;  1RT7 B;  3H25 A;  5GAG I;  5HVH A;  3A13 A;  4DXL A;  2K1R A;  4IH5 A;  3G8T A;  3LAN A;  1TKX B;  2XCP A;  2WSF C;  5J1E B;  4RNH A;  4LF5 J;  5H9F K;  1UA0 A;  2E5L F;  4CTA A;  4NZ0 A;  1IKY B;  3Q22 A;  4DF4 A;  3AAW B;  2FIU A;  3QFH A;  2F9D A;  1HHQ A;  4IR9 A;  4TU8 A;  2HLT A;  2V5H G;  3G8Q A;  3QT8 A;  2C2N A;  2DRB A;  4DX6 A;  1P9Q C;  1VLO A;  2QA1 A;  1QVF R;  1UFW A;  2RIJ A;  3Q8V A;  3M1V B;  2EFQ A;  2D9O A;  3HI9 A;  4QWE A;  4P2F A;  1CG2 A;  4DV2 J;  4H54 A;  3EM1 A;  4ZDN A;  1RI7 A;  1TMM A;  4RNF A;  1VQM S;  1S9F A;  2AHO B;  3G6V A;  1IKV B;  2IM3 A;  4ZCM A;  1L5U A;  2V2V A;  3IC1 A;  4XIU A;  2J0Q D;  3SSQ A;  2R9L A;  2AYG A;  5HSP A;  1Y5L B;  3FZB A;  4N47 A;  2MSS A;  3C66 A;  1P1L A;  4OI1 A;  3CDB A;  3I4P A;  3LAL A;  2KVQ E;  3OVA A;  2XMA A;  2QLJ B;  2CQ0 A;  3EWG A;  1GTH A;  2KM8 B;  3KOA A;  1NK6 A;  2KKH A;  5IT9 Y;  2ZZT A;  4WKR A;  1KTQ A;  2CQ1 A;  4ED3 A;  1EB0 A;  2KJV A;  2FDN A;  4DS5 A;  3ZTQ A;  1Q4R A;  2XI3 A;  3R1L A;  4OJ3 A;  3M32 B;  3HO1 A;  2GMH A;  2HQ3 A;  1HBO B;  2CQB A;  3SV4 A;  3OTE A;  4UST A;  1SH0 A;  1X9W A;  3HDS A;  2J8S A;  2P5V A;  2MZ1 A;  3HF5 A;  4GC7 A;  4NZ7 A;  2N7C A;  1HL6 A;  1R8H A;  5SUH A;  4OHY A;  2RS8 A;  1ZPV A;  4X4V A;  4O44 B;  1K0V A;  1L3V A;  1N5Y A;  4DQI A;  4A8Y A;  2FHJ A;  5LSO A;  1LQ9 A;  3CCT A;  1GXU A;  1HWK A;  1UJ5 A;  1HBU A;  4U8Y A;  4UQT A;  2DXD A;  2AP6 A;  3PIP Q;  4OZ5 A;  5KFD A;  1SIW B;  4OX9 F;  2EWH A;  4JV5 J;  2BAB A;  3DLK A;  2ZBI A;  4USJ C;  5J1N A;  4K4Z A;  3IGV A;  5BR8 F;  4LSN B;  1LK5 A;  4J9O A;  4NLY A;  4RW4 A;  1X5O A;  2ZH5 A;  3DXB A;  2OFG X;  4RW8 A;  1TK8 A;  4W98 A;  1EET A;  4I6A A;  1WOP A;  4MJK A;  3AJ1 A;  3CT9 A;  4O3R A;  2UXD J;  1FA0 A;  4CT9 A;  4C98 A;  3TA2 A;  3O2I A;  4NYZ A;  2AKW B;  2LXU A;  1N33 J;  2JX2 A;  2DNZ A;  2KZZ A;  4USV A;  4Y2A A;  3LW5 C;  3QWP A;  3S8S A;  3FQK A;  5DGB A;  1TV6 A;  1NLK L;  2MZJ A;  3ZC4 A;  5K5M A;  5G0R A;  1BQN B;  2W7A A;  2YKP A;  1GNK A;  1DQ8 A;  5EHH A;  1MSW D;  3WX8 A;  3BDP A;  3P49 B;  4HAC B;  4DN9 A;  1IBK F;  4RBV A;  1IQZ A;  1HAR A;  4AD6 A;  1REV B;  1N54 B;  1WEL A;  4JYA F;  1HYS B;  1UVJ A;  2HFN A;  4K8R A;  1XEZ A;  3OR1 A;  3ILL A;  4OV6 A;  2AF6 A;  2K3K A;  1Y10 A;  1FES A;  2UXC F;  2XI2 A;  2NZC A;  3IFE A;  1BMQ B;  4K59 A;  2BE2 B;  5KG6 A;  5DRK A;  3BO3 A;  5DGA A;  1DTT B;  5B08 A;  2QFI A;  3GR1 A;  4YUD A;  2G1D A;  3NBP B;  2RUS A;  4HKQ A;  1PJ7 A;  1BC6 A;  4ECV A;  2ACY A;  3P8B B;  3A3N B;  3OTO J;  3D1Q A;  3MEG B;  2K3I A;  2KL8 A;  3JAM U;  3QMQ A;  4CYU A;  2VOO A;  2PA3 A;  2BZ2 A;  1E6Y B;  1N32 F;  3EZ5 A;  2KFZ A;  1H6K X;  4DL7 A;  3E01 A;  2ZHB A;  4GO5 X;  4DV5 F;  2RS2 A;  4WPA A;  1MRO A;  4NCG B;  3G71 S;  2EG1 A;  4ZPB A;  3PJX A;  2E1C A;  4OZ1 A;  5C42 B;  1XMB A;  2MST A;  1WF0 A;  5B0B A;  1IKX B;  4IOC Q;  5IWA J;  3SCI E;  3OSP A;  5ADZ A;  1CSJ A;  2CPZ A;  4ETZ A;  1TUW A;  5JJB A;  2G0C A;  2MKS A;  2WOM B;  4O3P A;  4WJB A;  3LWL A;  3DGP B;  3LAK A;  4ZVR B;  4PQA A;  1HNW J;  1VK8 A;  2VAS A;  2YNH B;  3D7S B;  3A8E A;  2HLU A;  4KHP J;  5HL7 Q;  2MGZ B;  4TYB A;  2OH2 A;  3D54 A;  2XZW A;  1RT7 A;  5KFG A;  1Y9O A;  2NPI A;  1Y3J A;  3TX8 A;  1TKX A;  3VQT A;  3DU5 A;  2CJX B;  3KLH B;  5J1E A;  2FJV A;  2HMI B;  4ELT A;  5F8H A;  2NXN A;  1DTQ B;  1IKY A;  3OFF A;  2ZD1 B;  4NEY A;  3KHR A;  3BN7 A;  3BSN A;  1TVR A;  2FJE B;  4KFB B;  3LO3 A;  2DK2 A;  3K2Y A;  4LSL B;  3MM5 B;  3TJ8 A;  4F2S A;  3K58 A;  3M1V A;  4JI6 F;  3M8Z A;  5DDP C;  4AND A;  3J80 Y;  1KDN A;  1GH8 A;  5J2Q A;  1RTJ A;  4EO6 A;  1S6O A;  3KMS A;  1S59 A;  1FE0 A;  4J9K A;  2RT3 A;  4I56 A;  2FJB B;  1V6H A;  4IYQ A;  4DEZ A;  4X4T A;  1IKV A;  4J9U E;  1TQL A;  3CIM A;  2AYM A;  4RR5 A;  3IXQ A;  3IRW P;  3W2W B;  2DY9 A;  4I64 A;  2MY8 A;  1RWN B;  2ZH9 A;  4NCB A;  2VQF J;  3W60 A;  3KG4 A;  4GKK F;  3IMQ J;  2XCA A;  5CAA A;  4ED8 A;  3RUB L;  5THW A;  5ETP A;  1HMV B;  2GAG C;  1YRX A;  1TKD A;  3J7A N;  1NKC A;  2O67 A;  1KSP A;  4X65 F;  3UCU P;  4DX7 A;  3NXZ A;  1HBO A;  2F5G A;  1Q5Y A;  2KFN A;  1NK8 A;  2WB1 D;  2B43 A;  1HBM A;  3V6H A;  2R7V A;  1X4A A;  3J81 U;  2X1B A;  4LF7 F;  5KFS A;  1XER A;  2BM0 A;  2GQC A;  3VGV A;  2NLW A;  2ZBP A;  5AXM A;  1F1B B;  4DPO A;  2YNG B;  2FVR A;  2B8P A;  1R8C A;  1RTH B;  3Q24 A;  2MQO A;  2B4O A;  2H3E B;  5HMX A;  1CC7 A;  3QJL A;  2KN4 A;  2YWE A;  2YXL A;  5B0A A;  2W2N P;  2CAJ A;  3NNA A;  2NZ4 A;  4J7C A;  1RWO B;  1X7V A;  3POT B;  4JI7 J;  2JHE A;  3OUY B;  3CUL A;  4Y2I A;  1M1K T;  5HO4 A;  3CCL S;  2CPD A;  4OJH A;  2VOP A;  2V0N A;  3QZ7 A;  3CCZ A;  3OLA A;  1IWG A;  2DHS A;  3MWB A;  1LEO A;  2IBO A;  1JLC B;  1YBT A;  2DHA A;  4F04 B;  4UF4 A;  4HH1 A;  4HI1 A;  2DVI A;  1LKZ A;  2R7T A;  3O6Q A;  3QIP A;  4QJV A;  1U6F A;  1Z2Z A;  3BR9 A;  3RW6 A;  1S79 A;  4WBF A;  2XMT A;  2B9X A;  3OQ2 A;  4OYO A;  1VBZ A;  2Y3Y A;  4RW6 A;  4FF2 A;  5EWE A;  4PYD A;  2E44 A;  1REV A;  2W9B B;  1NO8 A;  4A8W A;  3LTO A;  3K17 A;  3C46 A;  4LBP A;  4ZMM A;  4LF6 F;  4DDF A;  1S6U A;  3D0G E;  2B7B B;  5ETN A;  4QOT A;  3KK3 B;  4QR1 A;  4DZD A;  5AJ3 F;  2P9E A;  1RTI B;  5IT0 A;  4QIG A;  4S0M A;  3H0P A;  4ES1 A;  4OYX A;  2ZWP A;  2HIQ A;  5GMK a;  2VH7 A;  3MUR P;  2GV1 A;  1UKU A;  1S12 A;  2M2B A;  1IJE B;  1CUL B;  1DTT A;  5KFL A;  4NLP A;  1B64 A;  2A2D A;  3AHP A;  4ID5 B;  3DLH A;  3ISN C;  1QAX A;  5JMN A;  2V94 A;  2CZ4 A;  2BW2 A;  2DXE A;  2N3O A;  1FFW B;  3GP9 A;  2VG5 B;  3NS5 A;  3AXK A;  1N8R T;  3KJV B;  2HNY B;  3SYZ A;  2N82 B;  2ATC B;  1VQ4 S;  4FYD A;  5KT2 A;  3AB4 B;  3KK1 B;  3MR3 A;  2G2O A;  4NCG A;  2HBR B;  2DEI A;  5C42 A;  1FWL A;  3MM8 B;  3FBE A;  2X1A A;  1B7Y B;  2JL9 A;  1PO6 A;  2DIU A;  3UO0 A;  2A2C A;  4K4Y A;  4WP8 A;  1H7W A;  4X4P A;  1ICE B;  5KFR A;  2FJX A;  3DGP A;  2Z30 B;  1Y4Z B;  3G6E S;  4CRJ A;  2YNH A;  4L3N A;  1ACM B;  2LQ5 A;  1YVF A;  2AX1 A;  2NUU G;  4YR0 A;  2H5I B;  3GTY X;  2DR7 A;  2XYP B;  1FT8 A;  4TVA B;  2MLY A;  3N4W A;  2GGP B;  4USU A;  3DYA B;  3FMB A;  3MR2 A;  4F3Q A;  3OVS A;  3W7B A;  2J6T A;  1X4E A;  4Y0F A;  4JI0 F;  1X0P A;  2A3J A;  2HMI A;  1VJW A;  3SBM A;  1RU2 A;  3V6K A;  1IKW B;  1DTQ A;  3IN5 A;  1MW7 A;  3EJM A;  5HP1 A;  1EQ0 A;  5IQ6 A;  1H72 C;  2ADC A;  4NXN F;  3LP1 A;  1VI7 A;  2V67 A;  1FD2 A;  3HFV A;  5DS7 A;  2VUG A;  1UP1 A;  1SI9 A;  4LSL A;  3MM5 A;  1M5K C;  2NSC A;  1FI4 A;  4RJV A;  4WP9 A;  4V1A k;  5CCL A;  4LIR A;  5KT7 A;  4UZC A;  2XSJ B;  2YKQ A;  3PX6 A;  4C8N A;  2XMM A;  5HMZ A;  2KZM A;  4ZLL A;  2H5E A;  1WDD A;  4ZVP B;  2YBV A;  2R7S A;  2Q79 A;  4AT1 B;  2E1M C;  1RTD A;  4Z7C A;  2ZH3 A;  1R31 A;  2DNY A;  1B0T A;  3TVZ A;  4Y3C A;  3S01 A;  4UOC A;  3J7Y U;  2ZBQ A;  1HBN A;  1K44 A;  3BSO A;  4F4X A;  2MLX A;  5B0C A;  3CDW A;  1RQ0 A;  5DQG A;  2HHQ A;  1N6Q B;  1NND A;  2X1G A;  2YWF A;  3DOK A;  4USW A;  2YQ3 A;  3D0I E;  1WC5 A;  1NEE A;  3TUI C;  4C7Q A;  2GA7 A;  1VHI A;  3NS6 A;  3NAI A;  3JTO A;  3IAS 9;  3KJQ B;  2APO A;  2FB0 A;  2Z8Q A;  2IRX A;  5AE3 A;  1X4G A;  4WE1 B;  4CLY A;  3FCV A;  2CPY A;  3NRB A;  4Q45 A;  3BEG B;  2PEB A;  1KEK A;  1WC4 A;  1N34 F;  3LPY A;  1EIY B;  4C8Y A;  1R8A A;  4OYA A;  3FCH A;  2E7V A;  5FDL A;  4NLX A;  3ZZU A;  2LA6 A;  4ZJQ A;  3FGV A;  4ZCL A;  1HI0 P;  1UCN A;  4P2X A;  1RTH A;  3TW0 A;  4J5O A;  1NHV A;  1RHK B;  2XMJ A;  4DR1 J;  1X8D A;  1SQE A;  1V3Z A;  3I4H X;  5F8M A;  1V3R A;  2M0G B;  5KFU A;  1HD0 A;  4CO3 A;  2BUN A;  2AJ2 A;  1URR A;  3JSY A;  2GVZ B;  2ZWO A;  3AT1 B;  3EDQ B;  1P6T A;  3R7S B;  3D6T B;  2DGQ A;  3CO9 A;  4ITS A;  2YQ1 A;  3HLU A;  4TQS A;  2UUB F;  2XYG B;  2NCK L;  4OL8 A;  2XGQ A;  1J5E F;  4Y2K A;  2XLJ A;  1JLC A;  2FTR A;  3EZO A;  2WON B;  1FDD A;  5KG1 A;  1ZYQ A;  3ENV A;  2QG9 B;  1UWB B;  5E3A A;  5A2Q U;  4XAK A;  1NSK L;  3IA0 A;  2HQI A;  2GML A;  3ZTS A;  4DL3 A;  3OR2 A;  1KHV A;  2ZEJ A;  3QPI A;  2RQK A;  1WC3 A;  2W9B A;  5EN1 A;  3RB0 A;  1VYA A;  6FDR A;  2RVJ A;  4B3M J;  3PHT A;  2DBB A;  1G3O A;  4M5N A;  3KK3 A;  3A8I A;  1U47 A;  1F2G A;  3HHD A;  1RTI A;  4RO0 A;  4FKY A;  2OO4 A;  1KVI A;  4B3T F;  5HRO B;  2J76 E;  5D15 A;  2WSC C;  3A12 A;  4N76 A;  1WUU A;  5E2Q A;  1CUL A;  4I68 A;  1HWU A;  2OFH X;  4ILR A;  4ID5 A;  4KH0 B;  4C3L A;  2VC0 A;  2Q43 A;  4LRC A;  4PWD A;  2W7O A;  1U2F A;  2FPH X;  1OSD A;  3MPY A;  4P72 A;  3WBZ A;  1QUP A;  3V4M A;  2ZIT A;  2VG5 A;  3ITH B;  4TLQ A;  3CJK A;  1VQ8 S;  2RQ4 A;  3V6D A;  2ASY A;  2D69 A;  1ZAX A;  4PQU B;  3QID A;  3MM6 B;  4GVL A;  5E3P A;  3R7N B;  3CD0 A;  4G1Q B;  3KDO A;  3O5T B;  1Q7Y T;  2LYV A;  3MCM A;  1N52 B;  1RCO B;  1U7L A;  2F7V A;  1RHQ B;  3W8G A;  2XB2 D;  3CNQ P;  3I87 A;  4RW7 A;  4ER8 A;  1FEE A;  2Y0S D;  3JSR A;  5C25 B;  2XS5 A;  2ZVS A;  4KGM A;  3SFU A;  4NLD A;  3ZNJ 1;  1NZ8 A;  2KRR A;  3ULH A;  3QT6 A;  2BKP A;  1XNR F;  1CJT B;  3B82 A;  4AXJ A;  5KFX A;  2J7U A;  4DLE A;  3UR3 C;  4LF4 F;  1CJV A;  2GVD A;  1N88 A;  1C2P A;  4YS2 A;  2M52 A;  2WSE C;  5CCM A;  4R8U A;  4DR4 J;  3C2P A;  4I7F B;  2MMY A;  1LFW A;  1IKW A;  1SXL A;  3R1H A;  4B9N A;  5L9N A;  2HVI A;  2C2D A;  1NDK A;  3ETM A;  3AD9 C;  4ZP7 A;  3W64 A;  3CJ3 A;  3G82 B;  4PUO A;  1UVI A;  4JV2 A;  2VF3 A;  1OQ3 A;  2QE5 A;  2RD5 C;  1NBE B;  2OI2 A;  2XMK A;  4WK1 A;  3L7O A;  1WTF A;  2XSJ A;  4B02 A;  4XDC A;  1IBM F;  5GMD A;  1HW8 A;  2OPR B;  4X64 F;  4DR6 J;  3MZI A;  5CQG A;  3K5N A;  2B5J A;  3D6H B;  1FNM A;  3DRP B;  1YJT A;  1ZAV A;  3OJS A;  4B9V A;  2I1R A;  1TFY A;  3EVM A;  1D0E A;  3FC9 A;  1NPP A;  5MLC V;  2DH9 A;  3TP2 A;  5F0W A;  3Q8P B;  5FLX U;  1TK5 A;  1I3O B;  4M94 A;  3BKT A;  2F8H A;  3F41 A;  5T7L A;  3MMC A;  1NK0 A;  4F4Z A;  3EMT A;  2IJN A;  4KY3 A;  4LT6 A;  3BH6 B;  5LSL A;  1HQU B;  2XHW A;  3PW7 A;  4OLP A;  1Q7L B;  3BQ0 A;  3CCU S;  3E3X A;  1N56 A;  2CDQ A;  5HLF B;  2GAH C;  4A8M P;  2LVW A;  1BXN A;  2V2Q A;  3NKY A;  3UD5 A;  4LBI A;  3MUT P;  3J7A 1;  4U7U K;  3MOJ B;  4NLQ A;  3GJT B;  1C1C B;  1YRU A;  4CLL A;  2GNK A;  4IRD A;  2E1R A;  2FC9 A;  4DPU A;  3DM2 B;  5DQH A;  2Z2Y B;  1IVZ A;  4NPO A;  4UOG A;  4W92 B;  4J9P A;  2ZH6 A;  3C3L A;  5FII A;  2HS3 A;  4I6Y A;  3H59 A;  2PE8 A;  1U0H B;  2OUG A;  3H8Y A;  1RT1 B;  4CLZ A;  4MKY A;  2GIQ A;  2IDE A;  4I2P A;  2J9E A;  2HHH J;  1LFP A;  5H9E K;  1QTM A;  4DCO B;  1NK5 A;  5HBM B;  4ZCK A;  2KXF A;  4XPE A;  2VIH A;  1ZPW X;  3AA8 A;  4ILM A;  1UA1 A;  2I6W A;  2BR0 A;  2ZOF A;  1UPM B;  4WU2 A;  3MM9 B;  1XJW B;  2WZ1 A;  1SIZ A;  4NLT A;  3TEG A;  4GKJ J;  3KHH A;  2EBG A;  2CUY A;  4QIW D;  2BKO A;  4D3G A;  4X2B A;  2XMW A;  3I32 A;  2UXC J;  3AB2 B;  2UUT A;  4A46 A;  3AA9 A;  2GMJ A;  3RAQ A;  4DPY A;  1C4C A;  2FVS A;  2QL5 B;  3OFH A;  4P73 A;  4DUY F;  3K8W A;  4DV0 F;  1VGY A;  5ETR A;  2DH7 A;  2DT9 A;  4R5P A;  1FFS B;  4RUA A;  3P96 A;  1F0X A;  3JQJ A;  3BSC A;  4FBT A;  5KT3 A;  4FKX A;  1I5O B;  1LW0 B;  3PTW A;  1RT2 B;  2NXE A;  1FEH A;  4Y28 C;  3RBD A;  3L9Z A;  4RX6 A;  2OD4 A;  1CBK A;  3O3L A;  4UOF A;  4RZR A;  1FF2 A;  1U1K A;  2K7K A;  4NWB A;  3UR0 A;  1LWE A;  1QVG R;  1D9F A;  1D9A A;  2AEJ A;  1F3F A;  2HVE A;  4BC7 A;  1WF1 A;  3NWG A;  4PXB A;  1HWI A;  5EUH A;  1RU1 A;  1R89 A;  1YIT S;  3N6M A;  2DRA A;  1HD1 A;  1EP4 B;  4O23 A;  4QWD A;  4F0H A;  2MJN A;  3E8O A;  1TL3 B;  4X4R A;  4FZV A;  4OJG A;  1RB0 A;  4EZ9 A;  4USM A;  1DUR A;  4W90 B;  5CYJ A;  4R0J A;  4EEY A;  1T0T V;  4U6P A;  5I3U A;  2I9S A;  5HAT A;  1HR0 J;  2HK2 A;  4BBY A;  4WFB Q;  3HZE A;  2RE1 A;  2IMW P;  1RT5 B;  1JJ2 R;  4PQU A;  2WBR A;  2RQC A;  2KYX A;  2B4U A;  1GQE A;  4G1Q A;  4DR3 F;  4LQ3 A;  2QLF B;  1S1W B;  2J0X A;  4ECY A;  5C2C A;  5L9X A;  3QNW B;  3IM8 A;  1JKH B;  2R7U A;  9ATC B;  3MEE B;  4UUX A;  1NUE A;  4B3O B;  4OIX A;  4HVZ A;  2DH8 A;  3UWT A;  4NCA A;  2M5Y A;  1N4L A;  2JC1 A;  2GJ2 A;  1OWX A;  2XNR A;  2QLW A;  4I1T A;  4KO0 A;  1QM9 A;  2M88 A;  3ZTO A;  1QUV A;  4KRW A;  2YH1 A;  2MQL A;  1CJT A;  1XMO J;  5HK4 A;  3G86 A;  5ETS A;  1L3S A;  2XMU A;  1JLF B;  2IJR A;  2JLG A;  1JB0 C;  3OXF A;  5EWF A;  1YDL A;  1FTR A;  3A1Y G;  3ET6 B;  3GYX B;  3I5B A;  4KPC A;  4MAK A;  1VC0 A;  1Q81 T;  1IM6 A;  3G82 A;  3FVY A;  4KGZ B;  1ZAW A;  2QLB B;  2VFT A;  2JH3 A;  1IBL F;  1XR5 A;  1FTC A;  1QJH A;  3IAM 9;  2XSF A;  1TL7 A;  4UW2 A;  3MHY A;  5EX0 A;  2OPR A;  5LMN J;  1JK9 B;  1PYS B;  4XPC A;  1BQM A;  2J6S A;  1A7G E;  3DRP A;  2JFD A;  4AYB D;  1MMD A;  2VPY B;  1ZTT A;  2PT0 A;  3HFK A;  2XS2 A;  1LWX A;  1C0U A;  3H2U B;  2FY8 A;  4C2M A;  5H9F J;  2QMW A;  3SDE B;  2I5J B;  4X4N A;  1MU2 B;  5E33 A;  1P1T A;  3P3D A;  2O01 C;  3T5H A;  4JP8 A;  3RR8 A;  4AL5 A;  1JXV A;  2QN6 B;  4FS1 A;  4F0K A;  3H42 A;  3CCW A;  2VG6 B;  3K0J A;  3V6J A;  3ZZP A;  4NXM J;  3UNY A;  2H9Z A;  1JLB B;  5IZH A;  2YX1 A;  1JLE B;  3NNC A;  1HQU A;  4ICL A;  4LQ9 A;  3KG1 A;  4U9R A;  4DFK A;  1ZZF A;  3EZU A;  3UFC X;  3PX0 A;  1IWA A;  2ZFH A;  3SZ2 A;  2KHD A;  4HEA 9;  5B09 A;  3DLG B;  1NSP A;  4QBU A;  4ECX A;  1IR1 A;  2EKY A;  5HLF A;  1RLD A;  3QGI A;  4Q0B A;  2XWY A;  4PXE A;  3QRQ A;  2BBE A;  1A0O B;  5GAD I;  2CG4 A;  1VRT A;  2RDI A;  3D4J A;  2UVW A;  3BV8 A;  1C1C A;  2J9D E;  4B08 A;  2N4D A;  1B0V A;  1TP7 A;  5ETQ A;  3CD5 A;  4FXD A;  1X5S A;  2R2R A;  4A8K A;  3H4B A;  1FX2 A;  3DM2 A;  4CNY A;  5J2N A;  3OT9 A;  3EIC A;  4ZVE A;  1W2I A;  4M5D B;  2NS1 B;  4YOE A;  3TAN A;  2W8K A;  1O51 A;  1HQE A;  1X31 C;  4DZ6 A;  2R8G A;  4K7Q A;  2HHS A;  3CCV S;  4F25 A;  2VQE F;  5J2P B;  1VQ9 S;  2OGU A;  1LNQ A;  1IR2 A;  3VF0 B;  4I67 A;  1VRU A;  2D7S A;  2GW8 A;  3GFH A;  3T1H F;  1MN9 A;  4EGL A;  1IXK A;  4NZ6 A;  2F4F A;  3PCO B;  2ZE2 B;  1U8W A;  1TAU A;  1OYD A;  5B0E A;  1XR6 A;  3H5X A;  1U1R A;  1AYE A;  3BDE A;  1GTE A;  3CME S;  2LQ9 A;  1WNE A;  1GX5 A;  2QRR A;  3EPG A;  3D3C J;  2O5D A;  2VV5 A;  1V3S A;  3I0R B;  4DWI A;  4P52 A;  2D1C A;  4YY3 F;  4OMF G;  1VJQ A;  1M90 T;  3CCS S;  2CWK A;  3W61 A;  1LW0 A;  2YWK A;  5KOX A;  4FS2 A;  3Q8Q B;  1ZM4 A;  1NXI A;  5C24 A;  3TAQ A;  1B0P A;  2UV8 G;  3W2V A;  5U47 A;  4A47 A;  4JI5 J;  1QLN A;  2GFF A;  2CWX A;  1CEZ A;  3SXL A;  4PXC A;  1UVN A;  3VAF A;  4CDI A;  1AZS B;  1FKP B;  2R4F A;  4PEO A;  3VGT A;  1XQI A;  1IR0 A;  5IFM A;  2MQ8 A;  1BY9 A;  2C3U A;  2A6O A;  3ZZO A;  4RKU C;  4RUC A;  3M2R A;  4IQM A;  1RT6 B;  3BBC A;  2CPX A;  2HNZ A;  2HVD A;  4ZP9 A;  2H4W B;  4UQG A;  3I9V 9;  3UDV A;  3CDE A;  2ZOG A;  1DY3 A;  3KG0 A;  2N4C A;  4LRE A;  3BF4 A;  3PYG A;  3CO0 P;  4FYY B;  4CLP A;  2GO9 A;  2XM3 A;  2P9G A;  2RKI B;  1EKR A;  3D0H E;  3BGL A;  4M5J A;  1A9N B;  1VK3 A;  2LQ8 A;  1T3N A;  2IA6 A;  2KXH A;  3VAK A;  3H40 A;  1JKH A;  3C6T B;  3TA0 A;  1RA7 A;  4B3O A;  1K0T A;  2ZM6 J;  2GIR A;  4X4Q A;  5FD1 A;  5KTQ A;  1HLW A;  3GWC A;  4LFA J;  1HNZ F;  3L4B C;  4IFV B;  2QSF A;  4O4R A;  3HKW A;  2YWG A;  1OYE A;  4DV6 F;  3Q8R B;  2GQQ A;  3IO1 A;  2UU9 F;  2MKI A;  2DNN A;  2L48 A;  2HAI A;  2D3O R;  1NH8 A;  4KGX B;  4N7T A;  5KFO A;  5IV3 A;  1EJ7 L;  1LXJ A;  2VFV A;  3T5K A;  2GS8 A;  3MPW A;  4UZB A;  1JLF A;  1YTY A;  4FN5 A;  4MYU A;  4P2S A;  4K5S A;  3IRX B;  1FRH A;  1YKW A;  4C97 A;  2LXF A;  2AJ1 A;  4ETX A;  3TQ1 A;  4L6V 3;  4BHQ A;  2OMO A;  3M30 A;  3JSB A;  3TVY A;  3FQL A;  2VFU A;  1T9T A;  4ZPD A;  3P45 B;  1VQL S;  1NME B;  5C7P A;  1NSA A;  1HNX F;  1S6P A;  3H4D A;  3PJW A;  1FXL A;  3NS7 B;  4X4U A;  1S1V B;  1SUQ B;  1FNX H;  3GII A;  2W01 A;  1RAB B;  1IBC B;  2HHP A;  1Y7P A;  1YRT A;  2XWX A;  4LF2 A;  2B9E A;  1VQ5 S;  1BWV A;  2QFJ A;  3CJ2 A;  1ULR A;  4PAA A;  2UUA F;  2XNQ A;  3SDE A;  1KQK A;  4KJI A;  3BH7 B;  2BJ8 A;  5D6G A;  2OPQ A;  4X62 J;  1QTN B;  3N0V A;  4ALZ A;  3VVU A;  2HK3 A;  2QA4 S;  1U09 A;  3DNC A;  3PFE A;  2EEY A;  1JLB A;  1E6V B;  2FLL A;  1D8Z A;  1U4B A;  1JLE A;  2X51 A;  1F2H A;  4G1P A;  5HQM A;  2BJE A;  4ZIV A;  2AW0 A;  4UY8 5;  2WBM A;  3CC2 S;  2G0J A;  1NJY A;  1O0P A;  2HGL A;  1W2B R;  1U45 A;  3MEK A;  3MR7 A;  1UL3 A;  5F3T A;  3MFI A;  3DLG A;  2W9C A;  3KMQ A;  3OFG A;  4LVN P;  2VL1 A;  5DG7 A;  4IH6 A;  1RT4 B;  3DKD A;  3DRY A;  1O5J A;  2RIL A;  4QU7 A;  1RAC B;  3KJF B;  5H1S V;  2V50 A;  4IOB A;  2B8Q A;  1JJ4 A;  4PG4 A;  3DHW C;  4IQX A;  2IC3 B;  5HQL A;  2OKQ A;  4F4K A;  3UVJ B;  2HND A;  2G13 A;  1SL1 A;  4MT1 A;  2PC6 A;  1UZD A;  1J5E J;  3ISZ A;  4M5D A;  4ZJO A;  1ARO P;  2VHG A;  1Q5V A;  5L1L A;  4NLV A;  4TLR A;  4C8O A;  2WVD A;  2X3G A;  2F8E X;  3SV3 A;  4OFZ A;  4XDD A;  4QPT A;  1S1X B;  4MH8 A;  4LFB J;  1WSV A;  3HHL D;  2PFF B;  2AJ4 A;  1O6X A;  2C22 A;  2EK1 A;  5J2P A;  3TWZ A;  3TX0 A;  2V4R A;  4X66 F;  1HIY A;  5T14 A;  4AQY J;  3QYY A;  2RAQ A;  5HQ8 A;  1FO1 A;  4QPX A;  2RF2 A;  3BGR B;  1WHW A;  1CJU A;  2AIR B;  3CED A;  4OJ1 A;  4ELV A;  2J0S D;  2ACM A;  3PG9 A;  4U96 A;  4LFC J;  1VFJ A;  4USH A;  2OTJ S;  2PA8 D;  3K7R A;  3TUZ C;  3J7Z 5;  2HZC A;  1Q8B A;  4JI4 F;  1FKO A;  1KLM A;  4B3R F;  1HHS A;  1NAQ A;  4U67 Q;  1HA1 A;  1IM4 A;  4HLB A;  4K0K F;  3I0R A;  3IBC B;  3LAM A;  4B9U A;  2CRL A;  2JLE A;  4FP9 A;  2JEI A;  3FFI B;  2E5J A;  3R5J B;  3W66 A;  1F5A A;  4DUZ F;  4OZL A;  2YKM B;  2HQD A;  3RJM B;  3CJ0 A;  2BA9 A;  2FY1 A;  2ILZ A;  4OI4 A;  5A0Y A;  2RH3 A;  4ATN A;  5KFH A;  3DRR A;  5CD4 H;  2B4V A;  2PSZ A;  4C8Z A;  3D68 A;  3G87 A;  3HHL B;  2C2R A;  1AZS A;  1FKP A;  2AGQ A;  4A8F A;  4J37 A;  3DOM B;  1Z1Z A;  4GO7 X;  3HHK A;  1KS2 A;  4DV1 F;  4J91 A;  3FSX A;  1JIH A;  3IS9 B;  3W5Y A;  3PW5 A;  4DV3 J;  3MCS A;  2H48 B;  2GJI A;  4RBU A;  2YWH A;  1S57 A;  2QL9 B;  4PR6 A;  2YNF B;  1RWK B;  2RUG A;  3WC0 A;  1NKB A;  3HHE A;  4MIA A;  4P74 A;  4LF5 F;  1RWV B;  2HFV A;  5DG8 A;  2RKI A;  2Z2Z A;  2IM1 A;  3UCZ P;  4YHH J;  1R8P A;  1K73 T;  3G6X A;  3TZY A;  3M8P B;  3G6Y A;  3I0S B;  1GMW A;  1UEU A;  2UVR A;  2F4V J;  4QIE A;  3CGI A;  2F8M A;  5AXL A;  2XY7 A;  2LKZ A;  4ECR A;  3MR6 A;  4NML A;  3C6T A;  1PYO B;  2VPW B;  2CQD A;  1T9U A;  4C8K A;  5ETK A;  4DV2 F;  2EK6 A;  4NA1 A;  2V8H A;  2ZJP Q;  1YJ9 S;  3W63 A;  1DFD A;  3WX4 A;  2VC1 A;  3RG6 A;  3KNG A;  3BKF A;  1TL1 A;  1S49 A;  4N77 A;  2KRB A;  3VZH A;  4M5M A;  1RAO A;  4NLR A;  1NJZ A;  3TAM A;  5B0D A;  4ZPV R;  4KGV B;  1T7P A;  2WRM A;  1ZA1 B;  1AUD A;  2OML A;  3IRX A;  1X4D A;  3PYF A;  1Z4U A;  3SCL E;  2XLI A;  3RW7 A;  3T41 A;  5CZV A;  2JVR A;  4PRF A;  1N5Q A;  1YGY A;  5A8W B;  2ZJR Q;  3BO2 A;  1IJF B;  2CJK A;  4DN0 A;  2YX4 A;  1X60 A;  3CMA S;  4G6V B;  1WF2 A;  1NDL A;  2Z56 B;  4ZVO B;  2ZDO A;  3ZTP A;  2W8L A;  4JI8 J;  3D6M B;  4DPW A;  1V9O A;  4DOZ A;  1RHJ B;  4OHV A;  5EWG A;  3DOL B;  1G4C A;  4NI2 B;  3D67 A;  3ZZY A;  1BLU A;  5CAB A;  1J27 A;  2PI5 A;  3SSS A;  1OIA A;  4BLG A;  3H5Y A;  4ED6 A;  2DGW A;  2ASJ A;  4DU7 A;  3LOU A;  5F8J A;  3F0N A;  3H20 A;  4NEZ A;  3G9C A;  4H4K C;  1J5O A;  1F9E B;  2MQQ A;  3AOA A;  2WVE A;  2HAF A;  2ROE A;  2BRK A;  2ILY A;  4L76 A;  3DCA A;  2Y8W A;  4JV5 F;  4EFA C;  4KB7 A;  2DHH A;  4WWS A;  1JNR B;  1DJ0 A;  3K8V A;  3K5O A;  4H4O B;  4OYB A;  2R7X A;  3TR5 A;  1HNI B;  4RBT A;  3OXG A;  2ZHA A;  5I3P A;  1UVM A;  3M6X A;  3PNI A;  3R2C J;  2HHU A;  2E1A A;  1U6B A;  1S5Z A;  1DAR A;  3DDK A;  4WIQ A;  1Y11 A;  4EBC A;  4MYT A;  2UXD F;  1B70 B;  4Q2L A;  2E5G A;  1NCL A;  4C0H A;  1HNV B;  4TY8 B;  1JLQ B;  3R3T A;  1Y0H A;  3R6L B;  2RHS B;  5HI7 A;  2HHX A;  2IC3 A;  3KLG B;  5F9L A;  1N33 F;  3UVJ A;  4MFB B;  3T6B A;  3CDA A;  1RBA A;  3GV8 B;  5KFQ A;  4P10 A;  2W25 A;  2MXY A;  4ZIT A;  4DUT A;  3HSZ A;  3BGF A;  1U2R A;  4ZHR B;  3LP2 A;  4N8O A;  2RRB A;  3QAU A;  3W5X A;  1S6Q A;  3ZTR A;  3PW2 A;  3GB0 A;  1KHW A;  3GQC A;  1R6V A;  4JI2 J;  3QO9 B;  1W7W A;  2I8E A;  3BGR A;  4IUF A;  2BDP A;  5C5J A;  1P27 B;  4OI0 A;  1VIX A;  3H98 A;  3B4M A;  3JSM A;  3GCX P;  2YKO A;  4TKT A;  5LMU J;  4YB1 P;  4ERD A;  2QMU B;  3ZXW A;  1LXN A;  4TY9 A;  1JNZ B;  1V5V A;  4I4B A;  1ZA2 B;  2XLK A;  3OSN A;  2QTW A;  3UDC A;  3D6F B;  2WVB A;  4LF8 J;  1AA1 B;  2H4Y B;  2EFG A;  3PW0 A;  2BVZ A;  1AFI A;  4DL2 A;  2M4M A;  2A18 A;  3MMJ A;  1ZOT A;  2W2Q P;  5D0E A;  5KFP A;  3SQG B;  4LF9 J;  2HW3 A;  3Q8S B;  3LGH A;  4DSI A;  4GVB A;  1H2T Z;  1JXL A;  3OVB A;  3N5B A;  4ZVS B;  1X4H A;  3MAQ A;  2B3T B;  1BWE A;  5IWA F;  1I94 J;  1XNQ J;  2HVH A;  2DNO A;  3CSK A;  5ETL A;  1RKI A;  4PXD A;  3TNV A;  3GFY A;  4DR3 J;  4QYZ K;  3DOM A;  2PGC A;  1HNW F;  3DHX A;  2NXC A;  3KLE A;  4TYA A;  5D0G A;  5KFI A;  4KHP F;  2UXB J;  2BAN B;  4IG0 B;  1KC8 T;  4ECZ A;  1NH7 A;  1DLO A;  4OZJ A;  1C0T B;  2ASD A;  1WKL A;  1UWA A;  3QQC D;  1X0F A;  3BGU A;  3HZG A;  1UEK A;  2VOD A;  5AXN A;  4NA3 A;  5E3Q A;  3QGP A;  2COL A;  3HD1 A;  1RT3 B;  4QIF A;  3NMR A;  3BQ2 A;  4HHJ A;  1F6T A;  2HQG A;  2HWT A;  5KOW A;  3M8P A;  4DX5 A;  1ZH5 A;  3LP0 B;  3NGR A;  8RUC A;  4KV8 B;  5F8L A;  3FRZ A;  2YQ0 A;  2EFN A;  4FYV B;  3KLI B;  1L3K A;  4HYK A;  1T94 A;  4DG1 B;  4M95 A;  2HS4 A;  2F65 A;  2L08 A;  2XZD B;  4CLS A;  2BW7 A;  3KK2 B;  2Y9H A;  2V68 A;  2R7O A;  2Y8Y A;  3R5B A;  4EBD A;  1H74 A;  4N41 A;  2UVV A;  1OS5 A;  3M2V B;  1NK7 A;  3T1Y J;  4M1K A;  1VIO A;  2FUG 9;  1S9G B;  1IQT A;  4JBC A;  4OYZ A;  4F26 A;  1U24 A;  4OI3 A;  4BC9 A;  2MKK A;  1SV5 B;  2XS7 A;  3EGV A;  4DF8 A;  3CC4 S;  2BMB A;  1HWJ A;  5AXK A;  1H2U X;  1Q82 T;  2ZDP A;  1T3O A;  3W9I A;  3MM7 B;  3HSD A;  2WCX A;  1VC5 A;  1X9M A;  4A4J A;  2VQF F;  5E5N A;  1WI6 A;  4CH1 A;  3M8S A;  2B6A A;  3N9U C;  3UN3 A;  3M6V A;  1YIJ S;  1VCT A;  2XO7 A;  4HT5 A;  5A8W A;  3M9N B;  2LEB A;  1WEX A;  3HVW A;  5K8O A;  2B56 A;  1FJC A;  4HR2 A;  2HUR A;  1EX8 A;  2IYI A;  2MKH A;  1S7H A;  3U1L A;  1YX2 A;  4WFX A;  4RUH A;  3DGV A;  5ETV A;  1M5S A;  6AT1 B;  1SJQ A;  3KUH A;  5JVG Q;  2HPU A;  5HMW A;  1EKS A;  5D4P A;  1S1U B;  5KT4 A;  3C16 A;  2OEJ A;  2FQQ B;  2XC9 A;  2W24 A;  2CNL B;  3N5F A;  1G1X A;  3CMQ A;  2PN6 A;  1OJ4 A;  2DNQ A;  4KPY A;  1QDU B;  4F7V A;  1KFD A;  3TZX A;  1T05 B;  3EYZ A;  1IUJ A;  5D4L A;  1K1Q A;  4DR7 J;  3PRD A;  3LWM A; 
#chains in the Genus database with same CATH homology
 2C2O B;  1BMQ B;  1SC1 B;  1RWM B;  1PAU B;  4JB8 B;  2CNN B;  2XYH B;  1ICE B;  3SIP B;  3IBC B;  3KJN B;  1RWN B;  2HBY B;  4ZVP B;  3P4U B;  1RWW B;  3R5J B;  4ZVO B;  3R7N B;  2CJX B;  2CNO B;  3D6M B;  1GFW B;  2C1E B;  1RWO B;  3RJM B;  1RHJ B;  2H5I B;  2XYP B;  1PYO B;  3D6F B;  3R6L B;  3GJQ B;  4ZVU B;  4ZVQ B;  1QTN B;  3GJT B;  2QL5 B;  2CNK B;  1RHQ B;  2H4Y B;  2H4W B;  2H5J B;  2Y0B B;  4ZVT B;  1I51 B;  1RHK B;  3D6H B;  1RWP B;  3EDR B;  3GJR B;  2P2C B;  1RWX B;  2QLB B;  1RHU B;  2C2M B;  3R7B B;  3GJS B;  2QLF B;  2HBZ B;  4DCJ B;  5IC6 B;  3QNW B;  2CJY B;  2XZD B;  3IBF B;  4ZVS B;  4DCP B;  1F9E B;  2HBQ B;  3EDQ B;  2H54 B;  2CDR B;  3R7S B;  2FQQ B;  2C2Z B;  1I3O B;  1RE1 B;  3KJQ B;  3P45 B;  2H65 B;  2H48 B;  2C2K B;  2CNL B;  1NME B;  2QL9 B;  2Y1L B;  4LSZ B;  2H51 B;  2HBR B;  2QLJ B;  4DCO B;  2XYG B;  2QL7 B;  4ZVR B;  1RHR B;  1RWK B;  1QDU B;  3NS7 B;  2DKO B;  1SC4 B;  2XZT B;  5K20 B;  1RHM B;  1SC3 B;  3R6G B;  1RWV B;  3KJF B;  1IBC B;  5IC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...