2C2MB

Crystal structures of caspase-3 in complex with aza-peptide michael acceptor inhibitors.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
103
Chain Sequence
b'ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-3 SUBUNIT P17
publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 103
sequence length 103
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2005-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2c2mB00
2FQQB 3P4UB 3D6MB 3QNWB 2HBRB 4ZVSB 1RWWB 3KJQB 1RWPB 3GJSB 2QL7B 2H4WB 1PYOB 2C2ZB 3RJMB 3R7BB 3SIPB 2Y1LB 1BMQB 3R5JB 3KJFB 2XYGB 1SC1B 3IBCB 4DCJB 1RHUB 2QLJB 2C2KB 2DKOB 2QL9B 2XZTB 3EDQB 3GJQB 2XYHB 2CDRB 1SC3B 4ZVQB 2CNLB 3GJTB 1RHQB 1RWMB 2CJYB 2QLBB 2H51B 3IBFB 2H5JB 2H54B 2HBZB 3GJRB 1GFWB 2CNKB 3R7SB 2CJXB 2C2OB 1RWKB 2H48B 2C1EB 2C2MB 2XYPB 1SC4B 2HBYB 2CNOB 4ZVOB 4DCPB 1RE1B 1I51B 1NMEB 1RHKB 2H4YB 2Y0BB 2H5IB 1RWNB 4ZVUB 1RWVB 3KJNB 2P2CB 4JB8B 1F9EB 5IC6B 1QDUB 3R6GB 4ZVPB 3EDRB 4ZVTB 1RWXB 4LSZB 3P45B 2H65B 3D6FB 1I3OB 2CNNB 1ICEB 1RHMB 1RWOB 5IC4B 3D6HB 3R6LB 1QTNB 4DCOB 1RHJB 5K20B 3NS7B 4ZVRB 2QL5B 2QLFB 1IBCB 1PAUB 2HBQB 3R7NB 2XZDB 1RHRB
chains in the Genus database with same CATH superfamily
1KHWA 4ERDA 4HVZA 2JEFA 1HBOA 3BKFA 3K5MA 4Y2KA 4NLUA 3NLCA 2VIHA 3H20A 3MD1A 3PO5A 2BX6A 2RU3A 4WPAA 1P9QC 4OI0A 4PPDA 1BQMB 3CT9A 3ILOA 1UCNA 5L8RC 4LFCJ 3DGVA 2PFFB 4DV7J 1RHQB 2KL8A 4TNOA 5DG7A 3MR2A 5KFLA 2CQPA 4QR1A 3A13A 3D68A 2LVWA 4Y3CA 2DNKA 2ZE2B 1RYSA 2AYMA 3FFIB 4ZDNA 4FXDA 5F3ZA 4JI8J 3R1HA 4NLGA 4IO9Q 4YR2A 1YBAA 4F36A 3G6XA 3QT7A 3PTWA 1TTHB 5JJBA 3Q8PB 4J37A 1NK9A 3BN4A 4G1IA 5IS2A 2FHJD 5GMKa 2JFKA 5J2MB 1JJ2R 1B7FA 3TO8A 3MMAA 4YHHF 4O0IA 2C3PA 2VZ9A 4KV8A 3BGUA 4I2QB 2AQ4A 2R7VA 2F3JA 3UDCA 3F56A 1E6YA 4IUFA 1TR0A 1CJTA 1N54B 3OQ2A 3L7UA 5GAEI 5KOXA 1BUXA 4UT4A 2NUHA 1UJ4A 4NA1A 4Q44A 2XEXA 2XLIA 4O44A 2IM2A 2RRAA 3CD0A 4XPEA 3VALA 1DY3A 2HBZB 4WJBA 2B4UA 1WC6A 3MR7A 4HI2A 1OSCA 3DOKB 4ED0A 5KG1A 4C8ZA 5DLGA 2B3TB 3D0IE 1XJWB 4OI1A 4RJVA 2CA9A 1FCAA 2VFTA 2NXJA 2CQ0A 2U2FA 1LFPA 1UJ6A 1QDUB 1XMQJ 3PM9A 2OPQB 4GKJF 3OSPA 4LBPA 1Y5LB 1JLQB 4YP3A 1U1NA 3DLHA 3ZZPA 1ZH5A 3QNWB 1F9HA 2I1RA 5D77A 1YK9A 2GHPA 1J5EF 2ZZTA 1G3OA 4ZIVA 3DN9A 4X62J 4OHYA 1NPRA 6AT1B 3G8TA 2FY8A 2QG9B 3M7VA 4DI6A 4WE1B 4OX9J 2LYVA 1T11A 1VBYA 1NJIT 5I42B 3RAXA 1BC6A 4B3MJ 4M1KA 2P5VA 1FNMA 2CNKB 3H2UB 4URGA 1HBUB 4QU6A 1F9FA 1Q8IA 4RW6B 5J2NA 3E01A 1PIEA 1JNRB 3MCMA 3QRRA 4ZVPB 1EB0A 2JL9A 3K7RA 5H9FK 1KLMA 1PJ6A 2ASYA 1RHMB 4TU7A 1C2PA 1CG2A 2KXHA 3M8ZA 2CVEA 1S4EA 1UWBA 1B7YB 5AJ3J 2KYZA 3SSRA 1KONA 4ZS6A 1YITS 2CWKA 2L9DA 2VBYA 3KHRA 1T05B 3NCQA 4MTPA 1WHXA 4I0WA 2OAUA 4DV5F 2C3OA 2XY7A 1SQEA 4DR4J 1U1PA 2HPUA 5D4NA 1VHFA 2CNLB 3LF0A 2O66A 4DR5J 5C25B 1Q95G 1TKXB 1D3WA 4O3QA 4A8MP 2WAQD 4RWXA 1RLDA 3ZNJ1 1TK0A 4RX6A 2NXUA 2L41A 5KFKA 3N28A 1L5UA 1IKVB 1Q8KA 2DHXA 3PX0A 3AXMA 1MMDA 3U1NA 5M2RA 2FLPA 1G1XA 1HI1A 3GFZA 4J5OA 4USTA 4QW9A 3G6VA 1U8WA 1S6UA 1O5JA 1U0HB 1FWPA 3KNAA 1S59A 4YN3B 5HSPA 3QFHA 2IRXA 4IRKA 4C0OC 2H5EA 2HVHA 2JHEA 3RU0A 5H9FJ 3HF5A 3UWTA 5HMYA 1WHWA 2ZBCA 1A7GE 2Z2ZA 3J81j 2RF2B 2YXLA 3CCLS 4HT5A 3VVUA 2ZHOA 2GVDA 5BYRA 2DO0A 5BYSA 4KO0A 4F4AA 5A6PA 1FDNA 4Y65A 2E5JA 4WZMA 1VRUB 4M5JA 1NJXA 1L3VA 2MGZA 2ZH7A 4RW4A 4DN9A 2HNZA 2HYIB 3PX4A 3BJYA 3G86A 3PW7A 3R5GA 2H51B 1X5TA 3TUPA 1TVRA 4FVCA 2E1AA 4ZHRA 4F3QA 4OI6A 2JWNA 4LSNB 3CJ8A 3M30A 3NWGA 2CJQA 3KHLA 5B0GA 3MM5B 3QJPA 2GHVC 3GR0A 4TY8A 3AT1B 4RW7A 2UXBF 1Q4RA 2GVZA 4JI6F 4QYRA 1RAJA 3N4WA 3KK2B 4MT1A 1WI8A 2X1FA 4R8UB 3U02A 5E3PA 1SH2A 3UI3A 2W25A 2HRUA 3VVTA 2LXFA 3JXOA 4KB7A 3IS9B 1RTDA 3RYLA 5HK4A 4MIWA 3F44A 2P6SA 3BN7A 5M2UA 3B6BA 3DLBA 3HHLB 1FVQA 2EXUA 4O4GA 3DRRB 3VZIA 1IM4A 2EFOA 4LFBF 4LSLB 3CCES 3OJUA 4LFAF 2GQ2A 3S01A 5D4OA 2C28A 1WORA 2V8HA 3FSIA 1N52B 2HAFA 3CTRA 2HHUA 2X1BA 3C19A 1J2VA 2IM1A 3SV4A 1OPIA 2UVUA 3NNCA 1JLEA 3QAEA 1DTTA 2EFQA 2KG1A 4OHWA 1R89A 4JV0A 4MK9A 2C3MA 2ZJRQ 2DCUB 1YLXA 3G96A 4PRFA 4E8UA 4ZVEA 4Y34A 2JLEA 1R3NA 1ZAXA 3PRBA 2UUAF 4K50A 1X4DA 5SUHA 2AX0A 2O5DA 3CO0P 2M88A 3AOAA 1NJZA 1IUJA 2XCAA 4JI3F 2P6TA 3TQEA 3EE3A 5DDOC 1RDRA 2A2CA 4CO2A 1FK9A 3HX9A 2HSEB 4E2FB 4FVMA 4I6YA 1T94A 2U1AA 2FGCA 1R0AA 1YBUA 4K5SA 3IA0A 4W98A 5CXTA 3MEEB 2ZBQA 3Q0AA 3TZWA 5F9NA 1AXQA 1WJ9A 5KT5A 4MKAA 2DD8S 3W2VB 4C8OA 2EFNA 1O6XA 1C1CA 2BABA 2E1PA 3U7JA 1W2IA 1QAJA 3CJKB 1BWEA 2ZDPA 1KBRA 5SZTA 4N47A 2R2SA 3AOBA 1UZHA 3PO4A 1S0VA 1RISA 1JLFA 1N8RT 1S6OA 3QGGA 3M4XA 3ZXWA 2XZDB 2ZH2A 2ZWOA 2VG5B 1RAAB 3IMQJ 1VK3A 2E7XA 2MKJA 2MKHA 1RB0A 4A47A 2LU1A 2ZM6F 2Y1LB 2VFUA 2PA8D 3LAMA 2ZH6A 2DNHA 1RHUB 4DV3J 2F8HA 3HDSA 3GMGA 2BJEA 2JVRA 4KKOA 2W2MP 1SC6A 1RT4A 5CCLA 2AEJA 1TMJA 2OFHX 1EP4A 3G2XA 4QWEA 4ZVQB 3T6BA 4OZNA 1U49A 4OYAA 2MLZA 1AW0A 1FKPA 4DQIA 4I56A 2C2OB 2HHTA 4IOCQ 5CD4H 2LFVA 1M5OC 2B4OA 2NPFA 5F8NA 4WXOA 3Q8UA 5G0RB 5HI7A 2R7WA 3FEZA 2ZJPQ 4FNHA 3P45B 3PFOA 2CNNB 2AYEA 1XMOJ 2B7BB 5K5MA 1H2UX 4WWSA 5GAEU 1BLUA 4NLDA 4ZCKA 1XEZA 3VAJA 3TA0A 1FVSA 1T9YA 1WC4A 2BEFA 4ECTA 3PEJA 1KOOA 4IRDA 4CTAB 1EJ7L 1MSWD 3MECB 4I67A 3MWBA 4UY8T 3EXCX 4HHHA 4OI2A 1K1QA 3I0RA 2KZMA 5L46A 3D4JA 2VFVA 2N4CA 4N76A 3G71S 1U45A 1X9WA 2KRRA 2VV5A 3M6VA 3UD5A 4IH7A 4FKXA 4DL2A 2WONA 4MK7A 4PUOB 5ETQA 4JI5F 4LF4F 1HR0J 3AA8A 4KGMA 2OPPA 1PC4A 3UN2A 2ILZA 5HROA 2LEAA 3ZZTA 3T19A 1LV5A 3M32A 4DV5J 2D3ZA 4YQWA 3SZ2A 1AZSA 3MAHA 1U26A 2K7JA 3NS5A 3N79A 2ADBA 1RWNB 1LKZA 3HZGA 5CH7B 1TUVA 4LSZB 2V8VA 2GW8A 1FJ7A 3RZAA 3WIUA 1CVJA 2RIJA 1VC5A 1KS2A 2YH0A 3H7HB 3HFZB 1P27B 4AFFA 3UE2A 5IV3A 1T9TA 1NDCA 3K5OA 4YEAA 4KC5A 2BW7A 2RVJA 5LSOA 1N33F 2CPZA 2CFXA 1LW0B 2UZAA 2ZD1B 4TU9A 4V19X 1LWEB 4B3RF 1BQMA 1BY9A 4FN5A 2LQ9A 5ADZA 3PHEA 2VASA 4C3LA 1NJYA 2KYXA 2DR7A 5L1KA 2G4BA 2XO6A 3BBBA 2MLYA 1VHIA 3FBBA 4PWWA 4DFMA 2RDJA 5D78A 2NR0A 4PWDB 3BH6B 1KQKA 3OR2A 4ED6A 4DN0A 4KH0B 4UZBA 2HFZA 3IBFB 3FFIA 2HWHA 3GIJA 1U1QA 4IG3A 4NA2A 2KU7A 2QMWA 1FX4A 1JJHA 3OBIA 4B9TA 3V81B 1CJUB 2JSXA 4Q45A 3CCJS 4FS2A 3JAMY 2DNLA 3NBPB 3EWGA 3D6TB 3EYZA 1HARA 1UWAA 3H5SA 1MNEA 2AYGA 2IYGA 1IR1A 4PG5A 4ZPAA 3G8QA 2W2QP 4ZPVR 1OIAA 2MQMA 4U7UK 2W1BA 5EX0A 1CJVB 3PR4A 4JI6J 3CCQS 3TJ8A 1B3TA 3W60A 4MMOA 4OZ1A 2W8LA 2W8KA 4XO0A 3UR0A 3QIDA 2PA3A 2VQFF 3KKFA 2KDOA 2YPYA 3AD8C 2VICA 5F8IA 2R3VA 3MFHA 3P5BP 4K5RA 3DOKA 3TRGA 3HO1A 3V6KA 3ETMA 2KG0A 3K59A 1U0SA 3D28A 2XQCA 1HYSB 1G4CA 3DXBA 3QGHA 4A8OA 4O4RA 3PR5B 1RT5A 3EGZA 4URSA 2OPQA 2B43A 4LF8F 3WX4A 4LFBJ 1SKSA 2LEBA 3LH2S 3KJNB 3V6HA 1WTFA 3MPDA 1YJ9S 3R6GB 2X3DA 1VFJA 2JX2A 3ZTRA 1I3OB 2B8QA 5IQ6A 3NMRA 5I3QA 1JKHB 1QUVA 1H0HB 2NPIA 4OYOA 3HM9A 3T5KA 1Q5VA 3GG0A 3ET6A 4Q0BB 2FZKB 3R7BB 2IM3A 2A18A 3K58A 1LWFB 2MQNA 4JYAF 1MU2B 2OEJA 4ZN1A 3VTIA 1PYTA 4F67A 3O1LA 2QMUB 4WE1A 3H98A 4EZ9A 4ER8A 3LP2A 4EGLA 5I42A 2N3LA 4KAIA 4LQ3A 4K8RA 3ELHA 3E2EA 5KT4A 3LANA 4WIIA 2IVMA 1HBUA 2OFGX 4LREA 1RWUA 4DHVA 1PILA 2DGSA 1JX4A 2J7WA 5HP1B 1M1GA 2H48B 4CQ1A 1ZS6A 2WVEA 5CYQB 2VG6A 5L1JA 1B0VA 2J6TA 3CMQA 2PT0A 2XCPA 1OSDA 1F60B 1YZ6A 1VI7A 3H25A 1HBNA 1LEOA 4H4OB 2DH7A 4O3OA 1ZM2A 2BJ7A 2QGFB 3N5BA 2RMLA 1JLCB 2G2YA 3TX0A 2BQ3A 2QLFB 2OIHA 5E5NA 5KG2A 4K0KF 4C11B 2E9TA 2M4MA 1XERA 4QYZJ 2LCWA 3O2IA 1BMQB 3R5JB 3PY8A 5CYJA 3D7SB 4NLYA 3RAMA 2A1BA 4KHRA 4E0DA 4N41A 1CPZA 3I5AA 2LQBA 4DPTA 3CNQP 1UKUA 5C25A 5HMXA 1TKXA 2MZTA 2XWYA 2ZM6J 2XZWA 5B08A 2LU2A 4YFUA 3R5CA 4CLWA 3QATA 4OJHA 3FKBA 4PABA 3TAPA 4B9VA 3HJFA 4AXJA 1RWKB 4Q2MA 2C1EB 3MM6B 2YKOA 2KHDA 4WCEQ 3HXMA 4KSEB 2NCKL 2XY5A 4EO8A 1Q1KA 4NMLA 4P6QA 1FDAA 2D3O1 1U0HA 3SFGA 3PFEA 1LQ9A 1MN7A 1UFWA 2FC9A 2ZEJA 2XGPA 4OYMA 2HHXA 2MJUA 2V9KA 2NREA 1KOHA 4RNOA 2HGMA 2UUCF 1N32F 2RF2A 2XLJA 4KE5A 2DPIA 3A8EA 2AJ4A 1QY7A 3KUHA 1NK0A 1VRUA 2OD6A 5A2QU 1HPZB 4ES3A 2R8KA 3W65A 4JI0F 2O1PA 2YKAA 4LF9F 4MKVA 4JUZA 1DQ9A 2RKIB 3N0VA 4LSNA 4JI4F 1XR5A 2VPWB 1S7IA 2PEBA 5HVHA 3MM5A 2YNGB 1RT7B 4NA3A 4WK1A 3FRYA 4GKKJ 3EJMA 1SC4B 2I2YA 5JVHQ 2CNOB 1FXRA 1IBKF 3E3XA 4O3RA 1HMVB 4WFYA 4M5HA 2M8DB 3CJQA 1FE0A 2AJ1A 3QYYA 4CLTA 3V6DA 3KK2A 3BGRB 2BM1A 3HK2A 4R8UA 1XR6A 4OJ3A 4CLKA 1ZM4A 1WDDA 1HNZF 5F41A 2DRBA 4ZP7A 3WHIA 1VLOA 5CYMB 2BJ8A 3IS9A 4NL5A 1UW4A 4GC7A 4F0MA 2FHJA 5CD4A 3EX7B 3DOLB 4HACA 2BZ2A 3R97A 1AT1B 1HWUA 1EKSA 4QW8A 2VPYB 2V94A 3EMTA 4C8MA 3SEOA 1OPZA 4O3NA 2L9NA 3GB0A 3DRRA 4UQGA 4C9DA 1EAYC 1LK7A 3HZEA 4LSLA 2V9WA 3EM1A 2V4QA 2LMIA 1RAHB 2KJVA 3W5YA 1RWMB 2VJUA 2XGQA 4DPOA 2Z2LA 1N5VA 1X4EA 3GV7B 1FNXH 5LMUF 1FWKA 2DHSA 5DJBA 4CLUA 3T5LA 4IG0A 3FCHA 3ILIA 3Q8SB 5KG0A 1F2GA 2WBRA 4QQBA 3C3LA 5D6GA 4MFBB 3BDEA 4ZKAA 3JB9k 1GNKA 3AB4B 1P1TA 1CBKA 4CNZA 4LRFA 4HEA9 3BO2A 3H5UA 1UL3A 3MPYA 1RWWB 1NB7A 1KQGB 3UDVA 5CA5A 3GYXB 4X4OA 1U1OA 4ZCIA 2O01C 4DV4J 2BJ3A 2VJVA 3ILJA 2MQPA 5K14B 2F65A 1QAYA 5D0RA 4DV0F 2W9CB 4WFXA 4CT9A 5IT9Y 2DRAA 3ZZUA 3MEEA 2NUUG 1PAEX 2RRBA 2C3UA 4LRAA 3W2VA 4ZP8A 3OD2A 3JSMB 1F5BA 2ZKUA 3AJ1A 7AT1B 8AT1B 3CJKA 3MURP 5KG6A 5EWGA 4B9NA 4DS4A 2Z2MA 5ETNA 2YTCA 5KFXA 5C7PA 5J2PA 4J9SA 5A8RB 5A2QY 1DQ8A 4ECUA 2JC1A 4B3TF 4N7TA 2A10A 2Y9HA 5LMNJ 1K73T 3PZPA 2YNFB 5HVFA 4FS1A 3BS9A 4M8LA 1NUEA 1O8BA 3Q89A 4NXMF 4LF8J 4NCAA 4F4WA 3HSDA 4ZVSB 2XMTA 1QAXA 2E5GA 4U8YA 3CIZA 2C42A 3AAWB 2FLOA 2YVSA 2VBZA 3T1YF 3FBFA 1HQUB 2OP5A 2VODA 3H2LA 2HVIA 1UMJA 3T41A 4DLEA 4LRDA 3CUNA 2JEJA 8RUCA 3DGPB 5F8LA 4Q8FA 1R8PA 3W2WA 3D2WA 4K4WA 1I1GA 1YJ7A 1FJGJ 1R8HA 3P49B 4DZ6A 4WYLA 1TKZB 3Q22A 4OI3A 2DYAA 2E1RA 4ECYA 1FFSB 3NS6A 2F4VJ 2UUBF 3DMJA 1F3FA 1FE4A 1JXEA 3VWSA 1F5AA 4ES1A 1QUPA 3DYAB 2ZZNA 3WZ0A 4UUWA 4IFYA 3J7AN 4MKBA 3DM2B 2CPIA 4ID8A 4DUYJ 5HANA 1IBCB 5LL6d 3J7Z5 1UPMB 2F9JA 1K8AT 2XMKA 2GV1A 3OL9A 4OZ2A 2QYCA 3TVZA 1I5OB 1F0XA 4WZQA 4LF5F 3KJVA 1RK8A 1LFWA 3FBCA 5DZ7A 2YH1A 3EGVA 3BR9A 3O6QA 1HQEA 2OPRB 3I0SA 4ZK7M 2CQBA 3C6UA 5DQIA 3B78A 4ZP6A 3HFVA 3MMBB 5F8JA 2JRSA 1WTBA 4EI2A 1FKAF 2ACMA 2YBVA 2HVDA 3R2DJ 2E9RX 3D67A 3PXGa 4ECXA 3QLHB 1NNDA 3C66A 4DV2F 1TUWA 4ELUA 2WBMA 3T9ZA 2B8PA 1RT6A 4MJKA 3J80U 1HD0A 4ILRA 5DLFA 1HKAA 3IWNC 3OPKA 4P10A 3DOMB 4OHXA 3JQMA 2ZD1A 3T6JA 1KRPA 1LWEA 2HBQB 4ATNA 2AV5A 2MY7A 5MLCV 4WFZA 3FQKA 3KHHA 1CJKB 3SSQA 4MH8A 3OT9A 1JXVA 1VQ6S 2Y3YA 3D66A 1SKUB 4TXSA 5JUMA 2VPZB 4WBFA 3TEHB 4KGXB 1M0SA 3ISNC 1QTMA 1W7WA 1CQNA 2UUCJ 1N32J 1HI0P 1S97A 3CO9A 1RKIA 5HO4A 2OHDA 3OLAA 2QN6B 3CCUS 4RUHA 4QWBA 2R9LA 2BV3A 3V81A 4JI0J 1RTZA 3LGHA 3KK3B 1OYEA 3GV8B 2V68A 3NBPA 3AJDA 5KFPA 1UETA 2BANA 1WOSA 2FJWA 2J9EA 1OWXA 4JI4J 5KFCA 4JB8B 4NLSA 4RLEA 3BSOA 2RJZA 3DLLQ 4Y2MA 1RT2B 4R25A 1WC1A 1HNXF 5B0FA 2M2BA 2RUGA 3CJRA 3W8PA 4C0BA 1TK5A 4Y00A 4NRTA 2KRBA 3NOGA 1GTEA 5T14A 1YJUA 2HHHJ 4UOHA 3UQSA 2HLTA 3GR1A 3SFUA 5C42B 5M2PA 3MEDB 1N88A 2KTQA 5LSLA 1YRUA 4ZA1A 2UP1A 1MMLA 1QM9A 4NYOA 3MAAB 2BKNA 5C2GA 4NCGA 1UEUA 4X4QA 1OJ4A 4M5NA 1SPBP 2QSWA 2OEMA 4LR8A 1WF0A 3T1AA 2KT3A 2H9ZA 3C8YA 2UUWA 1IJEB 4DSKA 4TKTA 4K4YA 2YX1A 3R2CJ 2YY3A 2DTJA 3DLGB 1RE1B 2ZJQQ 3J7A1 2NYIA 1L3TA 3BSNA 1JKHA 1VMBA 3CCZA 4R5PB 3R27A 4ECSA 3J81U 3BB5A 3NAHA 4BLGA 3JTPA 3ZFVA 4Q0BA 4A8QA 4CLZA 2MZQA 5DGAA 1FA0A 4J9MA 2AGQA 4OV1A 5F9LA 1MU2A 3CC7S 2RS2A 3TYTA 2IPOB 4DPUA 1NBEB 4DWIA 3UN5A 3KNGA 2LQJA 5A6WA 1MWQA 3FCVA 3JSRA 3ICLA 3DCAA 2E66A 3OTCA 4PZVA 1S6QB 1MROB 3BKUA 3RUBL 2I8EA 3FZBA 1S4FA 1HLWA 2W2OP 2ROGA 3BBFA 2DXEA 4W90B 4ZPTR 1BQNB 3D9BA 3UD4P 2QRRA 1Q0NA 4H4OA 3TAQA 4KHMA 2HQCA 5DO2A 4NOHA 1JLCA 3JQKA 4NCBA 3CDWA 3MM7B 2K1RB 3K5PA 1XC9A 1X5SA 4OLOA 3J7YI 1CULA 1S99A 4C11A 2KH9A 3D0HE 3P5TL 3NGKA 1HD1A 4TLRA 3KLEB 1QLNA 1UAWA 3WDOA 1YTYA 5F8MA 1KLNA 2CJKA 3PKYA 4HI1A 3W9HA 2XS7A 4ILMA 1R27B 2XYGB 2W7OA 1WACA 2HGLA 1NH8A 2VU5A 2XSJB 4ECQA 2Z57B 3OFGA 3NGTA 1H72C 3PDNA 4CRJA 5B0EA 1T95A 5KFRA 4M5DB 3LW5C 5HQLA 3RAQA 3MM6A 3MPUB 3M8PB 1ZTWA 2CJXB 2IMOA 1X7VA 4G65A 3MUVP 4P2XA 1T0TV 1DTQB 2IIHA 3MMCB 3PIPQ 1TL1A 4IR1A 2WSFC 1LXNA 4TYAA 2LEPA 2LLZA 1JIHA 4N8NA 5ETMA 1C4CA 4DV7F 3H8YA 2JOQA 1NDKA 2PFDA 4RUBA 5HBMB 3VF0B 3PYGA 1EZZB 4ECVA 1TFWA 3VAHA 2UUBJ 2WK4A 2WCXA 1Y7PA 1OO0B 3RBZA 3GPAA 3QGIA 1HPZA 4JI8F 2IBKA 2R8GA 1JLAB 2CZ4A 1CS4A 4IQMA 1ACMB 3QBCA 1U48A 2RKIA 1KKHA 4DX6A 2HZAA 3FBEA 2HVEA 3C6TB 5A76A 2G1HA 1SC3B 2YNGA 1P6TA 4FYDA 4LF5J 3VGTA 2QFJA 4X4PA 3G9CA 4KJIA 3PW5A 4M95A 3TUZC 1RUSA 1HMVA 1KEKA 4I69A 2C2MB 3BGRA 5DM6Q 2BR0A 1NMEB 4LF1A 4UTGA 2R2TA 2YKMB 3M8RA 4X4SA 3ZTOA 2HHSA 1R8AA 2DY9A 1ZPWX 1RTJB 3GTYX 3LWMA 5CYMA 3KYLA 1FNOA 2G2ZA 1N36J 3DOLA 1B4SA 3DRPB 4W4MA 1T03B 2RAQA 3DC2A 1LOUA 4JOUA 4DV2J 4PQAA 4OX6A 1NU4A 1VQLS 3BYRA 3CMAS 3NAIA 4IKAA 2B4VA 1MLAA 2J8SA 5D3GB 4P9SA 2GO9A 3KJFB 3DLKB 3QRPA 3K8WA 3TZZA 3CE8A 3T1HJ 3QIPB 5HJXA 1XMQF 1SBRA 1VBZA 3LO3A 1ZAWA 4QR2A 1MWZA 1X4BA 5C24A 3K17A 2L08A 4NZ7A 5IM0B 5B09A 3KLFB 2HS0A 4YDDB 1ZM3A 2ZH5A 2JJ4D 4A8YA 1VQKS 1WEYA 1XK8A 2G1DA 2V69A 1VRQC 1SJQA 4LF7F 1T9VA 5J1EA 4I68A 1RT1A 2XMMA 2DB1A 4FNIA 1NPPA 9RUBA 2K3IA 2V5HG 2CQCA 1IWAA 1YDLA 4MFBA 1RAFB 1QSLA 3OTOJ 4U95A 2OJ3A 4OX9F 2V50A 2Z56B 5K20B 2YWGA 4DF8A 1BWVA 4M5KA 1X9SA 4B3MF 4V19J 1V5VA 3BQ2A 2DH8A 3H2VE 1RA7A 5B0CA 4K2XA 3CCTA 3GIMA 1RWPB 3FRZA 5K14A 3MGJA 5KT2A 4LBHA 2W9CA 4YMEA 3UR3C 2IDEA 1RADB 5KFYA 3EVWA 3M2RB 2VFSA 5GMEA 2DY1A 2HQDA 1N0UA 1XNRJ 4X84A 3OUYB 3JSMA 2ABYA 2KFNA 1SUQB 2YWHA 3SQOP 1NK8A 1TKDA 1UJ5A 2POKA 5THWA 3F41A 2DHAA 1FT8A 3P8BB 1VIOA 3S6EA 5KT7A 3H4BA 4OL8A 3H4DA 5A8RA 1JLBB 3M8WA 1XR7A 1XIQA 4ZIWA 2R42A 4AYBD 2HVZA 3QT6A 1IR2A 4IO1A 3OTDA 3VZHA 2HWTA 4DR4F 4YB7A 4DQPA 5CABA 2BJ1A 2H65B 1YJNS 4HYKA 2CPJA 4IFVB 4O3PA 4I2PB 4QIGA 4QWCA 1SB6A 2CZVC 5D4PA 1IBLF 2KT2A 2ZOMA 2OTJS 4GVLA 3KMQA 2DISA 2WSCC 3SIPB 4FYWB 3PIOQ 4U7UD 5FLXY 1VRTB 3OR1B 4L76A 3DGPA 1OS5A 2M3DA 2RQ4A 2BUNA 3LGMA 4PR6A 4ZCMA 2ALYB 3A3PB 4K4UA 4EFAC 2ZKTA 3FK4A 1MG7A 2UXDJ 1TKZA 4DV6J 2M5YA 1ZZFA 4AQYJ 3V4IA 2DR5A 2FVRA 3M2VB 1X4AA 5D0HA 4ZVHA 1TL7B 2XYPB 3HVWA 1HA1A 3EVOA 2ERRA 3RR7A 4QOTA 1WI6A 2R2RA 1RAIB 3HVRA 3DM2A 2H1YA 2W9BA 3EDRB 3RW6A 4KT0C 4WTYA 5ITHA 1N6QB 3KG0A 1HBMB 2ZC3A 2J76E 2NXCA 1S72S 2QZ8A 1WSVA 1X8DA 3ZZ0A 1HNWJ 2MHEA 5T7LB 4X65J 2QFIA 3I6PA 2HZVA 2OPRA 1BQXA 2OKQA 3LP1B 3SI8A 2DGWA 2I6WA 3TI0A 1NKCA 4DL3A 5HQ8A 4A46A 1S9EB 1WKLA 1FI4A 1RKJA 4PYDA 4LUBA 2AP6A 1IWGA 3BO4A 2FDNA 1FFWB 2YWKA 3MF5A 1C4AA 1O51A 4F7VA 4L6V3 3PW4A 4LMZA 2FYXA 1H3DA 4KPYA 5C2CA 3C46A 1NDLA 4IOBA 3LALA 5J1NA 5U47A 4S0MA 2IMWP 2J0XA 1VQ8S 3DOMA 3QJJA 3M05A 3GZ7A 1D09B 2OTLS 3FEYB 2L3MA 5LM7E 5KG4A 2CG8A 2Q43A 4NLTA 4DPWA 1CJKA 4C7QA 2ZNYA 3M6XA 4OZ3A 5L38A 2GAGC 1ITPA 4WFNQ 5KFVA 2FTRA 2ZHAA 4ZN3A 2WVDA 3I31A 4UF4A 4U7CA 4LR9A 4OYXA 2EI5A 2XZTB 3WBZA 2W4DA 3OXGA 4QCLA 3OXLA 1Z2ZA 3B54A 3BPSP 3BH7B 1TP7A 5I3PA 4DQQA 2G13A 4QPTA 3J7YU 3CPWR 4KQZA 2ZC4A 5B0BA 3KK3A 3LAKA 1WF1A 1RACB 2MQLA 3OW2R 3FJ2A 1EETA 1GXTA 3UCZP 1K44A 2QE5A 5DGBA 3BGOP 1U8SA 1V9OA 1AYEA 3SCLE 4ITSA 1PJ7A 3C16B 1N5SA 3HHLD 2EK6A 4NLWA 5KTQA 2J0WA 5A8KB 5ETLA 2KXNB 4OYIA 3CJ4A 1TK8A 2QTWA 1FF2A 5FDLB 4QIFA 5C42A 3MEDA 1S9FA 3AHPA 1FEHA 4DJBA 2G0JA 3HD2A 3MAAA 1ZETA 4ECZA 2MYFA 4YB5A 4DG1B 1JMTA 4CYUB 3LOUA 2HFOA 2VA3A 2MEWA 3QGPA 4X4VA 2R7OA 3THVA 1Q5YA 4OZLA 1QE1B 1ZTTA 1WC5A 4JI1J 2E5IA 3NEKA 2FJVA 1X9MA 3DLGA 3TARA 2BM0A 4RNMA 2OMOA 3KG1A 3DRSB 2VBXA 3TA2A 4EYIB 4N77A 1C0TB 2MSSA 1IQZA 3OL8A 2VL1A 2MQOA 4DV3F 4R5PA 2WVCA 2FJBB 3CWJA 4FP9A 2BQUA 2H5IB 4EMDA 4WIQA 1DLOA 2C2EA 1FKOB 2GZOA 3QSYB 4USJC 3PYEA 1LW2B 1GXLA 4LF7J 1RWOB 2GMJA 3R1LA 1RHJB 5CCMA 5KT6A 3BKTA 3GSDA 2LKZA 1F3VA 3IR7B 4ZPDA 4ZLLA 3D6MB 2QL7B 2NQPA 4NE9C 2ACYA 1T8EA 1NZ8A 3G8SA 1WF2A 1VC0A 1N5YA 2BBEA 1F6TA 1S6QA 1MROA 3POTA 1PBUA 1Q79A 1XMOF 3I82A 5EHHA 1ZA1B 2BRLA 2QA2A 5B7WA 4F4XA 2ZH4A 3MMAB 2QC3A 1YJVA 2HWIA 4J9OA 1XBWA 1HHQA 1VQ4S 3U1MA 4DSLA 4F04B 3DKDA 1V3ZA 3IGVA 3VAFA 1UEVA 4WK3A 3MM7A 3UD3P 2B6AB 5DQHA 1X4CA 2K1RA 4DCPB 4JBCA 2W01A 1L3UA 2CJBA 1GEHA 4OV6A 3KLEA 1RWXB 2G9OA 1HR0F 4XDDA 2Q6BA 4RPFA 4CH0S 3D5MA 2BXJA 5HAOA 3GILA 4QBUA 2M0GB 3I9V9 1ZPVA 4LIWA 1NSPA 4F3OA 5KFNA 1FX2A 3NRBA 3MTKA 4M5DA 4F4YA 4W92B 4DV1F 1VR6A 4NEYA 3L7PA 1IBLJ 1N56A 5HLFB 2DNOA 3CXCR 3W61A 4DFJA 3CDBA 1V5IB 3C2PA 2MKKA 3PYFA 1NB2A 1QJHA 2BVZA 3RG6A 3I4HX 1DTQA 5E2QA 3MMCA 1ZA2B 5EGYA 3ENAA 2I5JB 3OFEA 4HR2A 3PRVA 4LR7A 4YS2A 3HHKA 2Y0BB 5DDQC 5AXLA 2PI4A 4IDKB 3OTEA 5A8WA 4NI2A 2A2DA 5HBMA 3TUJC 2JDJA 3QMQA 5CZXA 3BSCA 4N56A 2A0FB 3FUYA 4ZVFA 3W9JA 4R0JA 4DS5A 3OL7A 4NYZA 4LT6A 4MK8A 4FYXB 3SDEB 1JLAA 5KFZA 1N48A 1DBDA 2YKPA 3E01B 1VQYA 1FD2A 1D9AA 4OX7A 2PO4A 3C6TA 4KRWA 3SCIE 2C22A 2UU9J 4CCHA 4DL4A 2XULA 3N6LA 3HSZA 2BE9B 2W7AA 1EQ0A 3QO9B 1HW8A 1OY9A 2HRYA 2KVQE 2HIQA 1Y00A 2CQDA 4USWA 2EKNA 2E5LF 2YWEA 4NLXA 1U1RA 1YRTA 3GCWP 4WP3A 2YKMA 3EPIA 2YX4A 3BQ1A 4QIEA 2CVIA 1RTJA 4ELTA 5JMNA 2MQQA 4DSIA 3DRPA 4RUAA 1XMBA 4HDGA 2Q79A 4EBDA 2AKWB 2M52A 2CQ4A 3GE9A 4DCOB 1GMUA 4CLSA 1AB8A 1U7LA 5D3GA 1NJWA 2V0NA 2VONA 1JNZB 2FJEB 1IXKA 2JLGA 4G3IA 1PYOB 2V6AA 3A12A 3QIPA 2QEXS 3HHDA 4A8XA 4F02A 4F4KA 1M90T 4B9MA 1NHKL 1Y5NB 1S0OA 3KLFA 2A6MA 1FFGB 2AWZA 2CRLA 4B9UA 2XBPA 3AOCA 2VC0A 2XO7A 4CIOA 3FNNA 2VUGA 2AW0A 2IC3B 3I96A 2CIMA 4NXNJ 1Q7LB 1SCJB 4KH1B 1ROFA 5L1IA 2OD4A 3MM8A 1CQMA 1RU1A 4QR0A 4A8WA 1MW7A 4ZOSA 1SJ1A 2DNPA 2GJ2A 3AY0A 1KTVA 2VFRA 4C2MA 1DQAA 4P72A 5JVGQ 1URRA 2BE2B 4B17A 3M9NB 4F0HA 5G4DA 5BXIA 1S9GB 1S1VB 3M30B 3TWZA 1C0UB 3KOAA 2UXCJ 1NK7A 1BD6A 1RABB 1YGYA 2FHKA 3TAMA 2W2NP 1NXIA 1GAOA 3M2RA 2JC0A 3CW2C 1N34F 3UW1A 2KKHA 2ZNZA 1KVIA 3PVXA 1Q7YT 3S7RA 4PAAA 1SUQA 4AUKA 5C5JA 4J90A 3GV5B 2CPFA 2EFPA 4PQUB 5KFWA 3H59A 3LP0B 1RTDB 5IFMA 1RT3A 1FTRA 5E41A 2RRNA 5F0UA 5AXMA 3BO3A 2ROEA 1RAOA 1TUGB 2Q66A 3OL6A 5E7OB 2DEIA 2ZUGA 2DNGA 3IAM9 1WKJA 2BDPA 4USKA 2V2QA 1VJQA 2IHR1 4O4GB 1KVKA 4IFVA 5EUHA 3I4PA 4LRBA 4NLRA 4X66J 1WDTA 1A6LA 2YQ0A 2Q6CA 2MZJA 5F0WA 2PEHA 3GIRA 3HJVA 3TZYA 2YKQA 3HT3A 1X0PA 2AJ0A 1APSA 3G82A 4ED7A 3JTNA 3N5FA 1UW9A 2RE1A 1VRTA 1VQ9S 3OR1A 1HFEL 4PXCA 1HWKA 3VGSA 4UY85 1JLEB 3CCMS 1S6PB 4MYTA 1WG1A 4DR6F 1S79A 1H7XA 3QRQA 2E7WA 2SXLA 4NX9A 3HULA 3CJSA 4ZPWR 3R5BA 4I6AA 3M2VA 4LQ9A 1TL7A 3D1QA 4FF3A 3RGIA 4H54A 2F7VA 1E6VA 1FO1A 4L72B 1TKTA 1F5CA 2VC1A 2VQEJ 2F9DA 1UPPA 4DX5A 3TP2A 5HMZA 1M5KC 2N82B 3SCKE 3RRGA 2QMXA 1N6QA 4ZMMA 1J5OA 1HBMA 3D3CJ 3CF5Q 5EWFA 2CG4A 2G0IA 3KWMA 3TW0A 1R0AB 1TU0B 5KFAA 4RU2A 3QSIA 5T7LA 4J9RA 2G0CA 4GKKF 2KZZA 3TA1A 2JH3A 1DRZA 3DHXA 2FHOB 3LP1A 1C1CB 3RB0A 3NGUA 2P9CA 2FJDB 5DG8A 2LA6A 1JXLA 4TVAB 1KD1T 4C8YA 1KQSR 2RDDA 3DHWC 4OHZA 1ZM9A 1S9EA 1RZMA 4EBEA 3GJQB 2C2NA 3W8GA 1IM6A 2Y1RI 4ZJQA 4HHUA 2BACA 2X7IA 2HK3A 3I5BA 4X4UA 1A0OB 2GIRA 2DITA 1K0TA 1RTIB 1S1WB 1ZBTA 2QLBB 4ZLJA 1RAGB 2OPSA 2XM3A 1RAEB 3IGNA 3IWXA 4DV1J 2EPIA 5LOQA 4NEZA 2N3OA 2ASLA 2LA4A 4X64J 4RZRA 3V2UC 1RT4B 3MM9B 1NM2A 1SJFA 2A3JA 3AFGA 2FGOA 1FWLA 1GX6A 2LXUA 2D7SA 2IRYA 2KM8B 1YG0A 3GG1A 4ANEA 2XC9A 4P2MA 4HH1A 1WUUA 1Y3JA 2QL5B 4DR1J 2V8PA 3LWLA 3TVYA 1GMVA 1KFSA 3WIVA 4K4TA 1KNZA 2J9DA 2FZCB 4ZCLA 1SH0A 2W9AA 3RJMB 5T41A 3FQLA 4QJVA 1NK5A 4OZJA 2ZE2A 1W2BR 4B3SJ 4C8KA 3NY0A 3I32A 3BPDA 4C3KA 3HT0A 1WWHA 1UVLA 1YJWS 3QT8A 2BJDA 3H42A 4J7CA 5RUBA 4J9QA 4LF6J 5J2MA 4DV4F 1UA1A 3I0RB 4JV1A 4ZVOB 3CD6S 1MMNA 3C16A 2AGPA 1W26A 4I2QA 1OY8A 1G7CB 5DM7Q 4L75A 2WONB 2VA2A 2E5LJ 2VOPA 3CGIA 4PWUA 5FDLA 4WP8A 5HROB 2DNMA 1IVZA 2V8GA 3OVBA 2BKOA 3X1LB 2QV6A 3IXQA 2AEMA 4ED2A 1A9NB 2CADA 1S1TB 4RW8B 2VD3A 1CEZA 3CD5A 5KFOA 1N5TA 2R7QA 2IJNA 1PKUA 4WP9A 1IKXB 4USVA 4U67Q 3HP6A 4OYZA 4PCQA 5CHCB 1QE1A 4Q2LA 1FHTA 1YBTA 4TQRA 2PE8A 4JI7J 2HHQA 4GVBB 2EG2A 3E51A 5LMNF 1WD6A 2IJFA 3OV7A 3DRSA 1C0TA 2H3EB 3M8YA 3VQTA 2ZDOA 3NGDA 3SBMA 4USMA 4XIUA 3R7SB 1JLQA 2KO1A 4KGVB 4QYZK 4F3MA 3AQOA 4NWBA 1FKOA 2B7CB 1VQSA 2RILA 4NRUA 4J91A 2H4YB 2BOPA 1LW2A 3HFKA 4I64A 2PMHA 2XNQA 1N5QA 1VQ5S 3OR2B 1S12A 3B82A 2V4JB 3MCNA 4C97A 3GSIA 2B9WA 2BJ9A 1VBXA 2IBOA 1FJGF 2XLKA 1YWXA 2YKNB 2V34A 1Q16B 4F4ZA 4IG3B 1EIYB 2LQ5A 2DHHA 1IBMJ 4ILLA 2F4VF 1PC5A 2FZGB 4XPCA 2J9CA 3VQSA 3NCRA 1LNQA 1L3SA 1VISA 4RW6A 4DEZA 3PW2A 4FPRA 2ZVSA 5A0YB 4DUYF 2JVOA 1N0VC 2VB6A 1KTQA 3IP0A 1NAQA 3NMAA 1UVMA 3IBWA 4K4XA 1N34J 4I1TA 2B6AA 3M2UB 5IWAJ 5IT0A 3HHEA 2Y1JA 4JI2J 2HLUA 2JZ5A 4USHA 4DR3J 4RW9B 1FRIA 5HN0A 3ADAC 5AT1B 2F8MA 3UDLA 4E98A 2ASDA 1UVNA 3KLIB 1FRXA 1RP5A 3CDUA 1T05A 4F8RA 4WFBQ 2XB2D 2GO8A 1REGX 2HK2A 2D9PA 3DLEB 1ZAVA 2VG7B 3D6HB 4DSFA 2K2PA 2DNRA 5AE2A 2V2VA 1R31A 2Z30B 4AXIA 4QU7A 4LF2A 3EZ5A 4K2JA 1RT5B 3HVTB 1LWCB 4TYBA 2IA6A 2IYIA 4F2SA 1FXLA 4DBQA 2B56A 4NZ6A 2JEGA 5HLFA 2OLWA 4CH7A 3EXYA 2VHGA 4FXVA 4KHPF 5DETA 1M1KT 4BHQA 1IKVA 2OI2A 2ZOGA 5I3UB 3CCWA 4KGKA 3ENWA 3M8QB 3DRYA 3QWUA 3QT5A 4ENOA 2AJQA 3ET6B 1R8CA 2I5JA 1DAXA 4DR6J 4OMFG 1VDHA 1WC0A 4OZ0A 1VS3A 3IM8A 4FZVA 3O3LA 2BW2A 4ES2A 4IDKA 1RXOB 1AA1B 5GAGI 3CJ0A 3LP2B 3R5DA 1WC3A 3DDNA 2DVIA 3K5NA 2COLA 3LUYA 1S1XB 3SDEA 1U1LA 1WKKA 4DR2J 3OXFA 2CPHA 5GVQA 2F4FA 2HNYB 1K47A 2V2KA 2ZBPA 3AD9C 2GJFA 2ZOFA 3GCXP 2VG6B 3SXLA 3UO0A 3GFHA 2IRUA 2PMWA 1SC1B 1TFYA 1HBNB 4WKYA 1NSAA 1M5VC 2HMIB 2CQ3A 1VJWA 1X4FA 2HRTA 3QO9A 4ZJOA 4YY3J 1EARA 1T3NA 2FLLA 2GCFA 3RBDA 2FVPA 4AD6A 1PYSB 1S77D 3K89A 2AT1B 1C1BB 5HATA 5K8MA 2HHHF 3MR6A 3RW7A 2YWWA 3BF4A 1TV6B 4K4VA 5L9NA 3AQPA 4USUA 3NGRA 1QSYA 3UN3A 2OSRA 3F0NA 1B64A 2OMLA 2BYCA 2A6OA 4ZVTB 2XTJP 1NHUA 2WB1D 5KFMA 1B99A 2WB4A 3HHLA 1RLCL 5ETTA 1WSRA 4ED3A 4DU7A 1OQ3A 1UFLA 2HGNA 4FF4A 4ECRA 5KG7A 2GGPB 1D8YA 1YVFA 1Y3KA 2BOAA 3P4UB 4LJMA 4UOFA 1HNIB 4UZCA 2DIVA 4DQSA 1FRLA 4Z37A 4XTTA 5HVGA 4DCJB 3N01A 1EHWA 3CD7A 2JLFA 2QL9B 2DR8A 1H6KX 4AL7A 4EO6A 3FSYA 4FXWA 4LVNP 2IC3A 4OYWA 4H4KA 1S1UB 1UA0A 4CZCA 2MKYA 1FXDA 1WHVA 1NRKA 1KQFB 1XWLA 1K1SA 3D3BJ 2BRKA 4YB1P 3H5XA 2UVWA 3IWLA 3Q2SC 3I56S 4DL6A 3IRXB 1SH3A 3NNHA 1VBKA 4AT1B 4ED8A 4GRSA 4JP8A 1ZOTA 4EU0A 2BE2A 2AEFA 5KAKA 3CCRS 1HQ2A 4CT8A 2W7PA 1S9GA 1S1VA 4OJGA 1ICEB 3TZXA 2AF6A 3BEGB 4DUZF 1C0UA 2B9YA 1K9MT 3CVKA 2O67A 2N4DA 4Z7CA 4C4WA 2GAHC 1W25A 2NLWA 1X0FA 3DFEA 4DR7J 3V6DB 1QSSA 4KIAA 4G1QB 2QO3A 3SQGB 5EDWA 4PQUA 3KDNA 3VAMA 4KBIA 3HSGA 3UVJB 3L7OA 2FIUA 2CDQA 2XYHB 3LP0A 1VQPS 2B51A 4QIWD 1SJ4P 3OJSA 4HACB 2EG1A 4B3OB 2MKCA 1NSKL 3OVAA 4OYPA 1HWIA 4Z2XA 2HFNA 4DZDA 2WRMA 1SQFA 3EICA 2VG5A 3MUTP 4LRCA 2IFXA 2IVYA 1S49A 3DLJA 3MPWA 4C8LA 5KFSA 4MKYA 4TN2A 4OI4A 5ETVA 1SXLA 5DRKA 4WF9Q 2PD1A 2AJFE 3A3OB 1BXNA 4D3GA 1URNA 1OQ6A 2M9KA 5HL7Q 5LSRA 4UOCA 2N7CA 1S6PA 1SKWA 3LTOA 4P2SA 5IZHA 1PJ5A 4ELVA 4CLYA 4IG0B 2RU9A 3W9IA 3SCJE 5ETRA 2ATCB 2WW8A 2XS2A 4KYZA 1WEZA 4H4MB 1NK4A 2R7XA 1SJRA 5G0RA 3KUGA 3KLHB 1D9DA 3FEXB 5DDPC 2RQKA 4NYPA 2E29A 1ZYQA 3VCDA 5KT3A 2H54B 2DK2A 3FMWA 3NL0A 3CB4A 4Y2AA 3MR5A 3MCSA 4B9SA 4YHHJ 1GX5A 3TOQA 5GAHI 2MKIA 4BCAA 2ZVIA 4CTAA 2VDHA 4FF2A 2HQIA 3MECA 2F8EX 3I55S 2P9EA 2B9XA 3R3TA 5CQGA 1HW9A 4P52A 4BC7A 3MI7X 3OFHA 2CJAA 5IC4B 4K7QA 1XNQF 2EW9A 1PSDA 3CDAA 4ZVRB 2VH7A 4PUOA 2DT9A 3I9ZA 1T7PA 1RHRB 2FQQB 3AH6A 2MB0B 5HJYA 1VQOS 1FRKA 5J2PB 5KFHA 1VYAA 3KLGB 3PCOB 4CM2A 2GHWA 2IVFB 5KG5A 3H5YA 3ZTPA 1D8ZA 2DBBA 1N36F 7FD1A 1Y5IB 2J0QD 1RTIA 1S1WA 3LPEA 1YJTA 5FD1A 4GKJJ 1U47A 4WTOB 2KJWA 3ZZRA 1FDBA 3JAMU 1YHQS 4HT7A 5FJ4A 5EX3A 1VQ7S 4KHPJ 4QWDA 2V67A 4CH1A 3MM9A 1LW0A 1X60A 3T1HF 4PEOA 2ZFHA 6FD1A 1J5EJ 1J27A 2DEJA 5KOWA 4BC9A 3ZTSA 2FHMA 3W2WB 3M9MB 4CP5A 3PX6A 2DGQA 4WU2A 3NS7B 2YPZA 2Z8QA 3G4SS 4PWDA 4FDFA 3O8WA 4DFPA 2M70A 2EFVA 3GONA 3L95X 2Z0GA 2DGOA 4OHVA 2J5AA 2GIFA 3NNAA 4QIVA 1V6HA 2LXIA 3DMJB 5KFDA 4ZITA 4FPIA 1PG5B 2UV8G 3OTOF 3TUIC 2J7KA 2NXEA 3K0JA 4IFYB 4IRCA 1CJUA 3D0GE 1JQGA 1TL4A 4CO0A 2CAJA 3OHAA 3US5A 5LXRA 2YX7A 4KPCA 2ZITA 5FIIA 2H5JB 2WZ1A 4EUVA 2JNJA 2C3YA 3KJVB 4ANCA 1PCAA 1I51B 4ANDA 2MKSA 1HQEB 1S10A 1RHKB 3L4BC 4J9KA 3I0SB 2HIYA 1CJVA 2ZH9A 3I5CA 4J9LA 3C6UB 4EYHB 2D1CA 3KTQA 4Z7YA 3M6UA 1XNRF 3FSXA 1S1TA 4RW8A 2KFYA 2M8HA 3MFIA 1WELA 5DZ6A 1AROP 3C14B 3CC4S 1AFJA 1Y0HA 3PKMA 1IKXA 4FKYA 1KDNA 1UVKA 2QA1A 2C2DA 1U2FA 2UVVA 1FTCA 3BZQA 1GQEA 1SL2A 2IAJB 1HYSA 1RT6B 5HQMA 4GVBA 3AB2B 2EC2A 3MR3A 2HEKA 1VQNS 3FZ2A 2DNQA 2G2OA 3HSJA 3MZIA 1HI8A 5GAGU 3GLJA 3ZZYA 2QLXA 3TJ9A 4CDIA 1GTHA 2WW4A 2GJIA 1V3RA 5ETSA 3IR6B 2X1GA 3IAS9 2J9DE 5KFUA 2YNHB 1FJCA 3W66A 3ZTQA 2ZH1A 2C2RA 3WQPA 1G2EA 2X51A 4OLPA 2XNRA 3MOJB 1OYDA 3UCGA 2V4JA 2AJ2A 3RB3A 1HWJA 4ZLPA 4XK8C 2GIQA 4ZVUB 4N8OA 1LWFA 2YKNA 4U96A 2NZ4A 5BR8F 2GFFA 7FDRA 2LP4A 2UXDF 5CZVA 4DV6F 3ETOA 2DR9A 2R8JA 4AQYF 3PJWA 1F2HA 3HVAA 3D54A 2RQMA 1UFKA 3MDFA 2CQHA 3Q83A 2E5HA 4B9LA 2D74B 2BANB 2R7TA 3J80Y 3GP9A 5HP1A 4DUZJ 5A0YA 4O23A 5CYQA 1AUDA 3V5RA 2BMBA 3AD7C 4P7VA 4ZVGA 2M7SA 2CQIA 3M2UA 1RSCA 3CJ2A 2UXBJ 1SIZA 3U27A 4RW9A 3SYZA 2D41A 1HNWF 1YIJS 3QPIA 3VGVA 4X65F 2RHQB 1U2CA 5EN1A 3KLIA 4X4RA 4CLLA 3DLEA 1T9UA 2Q3PA 2GA7A 3HHLC 2FJAB 3FVYA 2VG7A 4NCGB 2P8IA 2P2CB 2OEKA 3RB4A 2VKRA 3MD3A 4KFBB 3ENVA 4XAKA 3B8HA 1QD1A 2B9EA 2P9GA 2Q1LA 3HVTA 4BBYA 1LWCA 2D69A 4ID5B 4PG4A 4LFAJ 4PXDA 3RBEA 1K0VA 2CPDA 3GYNA 2EBEA 2EFGA 5B0DA 4H4KC 4ECWA 3H90A 2V4RA 4MIBA 2PC6A 2PIIA 2D3OR 5I3UA 1WOOA 5KFQA 2C2KB 2VPXB 3M8QA 2EC0A 2EK1A 1GMWD 4GMKA 1UZDA 2ZBIA 1T9XA 2CQ1A 3M6WA 5E33A 4M63A 4U9RA 1FRHA 3CCVS 5IV4A 2Y1IA 3IG1B 5BYQA 4DMZA 2OUGA 1GFWB 3Q8VA 3MEKA 2QA4G 4MIAA 3TQ1A 2K7KA 2UUAJ 1H98A 1KHVA 1UEKA 3DDIA 1S1XA 1TAUA 4PYAA 5GADI 3R9LA 4JI3J 3PHTA 3UCUP 2RNEA 4A8SA 2HNYA 3CC2S 1XN9A 1TZ0A 1FERA 1SI9A 2XHWA 2BA9A 1BE4A 5D4LA 3RTVA 2R4FA 2N7YA 3DNCA 2HBRB 1NH7A 2HW3A 1KR4A 1IR0A 1NDPA 2HMIA 5J2QB 1M5PC 3MHYA 1RT7A 3J81Y 2J8AA 2X3GA 2E7VA 1XNQJ 3BM7A 4DL5A 2MJNA 3NGSA 3BDPA 1CULB 5EWEA 5D0GA 3QWPA 3Q2TC 2KI2A 3KXDA 3G6ES 1H2TZ 3CEDA 5D15A 3CCSS 3MEGB 1IKWB 1Y11A 1WOPA 4FYYB 2X1AA 4Y0FA 3Q8QB 5KFJA 3D1HA 3HD1A 1U2RA 2Y0SD 1C1BA 3NKYA 5F3TA 1NO8A 1TV6A 4EZ6A 1NLKL 1OMSA 2QIFA 3GJRB 1N4LA 4X4NA 2I38A 5LJ5Y 3UDEA 2DPJA 3KFWX 1BGXT 1WNEA 2IA0A 4NLOA 1KSPA 3ULHA 1DHMA 2UVRA 1H73A 1FRJA 3P6YC 3TNVA 4ICLB 3QZ7A 4CO4A 1NPKA 4JV2A 4URQU 3QAUA 1X4GA 2GGPA 3IRWP 2KT5A 2R7SA 4JI1F 2IY5B 2MZSA 1RGVA 2DGXA 1HNIA 3JQJA 4P73A 1GH8A 4DUTA 3Q24A 1YZ7A 3DU5A 3HMJG 1TL3B 5IT9U 1M5HA 3F73A 1TL1B 4L3KA 2R7UA 1FD8A 3IBCB 1S1UA 3PG9A 5GAHU 4IYQA 1RJJA 1P1LA 2ZWPA 1SV5B 2AU0A 1CSJA 2MSTA 2UUTA 3ZO7A 3IRXA 2VKZG 1U02A 4J9PA 1RCOB 2CJYB 5D0EA 4C8NA 1NHVA 4OQJA 3BREA 1VOMA 4OX8A 1CS4B 2RSQA 5IQQA 2HHVA 1WHYA 3DDKA 3BSAA 4NLVA 1IJFB 2ZZMA 1R6YA 1BHNA 2CQGA 4C98A 2DR6A 3DI6B 1IKYB 1Y9OA 4TU8A 2Y8WA 1S57A 3IFEA 4DF4A 1R8BA 1JJCB 3JYTB 1ELOA 4CNYA 5DDRC 3K5LA 4JI5J 4LF4J 5D8HB 4P7TA 4G1QA 3SQGA 1WEXA 4RBVA 2XMWA 4U6PA 2BE7D 2EVZA 2L48A 3UVJA 1XQIA 1Z1ZA 4RR5A 3VHQA 1REVB 2XMJA 2HURA 3A4TA 3T9NA 2HNDB 2XMAA 1I6JA 4B3OA 2ILYA 2DGUA 1HHTP 1FEEA 4Y28C 2XS5A 2QX0A 5E0OA 2KM8C 1S0MA 3PV8A 2DXDA 2YNFA 1N33J 1VK8A 1Z4UA 2GQQA 3S1TA 4B3RJ 3GWCA 1U6FA 3MAQA 2JFDA 5C24B 3QQCD 4Q7AA 3D1OA 3LA0A 2EBGA 4IR9A 4ZPCA 3A8IA 1HQUA 1P8GA 2I0XA 5KFBA 4BWJA 2EEYA 1LK5A 3MOZA 4DOZA 3C15B 5J1EB 1RT1B 3A3NB 2LECA 1GT8A 2W2PP 2E9ZA 2RT3A 2MMYA 5BR8J 3CULA 4H4MA 1UVIA 4RBUA 3BBCA 4KGZB 3KLHA 3RR8A 4FYVB 3L3CA 2V8DA 2ZH3A 1RTHB 1I94F 3KK1B 5AE1A 4USIA 1D9FA 4NPOA 4YB6A 3LGNA 5KG3A 1YJRA 4KR0B 4Y2CA 3DYAA 1EKRA 1M1HA 1QVFR 2HS4A 1U25A 3M9OB 1YRXA 3WC2A 4WXWA 3H0PA 2EKYA 5IT4A 1HNVB 3PJXA 2XI2A 2BQRA 2UU9F 3MXHP 2MXYA 1HL6A 2RH3A 2YWFA 4L74A 4A4JA 1PO6A 4A48A 4EBCA 2VOOA 2VQFJ 3H40A 1S5ZA 4NASA 3OSNA 1RCXB 1H74A 2ZBRA 4O0NA 4RKUC 2QJ3A 1UP1A 4QPXA 3KLGA 2KFZA 3MMBA 2F63A 4DX8H 4ETXA 2J7UA 3MCOA 4I7FB 1YKWA 2RD5C 3A8KA 2RHSB 4M5IA 2AGOA 1H38A 2LQ8A 1JLGB 3QLHA 4I4BA 5ETKA 5L39A 4HH0A 3EZOA 5DS7A 1RA6A 3CSKA 2AX1A 4LIRA 2B5JB 3ITHB 2F1FA 4DLGA 1TQLA 2GMLA 2W4CA 3CJ5A 4N5SA 2DNNA 4WYWA 2NS1B 3BGFA 1PGZA 3KUEA 4F2RA 4MYUA 5K8PA 4JYAJ 3AA9A 4WKRA 2LDYA 1NCLA 5F8HA 5IC6B 4I6WA 5IOLA 3D6FB 3HKWA 3EUNA 3MPVA 2HQGA 1U1MA 2CUYA 5E3QA 3U1LA 2APOA 4NXNF 3V4IB 2CZ9A 1DJ0A 1YSJA 4M5LA 2YNIB 1ULRA 3NCPA 3TR5A 3O5TB 1Q8LA 4DXLA 2FJXA 3DRXA 2CKWA 2YQ3A 3NP5A 4AL5A 3R8YA 2GNKA 2FUG9 3NG8A 3T5JA 4WU3A 2W9BB 5ETOA 4UW2A 4CLPA 1S76D 4PKDB 1FDDA 1R0BG 2WOMB 5E3AA 1IN0A 4ZPBA 3GQCA 2UXCF 1RT2A 1GXUA 1T02A 1WG5A 1O0PA 4K0KJ 4FF1A 3ENQA 1R7IA 1DFDA 4BDPA 3M1VB 3I87A 2IJRA 1SQGA 1KC8T 4DL7A 3HKZD 2WVFA 4ED4A 4GO7X 1X31C 3C14A 2E44A 4ZLNA 4CLFA 2WVBA 4L3NA 3Q86A 1RBLA 4XDCA 3J7ZT 3HI9A 2IAJA 3HLUA 3RBXA 2K8GA 1SIWB 3GFXA 3P3DA 4EWTA 1TELA 4L73A 4ED1A 3VGUA 4X66F 3IM9A 3PNIA 1ZZNA 1HBOB 2PDAA 6FDRA 3JSBA 3GU0A 4B02A 3HCXA 1U09A 5GADU 3IN5A 2YNHA 2OH2A 3VAIA 4ALZA 3OVSA 5IXUA 3HPOA 4TQSA 2KHCA 4U8VA 2HFVA 3G6YA 1EX8A 3ZZOA 4HTJA 1NSQA 4DPYA 2F5GA 4J9UE 3OLBA 1JWWA 1SL0A 5L9XA 3OFFA 1RU2A 2OGUA 4ETZA 2ZHBA 1R0CB 2QLWA 4LF9J 3TANA 4NLQA 3OHBA 2PN6A 2RDIA 1PBAA 5DG9A 2NXNA 2CPYA 1EETB 2HZCA 2VQEF 1VGYA 3BR8A 1B0PA 2HFSA 2NSCA 3CMES 2AD9A 1Z2LA 3PW0A 3ILLA 1LXJA 1IBKJ 1BQNA 3ZC4A 4BWMA 4KV8B 2OO4A 2RB7A 3W7BA 2W24A 4DSJA 4FBUA 2AMCB 1T3OA 2O3DA 5DQGA 1E6YB 4IH6A 5I4MA 1CJTB 4GO5X 2R8IA 2MHNA 1HNZJ 5B0AA 4PPZA 1NEEA 4M94A 4Q5VA 4O44B 2DXFA 2MY8A 3X3UA 4NLPA 2DRDA 2KN4A 1F1BB 3EGNA 2JEIA 4KFBA 5MAOA 3W63A 3EZUA 4J9VA 5KFTA 5LT5A 4CWBA 4M5GA 3Q8RB 2DH9A 2XSJA 3IC1A 4YOEA 4ID5A 4ZP9A 4IQXA 2W4PA 4HTIA 3G87A 1NK6A 1RYRA 1QAIA 2I9SA 4HDHA 1D1UA 2BKPA 3PYDA 1GK8A 4JV5F 3GJSB 2DNZA 4LBIA 4NZ0A 2C2ZB 3M8PA 2KXFA 4X64F 2PMZD 1DLOB 2MLXA 4DQRA 2ZUAA 2F40A 5LMUJ 3SSSA 4M5MA 4RL1A 1JJ4A 2CXEA 4LVOP 4F26A 3V4MA 4K4ZA 4O3SA 2AYBA 2FVQA 4DR1F 3IG1A 3ZZZA 3PACA 2ATLA 2MDAA 4EK2A 2DO4A 2FY1A 4K59A 4DPXA 3P96A 1I94J 4PXBA 1N5YB 2DGTA 4OIXA 4IH5A 2DIUA 4Q43A 2R7RA 3POTB 4B3SF 1VIXA 1U6ZA 3KG4A 5KFGA 4EEYA 3K2YA 4KY3A 1TAQA 2HKEA 4RNHA 1L3KA 1F9EB 4TLQA 3SV3A 4CO5A 3HHNB 5J2NB 3OTBA 3VAKA 4DV0J 2FD2A 2FLNA 5K8NA 2AHOB 5J2QA 3T5HA 3V6JA 1KLMB 5GMDA 3R7NB 1D0EA 1SKRA 2HHPA 4LF6F 4PXEA 2V63A 4DSEA 1UWBB 5KFFA 2UV8A 2WHOA 3JS9A 3MEGA 1IKWA 2ASJA 1KFDA 4UOGA 3L09A 4OYBA 3WX8A 1AFIA 3PJ9A 3PRDA 4DFKA 1V3SA 1VCTA 3ONQA 3T3FA 1DARA 1S0NA 3EGWB 4B3TJ 4F50A 1M5SA 3GFYA 3A8JA 1T03A 3LPYA 3LQVA 4NXMJ 4ICLA 2GQCA 4J9NA 3MTJA 3THPA 1YQHA 3PEHA 3GIKA 1KP6A 4CI0B 3Q23A 1RBAA 3RRHA 2DNYA 4JI7F 2R8HA 4CO1A 3T1YJ 2ROPA 3DLKA 2XHCA 3W64A 4BS2A 2WTFA 1DURA 2GS8A 4RNFA 3VAGA 4K4SA 1OY6A 1Q8BA 3R6LB 4PG6A 1TL3A 1QVGR 5IM0A 1UVJA 3UNGC 3KHGA 4C3MA 2Y8YA 2D3UA 4LFCF 2PSZA 4Y6IA 1B0TA 1CC7A 5A8WB 1Q82T 1SV5A 4NI2B 1VC6A 4P71A 2MPUA 4F25A 3CIMA 1JK9B 2CQ2A 3MUMP 2NZCA 1XTZA 1HHSA 2DGVA 3FMBA 1Q78A 3R5AA 3VR1A 1AUSL 2GVDB 5JXSA 3EVMA 2OELA 1G6BA 4KO0B 1CLFA 4OZ5A 1IBMF 1KWMA 1U4BA 2MGZB 4RW4B 1NKBA 2QSFA 2HNZB 3K8VA 3KMSA 2GMHA 1Q86T 1TVRB 4ZJLA 3DI6A 1IKYA 5HMWA 1RBOB 2E1MC 4ZHRB 5F8GA 2CYYA 3UPFA 5L1LA 3BQ0A 1X5PA 3SMZA 3JYTA 2B0GA 1H7WA 8ATCB 1NZAA 5FLXU 1FRMA 4C6AA 4TY8B 1Q53A 4YDXA 5IWAF 4RU9A 4RW7B 1UTAA 2R2UA 2GVZB 4JI2F 3OUYA 2ZH8A 4DR3F 1DZ5A 4C48A 3GYGA 1REVA 3VV2B 1FJEB 4RNNA 1EQMA 2RS8A 1Q81T 2CPXA 5LJ3Y 2AZ1A 2HNDA 4DL0C 1S7HA 2GX8A 2DHGA 2HAIA 2Z4PA 2DKOB 1JLBA 1R6VA 1T9WA 3DU6A 4HHJA 4HLBA 3DXSX 2XSFA 9ATCB 4DU8A 1SL1A 4QWAA 2CDRB 3JTOA 2QT7A 2K06A 4X4TA 2Z58B 3FDSA 3AODA 2FPHX 2ALZA 4I2PA 4DDFA 4Y2IA 1TL5A 4GC6A 2DJWA 4RWWA 3Q8YA 3QJLA 4PG8A 3UNYA 3IR5B 2FC8A 1NKEA 4TY9A 3W3SA 3B4DA 3A1YG 5K9FA 3C15A 3IO1A 2OSQA 1U1KA 1DTTB 2J6UA 3MMJA 3MM8B 2FVCA 4X62F 3TVKA 2B4PA 2CWXA 4DX7A 2J6SA 4A8FA 1Y10A 2LDIA 3BV8A 4WFAQ 5BJRA 1RTHA 5CAAA 3KK1A 4FBTA 4CM0A 3NOCA 1WG4A 4R0EA 2MZ1A 1H2VZ 1RI7A 4DR2F 2MQ8A 2XMUA 1GMWA 3N6MA 1JB0C 1KVJA 2L9WA 2HQFA 1FK9B 4C0HA 2XMVA 1U24A 3TAMB 1HNXJ 4OJ1A 1HNVA 4F0KA 4P2FA 5E3CA 3FGVA 2PGCA 3M8SA 3KLVA 3NXZA 1KN6A 4G1PA 5LXYA 5AJ3F 2QA4S 1X5OA 2FB0A 3QZ8A 3NWRA 4YY3F 1RWVB 2NYHA 4OFZA 3B4MA 3N9UC 1YI2S 2D9OA 3RB6A 3BGLA 2QYGA 1CC8A 2RQCA 4HKQA 4NMXA 2KVIA 2WSEC 4I7FA 4AL6A 3W62A 1PAUB 1RT3B 4B08A 5KFEA 3TJAA 2HQ3A 4P74A 3K57A 2CPEA 2FVSA 1JLGA 1Y4ZB 1JLFB 4KTQA 3N6NA 2Z2YB 4DR5F 1HWLA 2HFUA 2IDLA 2VBWA 2B5JA 5KFIA 3ITHA 2MTLA 2GC8A 1TMMA 5H9EK 3BYPA 4JV5J 3G82B 3ISND 4KKOB 3GJTB 3FC9A 5ETPA 2V2ZA 4UQTA 1EP4B 2AIRB 3ISZA 2MZRA 2XI3A 4A8KA 1MN9A 2YQ1A 1FKPB 1HIYA 2HS3A 4YR3A 3L9ZA 2DCLA 4IOAQ 3W5ZA 3CJ3A 4P75A 4G6VB 1X4HA 1YX2A 4MAKA 2VDIA 3QFWA 5K8OA 2EWHA 5E3RA 2YNIA 1QTNB 3AXKA 3CJTA 3UFCX 1LWXA 4RBTA 5AXNA 3FCWA 3RRKA 4RO0A 3WC0A 1SVDA 1E6VB 5AE3A 1TKTB 2AZ3A 3AJ2A 3S8SA 4YR0A 4CO3A 3KJQB 2H4WB 2KB2A 3KDOA 2E1CA 1R43A 1J5OB 5H1SV 2IM0A 2QLJB 2WOMA 3W1YC 4QZVB 3EDQB 5AXKA 1RQ0A 1FESA 2K3KA 3E8OA 3TEGA 3TX8A 3CDEA 1SJ3P 2RUSA 1IQTA 3O44A 5A8KA 5J1PA 1MWYA 1U6BA 2HG4A 3GIIA 4UUXA 3M1VA 4AE5A 4D3HA 2OPPB 2XWXA 4DR7F 5H9EJ 2ADCA 2J0SD 2HBYB 2PI5A 3M32B 1S48A 4YUDA 1VLYA 3EPGA 4ED5A 2XY6A 1B70B 4X2BA 2XG8A 1VQMS 1AZSB 4PG7A 3THTA 3ZNUA 4DG1A 4CYUA 3W5XA 2VF3A 1P9YA 4Q8EA 4V1Ak 2HHWA 3JSYA 2OPSB 4HL9A 2CJ9A 2NSBA 4RUCA
chains in the Genus database with same CATH topology
2FQQB 3P4UB 3D6MB 3QNWB 2HBRB 4ZVSB 1RWWB 3KJQB 1RWPB 3GJSB 2QL7B 2H4WB 1PYOB 2C2ZB 3RJMB 3R7BB 3SIPB 2Y1LB 1BMQB 3R5JB 3KJFB 2XYGB 1SC1B 3IBCB 4DCJB 1RHUB 2QLJB 2C2KB 2DKOB 2QL9B 2XZTB 3EDQB 3GJQB 2XYHB 2CDRB 1SC3B 4ZVQB 2CNLB 3GJTB 1RHQB 1RWMB 2CJYB 2QLBB 2H51B 3IBFB 2H5JB 2H54B 2HBZB 3GJRB 1GFWB 2CNKB 3R7SB 2CJXB 2C2OB 1RWKB 2H48B 2C1EB 2C2MB 2XYPB 1SC4B 2HBYB 2CNOB 4ZVOB 4DCPB 1RE1B 1I51B 1NMEB 1RHKB 2H4YB 2Y0BB 2H5IB 1RWNB 4ZVUB 1RWVB 3KJNB 2P2CB 4JB8B 1F9EB 5IC6B 1QDUB 3R6GB 4ZVPB 3EDRB 4ZVTB 1RWXB 4LSZB 3P45B 2H65B 3D6FB 1I3OB 2CNNB 1ICEB 1RHMB 1RWOB 5IC4B 3D6HB 3R6LB 1QTNB 4DCOB 1RHJB 5K20B 3NS7B 4ZVRB 2QL5B 2QLFB 1IBCB 1PAUB 2HBQB 3R7NB 2XZDB 1RHRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQQ B;  3P4U B;  3D6M B;  3QNW B;  2HBR B;  4ZVS B;  1RWW B;  3KJQ B;  1RWP B;  3GJS B;  2QL7 B;  2H4W B;  1PYO B;  2C2Z B;  3RJM B;  3R7B B;  3SIP B;  2Y1L B;  1BMQ B;  3R5J B;  3KJF B;  2XYG B;  1SC1 B;  3IBC B;  4DCJ B;  1RHU B;  2QLJ B;  2C2K B;  2DKO B;  2QL9 B;  2XZT B;  3EDQ B;  3GJQ B;  2XYH B;  2CDR B;  1SC3 B;  4ZVQ B;  2CNL B;  3GJT B;  1RHQ B;  1RWM B;  2CJY B;  2QLB B;  2H51 B;  3IBF B;  2H5J B;  2H54 B;  2HBZ B;  3GJR B;  1GFW B;  2CNK B;  3R7S B;  2CJX B;  2C2O B;  1RWK B;  2H48 B;  2C1E B;  2C2M B;  2XYP B;  1SC4 B;  2HBY B;  2CNO B;  4ZVO B;  4DCP B;  1RE1 B;  1I51 B;  1NME B;  1RHK B;  2H4Y B;  2Y0B B;  2H5I B;  1RWN B;  4ZVU B;  1RWV B;  3KJN B;  2P2C B;  4JB8 B;  1F9E B;  5IC6 B;  1QDU B;  3R6G B;  4ZVP B;  3EDR B;  4ZVT B;  1RWX B;  4LSZ B;  3P45 B;  2H65 B;  3D6F B;  1I3O B;  2CNN B;  1ICE B;  1RHM B;  1RWO B;  5IC4 B;  3D6H B;  3R6L B;  1QTN B;  4DCO B;  1RHJ B;  5K20 B;  3NS7 B;  4ZVR B;  2QL5 B;  2QLF B;  1IBC B;  1PAU B;  2HBQ B;  3R7N B;  2XZD B;  1RHR B; 
#chains in the Genus database with same CATH topology
 1KHW A;  4ERD A;  4HVZ A;  2JEF A;  1HBO A;  3BKF A;  3K5M A;  4Y2K A;  4NLU A;  3NLC A;  2VIH A;  3H20 A;  3MD1 A;  3PO5 A;  2BX6 A;  2RU3 A;  4WPA A;  1P9Q C;  4OI0 A;  4PPD A;  1BQM B;  3CT9 A;  3ILO A;  1UCN A;  5L8R C;  4LFC J;  3DGV A;  2PFF B;  4DV7 J;  1RHQ B;  2KL8 A;  4TNO A;  5DG7 A;  3MR2 A;  5KFL A;  2CQP A;  4QR1 A;  3A13 A;  3D68 A;  2LVW A;  4Y3C A;  2DNK A;  2ZE2 B;  1RYS A;  2AYM A;  3FFI B;  4ZDN A;  4FXD A;  5F3Z A;  4JI8 J;  3R1H A;  4NLG A;  4IO9 Q;  4YR2 A;  1YBA A;  4F36 A;  3G6X A;  3QT7 A;  3PTW A;  1TTH B;  5JJB A;  3Q8P B;  4J37 A;  1NK9 A;  3BN4 A;  4G1I A;  5IS2 A;  2FHJ D;  5GMK a;  2JFK A;  5J2M B;  1JJ2 R;  1B7F A;  3TO8 A;  3MMA A;  4YHH F;  4O0I A;  2C3P A;  2VZ9 A;  4KV8 A;  3BGU A;  4I2Q B;  2AQ4 A;  2R7V A;  2F3J A;  3UDC A;  3F56 A;  1E6Y A;  4IUF A;  1TR0 A;  1CJT A;  1N54 B;  3OQ2 A;  3L7U A;  5GAE I;  5KOX A;  1BUX A;  4UT4 A;  2NUH A;  1UJ4 A;  4NA1 A;  4Q44 A;  2XEX A;  2XLI A;  4O44 A;  2IM2 A;  2RRA A;  3CD0 A;  4XPE A;  3VAL A;  1DY3 A;  2HBZ B;  4WJB A;  2B4U A;  1WC6 A;  3MR7 A;  4HI2 A;  1OSC A;  3DOK B;  4ED0 A;  5KG1 A;  4C8Z A;  5DLG A;  2B3T B;  3D0I E;  1XJW B;  4OI1 A;  4RJV A;  2CA9 A;  1FCA A;  2VFT A;  2NXJ A;  2CQ0 A;  2U2F A;  1LFP A;  1UJ6 A;  1QDU B;  1XMQ J;  3PM9 A;  2OPQ B;  4GKJ F;  3OSP A;  4LBP A;  1Y5L B;  1JLQ B;  4YP3 A;  1U1N A;  3DLH A;  3ZZP A;  1ZH5 A;  3QNW B;  1F9H A;  2I1R A;  5D77 A;  1YK9 A;  2GHP A;  1J5E F;  2ZZT A;  1G3O A;  4ZIV A;  3DN9 A;  4X62 J;  4OHY A;  1NPR A;  6AT1 B;  3G8T A;  2FY8 A;  2QG9 B;  3M7V A;  4DI6 A;  4WE1 B;  4OX9 J;  2LYV A;  1T11 A;  1VBY A;  1NJI T;  5I42 B;  3RAX A;  1BC6 A;  4B3M J;  4M1K A;  2P5V A;  1FNM A;  2CNK B;  3H2U B;  4URG A;  1HBU B;  4QU6 A;  1F9F A;  1Q8I A;  4RW6 B;  5J2N A;  3E01 A;  1PIE A;  1JNR B;  3MCM A;  3QRR A;  4ZVP B;  1EB0 A;  2JL9 A;  3K7R A;  5H9F K;  1KLM A;  1PJ6 A;  2ASY A;  1RHM B;  4TU7 A;  1C2P A;  1CG2 A;  2KXH A;  3M8Z A;  2CVE A;  1S4E A;  1UWB A;  1B7Y B;  5AJ3 J;  2KYZ A;  3SSR A;  1KON A;  4ZS6 A;  1YIT S;  2CWK A;  2L9D A;  2VBY A;  3KHR A;  1T05 B;  3NCQ A;  4MTP A;  1WHX A;  4I0W A;  2OAU A;  4DV5 F;  2C3O A;  2XY7 A;  1SQE A;  4DR4 J;  1U1P A;  2HPU A;  5D4N A;  1VHF A;  2CNL B;  3LF0 A;  2O66 A;  4DR5 J;  5C25 B;  1Q95 G;  1TKX B;  1D3W A;  4O3Q A;  4A8M P;  2WAQ D;  4RWX A;  1RLD A;  3ZNJ 1;  1TK0 A;  4RX6 A;  2NXU A;  2L41 A;  5KFK A;  3N28 A;  1L5U A;  1IKV B;  1Q8K A;  2DHX A;  3PX0 A;  3AXM A;  1MMD A;  3U1N A;  5M2R A;  2FLP A;  1G1X A;  1HI1 A;  3GFZ A;  4J5O A;  4UST A;  4QW9 A;  3G6V A;  1U8W A;  1S6U A;  1O5J A;  1U0H B;  1FWP A;  3KNA A;  1S59 A;  4YN3 B;  5HSP A;  3QFH A;  2IRX A;  4IRK A;  4C0O C;  2H5E A;  2HVH A;  2JHE A;  3RU0 A;  5H9F J;  3HF5 A;  3UWT A;  5HMY A;  1WHW A;  2ZBC A;  1A7G E;  2Z2Z A;  3J81 j;  2RF2 B;  2YXL A;  3CCL S;  4HT5 A;  3VVU A;  2ZHO A;  2GVD A;  5BYR A;  2DO0 A;  5BYS A;  4KO0 A;  4F4A A;  5A6P A;  1FDN A;  4Y65 A;  2E5J A;  4WZM A;  1VRU B;  4M5J A;  1NJX A;  1L3V A;  2MGZ A;  2ZH7 A;  4RW4 A;  4DN9 A;  2HNZ A;  2HYI B;  3PX4 A;  3BJY A;  3G86 A;  3PW7 A;  3R5G A;  2H51 B;  1X5T A;  3TUP A;  1TVR A;  4FVC A;  2E1A A;  4ZHR A;  4F3Q A;  4OI6 A;  2JWN A;  4LSN B;  3CJ8 A;  3M30 A;  3NWG A;  2CJQ A;  3KHL A;  5B0G A;  3MM5 B;  3QJP A;  2GHV C;  3GR0 A;  4TY8 A;  3AT1 B;  4RW7 A;  2UXB F;  1Q4R A;  2GVZ A;  4JI6 F;  4QYR A;  1RAJ A;  3N4W A;  3KK2 B;  4MT1 A;  1WI8 A;  2X1F A;  4R8U B;  3U02 A;  5E3P A;  1SH2 A;  3UI3 A;  2W25 A;  2HRU A;  3VVT A;  2LXF A;  3JXO A;  4KB7 A;  3IS9 B;  1RTD A;  3RYL A;  5HK4 A;  4MIW A;  3F44 A;  2P6S A;  3BN7 A;  5M2U A;  3B6B A;  3DLB A;  3HHL B;  1FVQ A;  2EXU A;  4O4G A;  3DRR B;  3VZI A;  1IM4 A;  2EFO A;  4LFB F;  4LSL B;  3CCE S;  3OJU A;  4LFA F;  2GQ2 A;  3S01 A;  5D4O A;  2C28 A;  1WOR A;  2V8H A;  3FSI A;  1N52 B;  2HAF A;  3CTR A;  2HHU A;  2X1B A;  3C19 A;  1J2V A;  2IM1 A;  3SV4 A;  1OPI A;  2UVU A;  3NNC A;  1JLE A;  3QAE A;  1DTT A;  2EFQ A;  2KG1 A;  4OHW A;  1R89 A;  4JV0 A;  4MK9 A;  2C3M A;  2ZJR Q;  2DCU B;  1YLX A;  3G96 A;  4PRF A;  4E8U A;  4ZVE A;  4Y34 A;  2JLE A;  1R3N A;  1ZAX A;  3PRB A;  2UUA F;  4K50 A;  1X4D A;  5SUH A;  2AX0 A;  2O5D A;  3CO0 P;  2M88 A;  3AOA A;  1NJZ A;  1IUJ A;  2XCA A;  4JI3 F;  2P6T A;  3TQE A;  3EE3 A;  5DDO C;  1RDR A;  2A2C A;  4CO2 A;  1FK9 A;  3HX9 A;  2HSE B;  4E2F B;  4FVM A;  4I6Y A;  1T94 A;  2U1A A;  2FGC A;  1R0A A;  1YBU A;  4K5S A;  3IA0 A;  4W98 A;  5CXT A;  3MEE B;  2ZBQ A;  3Q0A A;  3TZW A;  5F9N A;  1AXQ A;  1WJ9 A;  5KT5 A;  4MKA A;  2DD8 S;  3W2V B;  4C8O A;  2EFN A;  1O6X A;  1C1C A;  2BAB A;  2E1P A;  3U7J A;  1W2I A;  1QAJ A;  3CJK B;  1BWE A;  2ZDP A;  1KBR A;  5SZT A;  4N47 A;  2R2S A;  3AOB A;  1UZH A;  3PO4 A;  1S0V A;  1RIS A;  1JLF A;  1N8R T;  1S6O A;  3QGG A;  3M4X A;  3ZXW A;  2XZD B;  2ZH2 A;  2ZWO A;  2VG5 B;  1RAA B;  3IMQ J;  1VK3 A;  2E7X A;  2MKJ A;  2MKH A;  1RB0 A;  4A47 A;  2LU1 A;  2ZM6 F;  2Y1L B;  2VFU A;  2PA8 D;  3LAM A;  2ZH6 A;  2DNH A;  1RHU B;  4DV3 J;  2F8H A;  3HDS A;  3GMG A;  2BJE A;  2JVR A;  4KKO A;  2W2M P;  1SC6 A;  1RT4 A;  5CCL A;  2AEJ A;  1TMJ A;  2OFH X;  1EP4 A;  3G2X A;  4QWE A;  4ZVQ B;  3T6B A;  4OZN A;  1U49 A;  4OYA A;  2MLZ A;  1AW0 A;  1FKP A;  4DQI A;  4I56 A;  2C2O B;  2HHT A;  4IOC Q;  5CD4 H;  2LFV A;  1M5O C;  2B4O A;  2NPF A;  5F8N A;  4WXO A;  3Q8U A;  5G0R B;  5HI7 A;  2R7W A;  3FEZ A;  2ZJP Q;  4FNH A;  3P45 B;  3PFO A;  2CNN B;  2AYE A;  1XMO J;  2B7B B;  5K5M A;  1H2U X;  4WWS A;  5GAE U;  1BLU A;  4NLD A;  4ZCK A;  1XEZ A;  3VAJ A;  3TA0 A;  1FVS A;  1T9Y A;  1WC4 A;  2BEF A;  4ECT A;  3PEJ A;  1KOO A;  4IRD A;  4CTA B;  1EJ7 L;  1MSW D;  3MEC B;  4I67 A;  3MWB A;  4UY8 T;  3EXC X;  4HHH A;  4OI2 A;  1K1Q A;  3I0R A;  2KZM A;  5L46 A;  3D4J A;  2VFV A;  2N4C A;  4N76 A;  3G71 S;  1U45 A;  1X9W A;  2KRR A;  2VV5 A;  3M6V A;  3UD5 A;  4IH7 A;  4FKX A;  4DL2 A;  2WON A;  4MK7 A;  4PUO B;  5ETQ A;  4JI5 F;  4LF4 F;  1HR0 J;  3AA8 A;  4KGM A;  2OPP A;  1PC4 A;  3UN2 A;  2ILZ A;  5HRO A;  2LEA A;  3ZZT A;  3T19 A;  1LV5 A;  3M32 A;  4DV5 J;  2D3Z A;  4YQW A;  3SZ2 A;  1AZS A;  3MAH A;  1U26 A;  2K7J A;  3NS5 A;  3N79 A;  2ADB A;  1RWN B;  1LKZ A;  3HZG A;  5CH7 B;  1TUV A;  4LSZ B;  2V8V A;  2GW8 A;  1FJ7 A;  3RZA A;  3WIU A;  1CVJ A;  2RIJ A;  1VC5 A;  1KS2 A;  2YH0 A;  3H7H B;  3HFZ B;  1P27 B;  4AFF A;  3UE2 A;  5IV3 A;  1T9T A;  1NDC A;  3K5O A;  4YEA A;  4KC5 A;  2BW7 A;  2RVJ A;  5LSO A;  1N33 F;  2CPZ A;  2CFX A;  1LW0 B;  2UZA A;  2ZD1 B;  4TU9 A;  4V19 X;  1LWE B;  4B3R F;  1BQM A;  1BY9 A;  4FN5 A;  2LQ9 A;  5ADZ A;  3PHE A;  2VAS A;  4C3L A;  1NJY A;  2KYX A;  2DR7 A;  5L1K A;  2G4B A;  2XO6 A;  3BBB A;  2MLY A;  1VHI A;  3FBB A;  4PWW A;  4DFM A;  2RDJ A;  5D78 A;  2NR0 A;  4PWD B;  3BH6 B;  1KQK A;  3OR2 A;  4ED6 A;  4DN0 A;  4KH0 B;  4UZB A;  2HFZ A;  3IBF B;  3FFI A;  2HWH A;  3GIJ A;  1U1Q A;  4IG3 A;  4NA2 A;  2KU7 A;  2QMW A;  1FX4 A;  1JJH A;  3OBI A;  4B9T A;  3V81 B;  1CJU B;  2JSX A;  4Q45 A;  3CCJ S;  4FS2 A;  3JAM Y;  2DNL A;  3NBP B;  3EWG A;  3D6T B;  3EYZ A;  1HAR A;  1UWA A;  3H5S A;  1MNE A;  2AYG A;  2IYG A;  1IR1 A;  4PG5 A;  4ZPA A;  3G8Q A;  2W2Q P;  4ZPV R;  1OIA A;  2MQM A;  4U7U K;  2W1B A;  5EX0 A;  1CJV B;  3PR4 A;  4JI6 J;  3CCQ S;  3TJ8 A;  1B3T A;  3W60 A;  4MMO A;  4OZ1 A;  2W8L A;  2W8K A;  4XO0 A;  3UR0 A;  3QID A;  2PA3 A;  2VQF F;  3KKF A;  2KDO A;  2YPY A;  3AD8 C;  2VIC A;  5F8I A;  2R3V A;  3MFH A;  3P5B P;  4K5R A;  3DOK A;  3TRG A;  3HO1 A;  3V6K A;  3ETM A;  2KG0 A;  3K59 A;  1U0S A;  3D28 A;  2XQC A;  1HYS B;  1G4C A;  3DXB A;  3QGH A;  4A8O A;  4O4R A;  3PR5 B;  1RT5 A;  3EGZ A;  4URS A;  2OPQ A;  2B43 A;  4LF8 F;  3WX4 A;  4LFB J;  1SKS A;  2LEB A;  3LH2 S;  3KJN B;  3V6H A;  1WTF A;  3MPD A;  1YJ9 S;  3R6G B;  2X3D A;  1VFJ A;  2JX2 A;  3ZTR A;  1I3O B;  2B8Q A;  5IQ6 A;  3NMR A;  5I3Q A;  1JKH B;  1QUV A;  1H0H B;  2NPI A;  4OYO A;  3HM9 A;  3T5K A;  1Q5V A;  3GG0 A;  3ET6 A;  4Q0B B;  2FZK B;  3R7B B;  2IM3 A;  2A18 A;  3K58 A;  1LWF B;  2MQN A;  4JYA F;  1MU2 B;  2OEJ A;  4ZN1 A;  3VTI A;  1PYT A;  4F67 A;  3O1L A;  2QMU B;  4WE1 A;  3H98 A;  4EZ9 A;  4ER8 A;  3LP2 A;  4EGL A;  5I42 A;  2N3L A;  4KAI A;  4LQ3 A;  4K8R A;  3ELH A;  3E2E A;  5KT4 A;  3LAN A;  4WII A;  2IVM A;  1HBU A;  2OFG X;  4LRE A;  1RWU A;  4DHV A;  1PIL A;  2DGS A;  1JX4 A;  2J7W A;  5HP1 B;  1M1G A;  2H48 B;  4CQ1 A;  1ZS6 A;  2WVE A;  5CYQ B;  2VG6 A;  5L1J A;  1B0V A;  2J6T A;  3CMQ A;  2PT0 A;  2XCP A;  1OSD A;  1F60 B;  1YZ6 A;  1VI7 A;  3H25 A;  1HBN A;  1LEO A;  4H4O B;  2DH7 A;  4O3O A;  1ZM2 A;  2BJ7 A;  2QGF B;  3N5B A;  2RML A;  1JLC B;  2G2Y A;  3TX0 A;  2BQ3 A;  2QLF B;  2OIH A;  5E5N A;  5KG2 A;  4K0K F;  4C11 B;  2E9T A;  2M4M A;  1XER A;  4QYZ J;  2LCW A;  3O2I A;  1BMQ B;  3R5J B;  3PY8 A;  5CYJ A;  3D7S B;  4NLY A;  3RAM A;  2A1B A;  4KHR A;  4E0D A;  4N41 A;  1CPZ A;  3I5A A;  2LQB A;  4DPT A;  3CNQ P;  1UKU A;  5C25 A;  5HMX A;  1TKX A;  2MZT A;  2XWY A;  2ZM6 J;  2XZW A;  5B08 A;  2LU2 A;  4YFU A;  3R5C A;  4CLW A;  3QAT A;  4OJH A;  3FKB A;  4PAB A;  3TAP A;  4B9V A;  3HJF A;  4AXJ A;  1RWK B;  4Q2M A;  2C1E B;  3MM6 B;  2YKO A;  2KHD A;  4WCE Q;  3HXM A;  4KSE B;  2NCK L;  2XY5 A;  4EO8 A;  1Q1K A;  4NML A;  4P6Q A;  1FDA A;  2D3O 1;  1U0H A;  3SFG A;  3PFE A;  1LQ9 A;  1MN7 A;  1UFW A;  2FC9 A;  2ZEJ A;  2XGP A;  4OYM A;  2HHX A;  2MJU A;  2V9K A;  2NRE A;  1KOH A;  4RNO A;  2HGM A;  2UUC F;  1N32 F;  2RF2 A;  2XLJ A;  4KE5 A;  2DPI A;  3A8E A;  2AJ4 A;  1QY7 A;  3KUH A;  1NK0 A;  1VRU A;  2OD6 A;  5A2Q U;  1HPZ B;  4ES3 A;  2R8K A;  3W65 A;  4JI0 F;  2O1P A;  2YKA A;  4LF9 F;  4MKV A;  4JUZ A;  1DQ9 A;  2RKI B;  3N0V A;  4LSN A;  4JI4 F;  1XR5 A;  2VPW B;  1S7I A;  2PEB A;  5HVH A;  3MM5 A;  2YNG B;  1RT7 B;  4NA3 A;  4WK1 A;  3FRY A;  4GKK J;  3EJM A;  1SC4 B;  2I2Y A;  5JVH Q;  2CNO B;  1FXR A;  1IBK F;  3E3X A;  4O3R A;  1HMV B;  4WFY A;  4M5H A;  2M8D B;  3CJQ A;  1FE0 A;  2AJ1 A;  3QYY A;  4CLT A;  3V6D A;  3KK2 A;  3BGR B;  2BM1 A;  3HK2 A;  4R8U A;  1XR6 A;  4OJ3 A;  4CLK A;  1ZM4 A;  1WDD A;  1HNZ F;  5F41 A;  2DRB A;  4ZP7 A;  3WHI A;  1VLO A;  5CYM B;  2BJ8 A;  3IS9 A;  4NL5 A;  1UW4 A;  4GC7 A;  4F0M A;  2FHJ A;  5CD4 A;  3EX7 B;  3DOL B;  4HAC A;  2BZ2 A;  3R97 A;  1AT1 B;  1HWU A;  1EKS A;  4QW8 A;  2VPY B;  2V94 A;  3EMT A;  4C8M A;  3SEO A;  1OPZ A;  4O3N A;  2L9N A;  3GB0 A;  3DRR A;  4UQG A;  4C9D A;  1EAY C;  1LK7 A;  3HZE A;  4LSL A;  2V9W A;  3EM1 A;  2V4Q A;  2LMI A;  1RAH B;  2KJV A;  3W5Y A;  1RWM B;  2VJU A;  2XGQ A;  4DPO A;  2Z2L A;  1N5V A;  1X4E A;  3GV7 B;  1FNX H;  5LMU F;  1FWK A;  2DHS A;  5DJB A;  4CLU A;  3T5L A;  4IG0 A;  3FCH A;  3ILI A;  3Q8S B;  5KG0 A;  1F2G A;  2WBR A;  4QQB A;  3C3L A;  5D6G A;  4MFB B;  3BDE A;  4ZKA A;  3JB9 k;  1GNK A;  3AB4 B;  1P1T A;  1CBK A;  4CNZ A;  4LRF A;  4HEA 9;  3BO2 A;  3H5U A;  1UL3 A;  3MPY A;  1RWW B;  1NB7 A;  1KQG B;  3UDV A;  5CA5 A;  3GYX B;  4X4O A;  1U1O A;  4ZCI A;  2O01 C;  4DV4 J;  2BJ3 A;  2VJV A;  3ILJ A;  2MQP A;  5K14 B;  2F65 A;  1QAY A;  5D0R A;  4DV0 F;  2W9C B;  4WFX A;  4CT9 A;  5IT9 Y;  2DRA A;  3ZZU A;  3MEE A;  2NUU G;  1PAE X;  2RRB A;  2C3U A;  4LRA A;  3W2V A;  4ZP8 A;  3OD2 A;  3JSM B;  1F5B A;  2ZKU A;  3AJ1 A;  7AT1 B;  8AT1 B;  3CJK A;  3MUR P;  5KG6 A;  5EWG A;  4B9N A;  4DS4 A;  2Z2M A;  5ETN A;  2YTC A;  5KFX A;  5C7P A;  5J2P A;  4J9S A;  5A8R B;  5A2Q Y;  1DQ8 A;  4ECU A;  2JC1 A;  4B3T F;  4N7T A;  2A10 A;  2Y9H A;  5LMN J;  1K73 T;  3PZP A;  2YNF B;  5HVF A;  4FS1 A;  3BS9 A;  4M8L A;  1NUE A;  1O8B A;  3Q89 A;  4NXM F;  4LF8 J;  4NCA A;  4F4W A;  3HSD A;  4ZVS B;  2XMT A;  1QAX A;  2E5G A;  4U8Y A;  3CIZ A;  2C42 A;  3AAW B;  2FLO A;  2YVS A;  2VBZ A;  3T1Y F;  3FBF A;  1HQU B;  2OP5 A;  2VOD A;  3H2L A;  2HVI A;  1UMJ A;  3T41 A;  4DLE A;  4LRD A;  3CUN A;  2JEJ A;  8RUC A;  3DGP B;  5F8L A;  4Q8F A;  1R8P A;  3W2W A;  3D2W A;  4K4W A;  1I1G A;  1YJ7 A;  1FJG J;  1R8H A;  3P49 B;  4DZ6 A;  4WYL A;  1TKZ B;  3Q22 A;  4OI3 A;  2DYA A;  2E1R A;  4ECY A;  1FFS B;  3NS6 A;  2F4V J;  2UUB F;  3DMJ A;  1F3F A;  1FE4 A;  1JXE A;  3VWS A;  1F5A A;  4ES1 A;  1QUP A;  3DYA B;  2ZZN A;  3WZ0 A;  4UUW A;  4IFY A;  3J7A N;  4MKB A;  3DM2 B;  2CPI A;  4ID8 A;  4DUY J;  5HAN A;  1IBC B;  5LL6 d;  3J7Z 5;  1UPM B;  2F9J A;  1K8A T;  2XMK A;  2GV1 A;  3OL9 A;  4OZ2 A;  2QYC A;  3TVZ A;  1I5O B;  1F0X A;  4WZQ A;  4LF5 F;  3KJV A;  1RK8 A;  1LFW A;  3FBC A;  5DZ7 A;  2YH1 A;  3EGV A;  3BR9 A;  3O6Q A;  1HQE A;  2OPR B;  3I0S A;  4ZK7 M;  2CQB A;  3C6U A;  5DQI A;  3B78 A;  4ZP6 A;  3HFV A;  3MMB B;  5F8J A;  2JRS A;  1WTB A;  4EI2 A;  1FKA F;  2ACM A;  2YBV A;  2HVD A;  3R2D J;  2E9R X;  3D67 A;  3PXG a;  4ECX A;  3QLH B;  1NND A;  3C66 A;  4DV2 F;  1TUW A;  4ELU A;  2WBM A;  3T9Z A;  2B8P A;  1RT6 A;  4MJK A;  3J80 U;  1HD0 A;  4ILR A;  5DLF A;  1HKA A;  3IWN C;  3OPK A;  4P10 A;  3DOM B;  4OHX A;  3JQM A;  2ZD1 A;  3T6J A;  1KRP A;  1LWE A;  2HBQ B;  4ATN A;  2AV5 A;  2MY7 A;  5MLC V;  4WFZ A;  3FQK A;  3KHH A;  1CJK B;  3SSQ A;  4MH8 A;  3OT9 A;  1JXV A;  1VQ6 S;  2Y3Y A;  3D66 A;  1SKU B;  4TXS A;  5JUM A;  2VPZ B;  4WBF A;  3TEH B;  4KGX B;  1M0S A;  3ISN C;  1QTM A;  1W7W A;  1CQN A;  2UUC J;  1N32 J;  1HI0 P;  1S97 A;  3CO9 A;  1RKI A;  5HO4 A;  2OHD A;  3OLA A;  2QN6 B;  3CCU S;  4RUH A;  4QWB A;  2R9L A;  2BV3 A;  3V81 A;  4JI0 J;  1RTZ A;  3LGH A;  3KK3 B;  1OYE A;  3GV8 B;  2V68 A;  3NBP A;  3AJD A;  5KFP A;  1UET A;  2BAN A;  1WOS A;  2FJW A;  2J9E A;  1OWX A;  4JI4 J;  5KFC A;  4JB8 B;  4NLS A;  4RLE A;  3BSO A;  2RJZ A;  3DLL Q;  4Y2M A;  1RT2 B;  4R25 A;  1WC1 A;  1HNX F;  5B0F A;  2M2B A;  2RUG A;  3CJR A;  3W8P A;  4C0B A;  1TK5 A;  4Y00 A;  4NRT A;  2KRB A;  3NOG A;  1GTE A;  5T14 A;  1YJU A;  2HHH J;  4UOH A;  3UQS A;  2HLT A;  3GR1 A;  3SFU A;  5C42 B;  5M2P A;  3MED B;  1N88 A;  2KTQ A;  5LSL A;  1YRU A;  4ZA1 A;  2UP1 A;  1MML A;  1QM9 A;  4NYO A;  3MAA B;  2BKN A;  5C2G A;  4NCG A;  1UEU A;  4X4Q A;  1OJ4 A;  4M5N A;  1SPB P;  2QSW A;  2OEM A;  4LR8 A;  1WF0 A;  3T1A A;  2KT3 A;  2H9Z A;  3C8Y A;  2UUW A;  1IJE B;  4DSK A;  4TKT A;  4K4Y A;  2YX1 A;  3R2C J;  2YY3 A;  2DTJ A;  3DLG B;  1RE1 B;  2ZJQ Q;  3J7A 1;  2NYI A;  1L3T A;  3BSN A;  1JKH A;  1VMB A;  3CCZ A;  4R5P B;  3R27 A;  4ECS A;  3J81 U;  3BB5 A;  3NAH A;  4BLG A;  3JTP A;  3ZFV A;  4Q0B A;  4A8Q A;  4CLZ A;  2MZQ A;  5DGA A;  1FA0 A;  4J9M A;  2AGQ A;  4OV1 A;  5F9L A;  1MU2 A;  3CC7 S;  2RS2 A;  3TYT A;  2IPO B;  4DPU A;  1NBE B;  4DWI A;  3UN5 A;  3KNG A;  2LQJ A;  5A6W A;  1MWQ A;  3FCV A;  3JSR A;  3ICL A;  3DCA A;  2E66 A;  3OTC A;  4PZV A;  1S6Q B;  1MRO B;  3BKU A;  3RUB L;  2I8E A;  3FZB A;  1S4F A;  1HLW A;  2W2O P;  2ROG A;  3BBF A;  2DXE A;  4W90 B;  4ZPT R;  1BQN B;  3D9B A;  3UD4 P;  2QRR A;  1Q0N A;  4H4O A;  3TAQ A;  4KHM A;  2HQC A;  5DO2 A;  4NOH A;  1JLC A;  3JQK A;  4NCB A;  3CDW A;  3MM7 B;  2K1R B;  3K5P A;  1XC9 A;  1X5S A;  4OLO A;  3J7Y I;  1CUL A;  1S99 A;  4C11 A;  2KH9 A;  3D0H E;  3P5T L;  3NGK A;  1HD1 A;  4TLR A;  3KLE B;  1QLN A;  1UAW A;  3WDO A;  1YTY A;  5F8M A;  1KLN A;  2CJK A;  3PKY A;  4HI1 A;  3W9H A;  2XS7 A;  4ILM A;  1R27 B;  2XYG B;  2W7O A;  1WAC A;  2HGL A;  1NH8 A;  2VU5 A;  2XSJ B;  4ECQ A;  2Z57 B;  3OFG A;  3NGT A;  1H72 C;  3PDN A;  4CRJ A;  5B0E A;  1T95 A;  5KFR A;  4M5D B;  3LW5 C;  5HQL A;  3RAQ A;  3MM6 A;  3MPU B;  3M8P B;  1ZTW A;  2CJX B;  2IMO A;  1X7V A;  4G65 A;  3MUV P;  4P2X A;  1T0T V;  1DTQ B;  2IIH A;  3MMC B;  3PIP Q;  1TL1 A;  4IR1 A;  2WSF C;  1LXN A;  4TYA A;  2LEP A;  2LLZ A;  1JIH A;  4N8N A;  5ETM A;  1C4C A;  4DV7 F;  3H8Y A;  2JOQ A;  1NDK A;  2PFD A;  4RUB A;  5HBM B;  3VF0 B;  3PYG A;  1EZZ B;  4ECV A;  1TFW A;  3VAH A;  2UUB J;  2WK4 A;  2WCX A;  1Y7P A;  1OO0 B;  3RBZ A;  3GPA A;  3QGI A;  1HPZ A;  4JI8 F;  2IBK A;  2R8G A;  1JLA B;  2CZ4 A;  1CS4 A;  4IQM A;  1ACM B;  3QBC A;  1U48 A;  2RKI A;  1KKH A;  4DX6 A;  2HZA A;  3FBE A;  2HVE A;  3C6T B;  5A76 A;  2G1H A;  1SC3 B;  2YNG A;  1P6T A;  4FYD A;  4LF5 J;  3VGT A;  2QFJ A;  4X4P A;  3G9C A;  4KJI A;  3PW5 A;  4M95 A;  3TUZ C;  1RUS A;  1HMV A;  1KEK A;  4I69 A;  2C2M B;  3BGR A;  5DM6 Q;  2BR0 A;  1NME B;  4LF1 A;  4UTG A;  2R2T A;  2YKM B;  3M8R A;  4X4S A;  3ZTO A;  2HHS A;  1R8A A;  2DY9 A;  1ZPW X;  1RTJ B;  3GTY X;  3LWM A;  5CYM A;  3KYL A;  1FNO A;  2G2Z A;  1N36 J;  3DOL A;  1B4S A;  3DRP B;  4W4M A;  1T03 B;  2RAQ A;  3DC2 A;  1LOU A;  4JOU A;  4DV2 J;  4PQA A;  4OX6 A;  1NU4 A;  1VQL S;  3BYR A;  3CMA S;  3NAI A;  4IKA A;  2B4V A;  1MLA A;  2J8S A;  5D3G B;  4P9S A;  2GO9 A;  3KJF B;  3DLK B;  3QRP A;  3K8W A;  3TZZ A;  3CE8 A;  3T1H J;  3QIP B;  5HJX A;  1XMQ F;  1SBR A;  1VBZ A;  3LO3 A;  1ZAW A;  4QR2 A;  1MWZ A;  1X4B A;  5C24 A;  3K17 A;  2L08 A;  4NZ7 A;  5IM0 B;  5B09 A;  3KLF B;  2HS0 A;  4YDD B;  1ZM3 A;  2ZH5 A;  2JJ4 D;  4A8Y A;  1VQK S;  1WEY A;  1XK8 A;  2G1D A;  2V69 A;  1VRQ C;  1SJQ A;  4LF7 F;  1T9V A;  5J1E A;  4I68 A;  1RT1 A;  2XMM A;  2DB1 A;  4FNI A;  1NPP A;  9RUB A;  2K3I A;  2V5H G;  2CQC A;  1IWA A;  1YDL A;  4MFB A;  1RAF B;  1QSL A;  3OTO J;  4U95 A;  2OJ3 A;  4OX9 F;  2V50 A;  2Z56 B;  5K20 B;  2YWG A;  4DF8 A;  1BWV A;  4M5K A;  1X9S A;  4B3M F;  4V19 J;  1V5V A;  3BQ2 A;  2DH8 A;  3H2V E;  1RA7 A;  5B0C A;  4K2X A;  3CCT A;  3GIM A;  1RWP B;  3FRZ A;  5K14 A;  3MGJ A;  5KT2 A;  4LBH A;  2W9C A;  4YME A;  3UR3 C;  2IDE A;  1RAD B;  5KFY A;  3EVW A;  3M2R B;  2VFS A;  5GME A;  2DY1 A;  2HQD A;  1N0U A;  1XNR J;  4X84 A;  3OUY B;  3JSM A;  2ABY A;  2KFN A;  1SUQ B;  2YWH A;  3SQO P;  1NK8 A;  1TKD A;  1UJ5 A;  2POK A;  5THW A;  3F41 A;  2DHA A;  1FT8 A;  3P8B B;  1VIO A;  3S6E A;  5KT7 A;  3H4B A;  4OL8 A;  3H4D A;  5A8R A;  1JLB B;  3M8W A;  1XR7 A;  1XIQ A;  4ZIW A;  2R42 A;  4AYB D;  2HVZ A;  3QT6 A;  1IR2 A;  4IO1 A;  3OTD A;  3VZH A;  2HWT A;  4DR4 F;  4YB7 A;  4DQP A;  5CAB A;  2BJ1 A;  2H65 B;  1YJN S;  4HYK A;  2CPJ A;  4IFV B;  4O3P A;  4I2P B;  4QIG A;  4QWC A;  1SB6 A;  2CZV C;  5D4P A;  1IBL F;  2KT2 A;  2ZOM A;  2OTJ S;  4GVL A;  3KMQ A;  2DIS A;  2WSC C;  3SIP B;  4FYW B;  3PIO Q;  4U7U D;  5FLX Y;  1VRT B;  3OR1 B;  4L76 A;  3DGP A;  1OS5 A;  2M3D A;  2RQ4 A;  2BUN A;  3LGM A;  4PR6 A;  4ZCM A;  2ALY B;  3A3P B;  4K4U A;  4EFA C;  2ZKT A;  3FK4 A;  1MG7 A;  2UXD J;  1TKZ A;  4DV6 J;  2M5Y A;  1ZZF A;  4AQY J;  3V4I A;  2DR5 A;  2FVR A;  3M2V B;  1X4A A;  5D0H A;  4ZVH A;  1TL7 B;  2XYP B;  3HVW A;  1HA1 A;  3EVO A;  2ERR A;  3RR7 A;  4QOT A;  1WI6 A;  2R2R A;  1RAI B;  3HVR A;  3DM2 A;  2H1Y A;  2W9B A;  3EDR B;  3RW6 A;  4KT0 C;  4WTY A;  5ITH A;  1N6Q B;  3KG0 A;  1HBM B;  2ZC3 A;  2J76 E;  2NXC A;  1S72 S;  2QZ8 A;  1WSV A;  1X8D A;  3ZZ0 A;  1HNW J;  2MHE A;  5T7L B;  4X65 J;  2QFI A;  3I6P A;  2HZV A;  2OPR A;  1BQX A;  2OKQ A;  3LP1 B;  3SI8 A;  2DGW A;  2I6W A;  3TI0 A;  1NKC A;  4DL3 A;  5HQ8 A;  4A46 A;  1S9E B;  1WKL A;  1FI4 A;  1RKJ A;  4PYD A;  4LUB A;  2AP6 A;  1IWG A;  3BO4 A;  2FDN A;  1FFW B;  2YWK A;  3MF5 A;  1C4A A;  1O51 A;  4F7V A;  4L6V 3;  3PW4 A;  4LMZ A;  2FYX A;  1H3D A;  4KPY A;  5C2C A;  3C46 A;  1NDL A;  4IOB A;  3LAL A;  5J1N A;  5U47 A;  4S0M A;  2IMW P;  2J0X A;  1VQ8 S;  3DOM A;  3QJJ A;  3M05 A;  3GZ7 A;  1D09 B;  2OTL S;  3FEY B;  2L3M A;  5LM7 E;  5KG4 A;  2CG8 A;  2Q43 A;  4NLT A;  4DPW A;  1CJK A;  4C7Q A;  2ZNY A;  3M6X A;  4OZ3 A;  5L38 A;  2GAG C;  1ITP A;  4WFN Q;  5KFV A;  2FTR A;  2ZHA A;  4ZN3 A;  2WVD A;  3I31 A;  4UF4 A;  4U7C A;  4LR9 A;  4OYX A;  2EI5 A;  2XZT B;  3WBZ A;  2W4D A;  3OXG A;  4QCL A;  3OXL A;  1Z2Z A;  3B54 A;  3BPS P;  3BH7 B;  1TP7 A;  5I3P A;  4DQQ A;  2G13 A;  4QPT A;  3J7Y U;  3CPW R;  4KQZ A;  2ZC4 A;  5B0B A;  3KK3 A;  3LAK A;  1WF1 A;  1RAC B;  2MQL A;  3OW2 R;  3FJ2 A;  1EET A;  1GXT A;  3UCZ P;  1K44 A;  2QE5 A;  5DGB A;  3BGO P;  1U8S A;  1V9O A;  1AYE A;  3SCL E;  4ITS A;  1PJ7 A;  3C16 B;  1N5S A;  3HHL D;  2EK6 A;  4NLW A;  5KTQ A;  2J0W A;  5A8K B;  5ETL A;  2KXN B;  4OYI A;  3CJ4 A;  1TK8 A;  2QTW A;  1FF2 A;  5FDL B;  4QIF A;  5C42 A;  3MED A;  1S9F A;  3AHP A;  1FEH A;  4DJB A;  2G0J A;  3HD2 A;  3MAA A;  1ZET A;  4ECZ A;  2MYF A;  4YB5 A;  4DG1 B;  1JMT A;  4CYU B;  3LOU A;  2HFO A;  2VA3 A;  2MEW A;  3QGP A;  4X4V A;  2R7O A;  3THV A;  1Q5Y A;  4OZL A;  1QE1 B;  1ZTT A;  1WC5 A;  4JI1 J;  2E5I A;  3NEK A;  2FJV A;  1X9M A;  3DLG A;  3TAR A;  2BM0 A;  4RNM A;  2OMO A;  3KG1 A;  3DRS B;  2VBX A;  3TA2 A;  4EYI B;  4N77 A;  1C0T B;  2MSS A;  1IQZ A;  3OL8 A;  2VL1 A;  2MQO A;  4DV3 F;  4R5P A;  2WVC A;  2FJB B;  3CWJ A;  4FP9 A;  2BQU A;  2H5I B;  4EMD A;  4WIQ A;  1DLO A;  2C2E A;  1FKO B;  2GZO A;  3QSY B;  4USJ C;  3PYE A;  1LW2 B;  1GXL A;  4LF7 J;  1RWO B;  2GMJ A;  3R1L A;  1RHJ B;  5CCM A;  5KT6 A;  3BKT A;  3GSD A;  2LKZ A;  1F3V A;  3IR7 B;  4ZPD A;  4ZLL A;  3D6M B;  2QL7 B;  2NQP A;  4NE9 C;  2ACY A;  1T8E A;  1NZ8 A;  3G8S A;  1WF2 A;  1VC0 A;  1N5Y A;  2BBE A;  1F6T A;  1S6Q A;  1MRO A;  3POT A;  1PBU A;  1Q79 A;  1XMO F;  3I82 A;  5EHH A;  1ZA1 B;  2BRL A;  2QA2 A;  5B7W A;  4F4X A;  2ZH4 A;  3MMA B;  2QC3 A;  1YJV A;  2HWI A;  4J9O A;  1XBW A;  1HHQ A;  1VQ4 S;  3U1M A;  4DSL A;  4F04 B;  3DKD A;  1V3Z A;  3IGV A;  3VAF A;  1UEV A;  4WK3 A;  3MM7 A;  3UD3 P;  2B6A B;  5DQH A;  1X4C A;  2K1R A;  4DCP B;  4JBC A;  2W01 A;  1L3U A;  2CJB A;  1GEH A;  4OV6 A;  3KLE A;  1RWX B;  2G9O A;  1HR0 F;  4XDD A;  2Q6B A;  4RPF A;  4CH0 S;  3D5M A;  2BXJ A;  5HAO A;  3GIL A;  4QBU A;  2M0G B;  3I9V 9;  1ZPV A;  4LIW A;  1NSP A;  4F3O A;  5KFN A;  1FX2 A;  3NRB A;  3MTK A;  4M5D A;  4F4Y A;  4W92 B;  4DV1 F;  1VR6 A;  4NEY A;  3L7P A;  1IBL J;  1N56 A;  5HLF B;  2DNO A;  3CXC R;  3W61 A;  4DFJ A;  3CDB A;  1V5I B;  3C2P A;  2MKK A;  3PYF A;  1NB2 A;  1QJH A;  2BVZ A;  3RG6 A;  3I4H X;  1DTQ A;  5E2Q A;  3MMC A;  1ZA2 B;  5EGY A;  3ENA A;  2I5J B;  3OFE A;  4HR2 A;  3PRV A;  4LR7 A;  4YS2 A;  3HHK A;  2Y0B B;  5DDQ C;  5AXL A;  2PI4 A;  4IDK B;  3OTE A;  5A8W A;  4NI2 A;  2A2D A;  5HBM A;  3TUJ C;  2JDJ A;  3QMQ A;  5CZX A;  3BSC A;  4N56 A;  2A0F B;  3FUY A;  4ZVF A;  3W9J A;  4R0J A;  4DS5 A;  3OL7 A;  4NYZ A;  4LT6 A;  4MK8 A;  4FYX B;  3SDE B;  1JLA A;  5KFZ A;  1N48 A;  1DBD A;  2YKP A;  3E01 B;  1VQY A;  1FD2 A;  1D9A A;  4OX7 A;  2PO4 A;  3C6T A;  4KRW A;  3SCI E;  2C22 A;  2UU9 J;  4CCH A;  4DL4 A;  2XUL A;  3N6L A;  3HSZ A;  2BE9 B;  2W7A A;  1EQ0 A;  3QO9 B;  1HW8 A;  1OY9 A;  2HRY A;  2KVQ E;  2HIQ A;  1Y00 A;  2CQD A;  4USW A;  2EKN A;  2E5L F;  2YWE A;  4NLX A;  1U1R A;  1YRT A;  3GCW P;  4WP3 A;  2YKM A;  3EPI A;  2YX4 A;  3BQ1 A;  4QIE A;  2CVI A;  1RTJ A;  4ELT A;  5JMN A;  2MQQ A;  4DSI A;  3DRP A;  4RUA A;  1XMB A;  4HDG A;  2Q79 A;  4EBD A;  2AKW B;  2M52 A;  2CQ4 A;  3GE9 A;  4DCO B;  1GMU A;  4CLS A;  1AB8 A;  1U7L A;  5D3G A;  1NJW A;  2V0N A;  2VON A;  1JNZ B;  2FJE B;  1IXK A;  2JLG A;  4G3I A;  1PYO B;  2V6A A;  3A12 A;  3QIP A;  2QEX S;  3HHD A;  4A8X A;  4F02 A;  4F4K A;  1M90 T;  4B9M A;  1NHK L;  1Y5N B;  1S0O A;  3KLF A;  2A6M A;  1FFG B;  2AWZ A;  2CRL A;  4B9U A;  2XBP A;  3AOC A;  2VC0 A;  2XO7 A;  4CIO A;  3FNN A;  2VUG A;  2AW0 A;  2IC3 B;  3I96 A;  2CIM A;  4NXN J;  1Q7L B;  1SCJ B;  4KH1 B;  1ROF A;  5L1I A;  2OD4 A;  3MM8 A;  1CQM A;  1RU1 A;  4QR0 A;  4A8W A;  1MW7 A;  4ZOS A;  1SJ1 A;  2DNP A;  2GJ2 A;  3AY0 A;  1KTV A;  2VFR A;  4C2M A;  1DQA A;  4P72 A;  5JVG Q;  1URR A;  2BE2 B;  4B17 A;  3M9N B;  4F0H A;  5G4D A;  5BXI A;  1S9G B;  1S1V B;  3M30 B;  3TWZ A;  1C0U B;  3KOA A;  2UXC J;  1NK7 A;  1BD6 A;  1RAB B;  1YGY A;  2FHK A;  3TAM A;  2W2N P;  1NXI A;  1GAO A;  3M2R A;  2JC0 A;  3CW2 C;  1N34 F;  3UW1 A;  2KKH A;  2ZNZ A;  1KVI A;  3PVX A;  1Q7Y T;  3S7R A;  4PAA A;  1SUQ A;  4AUK A;  5C5J A;  4J90 A;  3GV5 B;  2CPF A;  2EFP A;  4PQU B;  5KFW A;  3H59 A;  3LP0 B;  1RTD B;  5IFM A;  1RT3 A;  1FTR A;  5E41 A;  2RRN A;  5F0U A;  5AXM A;  3BO3 A;  2ROE A;  1RAO A;  1TUG B;  2Q66 A;  3OL6 A;  5E7O B;  2DEI A;  2ZUG A;  2DNG A;  3IAM 9;  1WKJ A;  2BDP A;  4USK A;  2V2Q A;  1VJQ A;  2IHR 1;  4O4G B;  1KVK A;  4IFV A;  5EUH A;  3I4P A;  4LRB A;  4NLR A;  4X66 J;  1WDT A;  1A6L A;  2YQ0 A;  2Q6C A;  2MZJ A;  5F0W A;  2PEH A;  3GIR A;  3HJV A;  3TZY A;  2YKQ A;  3HT3 A;  1X0P A;  2AJ0 A;  1APS A;  3G82 A;  4ED7 A;  3JTN A;  3N5F A;  1UW9 A;  2RE1 A;  1VRT A;  1VQ9 S;  3OR1 A;  1HFE L;  4PXC A;  1HWK A;  3VGS A;  4UY8 5;  1JLE B;  3CCM S;  1S6P B;  4MYT A;  1WG1 A;  4DR6 F;  1S79 A;  1H7X A;  3QRQ A;  2E7W A;  2SXL A;  4NX9 A;  3HUL A;  3CJS A;  4ZPW R;  3R5B A;  4I6A A;  3M2V A;  4LQ9 A;  1TL7 A;  3D1Q A;  4FF3 A;  3RGI A;  4H54 A;  2F7V A;  1E6V A;  1FO1 A;  4L72 B;  1TKT A;  1F5C A;  2VC1 A;  2VQE J;  2F9D A;  1UPP A;  4DX5 A;  3TP2 A;  5HMZ A;  1M5K C;  2N82 B;  3SCK E;  3RRG A;  2QMX A;  1N6Q A;  4ZMM A;  1J5O A;  1HBM A;  3D3C J;  3CF5 Q;  5EWF A;  2CG4 A;  2G0I A;  3KWM A;  3TW0 A;  1R0A B;  1TU0 B;  5KFA A;  4RU2 A;  3QSI A;  5T7L A;  4J9R A;  2G0C A;  4GKK F;  2KZZ A;  3TA1 A;  2JH3 A;  1DRZ A;  3DHX A;  2FHO B;  3LP1 A;  1C1C B;  3RB0 A;  3NGU A;  2P9C A;  2FJD B;  5DG8 A;  2LA6 A;  1JXL A;  4TVA B;  1KD1 T;  4C8Y A;  1KQS R;  2RDD A;  3DHW C;  4OHZ A;  1ZM9 A;  1S9E A;  1RZM A;  4EBE A;  3GJQ B;  2C2N A;  3W8G A;  1IM6 A;  2Y1R I;  4ZJQ A;  4HHU A;  2BAC A;  2X7I A;  2HK3 A;  3I5B A;  4X4U A;  1A0O B;  2GIR A;  2DIT A;  1K0T A;  1RTI B;  1S1W B;  1ZBT A;  2QLB B;  4ZLJ A;  1RAG B;  2OPS A;  2XM3 A;  1RAE B;  3IGN A;  3IWX A;  4DV1 J;  2EPI A;  5LOQ A;  4NEZ A;  2N3O A;  2ASL A;  2LA4 A;  4X64 J;  4RZR A;  3V2U C;  1RT4 B;  3MM9 B;  1NM2 A;  1SJF A;  2A3J A;  3AFG A;  2FGO A;  1FWL A;  1GX6 A;  2LXU A;  2D7S A;  2IRY A;  2KM8 B;  1YG0 A;  3GG1 A;  4ANE A;  2XC9 A;  4P2M A;  4HH1 A;  1WUU A;  1Y3J A;  2QL5 B;  4DR1 J;  2V8P A;  3LWL A;  3TVY A;  1GMV A;  1KFS A;  3WIV A;  4K4T A;  1KNZ A;  2J9D A;  2FZC B;  4ZCL A;  1SH0 A;  2W9A A;  3RJM B;  5T41 A;  3FQL A;  4QJV A;  1NK5 A;  4OZJ A;  2ZE2 A;  1W2B R;  4B3S J;  4C8K A;  3NY0 A;  3I32 A;  3BPD A;  4C3K A;  3HT0 A;  1WWH A;  1UVL A;  1YJW S;  3QT8 A;  2BJD A;  3H42 A;  4J7C A;  5RUB A;  4J9Q A;  4LF6 J;  5J2M A;  4DV4 F;  1UA1 A;  3I0R B;  4JV1 A;  4ZVO B;  3CD6 S;  1MMN A;  3C16 A;  2AGP A;  1W26 A;  4I2Q A;  1OY8 A;  1G7C B;  5DM7 Q;  4L75 A;  2WON B;  2VA2 A;  2E5L J;  2VOP A;  3CGI A;  4PWU A;  5FDL A;  4WP8 A;  5HRO B;  2DNM A;  1IVZ A;  2V8G A;  3OVB A;  2BKO A;  3X1L B;  2QV6 A;  3IXQ A;  2AEM A;  4ED2 A;  1A9N B;  2CAD A;  1S1T B;  4RW8 B;  2VD3 A;  1CEZ A;  3CD5 A;  5KFO A;  1N5T A;  2R7Q A;  2IJN A;  1PKU A;  4WP9 A;  1IKX B;  4USV A;  4U67 Q;  3HP6 A;  4OYZ A;  4PCQ A;  5CHC B;  1QE1 A;  4Q2L A;  1FHT A;  1YBT A;  4TQR A;  2PE8 A;  4JI7 J;  2HHQ A;  4GVB B;  2EG2 A;  3E51 A;  5LMN F;  1WD6 A;  2IJF A;  3OV7 A;  3DRS A;  1C0T A;  2H3E B;  3M8Y A;  3VQT A;  2ZDO A;  3NGD A;  3SBM A;  4USM A;  4XIU A;  3R7S B;  1JLQ A;  2KO1 A;  4KGV B;  4QYZ K;  4F3M A;  3AQO A;  4NWB A;  1FKO A;  2B7C B;  1VQS A;  2RIL A;  4NRU A;  4J91 A;  2H4Y B;  2BOP A;  1LW2 A;  3HFK A;  4I64 A;  2PMH A;  2XNQ A;  1N5Q A;  1VQ5 S;  3OR2 B;  1S12 A;  3B82 A;  2V4J B;  3MCN A;  4C97 A;  3GSI A;  2B9W A;  2BJ9 A;  1VBX A;  2IBO A;  1FJG F;  2XLK A;  1YWX A;  2YKN B;  2V34 A;  1Q16 B;  4F4Z A;  4IG3 B;  1EIY B;  2LQ5 A;  2DHH A;  1IBM J;  4ILL A;  2F4V F;  1PC5 A;  2FZG B;  4XPC A;  2J9C A;  3VQS A;  3NCR A;  1LNQ A;  1L3S A;  1VIS A;  4RW6 A;  4DEZ A;  3PW2 A;  4FPR A;  2ZVS A;  5A0Y B;  4DUY F;  2JVO A;  1N0V C;  2VB6 A;  1KTQ A;  3IP0 A;  1NAQ A;  3NMA A;  1UVM A;  3IBW A;  4K4X A;  1N34 J;  4I1T A;  2B6A A;  3M2U B;  5IWA J;  5IT0 A;  3HHE A;  2Y1J A;  4JI2 J;  2HLU A;  2JZ5 A;  4USH A;  4DR3 J;  4RW9 B;  1FRI A;  5HN0 A;  3ADA C;  5AT1 B;  2F8M A;  3UDL A;  4E98 A;  2ASD A;  1UVN A;  3KLI B;  1FRX A;  1RP5 A;  3CDU A;  1T05 A;  4F8R A;  4WFB Q;  2XB2 D;  2GO8 A;  1REG X;  2HK2 A;  2D9P A;  3DLE B;  1ZAV A;  2VG7 B;  3D6H B;  4DSF A;  2K2P A;  2DNR A;  5AE2 A;  2V2V A;  1R31 A;  2Z30 B;  4AXI A;  4QU7 A;  4LF2 A;  3EZ5 A;  4K2J A;  1RT5 B;  3HVT B;  1LWC B;  4TYB A;  2IA6 A;  2IYI A;  4F2S A;  1FXL A;  4DBQ A;  2B56 A;  4NZ6 A;  2JEG A;  5HLF A;  2OLW A;  4CH7 A;  3EXY A;  2VHG A;  4FXV A;  4KHP F;  5DET A;  1M1K T;  4BHQ A;  1IKV A;  2OI2 A;  2ZOG A;  5I3U B;  3CCW A;  4KGK A;  3ENW A;  3M8Q B;  3DRY A;  3QWU A;  3QT5 A;  4ENO A;  2AJQ A;  3ET6 B;  1R8C A;  2I5J A;  1DAX A;  4DR6 J;  4OMF G;  1VDH A;  1WC0 A;  4OZ0 A;  1VS3 A;  3IM8 A;  4FZV A;  3O3L A;  2BW2 A;  4ES2 A;  4IDK A;  1RXO B;  1AA1 B;  5GAG I;  3CJ0 A;  3LP2 B;  3R5D A;  1WC3 A;  3DDN A;  2DVI A;  3K5N A;  2COL A;  3LUY A;  1S1X B;  3SDE A;  1U1L A;  1WKK A;  4DR2 J;  3OXF A;  2CPH A;  5GVQ A;  2F4F A;  2HNY B;  1K47 A;  2V2K A;  2ZBP A;  3AD9 C;  2GJF A;  2ZOF A;  3GCX P;  2VG6 B;  3SXL A;  3UO0 A;  3GFH A;  2IRU A;  2PMW A;  1SC1 B;  1TFY A;  1HBN B;  4WKY A;  1NSA A;  1M5V C;  2HMI B;  2CQ3 A;  1VJW A;  1X4F A;  2HRT A;  3QO9 A;  4ZJO A;  4YY3 J;  1EAR A;  1T3N A;  2FLL A;  2GCF A;  3RBD A;  2FVP A;  4AD6 A;  1PYS B;  1S77 D;  3K89 A;  2AT1 B;  1C1B B;  5HAT A;  5K8M A;  2HHH F;  3MR6 A;  3RW7 A;  2YWW A;  3BF4 A;  1TV6 B;  4K4V A;  5L9N A;  3AQP A;  4USU A;  3NGR A;  1QSY A;  3UN3 A;  2OSR A;  3F0N A;  1B64 A;  2OML A;  2BYC A;  2A6O A;  4ZVT B;  2XTJ P;  1NHU A;  2WB1 D;  5KFM A;  1B99 A;  2WB4 A;  3HHL A;  1RLC L;  5ETT A;  1WSR A;  4ED3 A;  4DU7 A;  1OQ3 A;  1UFL A;  2HGN A;  4FF4 A;  4ECR A;  5KG7 A;  2GGP B;  1D8Y A;  1YVF A;  1Y3K A;  2BOA A;  3P4U B;  4LJM A;  4UOF A;  1HNI B;  4UZC A;  2DIV A;  4DQS A;  1FRL A;  4Z37 A;  4XTT A;  5HVG A;  4DCJ B;  3N01 A;  1EHW A;  3CD7 A;  2JLF A;  2QL9 B;  2DR8 A;  1H6K X;  4AL7 A;  4EO6 A;  3FSY A;  4FXW A;  4LVN P;  2IC3 A;  4OYW A;  4H4K A;  1S1U B;  1UA0 A;  4CZC A;  2MKY A;  1FXD A;  1WHV A;  1NRK A;  1KQF B;  1XWL A;  1K1S A;  3D3B J;  2BRK A;  4YB1 P;  3H5X A;  2UVW A;  3IWL A;  3Q2S C;  3I56 S;  4DL6 A;  3IRX B;  1SH3 A;  3NNH A;  1VBK A;  4AT1 B;  4ED8 A;  4GRS A;  4JP8 A;  1ZOT A;  4EU0 A;  2BE2 A;  2AEF A;  5KAK A;  3CCR S;  1HQ2 A;  4CT8 A;  2W7P A;  1S9G A;  1S1V A;  4OJG A;  1ICE B;  3TZX A;  2AF6 A;  3BEG B;  4DUZ F;  1C0U A;  2B9Y A;  1K9M T;  3CVK A;  2O67 A;  2N4D A;  4Z7C A;  4C4W A;  2GAH C;  1W25 A;  2NLW A;  1X0F A;  3DFE A;  4DR7 J;  3V6D B;  1QSS A;  4KIA A;  4G1Q B;  2QO3 A;  3SQG B;  5EDW A;  4PQU A;  3KDN A;  3VAM A;  4KBI A;  3HSG A;  3UVJ B;  3L7O A;  2FIU A;  2CDQ A;  2XYH B;  3LP0 A;  1VQP S;  2B51 A;  4QIW D;  1SJ4 P;  3OJS A;  4HAC B;  2EG1 A;  4B3O B;  2MKC A;  1NSK L;  3OVA A;  4OYP A;  1HWI A;  4Z2X A;  2HFN A;  4DZD A;  2WRM A;  1SQF A;  3EIC A;  2VG5 A;  3MUT P;  4LRC A;  2IFX A;  2IVY A;  1S49 A;  3DLJ A;  3MPW A;  4C8L A;  5KFS A;  4MKY A;  4TN2 A;  4OI4 A;  5ETV A;  1SXL A;  5DRK A;  4WF9 Q;  2PD1 A;  2AJF E;  3A3O B;  1BXN A;  4D3G A;  1URN A;  1OQ6 A;  2M9K A;  5HL7 Q;  5LSR A;  4UOC A;  2N7C A;  1S6P A;  1SKW A;  3LTO A;  4P2S A;  5IZH A;  1PJ5 A;  4ELV A;  4CLY A;  4IG0 B;  2RU9 A;  3W9I A;  3SCJ E;  5ETR A;  2ATC B;  2WW8 A;  2XS2 A;  4KYZ A;  1WEZ A;  4H4M B;  1NK4 A;  2R7X A;  1SJR A;  5G0R A;  3KUG A;  3KLH B;  1D9D A;  3FEX B;  5DDP C;  2RQK A;  4NYP A;  2E29 A;  1ZYQ A;  3VCD A;  5KT3 A;  2H54 B;  2DK2 A;  3FMW A;  3NL0 A;  3CB4 A;  4Y2A A;  3MR5 A;  3MCS A;  4B9S A;  4YHH J;  1GX5 A;  3TOQ A;  5GAH I;  2MKI A;  4BCA A;  2ZVI A;  4CTA A;  2VDH A;  4FF2 A;  2HQI A;  3MEC A;  2F8E X;  3I55 S;  2P9E A;  2B9X A;  3R3T A;  5CQG A;  1HW9 A;  4P52 A;  4BC7 A;  3MI7 X;  3OFH A;  2CJA A;  5IC4 B;  4K7Q A;  1XNQ F;  2EW9 A;  1PSD A;  3CDA A;  4ZVR B;  2VH7 A;  4PUO A;  2DT9 A;  3I9Z A;  1T7P A;  1RHR B;  2FQQ B;  3AH6 A;  2MB0 B;  5HJY A;  1VQO S;  1FRK A;  5J2P B;  5KFH A;  1VYA A;  3KLG B;  3PCO B;  4CM2 A;  2GHW A;  2IVF B;  5KG5 A;  3H5Y A;  3ZTP A;  1D8Z A;  2DBB A;  1N36 F;  7FD1 A;  1Y5I B;  2J0Q D;  1RTI A;  1S1W A;  3LPE A;  1YJT A;  5FD1 A;  4GKJ J;  1U47 A;  4WTO B;  2KJW A;  3ZZR A;  1FDB A;  3JAM U;  1YHQ S;  4HT7 A;  5FJ4 A;  5EX3 A;  1VQ7 S;  4KHP J;  4QWD A;  2V67 A;  4CH1 A;  3MM9 A;  1LW0 A;  1X60 A;  3T1H F;  4PEO A;  2ZFH A;  6FD1 A;  1J5E J;  1J27 A;  2DEJ A;  5KOW A;  4BC9 A;  3ZTS A;  2FHM A;  3W2W B;  3M9M B;  4CP5 A;  3PX6 A;  2DGQ A;  4WU2 A;  3NS7 B;  2YPZ A;  2Z8Q A;  3G4S S;  4PWD A;  4FDF A;  3O8W A;  4DFP A;  2M70 A;  2EFV A;  3GON A;  3L95 X;  2Z0G A;  2DGO A;  4OHV A;  2J5A A;  2GIF A;  3NNA A;  4QIV A;  1V6H A;  2LXI A;  3DMJ B;  5KFD A;  4ZIT A;  4FPI A;  1PG5 B;  2UV8 G;  3OTO F;  3TUI C;  2J7K A;  2NXE A;  3K0J A;  4IFY B;  4IRC A;  1CJU A;  3D0G E;  1JQG A;  1TL4 A;  4CO0 A;  2CAJ A;  3OHA A;  3US5 A;  5LXR A;  2YX7 A;  4KPC A;  2ZIT A;  5FII A;  2H5J B;  2WZ1 A;  4EUV A;  2JNJ A;  2C3Y A;  3KJV B;  4ANC A;  1PCA A;  1I51 B;  4AND A;  2MKS A;  1HQE B;  1S10 A;  1RHK B;  3L4B C;  4J9K A;  3I0S B;  2HIY A;  1CJV A;  2ZH9 A;  3I5C A;  4J9L A;  3C6U B;  4EYH B;  2D1C A;  3KTQ A;  4Z7Y A;  3M6U A;  1XNR F;  3FSX A;  1S1T A;  4RW8 A;  2KFY A;  2M8H A;  3MFI A;  1WEL A;  5DZ6 A;  1ARO P;  3C14 B;  3CC4 S;  1AFJ A;  1Y0H A;  3PKM A;  1IKX A;  4FKY A;  1KDN A;  1UVK A;  2QA1 A;  2C2D A;  1U2F A;  2UVV A;  1FTC A;  3BZQ A;  1GQE A;  1SL2 A;  2IAJ B;  1HYS A;  1RT6 B;  5HQM A;  4GVB A;  3AB2 B;  2EC2 A;  3MR3 A;  2HEK A;  1VQN S;  3FZ2 A;  2DNQ A;  2G2O A;  3HSJ A;  3MZI A;  1HI8 A;  5GAG U;  3GLJ A;  3ZZY A;  2QLX A;  3TJ9 A;  4CDI A;  1GTH A;  2WW4 A;  2GJI A;  1V3R A;  5ETS A;  3IR6 B;  2X1G A;  3IAS 9;  2J9D E;  5KFU A;  2YNH B;  1FJC A;  3W66 A;  3ZTQ A;  2ZH1 A;  2C2R A;  3WQP A;  1G2E A;  2X51 A;  4OLP A;  2XNR A;  3MOJ B;  1OYD A;  3UCG A;  2V4J A;  2AJ2 A;  3RB3 A;  1HWJ A;  4ZLP A;  4XK8 C;  2GIQ A;  4ZVU B;  4N8O A;  1LWF A;  2YKN A;  4U96 A;  2NZ4 A;  5BR8 F;  2GFF A;  7FDR A;  2LP4 A;  2UXD F;  5CZV A;  4DV6 F;  3ETO A;  2DR9 A;  2R8J A;  4AQY F;  3PJW A;  1F2H A;  3HVA A;  3D54 A;  2RQM A;  1UFK A;  3MDF A;  2CQH A;  3Q83 A;  2E5H A;  4B9L A;  2D74 B;  2BAN B;  2R7T A;  3J80 Y;  3GP9 A;  5HP1 A;  4DUZ J;  5A0Y A;  4O23 A;  5CYQ A;  1AUD A;  3V5R A;  2BMB A;  3AD7 C;  4P7V A;  4ZVG A;  2M7S A;  2CQI A;  3M2U A;  1RSC A;  3CJ2 A;  2UXB J;  1SIZ A;  3U27 A;  4RW9 A;  3SYZ A;  2D41 A;  1HNW F;  1YIJ S;  3QPI A;  3VGV A;  4X65 F;  2RHQ B;  1U2C A;  5EN1 A;  3KLI A;  4X4R A;  4CLL A;  3DLE A;  1T9U A;  2Q3P A;  2GA7 A;  3HHL C;  2FJA B;  3FVY A;  2VG7 A;  4NCG B;  2P8I A;  2P2C B;  2OEK A;  3RB4 A;  2VKR A;  3MD3 A;  4KFB B;  3ENV A;  4XAK A;  3B8H A;  1QD1 A;  2B9E A;  2P9G A;  2Q1L A;  3HVT A;  4BBY A;  1LWC A;  2D69 A;  4ID5 B;  4PG4 A;  4LFA J;  4PXD A;  3RBE A;  1K0V A;  2CPD A;  3GYN A;  2EBE A;  2EFG A;  5B0D A;  4H4K C;  4ECW A;  3H90 A;  2V4R A;  4MIB A;  2PC6 A;  2PII A;  2D3O R;  5I3U A;  1WOO A;  5KFQ A;  2C2K B;  2VPX B;  3M8Q A;  2EC0 A;  2EK1 A;  1GMW D;  4GMK A;  1UZD A;  2ZBI A;  1T9X A;  2CQ1 A;  3M6W A;  5E33 A;  4M63 A;  4U9R A;  1FRH A;  3CCV S;  5IV4 A;  2Y1I A;  3IG1 B;  5BYQ A;  4DMZ A;  2OUG A;  1GFW B;  3Q8V A;  3MEK A;  2QA4 G;  4MIA A;  3TQ1 A;  2K7K A;  2UUA J;  1H98 A;  1KHV A;  1UEK A;  3DDI A;  1S1X A;  1TAU A;  4PYA A;  5GAD I;  3R9L A;  4JI3 J;  3PHT A;  3UCU P;  2RNE A;  4A8S A;  2HNY A;  3CC2 S;  1XN9 A;  1TZ0 A;  1FER A;  1SI9 A;  2XHW A;  2BA9 A;  1BE4 A;  5D4L A;  3RTV A;  2R4F A;  2N7Y A;  3DNC A;  2HBR B;  1NH7 A;  2HW3 A;  1KR4 A;  1IR0 A;  1NDP A;  2HMI A;  5J2Q B;  1M5P C;  3MHY A;  1RT7 A;  3J81 Y;  2J8A A;  2X3G A;  2E7V A;  1XNQ J;  3BM7 A;  4DL5 A;  2MJN A;  3NGS A;  3BDP A;  1CUL B;  5EWE A;  5D0G A;  3QWP A;  3Q2T C;  2KI2 A;  3KXD A;  3G6E S;  1H2T Z;  3CED A;  5D15 A;  3CCS S;  3MEG B;  1IKW B;  1Y11 A;  1WOP A;  4FYY B;  2X1A A;  4Y0F A;  3Q8Q B;  5KFJ A;  3D1H A;  3HD1 A;  1U2R A;  2Y0S D;  1C1B A;  3NKY A;  5F3T A;  1NO8 A;  1TV6 A;  4EZ6 A;  1NLK L;  1OMS A;  2QIF A;  3GJR B;  1N4L A;  4X4N A;  2I38 A;  5LJ5 Y;  3UDE A;  2DPJ A;  3KFW X;  1BGX T;  1WNE A;  2IA0 A;  4NLO A;  1KSP A;  3ULH A;  1DHM A;  2UVR A;  1H73 A;  1FRJ A;  3P6Y C;  3TNV A;  4ICL B;  3QZ7 A;  4CO4 A;  1NPK A;  4JV2 A;  4URQ U;  3QAU A;  1X4G A;  2GGP A;  3IRW P;  2KT5 A;  2R7S A;  4JI1 F;  2IY5 B;  2MZS A;  1RGV A;  2DGX A;  1HNI A;  3JQJ A;  4P73 A;  1GH8 A;  4DUT A;  3Q24 A;  1YZ7 A;  3DU5 A;  3HMJ G;  1TL3 B;  5IT9 U;  1M5H A;  3F73 A;  1TL1 B;  4L3K A;  2R7U A;  1FD8 A;  3IBC B;  1S1U A;  3PG9 A;  5GAH U;  4IYQ A;  1RJJ A;  1P1L A;  2ZWP A;  1SV5 B;  2AU0 A;  1CSJ A;  2MST A;  2UUT A;  3ZO7 A;  3IRX A;  2VKZ G;  1U02 A;  4J9P A;  1RCO B;  2CJY B;  5D0E A;  4C8N A;  1NHV A;  4OQJ A;  3BRE A;  1VOM A;  4OX8 A;  1CS4 B;  2RSQ A;  5IQQ A;  2HHV A;  1WHY A;  3DDK A;  3BSA A;  4NLV A;  1IJF B;  2ZZM A;  1R6Y A;  1BHN A;  2CQG A;  4C98 A;  2DR6 A;  3DI6 B;  1IKY B;  1Y9O A;  4TU8 A;  2Y8W A;  1S57 A;  3IFE A;  4DF4 A;  1R8B A;  1JJC B;  3JYT B;  1ELO A;  4CNY A;  5DDR C;  3K5L A;  4JI5 J;  4LF4 J;  5D8H B;  4P7T A;  4G1Q A;  3SQG A;  1WEX A;  4RBV A;  2XMW A;  4U6P A;  2BE7 D;  2EVZ A;  2L48 A;  3UVJ A;  1XQI A;  1Z1Z A;  4RR5 A;  3VHQ A;  1REV B;  2XMJ A;  2HUR A;  3A4T A;  3T9N A;  2HND B;  2XMA A;  1I6J A;  4B3O A;  2ILY A;  2DGU A;  1HHT P;  1FEE A;  4Y28 C;  2XS5 A;  2QX0 A;  5E0O A;  2KM8 C;  1S0M A;  3PV8 A;  2DXD A;  2YNF A;  1N33 J;  1VK8 A;  1Z4U A;  2GQQ A;  3S1T A;  4B3R J;  3GWC A;  1U6F A;  3MAQ A;  2JFD A;  5C24 B;  3QQC D;  4Q7A A;  3D1O A;  3LA0 A;  2EBG A;  4IR9 A;  4ZPC A;  3A8I A;  1HQU A;  1P8G A;  2I0X A;  5KFB A;  4BWJ A;  2EEY A;  1LK5 A;  3MOZ A;  4DOZ A;  3C15 B;  5J1E B;  1RT1 B;  3A3N B;  2LEC A;  1GT8 A;  2W2P P;  2E9Z A;  2RT3 A;  2MMY A;  5BR8 J;  3CUL A;  4H4M A;  1UVI A;  4RBU A;  3BBC A;  4KGZ B;  3KLH A;  3RR8 A;  4FYV B;  3L3C A;  2V8D A;  2ZH3 A;  1RTH B;  1I94 F;  3KK1 B;  5AE1 A;  4USI A;  1D9F A;  4NPO A;  4YB6 A;  3LGN A;  5KG3 A;  1YJR A;  4KR0 B;  4Y2C A;  3DYA A;  1EKR A;  1M1H A;  1QVF R;  2HS4 A;  1U25 A;  3M9O B;  1YRX A;  3WC2 A;  4WXW A;  3H0P A;  2EKY A;  5IT4 A;  1HNV B;  3PJX A;  2XI2 A;  2BQR A;  2UU9 F;  3MXH P;  2MXY A;  1HL6 A;  2RH3 A;  2YWF A;  4L74 A;  4A4J A;  1PO6 A;  4A48 A;  4EBC A;  2VOO A;  2VQF J;  3H40 A;  1S5Z A;  4NAS A;  3OSN A;  1RCX B;  1H74 A;  2ZBR A;  4O0N A;  4RKU C;  2QJ3 A;  1UP1 A;  4QPX A;  3KLG A;  2KFZ A;  3MMB A;  2F63 A;  4DX8 H;  4ETX A;  2J7U A;  3MCO A;  4I7F B;  1YKW A;  2RD5 C;  3A8K A;  2RHS B;  4M5I A;  2AGO A;  1H38 A;  2LQ8 A;  1JLG B;  3QLH A;  4I4B A;  5ETK A;  5L39 A;  4HH0 A;  3EZO A;  5DS7 A;  1RA6 A;  3CSK A;  2AX1 A;  4LIR A;  2B5J B;  3ITH B;  2F1F A;  4DLG A;  1TQL A;  2GML A;  2W4C A;  3CJ5 A;  4N5S A;  2DNN A;  4WYW A;  2NS1 B;  3BGF A;  1PGZ A;  3KUE A;  4F2R A;  4MYU A;  5K8P A;  4JYA J;  3AA9 A;  4WKR A;  2LDY A;  1NCL A;  5F8H A;  5IC6 B;  4I6W A;  5IOL A;  3D6F B;  3HKW A;  3EUN A;  3MPV A;  2HQG A;  1U1M A;  2CUY A;  5E3Q A;  3U1L A;  2APO A;  4NXN F;  3V4I B;  2CZ9 A;  1DJ0 A;  1YSJ A;  4M5L A;  2YNI B;  1ULR A;  3NCP A;  3TR5 A;  3O5T B;  1Q8L A;  4DXL A;  2FJX A;  3DRX A;  2CKW A;  2YQ3 A;  3NP5 A;  4AL5 A;  3R8Y A;  2GNK A;  2FUG 9;  3NG8 A;  3T5J A;  4WU3 A;  2W9B B;  5ETO A;  4UW2 A;  4CLP A;  1S76 D;  4PKD B;  1FDD A;  1R0B G;  2WOM B;  5E3A A;  1IN0 A;  4ZPB A;  3GQC A;  2UXC F;  1RT2 A;  1GXU A;  1T02 A;  1WG5 A;  1O0P A;  4K0K J;  4FF1 A;  3ENQ A;  1R7I A;  1DFD A;  4BDP A;  3M1V B;  3I87 A;  2IJR A;  1SQG A;  1KC8 T;  4DL7 A;  3HKZ D;  2WVF A;  4ED4 A;  4GO7 X;  1X31 C;  3C14 A;  2E44 A;  4ZLN A;  4CLF A;  2WVB A;  4L3N A;  3Q86 A;  1RBL A;  4XDC A;  3J7Z T;  3HI9 A;  2IAJ A;  3HLU A;  3RBX A;  2K8G A;  1SIW B;  3GFX A;  3P3D A;  4EWT A;  1TEL A;  4L73 A;  4ED1 A;  3VGU A;  4X66 F;  3IM9 A;  3PNI A;  1ZZN A;  1HBO B;  2PDA A;  6FDR A;  3JSB A;  3GU0 A;  4B02 A;  3HCX A;  1U09 A;  5GAD U;  3IN5 A;  2YNH A;  2OH2 A;  3VAI A;  4ALZ A;  3OVS A;  5IXU A;  3HPO A;  4TQS A;  2KHC A;  4U8V A;  2HFV A;  3G6Y A;  1EX8 A;  3ZZO A;  4HTJ A;  1NSQ A;  4DPY A;  2F5G A;  4J9U E;  3OLB A;  1JWW A;  1SL0 A;  5L9X A;  3OFF A;  1RU2 A;  2OGU A;  4ETZ A;  2ZHB A;  1R0C B;  2QLW A;  4LF9 J;  3TAN A;  4NLQ A;  3OHB A;  2PN6 A;  2RDI A;  1PBA A;  5DG9 A;  2NXN A;  2CPY A;  1EET B;  2HZC A;  2VQE F;  1VGY A;  3BR8 A;  1B0P A;  2HFS A;  2NSC A;  3CME S;  2AD9 A;  1Z2L A;  3PW0 A;  3ILL A;  1LXJ A;  1IBK J;  1BQN A;  3ZC4 A;  4BWM A;  4KV8 B;  2OO4 A;  2RB7 A;  3W7B A;  2W24 A;  4DSJ A;  4FBU A;  2AMC B;  1T3O A;  2O3D A;  5DQG A;  1E6Y B;  4IH6 A;  5I4M A;  1CJT B;  4GO5 X;  2R8I A;  2MHN A;  1HNZ J;  5B0A A;  4PPZ A;  1NEE A;  4M94 A;  4Q5V A;  4O44 B;  2DXF A;  2MY8 A;  3X3U A;  4NLP A;  2DRD A;  2KN4 A;  1F1B B;  3EGN A;  2JEI A;  4KFB A;  5MAO A;  3W63 A;  3EZU A;  4J9V A;  5KFT A;  5LT5 A;  4CWB A;  4M5G A;  3Q8R B;  2DH9 A;  2XSJ A;  3IC1 A;  4YOE A;  4ID5 A;  4ZP9 A;  4IQX A;  2W4P A;  4HTI A;  3G87 A;  1NK6 A;  1RYR A;  1QAI A;  2I9S A;  4HDH A;  1D1U A;  2BKP A;  3PYD A;  1GK8 A;  4JV5 F;  3GJS B;  2DNZ A;  4LBI A;  4NZ0 A;  2C2Z B;  3M8P A;  2KXF A;  4X64 F;  2PMZ D;  1DLO B;  2MLX A;  4DQR A;  2ZUA A;  2F40 A;  5LMU J;  3SSS A;  4M5M A;  4RL1 A;  1JJ4 A;  2CXE A;  4LVO P;  4F26 A;  3V4M A;  4K4Z A;  4O3S A;  2AYB A;  2FVQ A;  4DR1 F;  3IG1 A;  3ZZZ A;  3PAC A;  2ATL A;  2MDA A;  4EK2 A;  2DO4 A;  2FY1 A;  4K59 A;  4DPX A;  3P96 A;  1I94 J;  4PXB A;  1N5Y B;  2DGT A;  4OIX A;  4IH5 A;  2DIU A;  4Q43 A;  2R7R A;  3POT B;  4B3S F;  1VIX A;  1U6Z A;  3KG4 A;  5KFG A;  4EEY A;  3K2Y A;  4KY3 A;  1TAQ A;  2HKE A;  4RNH A;  1L3K A;  1F9E B;  4TLQ A;  3SV3 A;  4CO5 A;  3HHN B;  5J2N B;  3OTB A;  3VAK A;  4DV0 J;  2FD2 A;  2FLN A;  5K8N A;  2AHO B;  5J2Q A;  3T5H A;  3V6J A;  1KLM B;  5GMD A;  3R7N B;  1D0E A;  1SKR A;  2HHP A;  4LF6 F;  4PXE A;  2V63 A;  4DSE A;  1UWB B;  5KFF A;  2UV8 A;  2WHO A;  3JS9 A;  3MEG A;  1IKW A;  2ASJ A;  1KFD A;  4UOG A;  3L09 A;  4OYB A;  3WX8 A;  1AFI A;  3PJ9 A;  3PRD A;  4DFK A;  1V3S A;  1VCT A;  3ONQ A;  3T3F A;  1DAR A;  1S0N A;  3EGW B;  4B3T J;  4F50 A;  1M5S A;  3GFY A;  3A8J A;  1T03 A;  3LPY A;  3LQV A;  4NXM J;  4ICL A;  2GQC A;  4J9N A;  3MTJ A;  3THP A;  1YQH A;  3PEH A;  3GIK A;  1KP6 A;  4CI0 B;  3Q23 A;  1RBA A;  3RRH A;  2DNY A;  4JI7 F;  2R8H A;  4CO1 A;  3T1Y J;  2ROP A;  3DLK A;  2XHC A;  3W64 A;  4BS2 A;  2WTF A;  1DUR A;  2GS8 A;  4RNF A;  3VAG A;  4K4S A;  1OY6 A;  1Q8B A;  3R6L B;  4PG6 A;  1TL3 A;  1QVG R;  5IM0 A;  1UVJ A;  3UNG C;  3KHG A;  4C3M A;  2Y8Y A;  2D3U A;  4LFC F;  2PSZ A;  4Y6I A;  1B0T A;  1CC7 A;  5A8W B;  1Q82 T;  1SV5 A;  4NI2 B;  1VC6 A;  4P71 A;  2MPU A;  4F25 A;  3CIM A;  1JK9 B;  2CQ2 A;  3MUM P;  2NZC A;  1XTZ A;  1HHS A;  2DGV A;  3FMB A;  1Q78 A;  3R5A A;  3VR1 A;  1AUS L;  2GVD B;  5JXS A;  3EVM A;  2OEL A;  1G6B A;  4KO0 B;  1CLF A;  4OZ5 A;  1IBM F;  1KWM A;  1U4B A;  2MGZ B;  4RW4 B;  1NKB A;  2QSF A;  2HNZ B;  3K8V A;  3KMS A;  2GMH A;  1Q86 T;  1TVR B;  4ZJL A;  3DI6 A;  1IKY A;  5HMW A;  1RBO B;  2E1M C;  4ZHR B;  5F8G A;  2CYY A;  3UPF A;  5L1L A;  3BQ0 A;  1X5P A;  3SMZ A;  3JYT A;  2B0G A;  1H7W A;  8ATC B;  1NZA A;  5FLX U;  1FRM A;  4C6A A;  4TY8 B;  1Q53 A;  4YDX A;  5IWA F;  4RU9 A;  4RW7 B;  1UTA A;  2R2U A;  2GVZ B;  4JI2 F;  3OUY A;  2ZH8 A;  4DR3 F;  1DZ5 A;  4C48 A;  3GYG A;  1REV A;  3VV2 B;  1FJE B;  4RNN A;  1EQM A;  2RS8 A;  1Q81 T;  2CPX A;  5LJ3 Y;  2AZ1 A;  2HND A;  4DL0 C;  1S7H A;  2GX8 A;  2DHG A;  2HAI A;  2Z4P A;  2DKO B;  1JLB A;  1R6V A;  1T9W A;  3DU6 A;  4HHJ A;  4HLB A;  3DXS X;  2XSF A;  9ATC B;  4DU8 A;  1SL1 A;  4QWA A;  2CDR B;  3JTO A;  2QT7 A;  2K06 A;  4X4T A;  2Z58 B;  3FDS A;  3AOD A;  2FPH X;  2ALZ A;  4I2P A;  4DDF A;  4Y2I A;  1TL5 A;  4GC6 A;  2DJW A;  4RWW A;  3Q8Y A;  3QJL A;  4PG8 A;  3UNY A;  3IR5 B;  2FC8 A;  1NKE A;  4TY9 A;  3W3S A;  3B4D A;  3A1Y G;  5K9F A;  3C15 A;  3IO1 A;  2OSQ A;  1U1K A;  1DTT B;  2J6U A;  3MMJ A;  3MM8 B;  2FVC A;  4X62 F;  3TVK A;  2B4P A;  2CWX A;  4DX7 A;  2J6S A;  4A8F A;  1Y10 A;  2LDI A;  3BV8 A;  4WFA Q;  5BJR A;  1RTH A;  5CAA A;  3KK1 A;  4FBT A;  4CM0 A;  3NOC A;  1WG4 A;  4R0E A;  2MZ1 A;  1H2V Z;  1RI7 A;  4DR2 F;  2MQ8 A;  2XMU A;  1GMW A;  3N6M A;  1JB0 C;  1KVJ A;  2L9W A;  2HQF A;  1FK9 B;  4C0H A;  2XMV A;  1U24 A;  3TAM B;  1HNX J;  4OJ1 A;  1HNV A;  4F0K A;  4P2F A;  5E3C A;  3FGV A;  2PGC A;  3M8S A;  3KLV A;  3NXZ A;  1KN6 A;  4G1P A;  5LXY A;  5AJ3 F;  2QA4 S;  1X5O A;  2FB0 A;  3QZ8 A;  3NWR A;  4YY3 F;  1RWV B;  2NYH A;  4OFZ A;  3B4M A;  3N9U C;  1YI2 S;  2D9O A;  3RB6 A;  3BGL A;  2QYG A;  1CC8 A;  2RQC A;  4HKQ A;  4NMX A;  2KVI A;  2WSE C;  4I7F A;  4AL6 A;  3W62 A;  1PAU B;  1RT3 B;  4B08 A;  5KFE A;  3TJA A;  2HQ3 A;  4P74 A;  3K57 A;  2CPE A;  2FVS A;  1JLG A;  1Y4Z B;  1JLF B;  4KTQ A;  3N6N A;  2Z2Y B;  4DR5 F;  1HWL A;  2HFU A;  2IDL A;  2VBW A;  2B5J A;  5KFI A;  3ITH A;  2MTL A;  2GC8 A;  1TMM A;  5H9E K;  3BYP A;  4JV5 J;  3G82 B;  3ISN D;  4KKO B;  3GJT B;  3FC9 A;  5ETP A;  2V2Z A;  4UQT A;  1EP4 B;  2AIR B;  3ISZ A;  2MZR A;  2XI3 A;  4A8K A;  1MN9 A;  2YQ1 A;  1FKP B;  1HIY A;  2HS3 A;  4YR3 A;  3L9Z A;  2DCL A;  4IOA Q;  3W5Z A;  3CJ3 A;  4P75 A;  4G6V B;  1X4H A;  1YX2 A;  4MAK A;  2VDI A;  3QFW A;  5K8O A;  2EWH A;  5E3R A;  2YNI A;  1QTN B;  3AXK A;  3CJT A;  3UFC X;  1LWX A;  4RBT A;  5AXN A;  3FCW A;  3RRK A;  4RO0 A;  3WC0 A;  1SVD A;  1E6V B;  5AE3 A;  1TKT B;  2AZ3 A;  3AJ2 A;  3S8S A;  4YR0 A;  4CO3 A;  3KJQ B;  2H4W B;  2KB2 A;  3KDO A;  2E1C A;  1R43 A;  1J5O B;  5H1S V;  2IM0 A;  2QLJ B;  2WOM A;  3W1Y C;  4QZV B;  3EDQ B;  5AXK A;  1RQ0 A;  1FES A;  2K3K A;  3E8O A;  3TEG A;  3TX8 A;  3CDE A;  1SJ3 P;  2RUS A;  1IQT A;  3O44 A;  5A8K A;  5J1P A;  1MWY A;  1U6B A;  2HG4 A;  3GII A;  4UUX A;  3M1V A;  4AE5 A;  4D3H A;  2OPP B;  2XWX A;  4DR7 F;  5H9E J;  2ADC A;  2J0S D;  2HBY B;  2PI5 A;  3M32 B;  1S48 A;  4YUD A;  1VLY A;  3EPG A;  4ED5 A;  2XY6 A;  1B70 B;  4X2B A;  2XG8 A;  1VQM S;  1AZS B;  4PG7 A;  3THT A;  3ZNU A;  4DG1 A;  4CYU A;  3W5X A;  2VF3 A;  1P9Y A;  4Q8E A;  4V1A k;  2HHW A;  3JSY A;  2OPS B;  4HL9 A;  2CJ9 A;  2NSB A;  4RUC A; 
#chains in the Genus database with same CATH homology
 2FQQ B;  3P4U B;  3D6M B;  3QNW B;  2HBR B;  4ZVS B;  1RWW B;  3KJQ B;  1RWP B;  3GJS B;  2QL7 B;  2H4W B;  1PYO B;  2C2Z B;  3RJM B;  3R7B B;  3SIP B;  2Y1L B;  1BMQ B;  3R5J B;  3KJF B;  2XYG B;  1SC1 B;  3IBC B;  4DCJ B;  1RHU B;  2QLJ B;  2C2K B;  2DKO B;  2QL9 B;  2XZT B;  3EDQ B;  3GJQ B;  2XYH B;  2CDR B;  1SC3 B;  4ZVQ B;  2CNL B;  3GJT B;  1RHQ B;  1RWM B;  2CJY B;  2QLB B;  2H51 B;  3IBF B;  2H5J B;  2H54 B;  2HBZ B;  3GJR B;  1GFW B;  2CNK B;  3R7S B;  2CJX B;  2C2O B;  1RWK B;  2H48 B;  2C1E B;  2C2M B;  2XYP B;  1SC4 B;  2HBY B;  2CNO B;  4ZVO B;  4DCP B;  1RE1 B;  1I51 B;  1NME B;  1RHK B;  2H4Y B;  2Y0B B;  2H5I B;  1RWN B;  4ZVU B;  1RWV B;  3KJN B;  2P2C B;  4JB8 B;  1F9E B;  5IC6 B;  1QDU B;  3R6G B;  4ZVP B;  3EDR B;  4ZVT B;  1RWX B;  4LSZ B;  3P45 B;  2H65 B;  3D6F B;  1I3O B;  2CNN B;  1ICE B;  1RHM B;  1RWO B;  5IC4 B;  3D6H B;  3R6L B;  1QTN B;  4DCO B;  1RHJ B;  5K20 B;  3NS7 B;  4ZVR B;  2QL5 B;  2QLF B;  1IBC B;  1PAU B;  2HBQ B;  3R7N B;  2XZD B;  1RHR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...