2C2ZA

Crystal structure of caspase-8 in complex with aza-peptide michael acceptor inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-8 P18 SUBUNIT
total genus 50
structure length 149
sequence length 149
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2005-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c2zA00
3SIRA 4NOLA 3PD0A 3V55A 3QNWA 3H0EA 4EHAA 1RHUA 2J33A 1SC3A 4DCOA 3KJNA 3OD5A 3P45A 3R6GA 2XZDA 3D6MA 4PS0A 3R7SA 3K7EA 1M72A 2H4YA 4HVAA 4JQYA 4DCJA 2FP3A 1I51A 3EDRA 5IABA 4QUEA 2J31A 2QL7A 4ZVTA 5IASA 3IBFA 1RE1A 2HBRA 4QUDA 4FDLA 4D3XA 2QLJA 4NOMA 5IC4A 2C2ZA 4D3ZA 3KJQA 4I1RA 1SC4A 2WDPA 1RHQA 1PYOA 3DEJA 3EDQA 4ZVRA 1JXQA 2QLFA 3R6LA 2QL9A 2NN3C 4QUHA 4EHFA 2P2CA 3H11A 3V6LA 1F1JA 4AW9A 3KJFA 1CVRA 1ICEA 2QL5A 1NW9B 4JJEA 4EHKA 4QU9A 4QUGA 2CNLA 4ZVQA 3IBCA 1PAUA 1RWPA 2C2MA 2XYGA 2HBYA 3PD1A 3V4OA 4ZVSA 3GJRA 1RHMA 4N6NA 4NBKA 4N5DA 3UO8B 5IAKA 2C1EA 5IBRA 3H1PA 2FQQA 4QU8A 3RJMA 5LUAA 2J32A 3S8EA 1K86A 4QU0A 1GQFA 3SIPA 5H0IA 1RWVA 2H65A 4HQRA 3P4UA 3D6HA 5LUBA 1RHRA 4EHDA 3R7BA 2C2OA 1F9EA 1K88A 3H13A 4JR0A 1KMCA 4QUIA 4ZVOA 4AWBA 4ZVUA 1QTNA 4LSZA 4IYRA 1I3OA 2FUNB 4PRZA 2H51A 4N6OA 3R7NA 1RWXA 4HQ0A 2J30A 4QUJA 4AWAA 4EJFA 3ITNA 5K20A 3BIJA 4PRYA 2CDRA 5IANA 4EHHA 2C2KA 4D3YA 2H4WA 4QUBA 2CJXA 4QUAA 2Y0BA 1GFWA 3GJSA 3UOAB 3R5JA 4N7JA 2HBQA 5LU8A 4I1PA 4DCPA 2CNNA 2H5JA 4FXOA 2CNOA 3NS7A 2H54A 1RWOA 4JJ7A 4M9RA 4JR1A 4EHNA 5IBCA 5LU9A 2H48A 5IAJA 1RWMA 4PS1A 1RHJA 3NR2A 5IAGA 4QULA 3H11B 3GJTA 5I9TA 1NMQA 4NOKA 4NBNA 4QTYA 3S70A 2AR9A 1I4OA 5IARA 4IEFB 4EHLA 4NBLA 5IAEA 5I9BA 4QTXA 1RWKA 2XYHA 4JB8A 4JQZA 2K7ZA 1IBCA 3D6FA 3V3KA 3R5KA 3DEHA 1NMSA 1QDUA 5IBPA 3E4CA 1SHLA 3NKFA 4NOJA 1I4EB 2Y1LA 4ZVPA 1SHJA 4N6GA 3PCXA 1RWNA 4FEAA 4N7MA 1BMQA 1CP3A 1RWWA 1QX3A 5IC6A 2XYPA 2QLBA 1NMEA 4JR2A 2CJYA 1SC1A 3DEKA 4FGUA 3GJQA 2H5IA 4JJ8A 4QU5A 2DKOA 3V4LA 2XZTA 5JFTA 2HBZA 2CNKA 1RHKA 3DEIA 3V6MA
chains in the Genus database with same CATH superfamily
3JR3A 4P2GA 4RK1A 2VYVA 5DN6A 4QT4A 3R9WA 4M8SA 4PX3A 3Q8KA 4D26A 4AIRA 4KSYA 5K8IA 4NRDA 3B51X 5JZVA 5EXDA 3ID6C 2QR2A 3DTNA 3KIPA 1XMPA 3NOQA 4ZJUA 1WSBA 5LJIA 4RGVA 3Q11A 1A98A 2OLJA 3IOYA 4ALLA 4IMJB 3RB8A 1JEYB 4AO8A 4PZZA 5I7OA 3KJQA 1I3NA 1QE0A 4OMUA 2I1LA 4FXPA 3ORFA 1NJ2A 4PYOA 4IVNA 4CCYB 4D8VA 1BZYA 4HKTA 1BHQ1 3EE6A 2CXQA 4QSMA 3T5DA 4ZOLF 3M34A 3BJZA 3BKWA 2E3JA 3IVCA 2I4MA 1DMRA 2ZLBA 1UFQA 4KUEA 3GV0A 4GP6A 3RUPA 2Z9DA 1N6KA 3EXIB 4C0XA 2P5UA 4D8UA 4WKGA 1A4RA 2R5NA 1ZMRA 2ZE8A 3DMRA 2EFDB 1FE8A 3JAKA 1QQ5A 3PQCA 3ZE0B 3EC7A 1CDDA 1MX5A 1R6DA 4JT9A 4YAOA 3SX0A 3UAVA 4HC4A 4W9RA 4JJKA 4KVFA 1E5VA 4CEJB 1B74A 4CQMA 1SD1A 3NRJA 4KTVE 2OV3A 3B7GA 3KPYA 1JG7A 4DQKA 2XTNA 4FM9A 1U2PA 4AD8A 4PO3X 4H17A 3FOCA 3NALA 4IR7A 3ZHUA 1NVDA 3BXFA 4QIHA 4ZVVA 2NT4A 1R9GA 1YTLA 5J5CA 2IWHA 5EHIA 4XZ3A 1YUMA 2JAHA 3KVRA 4LV6A 3MK31 3RV4A 4YI5A 2CL6X 2J0UA 3FLAA 4FZ5A 4CCSA 1SB8A 2YJ4A 3S1LA 5FPTA 1V37A 5D3MB 3VNBA 1MDFA 4RJIA 3CCCA 5JWOA 1VJ5A 3LQFA 1WS6A 1NKSA 2ZI5A 3VUFA 2Y77A 2YXNA 3HE3A 3NB0A 5CTAA 2YV4A 3PDWA 3U60B 2G9QA 1NR7A 2GTPA 2MJLA 4IIFA 1Z13A 3TI7A 4C14A 4IIYA 1QQ6A 5KNCD 2DLCX 3IGFA 1OA0A 3SZMA 3ICOA 3PE6A 1LW6E 2GK7A 2DWQA 2CNOA 4N0QA 1X1DA 3ZNPA 4AKIA 1L9KA 1UBTS 1J21A 1V2HE 1SOAA 2R4QA 4BLQA 4DV5B 1JDNA 4NWIA 1YJ8A 4PO1A 3K3PA 1PR5A 2QJTA 4DJ5X 3GJ5A 5JNSA 1TVKA 2RJNA 1LNQA 3BULA 4U7DA 1PDWA 1G1MA 2C3PA 1E20A 5JANA 3ZI0A 5K8TA 2GEBA 3PVSA 2A9VA 4N3BA 3S40A 1Y8AA 2YWBA 1U6IA 1EFRD 3PQEA 1OFUA 3CQ9A 2FR1A 4I4TA 4KG7A 4MLCA 4V0QA 3RNLA 4YT8A 5A4DA 3MRXA 5BW4A 2QUHA 1TJ5A 3LO8A 2K7ZA 2JLZA 2OXFA 1GTMA 2G9RA 2CL0X 4ER3A 3GLRA 4XYLA 4X92A 3TFOA 1K9SA 1Y9DA 2G88A 1BWQA 2NADA 4W7HA 5K99A 2DQ4A 3IV9A 3JQGA 3D5QA 1O9BA 1XFAA 1JT9A 4I1IA 4P7JA 3UAYA 2GPSA 5C80A 4XLZA 4EKIA 1JKMA 2Y92A 9LDTA 5HTKA 9ABPA 2EWMA 5EUMA 1FQWA 3M8KA 4ZCLA 1GGKA 1PWXA 3ESBA 1XZKA 2H2FA 2B8JA 3QBEA 1BWRA 4Q1VA 5AI5A 1GAQA 1UZMA 2I54A 2HQ1A 3NNNA 4FE3A 5BP7A 3VGJA 1PQWA 2NZ2A 1RP7A 3QU2A 5AKGA 3JALA 2QNBA 5HTOA 1WZNA 4OOEA 2NZXA 2X1LA 2XEDA 3D6MA 4TQ9A 2QIPA 1WCV1 1IY2A 1NYLA 1RAIA 4QBIA 3N2KB 1M34E 3L04A 1VYVA 2VYNA 2YJZA 2EKQA 5TS3A 1WB5A 5K0LA 4EMBA 5KU7A 3EEIA 1DWPA 4LKRA 3CN7A 3PT5A 3C39A 3O0TA 1KIAA 3L0SA 1KP3A 1Y6JA 1WULS 4FCWA 1N2BA 4E4YA 3W5BA 4P9NA 2BFPA 4DNPA 1IOWA 1QRTA 1FPMA 1IIRA 1O94A 3V32A 1A2KC 4DADA 3G2KA 5CVDA 2WRZA 5FRDA 4H4DA 4L95C 5AMXA 1UANA 1NIPA 4RFVA 3QXGA 2PYZA 3AUKA 2HDWA 1U7ZA 3FWPA 1NM5A 3MC1A 2H2IA 1XNJA 3EUWA 4BB0A 4AYTA 4DQUA 4F4UA 4YJ2A 1SVUA 2A14A 1G38A 2JKVA 4NE7A 1N5IA 1NQAO 1OF1A 5A4MS 3ICWA 3AUXA 1ZO8A 4JBHA 3ZHZA 3H1BA 2EOAA 3OOYA 3JQ9C 3PDIA 3T4PA 4JFRA 3ZWDA 5BSEA 3CH5A 3KDSE 4BL5A 4EA7A 2C5GA 1P3JA 3A3NA 2L18A 1KERA 1GG8A 4B32A 1UM9A 3G0OA 3H16A 1FYEA 1SM4A 4P4GA 1F6WA 1HNNA 4Z99A 2HV8A 5TGDA 1GUDA 3Q87B 4YN3A 1VBMA 5LUBA 2XLBA 2ZT6A 1A3CA 3AUAA 4GG1A 2ATIA 3MTGA 5HW0A 3COJA 2FMUA 1YR1A 4MO2A 5CXUA 4NY1A 3E1GA 4BO9A 5JQGA 1IBLB 4XIJA 4GVLA 2G8NA 4W5RA 3L84A 3ADKA 3CV3A 3AEYA 4RM3A 4X1KA 4WXPA 2PSFA 2OBLA 2YH2A 4ONEA 3BF7A 3RU2A 2O7RA 3G2PA 2F8SA 4EUKA 2I7DA 3UWOA 5JCOC 5KOJB 4OLBA 3WQHA 4XGIA 1E3TA 1JFVA 3P0RA 3QE9Y 3ZNNA 4OI2A 5HUQA 3VVCA 1VSUA 3WV4A 1BE1A 3NX4A 3EVFA 2R1UA 3R5JA 5JS8A 3OZWA 2IPLA 2OLEA 2H2DA 421PA 4CKBB 1K8YB 3LF1A 3Q8WA 3JQAB 4CR8A 4D9KA 4ZAFA 2C7QA 2Z58A 3H5IA 5EKXA 1EI9A 1L1RA 3TE6A 4FDAA 2VFAA 4QXRA 4QAJA 4E11A 3QVWA 2AI1A 2B37A 1OAKA 4LOKA 3PIDA 4OMDA 2VF4X 3GJTA 5FJJA 3RYTC 3P32A 4DOMA 4YCDA 2PH5A 4F8EA 5HWSA 4YJGB 3IURA 5TMEA 3S4YA 1V1RA 3DPSA 1JH9A 2E4WA 4RHCA 3FHJA 2I78A 4L5YA 4OHXA 2V7QD 4WJKB 2QHXA 4DIDA 4DR7B 3CRVA 2LR0A 2ZR8A 1WDKA 2ZDGA 3HDYA 3RPEA 1O6GA 1MRNA 2C8VA 4XSHA 5TRTA 4J03A 3GRPA 1TPYA 3K1YA 4LRYA 4DTCA 1XMXA 1U2ZA 3IH5A 4HXFB 1UXIA 2AC2A 2DKFA 3AW8A 3X1DA 5DDIP 2PWPA 2XXBA 3H5TA 5C7IO 1BKYA 1EFKA 4C0WA 4CDRA 3LUBA 3MJRA 2O5CA 1CFZA 3AB3A 4C4PA 1RIFA 3IEUA 1QCDA 5AJWA 1XLTC 3SIRA 5LQMA 5LCXA 3T5TA 4AB1A 2BAGA 1ISMA 4EY6A 1NHGA 4NHOA 3QUTA 4LG1A 1EX1A 3GQBB 1XMSA 1XZHA 2F2TA 1H1TA 3OX4A 3PWSA 1C2TA 1SVKA 3BE4A 1E7QA 2JFNA 4ZHQF 1QYCA 4UAGA 4ND8A 4YJ3F 6REQA 4J16A 3AB8A 1ZXXA 1X7YA 3GLGA 3RFTA 4NBTA 2HMYB 3DZFA 2XXAA 2CDCA 1NMZA 2QN6A 4KP7A 3OECA 4ACAA 1KTIA 2FFAA 2JJ8A 4YBZA 3RANA 3AEKB 4M6WA 3H6GA 3VO8A 4P86A 4P5DA 1UFKA 1H66A 2O8FA 1KVSA 1H05A 4WFQA 3WL8A 3UMCA 5I4BA 2DHQA 1I3CA 2X86A 1FP1D 2ST1A 2G0AA 2JKYA 2ZTLA 4LZZA 5ALRA 1AGPA 4C2UA 1YQXA 2A7XA 2WUVA 3EIXA 4BMPB 2FFQA 2WTBA 1I7SB 4JJEA 2VT3A 4G5XA 2YBEA 3S2UA 3DMTA 1JXAA 4NF2A 3O73A 4XFKA 3D1VA 5EERA 2D54A 4Q3BA 4TSRA 5B1SA 1N0VC 4KH1A 1R5NA 4X84A 1J4AA 3K5HA 5CB4B 4K3UA 4FD2A 3HN2A 3AHHA 3IQWA 1VLLA 3LI2A 5H02A 3ZWKA 1E1MA 1TUBA 2Q5IA 2XNDA 3QELA 4XQCA 3GLUA 5KINB 4RGQA 3WHLA 1KWGA 5FBVB 1ZOOA 5J2UF 1UK7A 4YRAA 4MQ4A 3SF8A 3I5MA 2C3YA 4LXIA 5ALXA 2JAWA 3U3KA 3NM5A 1R8YA 3FDXA 3PF9A 3UZUA 4GMHA 3ZLUA 5DE3A 3FOZA 1PTKA 1Q83A 3VR5D 4J2TA 2Q1WA 3MT9A 1C30A 4UBLA 2KBEA 4KBGA 4BMDA 4J0IA 1GPDG 1Q0LA 3FCSB 4LBWA 4UE6A 1KVTA 4E3WA 1RQPA 3KJHA 3L8FA 3UEOA 5L53A 1FUKA 1EG2A 4WESA 2HL6A 4U2EA 1PV1A 4HJXA 2GDJA 3QEOA 1ZK4A 1BHJA 3KDAA 4WN3A 5K0FA 3NH9A 1RCTE 1Z6TA 2DHCA 2Z3ZA 2P3LA 3JXEA 4JX8A 4WSOA 1ZLXA 4YRCA 4Q3KA 2Z3WA 4WUVA 4RF2A 4QUAA 2CVQA 4CMJA 5KX5A 1XELA 2VZ0A 3DBLA 3TCNA 1V7ZA 1WMFA 5DTQA 3LYLA 5K8VA 4URHA 2JDIA 3AEUA 1AIPA 3WNBA 4YYEA 4CCYA 1VE7A 2G72A 2QTVA 1KZHA 1PQPA 4XB6B 4C01A 4Z9BA 1VL8A 2OECA 1E62A 5DW0A 1WMSA 1P6UA 1PUIA 2VPXA 3FXAA 1GQOA 5KJ6A 1F8YA 1N6RA 1BEZA 4F04A 5KJCA 3LUGA 2Z9BA 3AP2A 1WZUA 3HC7A 3SJCA 2OZLA 4UFPA 2FMFA 1EE1A 3PJEA 5H83A 5BOSA 3OCUA 5E6UA 4FNGA 5IHXA 2Q9UA 3U4QA 2CXRA 2P5TB 2PDAA 1NNI1 3GZ4A 4WH0A 4AF7A 4GBMA 2HA7A 4EUFA 2ODQA 1EAMA 2PJUA 4R9NA 1ONBA 3KQHA 4ZOLA 2PFGA 4WY8A 1Z5GA 3VSDA 1PVOA 2YVUA 4Y18A 3RC3A 3SG0A 2X9NA 1TDJA 4RFSA 4QDJA 5HEKA 3JQAD 2SKEA 2GX6A 3DLHA 4LOAA 1HEIA 3GP5A 2AI3A 2BEUB 3R7DA 1U1IA 2IYXA 1B43A 1U9JA 2IU3A 2P6MA 4IVQA 4UTRA 5ICSA 4WCFC 3N75A 1ZNWA 4EUNA 3IAS1 4GVXA 4R1TA 4EA9A 2Q4TA 1YQTA 1NUSA 4ZMBA 1DIHA 1CEEA 5CNMA 1I7DA 3I04A 4GZMA 4Z54A 1TIBA 2QGFA 3UGKA 1E2JA 3PRJA 3M1LA 1K5GA 1YOVA 4C06A 4HWSA 1V6AA 3K9BA 1XTPA 2GJSA 2FPPB 1HM5A 2VDVE 3BZWA 3GDOA 2B6HA 2C3MA 4AL4A 3ZW8A 4C5AA 4RUKA 4ERXA 3OQOA 1DG1G 1OZAA 1E9RA 1A97A 1QFYA 2J5KA 3B6EA 4UW9A 4N8SA 4BMXA 2AC7A 1D2EA 2YW9A 4X3CA 3RLIA 4UNRA 5JASA 5EIFA 1RJEA 4L78A 3OKPA 2R96A 3DEJA 1AHPA 1WHTA 3ZY3A 4PR0A 2GD6A 3LRXA 4OBEA 1M75A 1X8JA 4Q93A 5JROA 1CIPA 1BN7A 2J8ZA 2OORC 4FI3F 5BV8A 2EKZA 5JCJD 1U4NA 2GN0A 1U3FA 1B6RA 1XRQA 3JQBC 4LQCA 4E6EA 3RIEA 2Q9CA 4IGEA 3F5FA 2W71A 2ZYIA 3GP3A 2OZLB 4NBWA 4NV0A 4CLEA 1R6AA 2B1GA 3MOIA 3ZE2B 3TRKA 4HS4A 2I0FA 4DUGD 5EJ7A 2Q6TA 2DWPA 5ALMA 1CJTC 1N25A 1EB8A 5FJIA 3FDJA 1W94A 4GQAA 3AERA 2HU7A 5CB8A 3T52A 2PGNA 5ADWA 1D0VA 1V11A 1TNDA 4NYMQ 4O4HB 1O95A 2X0NA 3DOOA 4GMXA 4W6ZA 2W83A 4WWHA 1XEFA 4F4HA 1I14A 3INNA 5IUKC 1RHRA 5ARBA 3GLVA 1FSSA 3WLPA 1YE5A 2BV3A 3AYZB 1MP0A 4JR0A 3DE4X 3GA7A 4HG2A 4ARZB 4YECA 2CYBA 4GRIA 4KKVA 4N0DA 1Y42X 4X91A 3ZLTA 3EOBI 1EEHA 3DVAB 2HU5A 4QNNA 3WGKA 2ZYVX 2EHDA 2H3HA 3K6SB 3G8CA 3DHYA 3CCBA 2ONJA 1KJIA 2GA8A 1IK4A 4Z3DA 4BX3A 5IM4F 4XLTA 4A0GA 4RV4A 3ZQ4A 3WXMA 5ALJA 4BJ5A 4UM5A 1P2SA 1UEXC 1FTSA 3GOQA 4P58A 3G2MA 1JV2B 1VBKA 4RJLA 2CV1A 2CYCA 1R2QA 3HYLA 1ZVMA 1MUUA 2JGFA 2QUJA 2ZKIA 2D0PB 3IUMA 1QVZA 3JQRA 3IR7A 1MAVA 4LHYA 5JXJA 4HB3A 4UUAA 1SXJB 5BWCA 1QE3A 1ZPDA 3OF2A 5IUJC 2NU7A 4OKNA 1QZ3A 1V35A 1Y1QA 1YNOA 4TV8F 4PXAA 5JAPA 1C0IA 2BFBB 4G0MA 1ZS9A 1I7LA 5KSZA 1AHIA 4V0NA 2JCBA 1H6AA 1WX1A 5C4MA 2OBFA 2JRLA 3OFND 5TMDA 1IWOA 1XLWA 1QHFA 2NAFA 3A28A 3BFXA 1IXRC 1OYVA 4PX2A 5KCMA 1H4QA 3FBGA 3V9AA 1VLMA 4NPAA 4LTNA 1OC4A 1Z6ZA 1TJ4A 2NZVG 2RK6A 1IN8A 4CM7A 1PIWA 3PI6A 1RIIA 2V0CA 5E1OA 1N0UA 5CDFA 1T8WA 3C6QA 2XMZA 3V8RA 4LJYA 2IPNA 2WJVA 5H81A 1E1QD 4XE5A 3AKCA 2YMLA 5AVSA 3PGKA 1FXSA 3NJ8A 4G89A 4B40A 3DTVB 3IQZA 3W1EA 5ITSA 4C78A 3AG6A 2A30A 2R8PA 4JJ4A 4Y9DA 2NZWA 3ILVA 2NQTA 5EP2A 1OXVA 2YWCA 2FK8A 3TM5A 2AW3A 3MTQA 1TZBA 5EPUA 1QHYA 2R8RA 1QZUA 4H60A 2X42A 3L82B 1KZ1A 4QXOA 3KUUA 1ZBQA 1KOJA 1UBUS 4WK4B 5DI9A 4TTJA 5IDWA 4PZEA 1JHAA 2PFSA 2R97A 3HLTA 1UJ2A 4YGYA 2W43A 5FL7A 1YDHA 3GZNA 1KJYA 1P5HA 2I22A 3TSYA 4DQLA 3FNEA 5K8CA 1TECE 1XZPA 4G0QA 2WTMA 4OQFA 2X8JA 3QBTA 4XR9A 2AOTA 2JDID 3BE5A 3HEAA 4YXWA 2XE8A 2QXUA 1HE8B 2RGNA 2ETXA 2VF7A 3AUJB 5AQEA 3UWSA 1AUQA 3G6WA 1EFDN 3QUCA 1NJGA 1T4MA 5E1MA 3JVIA 5F2OA 1T0JB 1OFGA 5DU2A 1Y34E 2H57A 4RENA 4IOLA 3BX1A 3FB4A 1RQGA 4BFWA 3V8EA 1IXSB 3HGMA 4MPPA 1U2RA 4YJFA 2IV7A 2WKSA 2WF5A 3CO0S 4DB4A 3SOPA 2W6JA 3A05A 1X1QA 2HFKA 4MP3A 4BPRA 5FTLA 4CW7A 1L5WA 3O91A 2QZ9A 1A7UA 4NBKA 1AC5A 3QPWA 1Z0SA 2C1EA 5HGJA 3WI7A 4BO5A 2FU5C 1ZJ6A 2RHCA 3D31A 4BX2A 4JVNA 2BMFA 2Q2NA 5ALEA 3JQAA 1NN3A 2H65A 3MWEB 1QIEA 2AFHA 3S2ZA 3SQOA 2QSYA 3U3JA 4MRMB 5J43A 2NTEA 4E5NA 1T1IA 3E9DA 2VWQA 5JJLA 4ZP1A 2H1CA 2CXSA 1JLHA 2VYVD 5DN6D 3RASA 2FZGA 3HKCA 3I0NA 4LFBB 4M9CA 1IDN1 3LY9A 1D4AA 3T7SA 3VGPA 5B2EA 4YJFB 2O3QA 1O6CA 1JFLA 1U31A 1X13A 5I4CA 2GK6A 2IIBA 3WSWA 5KPDA 1B2LA 4B6RA 1RQ2A 4K9RA 3B13B 1WXDA 3PC3A 2B82A 2XOKA 3OTQA 3L01A 3F7MA 1MJHA 4KFTA 1OXSC 1TM3E 2CFTA 2IV3A 1AA6A 2GETA 2YXDA 2P65A 2FFBA 2CJPA 1W85A 5DYTA 1IMOA 2D8MA 4BNIA 2NYAA 1TEVA 2ZIEA 5IAJA 3L7BA 5IFKA 2XMBA 2ZIVB 2QY9A 2V1XA 4MYUA 3TKAA 1WUJS 3I42A 3U7QA 4KV9A 4WAUA 2AJDA 2GM4A 3ZQKA 2Q3FA 4DUYB 3O4HA 3U40A 3WK6A 5GQSA 1XBTA 4QPNA 1E58A 3TR5A 3TD6A 4LYJA 2ID7A 5CDTA 3T3OA 1BVRA 1ORHA 4Q9KA 4P36A 2ATVA 3LUKA 5G3ZA 1C4KA 4QLOA 1M5TA 1OZGA 1XKTA 4NU8X 5ESDA 3TZQA 4CQMD 5JU6A 3M4JA 2CZGA 4RTRA 2VWGA 1EDZA 2IYFA 4ZDIA 1UZLA 5E4JA 3P9KA 2GCOB 1KJQA 1Z0ZA 5AI6A 2ZQ5A 4EPTA 3JQEA 2XZLA 4V02A 4W5QA 4PU0A 4P34A 4X8LA 5SZHB 2ICAA 1RQNA 2O6LA 1ZRHA 2GVNA 4QGBA 2VTEA 2QVXX 3GG9A 4L2IA 4HVLA 3GZTB 3T9CA 3O75A 1DUVG 5P21A 1THZA 5KTPA 3KJNA 4DLBA 2XLCA 3EZNA 4J4BA 1K8QA 2VDWB 4I0WB 5B1HA 3UXMA 4OSEA 4LWQA 9MHTA 1FRFS 3ZUPA 4BO4A 2O23A 1FFEA 3VNVA 1DAGA 1Z9BA 2AR0A 2JCSA 2W6MA 4L9SA 4MMXB 3I5YA 3BA1A 4INZA 4G1CA 2J5RA 1LZLA 2REQB 3M9XA 3O90A 2X3YA 4R98A 5DOZA 3TKLA 5LQUA 3TG2A 3A9SA 1JEYA 1R0BA 1KMHA 3O26A 3IB6A 4K6HA 1C4XA 1YQGA 2XD9A 3VPSA 1LQTA 1E2PA 2P27A 3HH8A 4F71A 2UZ1B 4OA5A 3HJFA 3QHQA 2XDQB 2WJJA 1P0FA 1Q91A 2JGJA 2XKAA 3PHCA 4WDQA 1ZEMA 3MS2A 3ASYA 1NNUA 1PZEA 1QWSA 3R3XA 3Q2KA 3K35A 2PU5A 4TMZA 4GKAA 3GLHA 3X43A 1U8FO 2OGWA 1Z16A 4G07A 1K1EA 5CIQA 2RD2A 3EPHA 5DX1A 3RVBA 3NIDB 1F1BA 1O7JA 4P4SA 1W34A 3HJUA 4E12A 5TF0A 3DZJA 4FNMA 3I6YA 5H3LA 2Q8PA 4EG8A 4XTCS 1V4NA 5EYPB 3RIYA 2OESA 4LISA 4CM8B 4RTMA 2CBXA 4N9QA 1RZRA 3DKRA 2I2CA 4RJTA 2I8CA 4CRWB 1A9OA 4YRPA 3SSMA 1P1JA 4QJ3A 1E5XA 3G0DA 4LFCB 4KXXA 4ENRA 2ZXUA 1Z2CA 1P1BA 2YCLA 5DM0A 5EWLA 4NYIQ 2HMAA 1FXWF 4JXXA 2QORA 4Y1RB 4CKWB 2JJYA 3QVVA 3ZDZB 4ZVUA 2PR7A 1N7JA 1QB8A 3ELWA 3BQMB 1U4SA 2NQ8A 4WLFA 3RS3A 3UK2A 4S1PA 3OM8A 3I12A 5KTNA 4KDEA 1SC6A 2G82A 5HXAA 1FRZA 3SR0A 3HCRA 2FQWA 5A1TA 3CT4A 4DLUA 2Z83A 1U8TA 3CLKA 2RH5A 5SV2A 5TQ2B 1OCEA 5KNDA 1QFJA 1PSDA 4CDMA 2RMKA 4YDSA 2XIQA 4LVOA 5AW6A 5LKAA 1W0JA 3PR1A 5IAAA 1V8ZA 4BP8A 3EXG2 3P5BA 4CG3A 5HJ5A 1DEXA 3OQNA 4O0LA 1V48A 1AKMA 1A9TA 2G70A 5HQJA 5HQ3A 3E3MA 4FFNA 5IN4A 1KA9H 1U1CA 1X8XA 3VM6A 5F1KA 5I7HA 2VZEA 3O2JA 2XV1A 2YYAA 3QQ5A 4O1MA 1E2IA 3TNDA 3TSOA 1ZH0A 3F71A 4L74A 1USGA 4D4GA 1QLJA 2QTZA 2HLDD 4JXJA 4MGKR 2IXGA 2I4IA 4BZQA 2WY2D 2MTBA 3D5TA 3FPFA 5B7GA 5E4YA 5FA8A 4M49A 1RKUA 4NE2A 5KHAA 5A0VA 4WQMA 4KV7A 1TLLA 3KQPA 4QOGA 2D0IA 2ZRAA 1FXUA 1N3BA 4KODA 3GUCA 4IJMA 2JGEA 3EIHA 4DV1B 3TEJA 3IP8A 3MWKA 4KJZA 5A03A 5F7XA 3CUWA 3AM4A 1ENZA 3NVAA 2WOJA 1PVVA 1WAMA 2GPJA 4C4SA 3GNTA 3GZJA 4OYHA 3ZX4A 3C8MA 4TLCA 4U8GA 3QOYA 4WVFA 5CCDA 4LF5B 4IWXA 2ZU0C 1EFPA 5EE1A 3L0BA 4AWXA 3S3TA 1KYZA 5KVAA 4HEJA 3BRSA 3VO2A 1HE3A 4XJVA 2OILA 4K86A 2KX7A 1JAYA 1BW9B 2EZ8A 4YIHA 4FMDF 1X7ZB 1CF9A 2RKWA 3SQXA 4R5HA 1ZCFA 4G09A 3W4JA 1ISRA 4KIJA 4O2AB 2CJWB 3WGOA 1DVRA 1RE1A 3HXMA 4Z4QA 2VEDA 1GU1A 2XCLA 3EGCA 3X1WA 1E7WA 4K9PA 3WHPA 3DBRA 3LDGA 1VMKA 3GLFE 4FOTA 4FN5A 3Q7SA 3T4EA 4RZ2A 4FSDA 1JLSA 2VAPA 1LK7A 1DZ3A 1WU8A 4NZNA 1R7RA 2IS2A 1T4DA 1IHOA 2CUTA 3EUAA 3BRWA 4ZHQB 2RK4A 1A8IA 2P6RA 3LXMA 3EIQA 3OCCA 4L57A 2K5UA 5A5DA 1X2BA 2Q6VA 1SIUA 1EUZA 2I6UA 2LZ0A 3DVLA 1RXCA 2W4QA 3H2YA 4JDUA 4EB6A 2UUBB 1M67A 3N8IA 5EIEA 1WMDA 1ZM2A 4JOCA 2R6JA 1WVIA 1ORIA 4LC1A 4M7PA 5EIWA 1R15A 1JHOA 1BG6A 3DE3X 3KYDA 3OVMA 4KLAA 1KSGA 3JAMA 1M83A 2O1XA 3D9QX 2CLHB 3F6SA 2NZUG 3I3SR 3RYIA 1CLEA 1XDSA 2J48A 3H9QA 1Q7CA 4HZGA 4OXKA 5GVSA 4XGQA 4QRHA 3ZDYB 2UYHA 2P79A 2W6ZA 1I24A 1U8EA 2Q1SA 4HNSA 3THXA 1PEDA 4RVUA 1K27A 2YC2C 4HWRA 1MNQA 2D5BA 3DMGA 3IP6A 4IIXA 3WWPA 3ZI4A 4J4HA 4LZOA 5LBIA 1RYBA 2IYZA 2PNFA 4YRBA 1EGMB 4AROA 3DEYX 3RRYA 3R7WB 2QPLA 3ONEA 2YZ2A 1OXUA 2C7GA 2P35A 4MO9A 2WP8J 4X63A 4B35A 1DARA 2A67A 4CKYA 1IYZA 1MORA 2J67A 2O8CA 1BFKA 1UC5B 1TCAA 4CWAA 2CLLB 1GPUA 1XALA 1UT6A 4Z7NB 3BFJA 3CN9A 2VCHA 1FTYA 1OTHA 2EFEB 3EW7A 2AFHE 1I1HA 1PFQA 1CE8A 4ON9A 1EVJA 2LW7A 1AKYA 5EGSA 4CF3A 4EMSA 2GF2A 1EX7A 4I5EA 2AC4A 2I6XA 4V2IA 4RZIA 3CX3A 3MZ0A 1QKJA 2DPYA 2W2PA 3TOVA 3TB6A 3X2EA 3DWIA 3EBOA 3SC4A 1P3Y1 3H65A 2EP5A 2QMUA 5FPYA 3PXGA 3FCXA 3CX7A 3KVVA 1QGYA 4NBNA 5L7TA 1ZIOA 3A6KA 3MINB 4NX2A 2PXAA 2ZUCA 4POAA 2WMOB 4D57A 2OCAA 2BTOA 1URPA 3GQBA 3I01M 3GVXA 3N7TA 4KKXB 3PK0A 1BKDR 3H9UA 4P3PA 1V5IA 2QI9F 4QDTA 3TCKA 3EK2A 3ORQA 3MJDA 1IBCA 3ACCA 1T5LA 5F3WB 3PEYA 4ND8B 6REQB 2J4CA 1JR3E 1YDMA 3FGPA 3L18A 4L9WA 1RWQA 4GDFA 1RZRD 1ZR2A 1QHIA 1Y7IA 2WSSD 3FFXA 4KQXA 2R7LA 5FI1B 4G1FA 4Z3OA 4A15A 3LPNA 1LNZA 1QJ4A 2D4AA 2Z4RA 2Z8ZA 3DYVA 4KXUA 1P7ZA 3E9NA 3AK4A 1U2DA 1Q17A 3LKVA 1PR2A 1P2BA 5IG2A 1YR8A 1KBQA 3ICVA 3PLNA 1WCWA 4PBRA 3GJ4A 5EQTA 2CNKA 5DGXA 4EY8A 2ZWVA 1T4GA 4NOLA 2POCA 3NBKA 3QW2A 2AKAB 2MT9A 2OORA 3QW4B 2X19A 1N2GA 4CT4B 1YZYA 4M1WA 3KM0A 2NXNA 3TUIC 2R86A 2KLBA 2WSMA 1XTRA 5A7FA 2ID9A 1Y7HA 5KHLB 1R00A 2PUTA 2A9PA 4WKCA 2O2SA 5EPEA 1B0PA 2ZW9A 4GO1A 2PX5A 4QUDA 3RV3A 1PO7A 1V1JA 3HPRA 3FN4A 5B6IA 1HDYA 3OWXA 4IXWA 2VNSA 5CFZA 1A8QA 1FMCA 3DULA 2AKEA 3MJVA 5CM9C 1M34B 1FTNA 4YJ3B 2ZUSA 3AVTA 4CGZA 1Y5MA 5FCDA 4GU5A 3VU8A 1DBRA 3BMCA 3KX2A 5CLIA 3V97A 3DZDA 4QHYA 3GFQA 3PF8A 5TNXA 3SBDA 5LNK1 1G5PA 4QWWA 5ES3A 3TB4A 3WRYC 4JSRA 1P8AA 4MUGA 1W29A 3CZ5A 1BXZA 5AVVA 4D6PA 3RF7A 3TMKA 1KEEB 3ZDRA 4HUTA 2FK7A 2I99A 5DLPA 3CM0A 3IDFA 4JKYA 4RH1A 5ADHA 3RK1A 2CJFA 3U31A 3T7JA 3WRXC 4Y9UA 4WA7A 5J5AA 1G5FA 1JLMA 1VI5A 3HRIA 1VG0B 5HA5A 1PNOA 2PKRA 1GGJA 4IXNA 1NXQA 4KR0A 1JSLA 5LOVA 2VYCA 3RBVA 3F7TA 4R68A 1U0EA 1NOKA 2J32A 2B35A 4BO7A 3L1VA 4HTFB 1QORA 3FMVA 2OYRA 3JRWA 3LPCA 3HL4A 3GMTA 1DC3A 1VLVA 3D0RA 1GV1A 3KPUA 2HPAA 5EKTA 3BKXA 4PQEA 4ZQHA 3TFQA 4N39A 4LSZA 3ZWWA 3BICA 4RE5A 1SKYB 3FDFA 3CBGA 1NVUQ 1PR1A 1R0KA 2Y9PB 3PLRA 4NCKA 1U81A 4ZCPA 4DIKA 1J8YF 2NO4A 4XQ0A 1YUBA 1PYGA 4XGKA 2ZU6A 4RIFA 2H1WA 4IKOA 4K81B 5HMLA 1QIGA 4MUYA 4B45A 5J40A 3OTGA 2CLOB 4RL6A 4RPCA 4M1MA 2A9JA 4TRNA 5K6AC 5CLLA 4MYRA 4U2KA 2D2IA 2CKMA 1VE9A 2BJWA 5H82A 4L50A 1TA0A 1VJRA 1Z83A 1QC5A 1QIJA 1RKVA 2QAIA 3EUEA 3FSGD 3LHDA 4H08A 4UPDA 4TL8A 3T5CA 1JPNA 4CQNA 4CLHA 2PL1A 2Y1FA 4X1OA 2FMKA 3WTCA 2YWGA 3KKNA 4K9DA 1OLXA 1E2FA 1R4NB 1D1SA 5B7PA 5FB3A 2XE6A 3WKBA 1TQ4A 3BRWD 2CFCA 2C7PA 3ZY4A 4EHJA 1N1MA 1RRMA 3UJHA 4EHLA 3KT6A 3ZZ0A 3IEPA 1TKCA 3BSYA 3BD7A 4G0ZA 1U4OA 4XIIA 3RTEA 4I08A 4F11A 2JD0A 5BO5A 4GOLD 2BFCB 5LZ9A 2YXBA 4O59O 3OLCX 1JU9A 3RBAA 1WV0A 4DUGA 3ME5A 4MQEA 4NU6A 2B25A 1EVQA 2NVWA 2WPDA 3A1VA 3CLTC 1QLHA 4IHQA 1QG4A 3MOGA 4FE7A 2XITA 5DT9A 4FW9A 1S2LA 1A0OA 3FZEA 4F2DA 4FB4A 1IXYA 3GRUA 4JH0A 1RP1A 5HMMA 5G2OA 2GN4A 4YCLA 3QOFA 1N32B 1G64A 5BNTA 2JIBA 4JI1B 5EOVA 1CETA 1XLVA 3EWAA 4UXHA 5F35A 1OFUX 1V9CA 3E5HA 3LQ4A 3GLQA 3QPCA 4XWGA 5CNJA 3TSAA 2NZJA 2CV2A 1E66A 1TKRA 1L5YA 3FMPB 1WOMA 5FLKA 4ARIA 3OE1A 3RFFA 4Y2HA 4PG5A 3CW9A 3EZLA 2HWXA 1X80B 3OLXA 2XZPA 3PNVA 1X1RA 1I36A 4YCJA 4QHTA 4I3GA 2MMCA 3B1WA 3TYXA 1FMTA 1YS1X 1TTPB 3WAJA 2V9CA 2YFKA 1MXFA 3QYAA 2BEWB 3HJBA 2WQ7A 3LHIA 5MF6A 1OA1A 4TLBA 1F51E 5FOXA 2WKQA 5CX4A 2C0QA 4PLHA 5FULA 4JEHA 4B4KA 2EVWX 1RKBA 2ZTMA 1P1FA 1OLXB 1EUDB 3L02A 4LTMA 2K2QB 2C54A 1TF5A 7MDHA 3S1AB 2PUFA 2OAGA 1A7JA 1G8FA 1MB2A 2QN2A 2E7ZA 2WA1A 1HDCA 3CBQA 5EJGA 4CIXA 1CUVA 4WASA 2PKXA 4WZZA 2XRYA 4I66A 1OH6A 2ERYA 2V6GA 3H2SA 1N9ZA 3MBIA 4JI8B 2R6CA 3NT2A 4AX8A 2R6R1 1ZUD1 1YMQA 3KYBA 3LGSA 2GSWA 1M7HA 2IX3A 2CEKA 3RS5A 2W2NA 1ZC3A 4US0R 4BVEA 3O6VA 3L0OA 4CEJA 1LPOA 1MQ8B 3ZH2A 4MYSA 4RVNA 3UUEA 1E1QA 1RJ9A 2FGKA 4B48A 3U9LA 4DMLA 4KAXA 1WRBA 3JAWA 2PL3A 1UPCA 1QPGA 1MB4A 2PA3A 2VDKB 3L79A 1YJCA 3P4UA 2P6UA 4CN9A 2I2XB 4WPGA 4E2XA 4YNBA 1JAHA 3IKMB 1L8QA 1MJGA 4FGWA 1E2UA 3JPWA 2ATEA 3FTCA 2EKBA 3P2JA 1HT3A 3MIZA 5IKPA 5KYNA 2I67A 1RWXA 2VCYA 2CNDA 4QUJA 1NUPA 2EF1A 2FFHA 2HGZA 3GLKA 3HKBA 5AXCA 4A0SA 4AZ3A 5H9WA 1U1DA 3ITNA 4IV0A 4C2TA 1X39A 4MUFA 3ZHTA 4ALIA 1G6OA 4M7OA 3TDKA 2GN8A 4O2LA 2E18A 1BOOA 2Y0BA 5AM0A 3MTDA 4X3OA 4BATA 2JB9A 5B3KA 3RFVA 4HNGA 4UOZA 4NCXA 4C3UA 3FFBA 6Q21A 1IEQA 5TV2A 2P9YA 5C51B 5DBGA 3L93A 1RWMA 4B0OA 5I9SA 2QLTA 4FJ0A 1CERA 1XA0A 2A5FA 1LRKA 3RS7A 4QGSA 1RLMA 3GAFA 4W8OA 4W9NC 3UJ9A 4QTYA 3GT0A 2R68A 3W78A 3GJXC 3TIFA 3THWA 2D06A 1JSCA 3X1MA 2FA9A 3TDNA 1ISSA 2OTCA 5DMXA 1AHNA 1EGAA 2BM8A 2W6JD 2FWRA 3URKA 3W5JA 2YWHA 5KHOC 2D0DA 4MHOA 4EG4A 3DXYA 1VBFA 2C96A 1DEHA 2FTKE 4OL9A 4IIEA 3O9VA 3T94A 4NTZA 4YK7A 4JXKA 1UM9B 4MMYB 2Z1NA 1IATA 3KTOA 3DL2A 4JP8A 1LKZA 1LJLA 3KT0A 1E9SA 5CFRA 5M7EA 1GPKA 4LZPA 4DA7A 4HF7A 4B3HA 5JZOA 2UUAB 4F60A 1GU7A 4OQNA 2WFLA 1U9ZA 4NG5A 3V6MA 1YOBA 4DPMA 1PKXA 3PWTA 1NNLA 1QJCA 2YUTA 1TKAA 3DOFA 2P78A 4OHCA 4TRJA 1P45A 1KMQA 4Y2JA 2VYFA 4IZ6A 2Q0XA 2XH8A 4IMRA 4C6TB 3ZDDA 1IRXA 2AG0A 1IH8A 1DRUA 1M1YB 2CE2X 1H4SA 2ZUEA 1AXEA 4DARA 4KYUA 3M7IA 2LTAA 1UDXA 3ZWVA 1L5HB 2XF2A 3L4SO 2AUTA 3I2HA 4Z9XA 4FFSA 3THOA 3F3SA 5JSZA 3D3QA 1E4VA 1KPIA 2R8ZA 4IS2A 4L0DA 4CV3A 3TLKA 3WIUA 3UJNA 2F9MA 1OX4B 2WJYA 1E0JA 1M0SA 1ZZEA 3IRVA 4HDQB 4LXGA 4DXHA 1Z6YA 2ZRKA 3JQCA 2GHRA 1NSYA 1VMAA 4LSGA 3OCXA 3LX8A 3RJTA 1K6XA 3OBIA 2O0KA 1Y7LA 2OM6A 4BLOA 1MCZA 2YIDA 1RLTA 1U6KA 2PS3A 2VDRB 2ZZKA 3DP9A 5JD5A 4BP9A 3UJ7A 3W2FA 1V9LA 4JT4A 4XASA 2C7RA 2JJQA 4PLVA 1J9ZA 4Q00A 4YO7A 4PLTA 2WPDD 4ZCTA 4R0MA 1J5EB 2APJA 2LVBA 2BSXA 2X8JB 3LQYA 3AVWA 1P4GA 2FKNA 2BMAA 4MW0A 2ZROA 3TRFA 5IWCA 4MW6A 4AP5A 4TS3A 4B71A 4F92B 2PSJA 4MJLA 4B3TB 1WTAA 2G71A 2AF3C 2G1AA 3Q98A 1V8PA 4BVKA 3CVUA 4DDUA 4OAPA 3PGJA 1MOQA 1HYHA 3R7AA 3B5JA 3N0WA 4CMKA 5FNVF 1ADJA 2C42A 1D5CA 4QEKA 3W2IA 2HSJA 2B8WA 4LF4B 1EXWA 3HVHA 3I2JA 4ZYYA 4HRVA 2EW8A 5E7QA 3G5TA 2NSLA 4Z0NA 5A7GA 1OMOA 1EVKA 4UUBA 1A9SA 3N0VA 2AOXA 1ZD4A 1VGRA 3G1WA 4UFOA 3RAFC 4LGYA 2ZJ3A 5TMPA 4JR1A 1VPLA 3KVOA 1OGYA 3G3EA 2PT7A 3OCJA 4RHYA 5AJXA 4DWWA 5BWOA 2JBAA 5THXA 2XDQA 5HRUA 3PDCA 3RIXA 4GF5A 2HIHA 4I50B 3QUAA 3VSEA 1SGWA 2OAEA 3DCYA 3QTBA 3G88A 1Q5PA 4WXRA 1O08A 5JXIA 4IUYA 4U7PB 3OFVA 1I4TD 1X9GA 3LOPA 4ZCRA 4DLWA 3C3EA 2JW5A 1MX1A 2FN9A 4PLZA 3PGA1 4Q4HA 1W581 3LP5A 4BMCA 4B73A 3S81A 1YRLA 1XTBA 3AF0A 3K0EA 4KL8S 1NJSA 4N1AA 3VTAA 1ZOIA 3LL7A 3QXSA 4TSFA 3D3WB 5TQVA 3W5AA 2C5LA 1RXVA 4DCNA 4BLPA 1JHXA 2F3PA 1QR2A 2P91A 4XARA 3W1VA 1PJQA 4RS3A 3DO5A 3P9QA 1V8BA 3ET4A 3PWKA 4L6IA 1KAQA 3V4LA 3JWHA 1MEOA 2YYZA 1H93A 1KK3A 3IKJA 3ULKA 2HRBA 3WGMA 3KQUA 2F3RA 5BYKA 1F6DA 2ZJYA 2FZ5A 4BCBA 1V5EA 2OOKA 1KEVA 2MU1A 2XWBF 2JI9A 4KR9A 1VJDA 1NF9A 2G1KA 3KR1A 3T1YB 3AKYA 4LK3A 4D97A 3BXHA 3PC8A 4LXXA 1W25A 4OEHA 1X7ZA 4GPTA 3C4VA 4EPYA 2HUNA 1NU6A 2O3TA 3NBFA 3RS9A 4UEJA 3GRRA 2V6BA 5KNDD 4PVDA 2GILA 1G16A 3IAEA 3K09C 4PV7A 3NEYA 1G2IA 1Y89A 1Z0JA 3ANMA 3P20A 5CXQA 1E63A 2P1RA 1W0JD 4NOMA 2VN8A 4EM6A 1OH7A 5A4KA 1SXJC 1B73A 4KX5A 4LCEA 4XIFA 1ZL2A 3S1SA 1VL6A 3CWZA 4RMNA 3TIIA 1U0SY 1NBME 4CF6A 2GJ8A 2Q2OA 2ZWIA 4UJ5A 4ZT4A 3AC0A 3UV3A 3MUFA 3IPLA 3O3NB 1MENA 2VLBA 5CFQA 1GCIA 1USKA 4O4IF 2K4MA 1WXQA 3AL2A 3UMGA 3BCRA 3A1TA 2HCRA 2ZXEA 4MSUA 1KZGB 1OWPA 2GM9A 5CA0B 1UEJA 3NEPX 1COZA 1LF5A 1G17A 1TK2A 5KYWA 3K8QA 4ECEA 5IYZA 3HRHA 4RM2A 5A0TA 4IHAA 2H2WA 2RFLA 4ZVQA 2P8SA 2OD9A 4R6XA 3GP8A 4FONA 4D9EA 3FH0A 4FR2A 2IZ1A 1ZMBA 4GP7A 1G1AA 1PU2A 3ICPA 4TM7A 5DCLA 5K3DA 3O21A 1BWPA 4P33A 4R83A 2Y05A 1P39A 2X9LA 4Y2VA 1NR5A 3SBEA 3M3PA 3UAGA 4G24A 2PMWB 5TY0A 1O94C 1OI2A 3T12A 4D4LA 4AXBA 4ND1A 1UK8A 3JASB 1WSDA 2HHJA 4XQGA 5EWLB 3DHEA 3M4ZA 3EA0A 4JVSB 4OYYA 5LMZA 4HWTA 5IT9A 4OGGA 3RARA 4LXHA 1H2XA 1NI4B 2Y99A 1SCUA 4DR3B 2YCBA 2IYEA 3L7OA 5B6PA 4RIHA 3MQ4A 2BR3A 2O5RA 3G8YA 4B6SA 1P5RA 4QATA 2Q1UA 5AVUA 3O8QB 3C6BA 3FW1A 1DOZA 3FUCA 3CH4B 4IMIB 4LZAA 2GT1A 1QV6A 4JDPA 2HF9A 1XAGA 1J2RA 5E6SB 1I13A 2DULA 3U9TA 2RI6A 3ZDXB 2WJWA 3BC1A 3LFUA 4BVFA 2C5EA 1Q6YA 4FXOA 3DM9B 1P4SA 1R5JA 1XDUA 1NURA 3GWZA 4ZEOA 3R09A 5ED4A 2LNDA 4WFIA 4HQLA 1ZMXA 2F64A 3NR2A 5B12A 5IAOA 3HFJA 1ZOLA 3A27A 1M2VA 3HBAA 4G63A 2OD7A 3UH1A 2WU3A 1A77A 5BW5A 2I3BA 2XMRA 1RD4A 3I4LA 3N2NA 3V3TA 2WV9A 4LV5B 1A27A 2FFRA 2XYQA 3HZOA 4PNZA 5AOCA 5K51A 3K0CC 3RC7A 4C1NA 1XKLA 5B4TA 2CEAA 4DA0A 4DLZA 4GKVA 3BRQA 5EWMA 3FPSA 1OLUA 3I9OA 4IKPA 4EY5A 1P0PA 2VP5A 2VOJA 2REBA 3L0PA 3QLVC 4NSNA 4P5PA 2IITA 3E4CA 2CDAA 3QBJA 2PTHA 4J6FA 2UYOA 2VBFA 4V3BA 4Q9IA 1F8UA 2J3LA 3DEAA 4Q47A 1GPH1 5AP9A 1YD7A 1Z25A 3L8EA 1G9TA 4INPA 3FHLA 3EODA 4Q7LA 2OXIA 4KUHA 2AN9A 1OZHA 2CVZA 1T0BA 1MPXA 3DR5A 2WVAA 3TNJA 4WBNA 3CWCA 1Q15A 5AIBA 2IRWA 3M1YA 2VT6A 3BWYA 3F6PA 2J85A 3KXLA 4PBTA 5ILQA 3AILA 3GLTA 2OFFA 5EMKA 4JUDX 1LJUA 3HLKA 1FZTA 1NJ5A 1RJWA 3LV8A 3K2IA 4QJ5A 4EKGA 1JFFB 1L6IA 2AWNA 1CY4A 1E3LA 4X45A 2CMFA 1XU9A 1DXYA 3D02A 1MRZA 2HFJA 4EABA 1QSGA 2Z6AA 2Q1XA 1A04A 1QR6A 4V0MA 4NMXB 4JBXA 1FS4A 2PQ2A 1XA3A 1SEPA 3UUGA 4Y1EA 2QM8A 1N6OA 4LBYA 1N36B 1L8AA 3A9VA 1J06A 2F90A 1PNTA 3FLEA 5HE8A 4QPZA 1ORDA 2MYNA 4LYHA 4V39A 4WEQA 2GHTA 4QOHA 1RLIA 1NJ8A 3SMQA 1NVXQ 1NXWA 2Z2XA 4M1QA 4DIBA 1X7WA 3D2BA 4CIWA 1KR2A 2O8VA 3DD5A 4ARSA 1EBFA 2CLDX 3MTIA 5JQGB 1RBZA 3OT4A 3TEMA 2PMBA 1ULAA 2WSBA 3IUJA 3T61A 3M4NA 2ZYUX 1YXMA 3ZIAA 3JARA 2KJQA 3WB1A 1YZNA 5BR7A 5U1PA 1XZ8A 1K7XB 4Q9HA 5H68A 2VDMB 2PL9A 3NV9A 3PIRA 1D07A 1GWNA 3JYQA 4TSFD 4F1JA 5AK3A 3AF6A 1J2UA 3PEUA 4KQHA 3TR6A 5LOVB 4LA4A 1HSZA 2ZBEA 1ODCA 3FHOA 4PO8A 4KPFC 1DJPA 1N4AA 3B9BA 2UVQA 2ENUA 4H3KB 1XAIA 2ZXFA 1T5SA 3L3BA 3UJBA 2AFHB 4BS9A 3SC2B 4EFLA 5J58A 2KLHA 1GZ7A 4I9UA 3Q85A 8MHTA 2WZDA 7ABPA 3ZXSA 1A82A 1USVA 2RCYA 2YMPA 3KL4A 1DIAA 4UHEA 3QZUA 3SJBA 2GK4A 3ABSB 1W1IA 5ALKA 2B7BA 1EK2A 1P81A 5DK4A 3UCFA 4CMAA 3ZK8A 1YL6A 3FNBA 1C9JA 3A4YA 4JMLA 4Y7CA 1C1DA 3FHCB 1WO8A 2WWWA 3CJQA 4TRRA 1GG2A 3TQFA 1CVIA 2RGCA 1HH4A 4M1ZA 1EBUA 1EQ2A 1HL3A 2W58A 4LVNA 3LA8A 1HNZB 1JBEA 4HD8A 3NMUF 1AE1A 1HR0B 4BB9A 1ABBA 1XROA 4BX9A 1XZMA 2QRVA 1K0UA 5CBPA 3R5XA 5F78A 2QTFA 4JEUA 4CU5A 1YKGA 3JQFC 4B7XA 4NOKA 2PD6A 5EJIA 3TOXA 4UVHA 1I1QB 3RS8A 1W93A 3F9RA 3JD2A 3PNYA 4RKYA 4I19A 1HZJA 2PD3A 3GDHA 2PO7A 1N33B 1M2HA 1S3IA 3A7DA 3KU1A 1QQAA 1DGQA 3DEFA 4OH7A 2AL7A 1XDBA 2H92A 4IG4A 4LKOA 1RPZA 3AVVA 3WGLA 2OC4A 3GG2A 1P5FA 3G0GA 4C0HA 6YASA 5JUWA 4BNVA 2GZAA 2H52A 4ND7A 3T4UA 3I09A 4C1BA 1SXQA 2CC2A 3W4KA 3Q0IA 1PGNA 1E4YA 3TQQA 3VI3B 4Q34A 4Q7EA 4E6PA 3HCFA 4UVDA 4W5OA 2LGJA 1TUGA 2TRSB 5JEDA 3OY2A 3IUBA 5CVVA 1JHDA 3EIOA 5KVVA 2FPSA 3I5XA 1QRRA 1T0UA 2ODPA 4RSHA 4B87A 2MSNA 4BNDA 3QE0A 1J07A 4MYHA 2XAUA 4L4RA 5D3ZA 6PFKA 1FC0A 1ZJ5A 1JEQB 1YU9A 5ICMA 5E2AA 3UCXA 4F5ZA 3WIBA 4RLFA 3NW9A 2D2EA 3O5AA 3T7TA 1AZLA 1H2BA 3HKDA 5G40A 3AEQB 1T15A 1HL7A 1Y9AA 2FJUA 4IDBA 1I9GA 4P4SB 2V7BA 1DXQA 3LUHA 1Y6ZA 1VE6A 3WX0A 4KXLA 4G0XA 1UWKA 1IZZA 3L9XA 1NXOA 2O7SA 4RETA 3VO9A 3WYAA 4CM8A 5A3QA 8GPBA 3MBKA 3O8OB 4PC3A 5HIJA 5INTA 3V4FA 4W1QA 4URWR 3RYIB 4JCOA 1FDOA 1UBSB 1KU0A 4US2R 3JQ9A 4JYAB 4L02A 3S28A 1YR2A 3BB1A 3TPZA 4ESOA 1CZNA 1F60A 2QTCA 5JNLA 3I2KA 1P7PA 2PSEA 1MTZA 1NZFA 2HO4A 2P2CA 2OKGA 4UQLA 2XA9A 3UBTA 2JIMA 1P4AA 3IMEA 3A7EA 1JU4A 1RYMA 1CQIB 3I64A 2C4NA 2VDQB 1SFRA 2IXBA 4XH9B 3W8EA 4BCDA 3BGVA 5JATA 1Z4NA 1GIAA 2J0QA 4FGZA 4DCUA 4JLDA 4K0KB 4BXOB 5DLEA 1QX4A 4HLDA 4OJNA 4C6TA 3KFLA 1C0KA 1KO1A 1XVVA 3IOBA 4WKPA 1XNGA 1SUDA 2W0SA 1SKMA 1IIBA 2BMJA 4N54A 3I1IA 5H80A 4GX5A 3N87A 1D1TA 2X77A 1SRRA 1EFUA 5BNWA 2OB2A 5LVAA 4FKZA 1LK5A 5CVUA 3BJIC 2GPWA 1TYAE 5FT9A 3FVWA 3KYCB 2DERA 1L4GA 2R2GA 5EE9A 2C9DA 2ZB2A 2VNKA 5JIBA 2HW8A 1XVUA 1WPGA 3PNQA 2DPMA 3QU9A 4IL5A 4CKZA 1I7NA 2WG0A 4RVOA 2VJAA 1YRHA 5U4XA 2FAXA 1BROA 1JDBC 1RAAA 2WUDA 4GR9A 1I0LA 4HY3A 4KFRA 4TT3A 3SHVA 1HDZA 4QG3A 4FCTA 3GMDA 4KO8A 1H2YA 4GSYA 4MV5A 3B89A 3E5NA 2A7QA 4L4YA 3IJPA 4MVJE 4MVJI 4GOOD 1P5ZB 1X74A 4GI5A 3SAJA 3C7KA 1JT2A 4B9AA 3VZSA 5CBKA 3GJSA 1PJ8A 3P19A 1DRKA 1F4PA 2CDBA 2OT3B 5EIBD 3HVUA 3AUTA 4FN4A 2JCGA 4K9OA 3ZCVA 4ZT3A 2HDNB 3VA7A 4YEDA 5GJCA 1ZUHA 4JMPA 2QDXA 4MTLA 2O8FB 4B47A 1VG8A 1ZONA 5BN4B 3S2SA 3ENZA 2IW3A 2QQFA 3GGCA 1EVIA 4IEFB 1Y1RA 2FPOA 2QW8A 2Q8QA 4NBLA 4QBKA 4ALJA 2ZVDA 5LN1A 1XPJA 3WWZA 1P77A 5KYUB 1I0IA 3OPQA 1JXMA 3PFBA 4O25A 1AKEA 4LGMA 3F47A 4IJQA 2KI5A 4AQDA 4E5UA 3AVXA 1PTJA 4AMZA 2CXOA 3HSYA 5J4YA 2Y66A 1Z4PX 2FN3A 4NOJA 2IS4A 3E61A 1KF0A 1RM4A 2YNMC 1K5HA 2VXBA 4WZ6A 2FEAA 4HZUA 1J1IA 3IRUA 4DC9A 1KK2A 4MWSA 2JJ1A 5EIBC 3M4XA 2IEYA 3IAFA 3E7PA 4Q37A 3F90A 4R8SA 1EFPB 1IQPA 1HE4A 3SYKA 5CH3A 4LEIA 2OE2A 4ZTBA 3J81k 4J7AA 1WDLA 1BE0A 3NC4A 4Q9AA 3VOSA 3LLMA 3ND6A 1XK7A 4GXTA 4H2DA 2QV0A 2DX7A 2VJLA 1KDRA 1FDIA 3LT0A 4IPTA 4L8YA 4M38A 1WWKA 3DONA 4JGIA 1E9DA 4DV4B 3A9RA 5B53A 1ENOA 1NOIA 1PBTA 1WLSA 2Q27A 5GV7A 2FKAA 5JPIA 3T3DA 4PX5A 2PGAA 1PL6A 3WNVA 4CKXA 1U0BB 1WDWB 2JATA 1Y8ZA 4YACA 1XLTA 1CX9B 1ZUNB 4YJHB 1IZ9A 1Z68A 5DHSA 2H07A 1SUEA 1YVRA 3KOZA 1Q0ZA 4LHEA 2HHAA 4JI5B 4FDUA 3C41J 1E92A 1G20B 3R5HA 4HB0A 3ND7A 1O6FA 1CDZA 4L3VA 4RK4A 4ARCA 2AF4C 1YL7A 5JCXA 1GR1A 2GD2A 3GH3A 5CHYA 1UBHS 4NDZA 1C1YA 1N5JA 2QTWB 3GB9A 3OIDA 3ZK9A 3UK7A 4XQEA 4E22A 3UV6A 3HR4A 2KPOA 3LLSA 5CJ2A 1N2ZA 1UBKS 1LPNA 3W5IA 3KAQA 4BWGA 1I94B 4GVPA 3RVJA 1JXOA 3VMMA 1FDUA 2DLDA 1UQTA 2O8CB 4NONA 4QVIA 3WY9A 3WBJA 4LSMA 3BJMA 3KXIA 2N9UA 2BFWA 2ZULA 2IWRA 2UXBB 1ML3A 1X7GA 3THYB 1K6JA 1QUFA 1L4EA 1E4EA 3KOXA 4WW0A 2RIPA 3HPQA 5IJXA 3Q41A 1I5OA 1GD1O 4BGEA 1O97C 2BKLA 1GXSB 2VUUA 3OBBA 4G2TA 4B7UA 1E98A 2QBYA 1Q21A 4C76A 3REGA 2XA2A 4XA8A 1XPRA 5IK2A 4CI0B 3ZWCA 1RXEA 2D0OB 3DMYA 3O2QB 4XB2A 4MWZA 3QITA 1KDOA 4IFIA 5BURA 3EZ7A 5F98A 1DU4A 3IT3A 4E21A 3KZXA 3GLIB 1E1DA 4Q1EA 1T5DX 1JIIA 2PBFA 1EUCB 1EIZA 1QGAA 4PICA 2B2XA 1WKCA 2CXHA 3AKEA 5FOSA 4UARA 5LR6A 2I1QA 3J7AC 1JIQA 3WISA 1W49A 2QTLA 1XJ0A 4MJXA 4LJKA 3TS1A 2C3UA 2OZVA 4K9LA 5CX1A 1XRLA 5JLAA 1GXSA 3A26A 3PFHA 4GKBA 4KLCA 4K6CA 2I3DA 3KT3A 4TX1A 4MW4A 1WETA 3IKLA 5JXGA 2RJOA 1N3LA 2BCEA 2PFKA 4OXIA 1T8TA 5JLJA 1XEXA 1Z8FA 4AECA 3VKGA 1INLA 1USUA 4NPHA 5F9FA 2W6CX 1JEJA 4EW3A 1P75A 4WFJA 2PZFA 1F6BA 3ANLA 4N65A 2Q29A 2BBTA 3L43A 3EVCA 2QZJA 2ORIA 4R5MA 2YNMA 1BDBA 5ES4B 5JG7A 1UKEA 1FNDA 3W6NA 2I5PO 1E77A 4IINA 1YA8A 1CUXA 1IAVA 1NHWA 2QBYB 3PA8A 4AO7A 1DJNA 2ASEA 3NONA 3VU9B 2N46A 1E99A 3HY4A 3UYLA 3HDGA 3G1UA 4EATA 1ESDA 3U4IA 3JQPA 1L9XA 3W8DA 4W63A 2Q9AA 4Q1AA 2XKBA 1BX3A 4BKMA 2W2LA 3K7EA 2WJZB 1T25A 4QDKA 5B7QA 2IPAB 1KE1A 1OIXA 4RD6A 1P9LA 2GCGA 4D41A 2B21A 3NASA 3UF0A 4LRUA 1DINA 1DO8A 1W47A 1FL9A 2BZSA 2C7BA 2CZCA 3WGUA 4N7RA 1IOVA 3DVQX 4M8LA 4XAQA 4FOOA 1D4FA 3HACA 4C9BA 4F3NA 5EJ9A 4CEIA 4URYR 3U7QB 5BN1A 2X0RA 5ALGA 4JJFA 4YLGA 5CFLA 5DBIA 4CQLB 4RANA 2HRDA 1ORTA 1V7QA 2WU1A 1DJLA 1O58A 4ZOAA 3HUTA 4LMPA 3SPXA 1A2QA 1N0WA 4UAVA 4A1OA 3C8ZA 1SCKA 4EKNB 1JQ5A 2I65A 3T5PA 2Q4EA 2IXDA 3KOOA 3RGWS 13PKA 2Z2ZA 4NMWA 2PWAA 2QLNA 4B6JA 3ZWBA 2QLMA 4FDMA 4HZUB 1K8RA 1GCOA 3KSZO 3RUDA 2H1OA 1PNQA 3AHJA 4RMJA 5HQ3B 4QG7A 3ZC3A 4KQ9A 5K4GA 1SQ6A 3CEJA 3ZLBA 1NSFA 3QPVA 3OT1B 4JZYA 4DVJA 1X77A 3THXB 1J8MF 1OILA 1VHJA 1Y1KE 1JP7A 1XD9A 4LDJA 3NHAA 1U0GA 4ICIA 4IAOA 3ENKA 3NDIA 1HURA 4NI5A 5D1HA 1T35A 1MO4A 4CQLA 2D13A 4HQFA 2PRIA 3ELYA 3F6CA 1CQPA 4YAEA 1ATIA 1ZIDA 4J2OA 2B61A 2VHTA 2V65A 1QRUA 1WD5A 1ODIA 4EAQA 1EHIA 1KS9A 1HQCA 3DNFA 4HV4A 5LP6A 2FZLA 3SWWA 2CLSA 4WADA 1G6HA 2CCJA 3ITEA 5F4BA 1AUVA 4RY2A 1QCZA 3ROGA 4L76A 4NMHA 3SKYA 3UAWA 1C81A 5K4AA 3CKKA 3CRQA 3P9SA 1UZAA 2NUTA 3E0QA 3IA7A 3MIIA 2C8JA 2XW6A 5J1SB 4G65A 5CH8A 3VKFA 2YVAA 2MIIA 3N53A 1P3DA 1OUMA 3E0XA 3E18A 1W36C 5M29A 4PZAA 3H2ZA 1IM8A 1T4CA 4L16A 5DB4A 3H17A 2D2XA 3GNSA 4N5LA 3KTDA 3R5TA 4FBMA 2V4ZA 1YDFA 1RT9A 3B7PA 4DNFA 2LRHA 3KQMA 2PKEA 4A8JC 1U3WA 1MB3A 3RS0A 5L7WA 2PRSA 2ZIAA 1E3JA 1Q1ZA 1Z62A 2JD2A 4L8LA 3N8NA 5BXYA 1JLKA 1G4AE 1ECJA 1M6WA 2AN5A 2PIAA 3LP8A 4JC5A 1QU3A 1FFXA 1M2WA 3OA0A 3DBHA 3WWOA 5ALUA 5C5EA 2JLUA 1LY1A 3F9IA 4GI2A 4GOMD 4WTOA 5DPMA 3L7JA 4BFYA 1DB3A 3FKQA 2FX3A 4OSOA 1LGYA 2NXCA 4IHJA 1SU4A 4HH1A 5HRAA 4I7EA 2JLVA 3FCOA 1ZZGA 4B4DA 2DVMA 3ADPA 3NKLA 3KZKA 1UR5A 3ZJ5A 2XZTA 1KYVA 2R751 3Q3HA 2HA0A 4E70A 4F06A 3ORSA 1C3JA 3H2IA 3LU1A 1RYHA 4RVFA 3IIKA 1SCDA 3RT7A 3IKTA 1K6MA 3L8GA 2YUIA 2R8YA 3ITDA 2Q3HA 4P32A 5C1IA 4XOUA 2GERA 2LDXA 4H4CA 3WIOA 3WYDA 4YAKA 4RTNA 2H7CA 4E2WA 1VC2A 3NJ4A 3DBHB 4DM3A 2DT5A 3E9RA 4GM1A 3IJ5A 4DMHA 3H4MA 2G76A 3QV2A 1I6MA 1UP7A 2INGX 3OG9A 2IVFA 3INYA 4J8PA 2WP0A 5E3IA 4YP1A 2P2YA 4RU1A 5CR9A 2UVPB 2YVLA 2FCRA 1LPSA 2EKPA 2AG5A 2AVNA 1NVVQ 3FIJA 3NOXA 4FVTA 4FT4A 1KQ3A 3WWCA 3UATA 4XOIA 2VHCA 3NFRA 4PR3A 4U9HS 4M83A 1IPFA 3M3HA 2P30A 1E2NA 4RS4A 4FGLA 4RK0A 3V8MA 3WLEA 3ZGYA 3FF1A 2AR7A 4OU4A 2VQSA 3VI4B 3KQLA 5IC5A 3IHWA 1AKNA 1TL7C 1U02A 1EFHA 3HO1A 1UIRA 2XNJA 5ED0A 2XWPA 4H0FA 3I8XA 1S9HA 5KUTA 3ES9A 3SM9A 3O2NA 4HTAA 1TI7A 1OV6A 1MX3A 2B5VA 3GCZA 4LDNA 4LPKA 3FUVA 5FD8A 3QXHA 5HYVA 2ORED 1Q0RA 1QHSA 3Q2OA 3SIPA 1IEXA 1RLUA 2P1ZA 2PX4A 3FJOA 3OPVA 4N03A 4C0KA 3JASA 2BP7B 5EJMA 2GR9A 3N6VA 4H35A 5DRTA 1GQQA 2VP0A 4ZYLA 1NE2A 4S1OA 1D2NA 1TUEA 3HRKA 4JUAA 3M82A 3UG6A 2BHRA 2OCYC 3HR8A 4WBSA 5PNTA 1XJWA 2HEGA 2IZ0A 3GN1A 4IUDS 4M0DA 4XTRA 3T7DA 4EY7A 4K6OA 2IYRA 3UJDA 1BGXT 1M2NA 4P38A 2X8WA 1VHQA 1KIFA 4I4IA 2H00A 4PIVA 4EO4A 4WERA 5GGXA 4B3BA 5L3ZA 4OTZA 4QYSA 2BN4A 2NUAB 1G2PA 4LNAA 2HI0A 2YOGA 2JGNA 1L7VC 1TF2A 5ALVA 1MZVA 3TR0A 4YREA 4LF7B 2RHHA 1KETA 2O7VA 3G82C 4Z86A 1QUEA 3E27A 5IKXA 3HK2A 1RWBA 1W4CA 2D8AA 3ANYB 1L4FA 3BEOA 3DL0A 4M21A 2JIZD 3TRHA 3VR6H 2Y9MB 3AR4A 3SQLA 1WE2A 1AMUA 3TG8A 2W00A 3NYWA 2FZEA 1PLKA 2WFLB 4PXYA 4CTKA 3FPHA 3THWB 5G0VA 4XUGB 3GBVA 4EQ6A 2WHPB 5JBNA 1FNSA 5C5CA 3ICCA 3PUIA 3BH6A 4R8RA 4FFMA 4MAFA 2W70A 3RTBA 4GWKA 2Q3BA 2HX1A 3CLRC 4GFDA 1UKYA 1NQ5A 3UFBA 4BO3A 4F3CA 1L3IA 4YRTA 2XMSA 1WPQA 2WF6A 3D2CA 3BVPA 5G0UA 3LXUX 3ZQUA 1ZNZA 4UAJA 3HTXA 2WICA 1QX3A 2DJIA 2MSLA 2VPIA 2WYUA 2RCNA 1RPTA 1GN9A 3CHYA 1ML4A 5EZSA 4OU5A 1AVTA 2EW2A 5BWMA 3A3PA 5EA2A 2W93A 3BMOA 1QZTA 1LV7A 2D00A 4QGAA 3TRIA 4DDTA 1N77A 1DKMA 5IJWA 1M5RA 1ZI6A 2HM7A 4J16C 2I33A 4KQCA 4YAIA 2A2ZA 4HVAA 1CUEA 4KIFA 3O8BA 5D6OA 5ADVA 5B5SA 2HYIC 1FQKA 1Z38A 4JODA 1SA0B 1MDBA 3AHFA 1E6LA 2Q4BA 4YV0A 2P3QA 1NX9A 4R9VA 4BJ3A 1K6EA 4BQOA 5IU6A 2B83A 4NEQA 4WJLA 5ICFA 2QJFA 1R37A 2PZAA 3EXHA 2FSVA 1PUJA 4ZKEA 5JS1A 3SEFA 2UZIR 4ZO7A 3G0IA 1NRJB 1E5LA 3IR6A 3T3PB 2P67A 3QFSA 4L4SA 4OK6A 1WU7A 4R31A 1GAJA 3EGIA 4RTJA 1M2OB 1HOXA 1EB9A 3GEEA 5LL6P 3QY9A 4RH3A 4B3RB 2YZNA 1WXIA 1I1OA 1AZTA 1JLLB 2VSFA 2DRIA 3SOZA 2EBHX 4DQDA 5CDYA 1RC1A 1X38A 4WN9B 1WNFA 2C5AA 1Z5UA 4BMSA 2RBEA 1EBBA 1R9MA 1PZNA 4MWOA 3ZV7A 5JQGF 4FS8A 5IDYA 4YB8A 4DYHA 2OUKA 2VUIB 4ZICA 4JAVC 2D4HA 4RADA 3KR9A 3TLJA 5I7WA 3NO4A 4FHDA 3PYLA 1TYCA 4EYEA 5JVDA 4G8BA 2DFPA 4YIKA 3T35A 1TZ2A 3PG5A 3WAKA 1G8SA 4V0ME 5IMBA 1BO6A 2JFGA 1DC5A 3ELUA 3PU6A 1PJZA 3TJZA 5DHTA 3QVGA 3O94A 2OCPA 5FNVA 1CXZA 1B7GO 1M2VB 4DV7B 2X8LA 3OX2A 4YMGA 1NVBA 2DQZA 2P6OA 3H1GA 3VPGA 3Q0TA 1RW4A 1R8QA 2WB4A 3PZBA 4OQXA 4GM0A 5BMOA 2D7CA 2Z6QA 2GAJA 2FF7A 1XG5A 1YQDA 3LECA 1KRHA 1VKJA 2JGDB 5HS6A 2PA0A 4Y1GA 3ZCQA 4U8HA 1N5DA 1T9HA 1GV0A 3O8OA 4M88A 1ZWLA 4HXEB 4TMFA 5CYOA 1JYFA 1XMVA 1C50A 4FUTA 4QM7A 4KR7A 3I8SA 3PJDA 1I01A 4JJ7A 4GLBA 4BWFB 1UP4A 1YB2A 1Q0SA 3FVVA 1N7HA 2Z57A 3ELBA 3I28A 3LGAA 3QIVA 4GX2A 5GM2A 1O97D 1P2GA 1S8AA 1XA4A 2H7XA 2I8LA 2XQVA 2Y71A 4NU5A 4XYBA 3UJ8A 1OE0A 1PT5A 3EG5A 5AHKA 1W88B 1ZH6A 3ZU2A 2W22A 3OU6A 1BGVA 3LLUA 1WB6A 4P35A 1ZINA 1MV8A 2OHIA 1M1YA 1U8CB 1PG0A 1SVSA 3BAZA 4PAWA 5IVHA 2YQZA 1L7QA 1ZVKA 3SXUA 2DFNA 4CT5A 3GUYA 4QBTA 3QKSA 4FEAA 1WV1A 1KVQA 1YS6A 4LX0A 3WLRA 2HNAA 4BMNA 3GX1A 2IF2A 3I6MA 5B2ZA 2IGBA 2VHJA 3HKEB 4GP9A 4LMRA 3VKVA 3VR3A 2QKYA 1GADO 1QP8A 3PQ5A 2R4TA 5FWXB 5JW6A 1RRKA 5JAQA 2BEVB 1C9YA 3IAM1 4HSGA 3ONWA 2G09A 4CVNA 2VSYA 3R3WA 3L41A 3OTOB 5B58T 2C1ZA 3OLYA 4MPJA 4E0BA 4D9JA 2ZEJA 2NU9B 4E2YA 1YVPA 2H4YA 1DXHA 1EUQA 1DAMA 1YBFA 3KXDA 5HCNA 1YWGO 4TGLA 1TIPA 3PNPA 3M6MD 3J7TA 1JVNA 3HBJA 2XQIA 3OTHA 3EDQA 3MG9A 4M9QA 4MQFA 1V3UA 2Z4SA 1JW9B 1P4RA 1X9IA 5I8ZA 3WYNA 1BCSB 2NSJA 4V0OA 3Q12A 5ECDA 4NV1A 1TEHA 2F4NA 2XCUA 1X86B 1KBZA 1Z06A 3FBTA 5K3CA 3SNHA 2PEZA 1A1SA 4PQRA 3JYLA 3O8NA 4AJNA 5L8VA 4BRUA 1ICEA 4Z1MA 3L7CA 1XD2B 3EIWA 3ROMA 1MO3A 4UBIA 4ZU3A 1C9KA 1O8BA 3O93A 4G26A 4PPQA 3CPHA 3FHTA 3W5SA 5IT5A 2RKBA 5KYVA 4DC0A 1RRPA 3ODPA 3QHPA 1TB4A 5LPNA 3H5LA 3HU5A 5B55A 3ZH9B 2NUTB 4KQGA 2JVJA 2C9ZA 4WXYB 2TYSB 4G5YA 2FSHA 5DTJA 3PR2B 3UW1A 4DCSA 5BV1A 3WMWA 1DEKA 1MO6A 2ID8A 3L8ZA 1X7HA 4V0LA 2FMIA 1KARA 3Q7PA 3O0DA 2R1VA 2FDRA 5JS2A 4IDNA 2EYUA 2PLFA 2XCQA 2I2AA 3GGSA 2WHRA 1M1YE 5DYIA 3TZBA 2BGWA 4TZ6A 1I3OA 4N5MA 2DHRA 4HDRA 3NHPA 4M0UA 4KWTA 2Q07A 5E0KB 4B4OA 4X95A 4NYMR 5A02A 3TGPA 4NJMB 3GFPA 3H5WA 4ZZ2A 4N3GA 3BWDD 3ND5A 3H1FA 4LSWA 3VNAA 3QIAA 2W2OA 1LVUA 3JD4A 4NENA 1PBNA 4FFOA 4PM4A 3DBIA 3OZDA 2WSIA 5HFJA 1G3IA 3FWHA 2YWRA 4LTDA 4QGHA 1R12A 4XWAA 2RHWA 4FGSA 4YVFA 4QKQA 3U26A 3KQKA 2DUNA 5M5BA 5FYDA 4DR5B 2HZ7A 1OBVA 5JH7B 1PJ3A 3Q88A 1DNPA 2H3EA 1R0XA 5DNEA 2CXNA 3I61A 1JLRA 2HDOA 3LVFO 3Q7EA 3ONVA 5BT8A 1ZIPA 3B70A 1Q22A 4DDVA 2B20A 1KKMA 1KYYA 1ESNA 2VPQA 1QYWA 4JS0A 4DANA 1YB6A 5BYAA 4L7QA 4LYEA 3LBHA 1G63A 3RROA 3K6SA 1E3IA 5DSXA 1HNXB 1BVHA 4OGFA 3W9BA 3O4FA 2IOFK 1XPUA 4R2LA 4UHHA 1GZ6A 4L5JA 4P3YA 5CHEA 1N8TA 1JG6A 1BXGA 1HFWA 1PK7A 1HLPA 2ZCUA 2GBIA 1THGA 1E1LA 1LVGA 1CF4A 2DQKA 1M8GA 4EI9A 3AM1A 3BD8A 5IVIA 5KQMA 1ECFA 4F38A 5AJZA 2ZAYA 3NDBB 2W2MA 1YK1A 5EQFA 2IEZA 4AG5A 1VL0A 5DV9A 4FWIB 3UA4A 3RYCB 5LA6A 3E9EA 4AWBA 5I7SA 4Q19A 5BN4A 3Q40A 3HSSA 1NWHA 2R44A 1OJ7A 3H04A 3GGGA 2DQYA 3AY7A 1EVZA 3HB0A 4X93A 3UXYA 4PBSA 4WIAA 1T1JA 3KEGA 1U0OC 3AVPA 1VIYA 3UJ3X 1YS4A 4H9GA 2JFZA 4YUXA 3BS4A 4MKIA 4OXYA 5AVOA 4EVSA 1W36B 3ZD8A 5P8WA 4G8DA 4PG4A 5JSYA 2QLJA 5E8RA 4Y2RA 2DZDA 2M6SA 3OIFA 3CUSA 1F8FA 4A8JB 4UM9D 1GEGA 4YCNA 5HFNA 4L8FA 3WLHA 4R8VA 2C7VA 1B41A 1P2TA 3HJRA 3IUQA 4MROA 4B6GA 4WD3A 1NF8A 4RVDA 3KOUA 1YHNA 2J0UB 2V7GA 3I05A 4PZCA 3RO7A 3U4CA 3CSUA 3WSTA 5CDUA 1KQGA 3IC5A 3KP1A 3QXXA 4DB2A 2O3RA 4PRKA 5EJ5A 4O1IA 1VG9B 3FKSD 3TW8B 4PE5B 3UC9A 4EVRA 5LYJB 1Z74A 5DISB 1Z0DA 4C5CA 2FR8A 2VL7A 4YRRA 2QX8A 2JFYA 1OPXA 4Q5IA 4QD3A 3CR7A 3TLBA 1CS0B 2NUBA 1ITZA 3IQFA 1M8FA 2Q62A 2AOTB 4M3NA 4NAHA 5EN4A 1KKUA 4KNVA 4AG3A 1HY3A 1U04A 1XZDA 4U7FA 2IZOA 5HPYB 2D1RA 2E1PA 1HXHA 4GIBA 1ZIXA 4Z9FA 1JMVA 3OZGA 4S3MA 2VK8A 5TARA 5IZ4A 5J2TA 4MIKA 1UOOA 1AUOA 4FFRA 4DV2B 5HSGA 1CZHA 4MGHA 1D5WA 3OFSA 1S02A 3EOAI 1FVHA 4HFMA 4WBNF 5KOHA 2P5YA 3RSQA 4D8XA 4GMGA 2C5BA 4ZI7A 3Q7IA 2W2LD 4TQAA 3PXBA 1KAOA 3V4VB 4D96A 1ZGJA 2O2GA 1MRSA 3HJAA 1UDAA 2E21A 2JA1A 5M2QA 3EA4A 4MV8A 5C8XA 1S7GA 1CCWA 4G0WA 3FTEA 1KAHA 4RK7A 3ESXA 3FYCA 4J3JA 3C87A 4PC7A 5JSKA 3A1SA 3W6UA 2P62A 3DP7A 5ICEA 1W48A 2V6FA 3CNEA 4Q6WA 3SJUA 3UFXA 4ENWA 3VJLA 1G7RA 1L5LA 4PNHA 3EQ8A 4R7GA 1BCSA 5TB5A 1D0IA 3IUPA 4WLUA 1N75A 1R9NA 3GRZA 4FT2A 1XNHA 4GKKB 2AMYA 4M76B 4ZDKA 2Z8XA 2G63A 4NZOA 3K9QO 4K7JA 2X6QA 1I0ZA 4HDOB 4WA8A 1V8DA 2QYTA 4R1NA 4RNCA 4B3IA 3AJEA 4C3VA 2HSDA 1XK6A 4QTXA 4H1HA 3DDWA 3ORRA 4BVBA 1IUPA 2VRCA 2ZSDA 1SC9A 3FGNA 1JJAA 3VZQA 3TZEA 5H70A 3ENWA 1I2ZA 3EXFA 1YI0A 5CYFA 1RQ7A 2BFEA 3RIMA 1JIXA 4OQEA 1NR1A 1AKQA 1U80A 1ZQ1A 2BISA 4RVHA 4PNEA 4UE3S 2JK1A 3ZU3A 4TL7A 1OXTA 1JDBB 1TD9A 3UWDA 1OYWA 4OQPA 4I3FA 4H0CA 1W4LA 4IOKA 5TGTA 1U0LA 3K9NA 2GJAA 5H3HA 4B75A 5C8DA 3A58B 3LY7A 1BE8A 1Q12A 4AICA 5FYQA 1W5BA 2IEBA 2G7MC 4EK9A 5FXMA 1XI2A 4Q4CA 3NBYC 4XYEA 3ER8A 2ZJFA 1D4ZA 4WLEA 2LKDA 3HCCA 1WL8A 2V98A 1MOSA 2YIJA 1SBCA 1MIOB 3PDUA 2W2VA 3M0EA 3ZYCA 1R3UA 4RKWA 3C3CA 2Q28A 5G53C 3ZV4A 2QG6A 3PRHA 2UYQA 7GPBA 4V38A 1CC1S 2ZYDA 4QPDA 1CIJA 2M32A 1C9MA 3N59A 2CHVA 2E4VA 4OYRA 3N1UA 4MP6A 4FMBB 1DIRA 1JR3A 1M8KA 1RXYA 2BBOA 1DC7A 2ZJ7A 3OC6A 2Z4TA 4KRGA 4YMSA 5DO9A 1JE0A 3H84A 2L19A 4JIGA 3IV6A 4QFDA 4GBED 4ZJYA 5LOVF 4DA6A 1CQZA 2D7JA 2WD7A 1E7YA 1SVNA 4Z53A 3MINA 2QNRA 4YV2A 2BHSA 4Q01A 2O7NA 1SZDA 4FLFA 4J0HA 4TXMA 1AKWA 3PCTA 3ZBQA 1ONNA 4BKRA 4ZYXA 4IQ0A 4KVGA 1GPBA 4DDKA 4F85A 3AI3A 3AHDA 4RPLA 5JY1A 4R3NA 2XYGA 2PLAA 2YRFA 3KKQA 3U48A 3CNLA 3PPVA 1ZA1A 4DJFC 5JHHB 2YIVX 3GARA 1TVMA 2C2YA 4BHTA 3T1TA 1NBMA 4TKUB 1JG2A 1X8LA 4U39A 1E2QA 4NARA 2DETA 3UB3A 3N74A 5F3RA 4B3MB 4DQXA 3AEUB 4AMVA 1QRSA 4Q0MA 4DHWA 4QQNA 1SEVA 4OX9Y 1FYXA 3FVTA 3CVWA 1DKNA 2X2EA 1GRRA 3OCYA 4FBGA 2GYYA 4JC8A 2BFFA 3EDMA 2XHZA 4IXDA 3KAJA 2DPLA 4BC1A 1PJSA 1EX9A 3RFCA 2EBWA 4RQTA 5CT6A 3WL5A 5HP4A 4H77A 1YIOA 1D04A 1DKPA 4HNTA 4O2RA 2CV0A 4MAAA 1RC8A 1JDUA 4NFHA 3T7IA 4NYJQ 5HBRA 2FUKA 4EJFA 4DUZB 1G21E 2V5AA 4UCXA 3MGCA 4Y3UA 1P61B 3IP7A 3PEFA 1TTQB 1VHTA 3R7WA 2IHVA 3SDZA 1TLFA 1NDUA 3F1LA 4UU8A 4G4SP 5C8YB 4C7OA 1T9GR 3UIEA 3NHFA 2CD9A 1OHHA 3HB9A 4U1RA 3TLGA 4IZOA 2QMHA 3DLBA 2RHOA 2JFBA 4WOPA 4RFSB 4EHIA 4KIUA 4K3VA 5EXSA 3DT9A 2X6RA 3ZHBA 4TV9B 4X20B 5FWNA 3LT1A 2CF5A 4HRAA 4PLCA 3W3AA 3S5UA 1SIWA 3ER6A 5EQJB 2R60A 5CLQA 2IY9A 1B8VA 3DDHA 4Y1FA 2GS9A 5ARDA 2YVKA 3ANSA 1UODA 5AVWA 4LS3A 3C45A 3EVAA 4FYIA 1UXGA 4K8OA 1OXKB 3NWBA 1SWWA 3CUVA 3DC2A 2ZB4A 2P9HA 3FMFA 3HB5X 1M9NA 1VJGA 1SB9A 2OXRA 5ESXA 3LK6A 1R10A 4DDWA 3KLMX 2X0FA 4Y0VA 1GAWA 3JX9A 2WQ6A 4ENPA 1IN1A 1I4EB 3ZIUA 2GM3A 3ZWPA 1GRQA 5F2EA 4BCCA 3LF2A 3AR2A 2E4YA 3L6EA 3UAXA 1W52X 2QUKA 4LJ8A 2XKKA 3HI4A 4Y9SA 1FP6A 2PNJA 4JLPA 3K1TA 1TGVA 2W6OA 3VOAA 1EHYA 3CFYA 1WF6A 3OOWA 4PLWA 4B7AA 2HJSA 4G36A 5KNCH 1B1AA 2J9RA 3VDQA 5FTJA 3HJCA 4D44A 1WDMA 4Z1OA 4RE6A 3P94A 3TTYA 5L95A 2XVAA 3VHXB 2BDEA 2DWOA 1SY7A 1IWPB 1QFXA 2FWPA 2VH2A 5HKKD 1QOQB 3HXKA 1PS0A 3HDTA 3ILXA 1B8NA 3L1KA 2RB5A 3OA2A 4KMOA 2P9EA 5CT9A 5G3YA 4ZVTA 1OVGA 4IJWA 3TLGB 3VYVA 2CDNA 3AEXA 3V1TC 2WILA 1N34B 5IEBA 1PJRA 2WMYA 1N92A 3WDSA 1WCYA 1XVLA 2PMEA 4ZK2A 1US8A 4B31A 3OUTA 2V4UA 2WWHA 5IJ9B 2Y8EA 2RHGB<