2C34A

Leishmania mexicana icp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
116
structure length
116
Chain Sequence
GSHMIAPLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWTRVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYVVLVKPRKRGHHTLELVYTRPFEGIKPENERYTLHLNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Leishmania Mexicana Icp Provides Evidence for Convergent Evolution of Cysteine Peptidase Inhibitors.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Inhibitor
molecule keywords INHIBITOR OF CYSTEINE PEPTIDASES
total genus 10
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c34A00
2FO8A 2H7WA 2NQDA 2OULB 3E1ZA 2NNRA 3PNRB 3CBKB 2WGNB 3M86A 3M88A 2C34A 3CBJB
chains in the Genus database with same CATH superfamily
4LSDA 4CC4A 3GSWB 5C0JA 3HC0A 3B9EA 4XPTL 1NCNA 1PG7W 4F7KA 2J5WA 4G6MH 2Y36H 5INDA 3INUH 3B6SB 3GHPA 4ZD3L 1DQQA 2CIIB 4FRWA 2VAAB 4Y19E 1I9RH 1E2ZA 2B3RA 5CJBA 4BBWA 4K3DL 4LLDB 5T3XE 3OZKA 3Q2WA 1CURA 3A4AA 5HHPB 1ZXKA 2WQ8A 1MQKH 3HHRB 5SWSE 3WE6B 3L3JA 1CF1A 3EFFB 4R7NB 4R4ND 4QRRA 3WJMB 2EVIA 4O9HL 1NBVH 1CE6B 4PM1A 1LK2B 2OTWB 3NSXA 4JY5L 2JK5B 5FYJH 3SBRA 3IRZA 3MU3A 1T3FA 3FOMB 4KV5F 2OXHA 2XG5A 4PVBA 5EUOE 4B0MB 4M61A 2XTSA 3TC9A 3DYPA 4NZJA 5D55A 1QNZH 4WFGE 3DX3A 5DSCA 1DSFH 4DW2L 1IL1A 1K4CA 2I26N 4R26L 1MCEA 3RKDC 1OOAA 2EAEA 3OKKB 1BF8A 1FFRA 3ROLA 2Z8RA 2L7JA 1LK3L 1XGTB 4GKOA 5KSAA 3DRQB 4ORZC 4FMVA 3X13B 1CGSH 3VFPB 1BIIB 1QFWH 5CZVL 4FHJA 4RRPA 2W9DH 1HOCB 2YN5A 5HGDA 4PS8A 4DUVA 1SY6L 1A0QH 1IAIM 2X44D 1JTPA 4PRPA 5LG6A 4JM4H 3SO3C 4DETA 3B2VH 1J12A 1AKJD 2J73A 3GXFA 4P2CG 3DBXA 2IBBA 2R39A 3FQXB 3EHBB 3OQRA 4DHLA 3NBNA 2FZ3B 4NBXB 4UAOC 5E1QA 4JFEB 1N5YL 2G3NA 4PEEA 1AQKL 5CSBA 1JD7A 1VHPA 4M02A 4KKNA 3UG4A 3F7YA 3P3TA 2CCLA 1BBJA 1LO3H 4JO3L 4OFYA 5IW6A 3FUFA 2O6EA 3CXHJ 3NZSA 3BVWA 4KXDA 3KMDA 1NBVL 1C8PA 4LF3B 3EJZC 3QWQB 2WINB 4ERSH 1WFNA 3CFBB 5EOTA 4JY5H 3UPCA 4FXGA 1URLA 2H26A 3OJVC 4WFGD 3CSTA 4ABVA 5IMLA 2XA8L 3U4BL 4AXWA 1ZOXA 1I7UA 1F6FB 2DKUA 1T5WA 4MJJA 2FQDA 4JDZB 3LQAH 4XP9L 3TNNA 1KELH 5EORL 3OMNB 2V3FA 5DK0A 4JFFB 3O6FB 1ILUA 3KXFE 4Y88A 2CHZA 2GEEA 3OX8A 1YY9C 3K4DA 3WTSA 1W8EA 2R0ZH 1U2YA 4NNPH 1N7ML 4CMHC 2DQFB 2XWTA 4M7ZC 4PN6A 3L3OB 1X9LA 4ZUVB 4LU5H 4MHHI 5M7QA 3QP3A 5DD5H 1A5FH 4MCYB 3LD8B 3NSDA 3DECA 2CALA 1TEFA 4CVWA 1J11A 1CYGA 2ATKA 2XIDA 4I3SL 3GKWL 1XGTA 2JJWA 2OBGA 3HR5A 5DJ2A 2EVFA 4O51B 3VXSD 4NJ9L 5KSBB 1YPZF 2WNGA 1W8NA 5C0BA 3V7AG 3VGBA 1QW8A 1ZTXH 3OG6B 2A9BA 4NQEB 4DKTA 5KYXA 5HHQB 3UAEA 3GBMH 1MCFA 1MJUH 4NKIL 1ZCRA 2A9CA 3M1CA 4L37B 2VR8A 2Z91A 4Y5YB 2FTAA 3NG5A 1HN1A 1HS6A 4JGNA 1J87A 4RFNC 3KWUA 4I85A 2SEBB 3BX7C 2K7QA 5D6DA 2YA1A 2YBRA 4JFQA 4XCCH 3L16A 4G8AC 4M62L 4X50A 3QRBA 2V9RA 3I9AA 4G9FE 4HKJA 4IJTA 4L4JA 2FRGP 2GJZB 4DGUA 1UD8A 2OMVB 4JM2C 2BS9A 2QJDA 1CDCA 1JF1B 3GZQA 1ICTA 3F7QA 4XVOA 4TF4A 1BZQK 5AYQA 4TVPL 3CH1B 4W70A 4ZO9A 3DX9A 5CD5C 1NSNH 3OLGA 1SXAA 1N9PA 1RZGB 2FB4H 2EDXA 4X8CA 4WWKA 4HS8H 1F4YL 1IT9H 3EG9A 3QORC 4I5BB 2WN2A 4LL4A 5FUZH 2AK4B 1CDUA 4QYAA 2YJQA 3DUUB 4U1NA 3TJHC 4AQAA 5HYIA 4RH4A 2QDWA 2I7OA 4GO8A 5JO5B 5JHDB 5I1IL 4TSAL 1I1YB 3FRPG 3MJWA 4FQXC 2Z31B 2ICWJ 5F96H 1OQOA 4S1SH 1QR4A 2QPUA 2Y7SA 3GD1C 1XGUB 4N90D 4XPHH 3P02A 4NZRL 1PYWB 3D0VB 2IANB 1CFMA 2FATL 2EABA 2IGLA 4MNQD 2J1XA 5GS0H 1B90A 1IC5L 1WCQA 3WBDA 1WWAX 2YQ3A 3KG5A 1DLHA 4JRYD 2MNUA 2Z31A 2V2XA 2HLAA 5IMKA 4Y5YA 3QDGB 2BH0A 1WITA 2J8UB 3D4ZA 1F56A 3L9RA 5J11B 2AHIA 3IKCB 3WXWH 3CVCA 3ZHLA 3AT0A 5K9QI 3VXUD 1BX2B 2DM4A 5D93C 5D70L 3T0EC 4RRPM 4XBGB 1AZBA 3GYRA 4LEXH 4WNSA 3DPBA 2GG1A 5ISZA 1S4IA 2CKBA 4HIIA 5CUSH 3LIUA 1MLBB 3N1FC 1OO2A 5F89B 3RE0A 2R2BB 1S2EA 1NSNL 3J8F7 3TBWA 5I9QC 3KW7A 1ZA3A 3KPPB 2AS5M 4L4VD 1B3IA 2OSLA 2HPOA 1N59A 3CDYA 4PJGA 4DP6X 2VH5H 2EXYC 4X9BA 2HVJA 1KXTA 2KZWA 3BKMH 4N9GB 1F3JB 1JZFA 5FUOH 1F90L 3L3KA 3HE6D 3AREA 1UXSA 1DEEA 1BOGA 2WLNA 2MIZA 2XWEA 2XG4B 5GGQL 3HUJA 3PV7A 5B8CC 4N0CC 2ZP9A 3C2AH 1U8NB 3KWVA 2GY7B 1LEIB 5CINH 3IWUA 4JDTH 1T1WB 2ZONA 5EOCL 4OLWL 4YDIL 5IVZB 3LS4H 4UM9D 5J1TC 1NAMH 2JKIS 3ARVA 3BW9B 1N64H 5K1NA 1QPPA 2X9XA 3D3VD 4DQAA 3CUPB 5JORB 2A9NL 3RWEB 1IIKA 1ND0A 4IRJD 1QSEE 4Z7UA 5GGTL 3GSVB 4J3WA 5FS5A 4PV1C 4QRTB 5HHXH 5F1KC 1A6AA 4AC2A 2A9DA 4LP4A 1OK0A 2X89A 4EI5C 3GRBA 3TBTA 1HZHH 1IZKA 3OHXB 2Y9RT 1QEWB 4U1GB 1EHAA 1QFUL 4TNWK 3QUMH 3BH8A 5CN2A 5DMIH 1IBGL 1DFXA 4KHXH 2EIDA 3BKYH 5EOQL 5AAWC 1N19A 3AUVA 4XP1L 5D5ME 2NSXA 1LNUA 5ES4B 1KJ3H 1OCRB 3OAYK 4ZS6D 5GGRA 1RIVH 2CK0L 1IX2A 4LAJH 5DEGA 3WG7B 3DHJA 3GRWL 3VQ1C 1VFUA 3VFPA 4N6RB 3SY0A 1I1AA 4H2AA 1M71A 3GIZH 4I13B 3ECUA 3KVPA 3WIIH 3B1UA 5CILH 4U1KB 4Z7OF 4ANWA 5B3JE 3LRSA 3ZHDA 1JGLL 3O3AB 3ARFC 4Z8FH 3QYMA 1SXBA 1I4FB 2FX7H 1QQDB 2VSMB 3CLEH 4LBEB 5C09A 1KCVH 2DQTL 4IBSA 3VGAB 1H3VA 4M29A 1T0NA 4ZTOH 4OZ4B 5CKGA 3IU3A 3T0AA 5J1AB 1ED3B 1J18A 3WD5L 3L54A 4FYSA 5MENE 2Y7QB 1VRSA 1BREA 1NFAA 1JZ7A 2ZCKH 5EO1A 1MFCL 1T0MB 3AU1A 1NAKH 5C3LD 3QIUD 4HKZB 2EH7H 1CLZH 2M2DA 2XOTA 4FXGB 5DO8A 4XPAL 4CU7A 1GIGL 1ZS2A 4L8DA 1HDMA 4LLMA 4M6OL 2PW1A 3H9SA 3MCYA 1AKPA 4GRWE 3UYPB 4NI6A 4G8FA 4YVUA 2W94A 2IMMA 2C9VA 2WLLA 4D9LL 5EBWA 2CA4A 2FL5A 2YLHA 3LIZH 1HXMB 1JHKL 3OLIA 4PGJA 5ITFB 1NAMB 2VL5B 5IQ7L 2QADB 2XTJE 2DV6A 1FIEA 1WDAA 3FF7A 4NP4L 3NSCA 4WI3A 3C6LA 3L1FA 5SX5K 4C59B 3HI6H 1XZWA 2LGNA 2CAKA 1CN4A 1F41A 3KPOB 4GMTL 4UM8B 1JWUA 1YEIL 2AF2A 4PJCE 2CXGA 3QHZL 4XAWL 1YPZA 1N4XH 2FIKA 3SZ6A 4GQ9L 3QT2A 2NY5H 2ZUXA 4HWUA 4XRCB 2RA1A 1BBDH 1DDTA 4EN3A 3MV8E 3NOIA 1J9CT 5EZJB 1ETJA 4K9EH 3RVXC 5D71L 1QASA 1MRFH 1WWBX 1UD5A 3K6NA 1SJVA 3CMOL 4PJCB 1XCXA 3L95B 2ICWB 4G7SB 4AJVA 4M62H 4AYFB 5KTEH 4KMTH 4JHWH 3U9PH 2ITDA 3WFBH 1RZIA 1XBRA 3N85H 3CSFA 1OAYH 3OGCA 1JZ3A 3QDJB 4UV7L 4XCNA 5FO9B 3ESNA 4FG6D 1UFGA 3E2HC 4S11A 1AQKH 3HZMB 5EUOB 5I6MA 3SQOL 1I8LA 5F3FA 2XNAB 4FA6A 3C5JA 2R69L 1ACXA 1C1EH 4NUJB 5EZPA 4D0DB 4PGEA 3QORA 5HBBA 1JZ5A 3PDDA 4KROC 3QISA 5IJVA 3QRLA 5TE4H 1NFDB 2J8UE 4PHZA 4NYLA 5JR1L 2FLMA 1AC6A 3ARFD 4NN5C 1CFTB 5BZZA 1QWNA 1YN7A 5D6CB 4KVPA 4X8XA 1RSFA 4YXLH 3BJ91 5C0CE 5IEKB 2YEVB 5AW7B 2GTWA 5IBLC 3RZCA 1JRHH 3O2DA 1HEHC 2EKSA 3L3DB 2YPVH 2XN9A 3H6JA 2R0ZL 3DGDA 1DANT 1GHFH 5DVNA 3WS3A 4Y2DB 1YYCA 4OFQA 1OE1A 3CFMA 3DVGB 4JFEE 2KUTA 1BZOA 2GTWB 2NTFB 4HF5H 1AR1C 2ZF9A 3WN5B 4UZGA 2O5ZL 1S7UB 5IIEA 1UB6A 1F5WA 3IAQA 3MBEC 4FLSA 4JANA 1MJ8H 2BVYA 4Q8BA 3CDFA 4R2GC 2WV3A 1CT8B 4JPQA 4MA3A 3VFNA 1RCYA 4GXUN 5CZXD 1LO4H 4Z7WE 4TUKL 3TZVA 1A1NA 3V95A 3X2QB 3RIAK 2P5PA 4GIOA 3ZXAC 2OR9H 2BERA 2YMTA 1KBVA 2ZWLT 8PAZA 2YBRB 5FCUH 3AQZA 3IK2A 3US9A 2C1OB 3V4PL 3FC8A 2H0JA 5HYEA 2WYIA 4HWEH 3MR9B 3UP6A 1G7JB 4X9FA 1W16A 4G42B 4HHGA 3QUGA 1U8HB 4DKEL 1LWHA 5BMFH 1AZVA 4YBLC 5IFJB 1XSJA 4M9OA 3S34H 5LDSA 4LEEA 3TN0C 5I18L 3VFOB 5HHVH 4J23A 2XRAH 3CLFH 3GFUA 1JVLA 3L2NA 4OCXH 3RDTD 1FSKC 1OAXH 1QSEA 3FQTA 2LU4A 3GMLA 4QOKD 1AZUA 1U8LA 4IIQA 1IAKB 3TEUA 1WZ1H 3LAFA 2DYPA 3KLDA 4RA0C 4C4BA 3NCJL 2OW7A 1MHCB 5D1XC 2DH2A 3UMTA 2X4RB 2NW2A 3L4VA 4RDQG 3QDHA 4PP2B 5FFLA 3EJZD 1M3IA 5F9DC 2XWTB 4EXPX 3OMAB 4Z7UF 4R6UA 1P7QB 3FAWA 2MOVA 2HKHL 3QCVH 4BCXA 2XN1A 4EEEA 3KNBB 4CNIB 4OAWB 4I18A 1E9QA 1Z9LA 2OYKA 4Y5XA 3SD2A 4HJGB 5DEFA 3UZVB 2NNCA 1S7TA 2W8CA 4XPFL 1QLRB 3T0DA 1UEYA 2OMZA 5L6YH 4N2AA 3IDXH 4ODTH 4QRRB 4GW5B 4MNHB 2XV6B 4JFDB 1KLFB 3ZL4H 3ARDB 1BAFH 3D5OF 2TAAA 1T5XA 1KB5L 3JWNE 3POCA 3PWPD 1AQMA 2CGRH 1QHOA 3Q7JA 3QJZA 2K7PA 2R29L 1T89A 4GOSA 3BPOB 3W1ZA 1JNHB 1XO8A 5I1EH 1BECA 4WI4A 3WXVH 4C83B 2Q3AA 2E7HA 4Z7QE 4HLZG 1V5JA 2HJLB 2WHVA 5FOJA 4K5OA 2F19L 1NCDH 4LAQH 4MJIE 4GLRH 4UQEA 5HVWA 3L1OH 4PY7B 5T3ZE 3T4YB 2LFEA 4IMKA 4PQXA 4HVBA 5IB4B 3FFCA 5ESQB 4B50A 4UNUA 3OV6A 1D7DA 4WUKL 5EIVA 1F8TL 3VD5A 1RPQA 2VMEA 2HA1A 4HS6B 2NW2B 3BUIA 1XZ0B 4G59C 4QAMB 1R5VA 1NCGA 1F3DJ 2P3YA 5GGVH 3WKYA 3ZE0F 1NLDH 5K1VA 3CX5K 1UWGL 2FJFB 4NUMA 1G7MB 2XQBL 4EZMA 5BS0B 4F24A 3SQBA 2F53E 1IBHA 2BP0B 1U3NA 4BRVA 4F9PC 3PQYE 4KRPD 1F11A 5L9DH 3CVDA 4LLYA 1MPAH 3W0WA 5DD6B 3HPLA 4AV0A 5JW4Q 5F8QC 1E5BA 3CN3A 1ZHLA 2V17H 5BUPA 3GMMB 2H26B 2D03H 1JK9B 3NT0A 1ZSDB 2VLLB 5F9OL 3QUKB 5F96L 1E4KC 4AT6B 1PKQA 1UB5B 2F53D 5CFHA 2GC7C 3P0YL 4N26A 1J9SA 3ARBA 1J1PL 3HI1B 4ODBD 4PWJA 4B3VA 3BKJH 3NJFA 3NSFA 3S3JA 3ZDWA 4AL8C 1FGNL 1OPGL 3LN5A 3QH3A 1NFDE 1USZA 4AYSA 3OKNA 3QRFM 1BOGB 1VGEH 1KJ2A 2X4QA 2E7CA 3BAKA 1UZGA 5D1QE 1LE9A 2AXHA 5E9AA 3PAYA 2MPAL 1TZHA 1ET5A 2OMWB 2ADFH 1TLKA 2HUEA 4JO1H 5LN4A 5MP6L 3GMQB 2VZ3A 2X4NB 3ZDZF 2X87A 3U7AA 5GISH 1DBMH 1ZLWH 2DWSA 2IPTH 2BIMA 3H55A 3X11A 2K6ZA 1ZAGA 3B3IB 5GGVL 4U31A 2Y24A 3DOIA 5G4MA 4A63A 3DK0A 1U58B 1NDTA 4KKBD 1TTAA 4WK0B 3SKNA 1Z9NA 3QQ4B 1L3WA 5KG9B 1U0QA 5DRNB 5BZWA 3L5JA 1RZJL 1YNTF 3NIFB 3BPCB 3GMRB 1LQBC 2VW6A 3RGHA 3QUYA 2D4FA 3HN8A 2ADIB 5D5MB 2WBJA 2PKDA 1EV2E 1JF6A 2Q7YB 2WQAA 1THCA 1AO7A 5FKAA 4FP8H 3PCYA 3APCA 5D2LB 3SDDB 2ZPKH 4YL4A 1HNGA 1J1PH 3L5HA 2D73A 4L4TD 3DGGA 3BJLA 4UWQB 5LQBL 1EX0A 3BH9A 4JUTA 4ETQB 4Z23A 2E7BA 3WUZA 1Q94B 3FO2B 4H44C 3H3PL 1GS7A 2B39A 5F88A 1AHWB 1XF5A 1OP3K 5CAYB 3CH1A 3MCKB 2Z8SA 1UATA 4LSSL 2G4GA 5K39A 1UACL 4M6NH 1F6AA 1MFAH 3UFIA 3DMMA 3L4CA 3K80A 2GSIB 4P59H 2FJGA 4NNPL 3ULUH 5IM7A 3SYCA 1KCSH 2ZP0T 5IJDC 1BYOA 4QAWA 5AW6B 3HTLX 3IJEA 4XCEA 2D3JA 3OKMB 4FAAB 1CBVH 4KMTL 3DX1A 3ATFA 4NDMA 2BRQA 1Q4NX 2M26A 3FJTA 1GSMA 4QHUA 5B39G 3TFKD 1E5AA 1ILSA 1Y6KR 2VQ1B 4NQVA 4XMXA 1GY2A 3VWKC 4HJ0C 4X4XA 4NGHL 2AQNA 3GF8A 4F93B 5DD1H 1WBZA 5KBLA 3D4GA 4D0CB 4OI7A 4AEIH 3QPKA 5KYWB 3RZCD 3KBHE 3ZTEA 5LNDA 3QQNA 4JM2B 1QLFA 4YHPA 2IIJA 1RPUA 2V6HA 1GGIH 4AQEB 4IBYA 1J1XL 3R4RA 2J25A 2DQCH 3K81A 4N85A 3GC3A 3B2VL 3HZVA 5F7FA 4Z78A 1BQRA 5JW3L 1A66A 1N2RA 2YXFA 1R5VB 1PX4A 1XGUA 3MV9B 2EADA 3LZQA 1DVSA 3Q43A 4BUQA 3MV8B 4X6CF 2VXSH 4X83A 5E6RB 2XKSA 2GBUA 4XMKH 4AITA 3E1F1 4F33A 4LPVA 3I75A 4DK6A 4U1JB 1E5UI 3UTQA 4NZFA 2ENSA 1H5BA 2B08A 2O5NA 4ISVB 5GIRA 3NYKA 3KZ8A 1PNCA 4FLRA 4ZPVB 1F3JA 4UB0L 3F12B 3H42L 2WTPA 3MREB 5AOLA 4Z7QB 4ZMYA 3W5NA 2VZSA 5EEVA 1X5YA 2EH8H 5CNHA 3TONA 5C2BL 1A21A 2BNQE 3P2TA 1WZAA 1CJYA 1N6VA 4Y5XB 1YEEH 4APQD 5JIMA 3OKMA 4HUWA 3ATBA 4ODSH 3VFSB 1E2WA 1MRCH 1RZQA 1P9MC 5E2UH 4PSPA 5E95B 1FO0A 3MFGB 3BZDA 4BEIA 4K5PA 4QOKA 5E6ID 1DJHA 3BP4B 1CE1H 1YNKL 5CN3A 5TQ0L 3C08H 2DIBA 2NY2B 1IARB 2VDPH 1GY1A 2CCVA 4HBCL 4L9LB 1IFGA 1QD0A 1YEFL 2LLGA 5DUMH 2JQZA 2AEPL 1BBDL 1IAKA 1BAGA 4ANXA 2YC1B 3F04A 5E4AA 2E4FA 2C7UA 4HUNB 3U7YL 5EIIB 4LRIC 3QAQA 3GRWH 3HE7B 4NRZB 4UOQA 4AV4A 1YYLH 2EC9U 4F57H 2Q8AH 1PW3A 4N86A 3KH4A 1GCYA 3HNSL 3QDAA 4L29A 4BHUA 4CNIA 1MRDL 1INQA 1FL6A 4TNEA 4YBQD 3RU8L 4E9QA 1C5DA 1FIGL 5F6IC 2WP3T 5GSRA 5IB1B 5I2IA 2G75A 4FC3E 1QVOB 1R34A 1UD4A 3B8YA 5IB4A 2F74B 2ZQKA 4LOUC 5F7BA 1IM3D 4LKCB 4U6VL 2R4RH 4P5MB 3BQUB 2PYED 4L8SC 1XD0A 3S4SG 2FDBP 3CC5B 5FOBA 3DSFH 1WEJH 4OZ4A 3UACA 5T1DH 1PTZA 2CJ3A 3EOAB 1FVCB 2APVA 1YEDB 2XXFA 3HBGA 4XVTH 5AL0A 4QJ5B 1X5ZA 1WIUA 5CR1A 5KVEH 2QQLL 2WYZA 1TZAA 2YPVL 1TUPA 4AXWB 3ZYOA 2GJRA 4F7TB 3UPRB 3B6SA 1XXDC 4MDRA 2D31B 4AT6A 2ZYHA 4ACTA 2P44B 2HH0L 2NSMA 1KY6A 4QT5B 35C8L 5KSBF 2JFCA 4Y2DD 2EVJA 3QH3B 1QACA 4OBRA 3I9IA 4CVUA 3A4EA 2P5EB 4ODVL 5C0FB 3EYUH 4JFZH 2PCXA 4IKIA 4PG9B 1B9ZA 1BSIA 1DVXA 4F8NA 1KIUA 1M6UA 5GSVB 5IB2A 5IHZA 5TDNB 4KHXL 3FQ1A 1M7UA 5A1AA 4WWKD 5IBTL 3E9TA 1JPSH 3WLBB 1ET7A 4UIMB 4LLYB 3W0WB 4PP2A 3QDJE 1M2VB 2OLDA 2DWTA 2ED8A 4J8RB 1EFXD 2XN0A 1ZS8B 2VJ8A 1DQTA 5I15H 4PY7A 4WTZG 2WGXA 2AERT 3JZ7A 3PABA 4OZGF 4I3RH 4MA7L 5DJZA 3ROLB 4XMKL 2YKLL 5AVQB 2A3TA 3FT2B 4LAQL 2GC4C 3CDZB 2FO1A 3VNYA 4PRIB 1A7OL 3V0WL 4YIQB 2J1YA 5LLIC 1KYDA 4RX4D 5AAWA 4IIZA 1CICB 4L8CB 1Q9OA 4OH2A 1FZMA 1VFBA 4UB0H 4XH2B 2WCSA 5LCVL 5KJRH 3MCG1 1U6AH 4JPVH 3ML9A 4PVLA 4ZRGA 4ZTOL 1KIQA 2YUWA 5F9JA 2HPTA 1UD2A 5FYLL 2NMSA 4A2FA 1KTKE 2Q86A 4APQA 1HYSC 2V4LA 2WOYA 5FA4B 4KV5E 2VMJA 3I6KB 4QYOB 3VQ2C 5L2JB 3VXRE 4DNLA 1F90H 1NC2A 3IT8D 1GOFA 2ZJSH 3BAYA 3S37H 4CC1A 1A9EB 4ZOCA 3E0GA 1HSBA 5C71A 1NGWB 1Q72L 1ZD6A 3HAEB 4D9LH 2NDGA 4FQLH 4IGBC 3WEOA 2L04A 4AV5A 4E0RA 3FU5A 5C0IB 1EPFA 5FCSH 4W4OA 1G87A 4N28A 1MJJB 3VXRD 2GIXA 4BSVB 2ZT9C 4UQ3A 1BEXA 1G9MC 2ZWZA 4K2UH 4NO5A 4ZW5A 1O6VA 2PYFB 4QF1A 3GJEB 3Q9PA 1TJIL 3IJEB 4HIHB 4XCEB 2EEAA 2N4IA 4U6HA 2QSCL 3MV9E 5ITFA 3PDOB 1A6UL 4JW3A 4LCCB 2HX7A 3V6FB 5DRWB 1SUJA 4JZJB 3C8HA 4JNXA 2A6IA 2XIIA 4YGVA 1L9RA 4O4YL 3VGFA 1CDGA 3EYVA 3MLYL 2HXAA 4MAUH 1CFSB 2XICA 2IPTL 1A7OH 2GQHA 5CF3A 4X4XB 4ZFFA 2OR8A 2AQ3A 2PMZA 5KVEE 3PQYB 3GO1H 3LKQA 5D71H 4OSUL 1TQBB 4XMLH 3TVMA 2ZX9A 4Y8AA 5D6CA 2Y6TE 1DN2A 4NQQA 2MCAA 3TTYA 2XXCB 3OGOE 3M1BA 4QI3A 3E1ZA 1T04B 1VSCA 1RU9L 3HS0B 5E7BA 3ZKSD 3DX4A 4MXVF 4XB3A 4HAKA 1MI5A 2AV7A 1J1OL 4GBXB 1BQLH 4H8WH 4U1GC 2B5IB 2WYTA 4HUKB 3CVBA 3IPFA 5DLLA 2IOIA 3AGWA 4WHYG 1I1FB 2GAZA 4F3FB 2R1WA 4KBPA 3IMSA 4RGNE 2UXGA 3LZFL 1SOQA 5D8JH 3D18A 5DRZB 1CXKA 3LEVH 2HT2C 3KPMA 2ZSVB 2C4XA 3HAEA 1FHNA 3UAFA 1QA9B 3UJJL 1BXUA 4PD4J 5IB3A 1MSPA 3BRFA 4AMKH 2HT4D 3O6ML 1A4KA 3FT0A 1FV1B 3IMWA 1CG9A 1XGPA 1YYMH 3D1MC 3JV4A 4M6OH 4ZW7A 3Q2LA 3NA9H 4PREA 3CFUA 2MKLC 4KNQA 6PAZA 5I0VA 4TKWA 3BAEL 2AGJL 4AGMA 2Y6SC 1FG2A 1ZY9A 3BO8A 3HR5B 4JFDE 1CD8A 1OGAE 2XXMB 2IXQB 4JGUA 5DHYA 5IUSA 2LLNA 3LNDA 1O5DT 2VQ1A 2RGSA 3CBKB 2IALA 5I28A 1H6TA 3BD4A 2GJ6D 5JO5A 1KZQA 3BIBX 5D2LE 4BA8A 1VKXB 2BSTA 3O6LH 1YPZB 3O2VL 4OD3L 3O3EB 3BH8B 3BYYA 3BP5A 3N04A 3DXAD 2V2WA 2VZUA 3KL3A 5EOCJ 1CDJA 1FVEB 2FCBA 3BMVA 5F1NB 4LVHC 2X3BA 1KEML 3LCYA 4MJ5B 2JTDA 3NCMA 1GZPB 4GT7A 5DVMA 2XTJB 1F6AB 1H5BC 3LQZA 4U3CA 1WGVA 2VDRL 5BCAA 4MZ2A 5AB0A 3DSFL 4R5TA 4Y19A 3DKHA 4G6KH 4LVEA 1RFDH 2YAOA 4FERA 5B39A 2OK0L 5EC1B 3C60C 4BSWA 2H1LM 2IV9A 4BK5A 1KY7A 5EBGA 4DJMA 1RUPH 4OM1H 5GGTH 3V0JA 4KJYB 5IP4A 2XBDA 3SE9H 2XN9E 1PZSA 4JRWA 4HOMA 1GC1H 1IEAA 2AZUA 4JHUA 3DETC 2VAAA 4FNLH 4K3DH 3GINA 4R83A 5F3BA 5AKRA 1E30A 1N68A 2W92A 3BDBA 3SDDD 1ZLVK 5JIQA 4XP6H 4JKNA 1FFOA 4UTBA 3RVWC 2AKRB 2X6CA 1WZ1L 5L7XH 2ISDA 3KPRE 4JFPB 5IF0B 2VSDA 5FA3B 3GMOB 1JNHA 3LKSB 4J4PC 3T6XA 3S9DB 2WJ7A 4WU7B 4TMPA 1ZWIB 4P5RA 4GRLC 4P2OB 2P47B 4GRWH 4XZUA 5AZEH 1HHIB 4XNBA 1X6NA 1W72B 4DP0X 1FNEB 5HDBB 3UTTA 4Q9QH 4TUOB 5MI0B 3PWLA 2X89D 3TN0D 5JZ7D 2HKAA 3MKGA 4PWKA 3TFBA 2W95A 3HZ3A 3SPJA 4HLEA 3RGVA 1OGTA 3K2IA 4H0HB 1AGDA 5DUML 3WNLA 4O2CA 5KOMC 4AEHL 1GW0A 5JLZB 4C8XA 2R0LH 3GSVA 5CLXA 3R7RA 2ITCA 3NUKA 2CRZA 1NIBA 1BAFL 2YSSA 3PUCA 4JFHD 1QEWA 2R23B 2XI9A 3BXNA 3FSZA 4G9FD 1F4HA 3KWWA 1GXEA 2VXVL 1W2KT 1CYXA 1YECL 1IM3B 4FLQA 4NX0A 4I2XA 1MFCH 4DZBB 1TTBA 1BVKB 4P23C 4CL7A 1N67A 1OGAA 3NJJA 4HZLB 3NJMA 2DD8L 2FIRT 4D8OA 4EKXA 4KH9A 3DNKA 2W9LA 1Q9LB 1PCXA 4W9CC 4N9GA 5FIEA 4R2GD 4NOFA 1I8IB 3TOPA 4QXTA 4ZNEE 3DYMA 4L4VA 1FO0B 3MVSA 2IH8A 4PVMA 2YOCA 4NNXA 4PW3A 3V5KB 4LHUB 4ODWA 4K3EL 3NK3A 4QEGA 4Z3GA 4BKLA 5I1JL 3VU1A 1C7TA 2MQCA 2VDKL 1ML0A 4GUOA 3ZDXF 5JIDA 2JLPA 5CCKL 1T20A 1QQDA 4RWYH 1GS6X 1TOXA 1MLBA 5A2JH 3QNZA 2NTSP 3O4OB 4ZFQA 5ICUA 4ZD3H 3AS2A 1X44A 5CLYA 5BS0D 5D1ZD 1KGXA 4IRSB 1JWMA 1H3WM 2Y7NA 3JV6B 5IR1B 2J2ZB 3WMQA 4LHJB 5EPMA 4AW4A 1K3IA 3B5GA 3C5SB 3MRCB 4WO4B 2GITA 2VITA 3G04A 3R0NA 3N1PC 4MDJA 1UD3A 4OZFG 1FWXA 2KQNA 3DOSA 5IVXB 4ZFOB 5I2IB 5E8OB 1LMIA 3NGBB 2DQFA 2AC0A 5DK2A 5E4EB 4WW1A 3QI9A 5J6SA 3S37X 3LEYH 3O2WL 4EI5D 4F2ME 4GPVA 4GY4A 5B1JC 1QYGL 5TDNA 2HKHH 2XVLA 3FO9A 4RWHA 4DPRA 1GTFA 3FU6A 1FFPB 1ZV9A 3D4CA 3GMNA 5KBKA 5IMKB 3K6DA 4UUJB 3JYCA 1G6RA 1JGDB 3P11H 3V5DA 2A77H 3U83A 1F4WH 1FSKB 1Z5LA 1ASPA 5E5UB 4BKSC 2MNWA 3CVIH 1ADQL 4DO6A 5LWYL 1HKFA 2MQ0A 4PJ7F 4YHLL 4JFDA 4GKNA 3LMJH 1D5IL 4MD4A 3ZUNC 5D1XB 3ZDYB 1OSYA 3BUBA 4MRCA 3ZDYF 1F42A 4U33A 5I18H 3BN3B 3MA7B 1RFDL 1TFPA 5E2TH 5CZVH 3ZVVA 1T03H 2V37A 4GKSB 3TA3C 3BT2H 5JDSA 3WEMA 2VDRB 3QQ3A 1A0QL 4LFHG 5I30L 3LH9A 3ME0A 4N1EA 3LZFH 2Q6WB 3TF7C 5FPIA 2H5UA 2NQ3A 3H3BC 3M1OA 4R4FH 5J6GB 4AGPA 3J07A 3SDAA 5F0LB 4PWIA 3JV0A 4Z3FA 3ES6A 4WFED 2ENQA 5ESVA 4LPCA 5I8EA 4LRNH 4JY4B 4LRIA 3G6AB 3MROA 2JJUA 2GUOA 4MSWB 5LBSA 2RR3A 2VRQA 4LF3A 4E9LA 3KYKH 5FO9A 1NJ9B 1EFXA 5IJBC 4OU3A 3EHBD 3HLAB 4XGZA 1QBBA 1DVFA 1P7KA 2WZAA 2YGPA 3ALWA 1F3DH 4OFPA 1JFQH 4PJCF 4N2EA 1I3UA 1N0LB 4KFZC 4YO0A 3TIDA 5ICYA 3QJFB 3MV11 2LVCA 2WBWB 3CPLA 2IANE 4J28A 4ZK8A 5JW5B 2KC0A 1M2OA 3JWNC 4JMXA 1FBIH 1TVDA 1QLEB 5B7MA 3P4MA 3QFJD 4ZMWA 5AWNL 3I6LD 2VLJA 1DJIA 2LV4A 1DVFB 1P7KB 1U91B 2W65A 3ZTNH 3JT2A 4LFHD 5AW4B 4OLEA 3ZZQA 4YFLF 1J5CA 2UVFA 1U3HA 2GSMB 3QIBA 3RVTD 3ULVF 3WMPA 1D9KC 4O00A 3ZIMA 4IEFB 3WS6C 4DOHB 4JRYE 1I3GH 1CGYA 1S8DA 2ILLA 4JFYB 4YXLL 1DEDA 1I1CA 2DWDB 2OJZH 2B1AL 3VWKB 4ZFGH 2CKBL 2RFXB 2O72A 3QZOA 1S9KC 4R97B 3S6CA 4E42A 1N6QH 5INDB 2D9QB 5E6IA 2N1KA 3C5XA 1PQZB 4PJ9A 4YHZH 2G2RB 4AZUA 2RIKA 3S2AA 1V05A 3IFPA 5D7JA 5DJYB 3AT8A 1FAIL 2VKWA 3QO1B 4QRQB 5K9KA 2WBKA 4YSDA 4BINA 4BQBA 4BZ2A 1BQLL 4H8WL 3N9GH 1EXHA 4Q4EA 1R3LA 3EYQD 4N90E 1N18A 2P8MA 5LBSH 2F53A 2WNWA 3F01A 1PQZA 4PJ9B 5FW7A 3U2JA 3OC8A 4JFXA 3TASA 2NZ1A 3V0IA 4ENZA 1EQWA 5I0ZA 2ZXCA 2VMFA 1T7YA 4GRLA 2UZXA 1ZHBA 3ARXA 4N0FA 4PJ8D 1A1OB 3GM8A 1V7ML 1FORL 1PSKH 1RLBA 5LAXA 2MKWA 5JW4R 1YN7B 3Q6FA 5AWNH 3VGDA 3ULSB 2W60A 1CI5A 4IGBD 5DD0H 3FTUA 1CFSA 1CDYA 4BH7B 3QYNA 4HUUA 3NCFB 4Z7VA 2QKSA 3VD7A 3RA7H 4JKPH 2CHWA 5JHLH 1NBQA 3C5ZD 1G7QB 5KSAD 4Y5XC 2V5YA 1MWAH 1COBA 5IW3A 4MQSB 1IRAY 1KCKA 1T2JA 1WO2A 4NUJA 4D0DA 3FFCD 3OC5A 3IDMA 4PTTB 1TNNA 4X7TA 2VB5A 1Z9MA 3CFCL 4X2UA 3RILA 1UGNA 3KBEA 4AVIA 4EPSA 2UXTA 4Q0XH 3VWJB 3IAGC 1PX3A 4Y4FB 1U4FA 4CADA 3HPJB 2V0AA 1URIA 1DBKH 3IDYC 4FX5A 3TBYA 4M5SA 3UBXB 3QXUA 5D96C 5EU4B 5ACZB 1I9IH 5DEZA 4PRPE 1WP6A 4XMVA 1ACZA 3UIZA 3HE7C 1X6LA 2GW5A 3PWJB 5I5IA 2F7RA 2Y7MA 5IK3A 3BGAA 4ZDHA 4UNIA 4RFEB 1TO5A 4RBPH 2CBQA 2P28B 4XNUH 1ECZA 5HGGS 4NZDA 3RKPA 3KW8A 1MLCA 5FGCE 4LQ1A 1YQ2A 5E0FA 5L2KD 3VACA 1RUAL 1HL4A 4MQTB 4CN6A 5FWQA 1K3ZA 3MRGA 4J3OD 3DX6B 4GRLB 4P2OC 4CSPA 2JIXA 4ONGH 5J57B 3TIEA 4N3UA 1JI1A 2XT1B 3D25B 2QR0B 4G8GE 3H0TB 4DWHA 3MUZ1 1NCCH 3AREC 5G2NA 1QRKA 1I1FA 2GAZB 2R56L 3RWIA 1KENH 5KAQF 4X7SH 1B0WA 4GRWF 1QWUA 4IBUA 3BWZA 4HDIA 2Z92B 5J3HD 4JY6B 3KPLA 4PRHB 1UENA 4K7PH 5C08D 3RNQA 4Z7IA 2RACA 1EJOL 4G8GB 4HAGA 1RD6A 2IV8A 3RWIB 2KQMA 5AOMA 3KPQB 1Z9PA 3PAZA 4FQQA 1N0LA 2A1WH 1D5ZA 2MHAB 1RVFL 5IOKA 3QFDA 3QI9D 5C8JB 4DFHA 4WUUE 4XZUB 1SZNA 1FVEA 4G2AA 2CIKA 2X2IA 1OPGH 3GDBA 4HIJB 5ESQA 3T0EA 2VITB 3IAPA 2ARJA 2X6UA 2YPLB 1BQSA 3U7YH 1AXTL 1R4XA 2EXYD 4S2SB 1JWSB 3V5HB 2DBLH 3VM5A 5C0CD 5LVEA 2MQGA 5E9NA 4YLBA 2FEDD 5K9QG 1IC5H 5DWUH 2NY7L 2HTKC 4M1GH 3EAKA 3UCQA 5HHOA 4H13C 1JSYA 3MOAL 3D50A 1OOWA 3WOVA 3BVNA 1R3HB 1WD9A 4KTDL 3VI3A 4X4MA 1HE7A 5IESL 4Q7DA 5CZRA 5DJ8B 5BJTA 4WU5B 3OMZA 3O4OC 1MCSA 4RAUA 5I71C 5D1XA 4K8RL 4LKCA 3AS1A 1ZLUH 2B20A 4TUUA 3FSOA 1I3RA 3KGRA 2WXJA 3QJVB 5ENWA 5IBTH 1U92B 4X42A 2J57A 4ELMA 2AVGA 2YZ8A 1L6XA 1RZGA 1UQSB 4OZGB 4Y2OB 4LGPB 1E7VA 4LCWD 4RSYA 3DJSA 4K5NA 3CHPA 2W38A 3NIDB 3RPBA 1MY5A 4NSKB 1ZHKA 4EUPA 3NZ8B 3GBLA 3KE0A 2KBGA 1YNLL 2P80A 4ZFZA 4PWEA 4DT2A 4ONOA 3ECBA 4HJJH 4JRYB 1A2YB 5HY9A 2F7PA 2AITA 5CJOL 3D4YA 3T71A 1MIEH 1HHHB 2G9HA 4V2BA 5T1KB 4BKTC 1WC7A 3MRRB 3SGJA 1AGCB 4R96B 1RUMH 1D5MB 1F45A 1ZIBA 2YXWA 3RY6A 3KPSA 4R0LB 4QLRA 3KYOA 5AUMB 4TQHA 1XXFC 2CBMA 3IJYA 2WZ0A 5IKCA 3EJYD 2A6IB 4GUCA 3F85A 4ORGA 3W39A 4L3AA 1NPUA 1EMTL 3QQ9C 1AIZA 3ULVH 1JYNA 1GGTA 1UT2A 5CIPH 1CO1A 3EIFA 2QQQA 3U6XA 8CGTA 5HVGB 3EGSA 3Q5TA 3RL2B 4JQVC 5KUKA 2APFA 2EILB 3HMXH 2Q2EB 2ZOKA 3NTCL 4Q4IA 3FQYA 3PXHA 4P9MH 1LJMA 4TXVB 1IEHA 3BDYL 1CG9B 1XGPB 4IEFA 5CM1A 5DLMH 3CX5J 4UDUA 4F2FA 3RWJB 1LL1A 3PG2A 5EU6B 3SDCA 1MG3C 1P2CB 3DVIA 3P0VH 2VIRA 4QTIL 1QSFA 1GZHC 1JGIA 4CSZA 1P1VA 3JSSA 4KKAC 1I9JL 2AEIT 4EUPH 1CS6A 1S9WB 3MC0A 2QPFA 4MYWB 1JBJA 3FH8A 4R4BB 2HTKD 1U33A 1IGFH 4I0KA 3ML8A 3C08L 3QDGD 3US1A 3V6OE 4Z8FL 1NINA 4XO3A 2JF1A 2F5AH 1UOWA 3IBEA 2DLFL 3QNXA 4DQOL 5JYLA 4G7RB 1LK3H 2FWOA 2QGCA 1NCAH 4UOW0 5M95B 2XQYG 4GBXC 4AL8L 4BWTA 5IREA 4K7FB 1GJUA 4XOEA 2YEZB 2X6MA 5T1DL 1M7IB 2AJVL 5F7MC 1PZ5A 1IVTA 1S7WA 4MSWA 3ARRA 2C3WA 3KPSB 4R0LA 3SGDH 3IMBA 3SQOH 5DZAA 5DFWH 1M05B 4G6JL 2FEJA 4FI6A 2GBVA 3QIWA 3KPSD 4UUJA 2FR4A 5GSRB 5IB1A 5JIKA 1S7SA 4XHJC 1CK0H 4Z7UE 1U30A 1AANA 4RETB 4NWTL 3QA3A 1LO2L 3SE9L 2IAMA 2WUCL 3MXVL 1QR1A 1BJ1H 1R1CA 4HK0A 3HBZA 3ETTA 2QSVA 3A23A 3ET9F 5CKAA 2H0PA 2KPWA 5KJ4A 1YEHH 1SQMA 3S88L 4LVOC 2VQTA 5HDBE 4Q6IC 3KLLA 4K7PX 2ICCA 4MJ2A 1J1XH 4QNPF 3SOTA 1NC2B 2IWKA 4P2YA 4OLWH 5CEZH 4Y1AB 1WT5A 3LPFA 2PXYA 2CR0A 4LPUA 1MCWW 4ZG1A 2QADD 3IYLW 1JGDA 1FL3A 2PWFA 1CB4A 1CICC 4A7QA 3R7QA 4YE0A 1L5GA 3PS6A 5AVYB 1KLUB 2Q2LA 3UTSA 5HJGA 5AALA 1HH9B 3P30H 4NPYA 5F97E 5LNGA 1AAJA 1LEKA 3QCUL 3UGUA 4GRWB 1ACYH 1NMCC 1TZ8A 3QUML 1MHHB 3GSXA 3ABMB 2FBRA 3FQ2A 1MHEB 1IBYA 4AZ8A 2HAZA 1OT1A 1U8OA 1U8IA 4D0CA 4Z7VE 5CEYB 3RB5A 4UT7L 2G3ZA 4FDWA 4U0RC 3EJYC 4XN8A 5IWLC 5MEOB 3QWOB 1U58A 1UA6L 5T33L 3LSOB 4DVRL 3L4ZA 3HN3A 3O6MH 3WJJA 1PLCA 3AXHA 3ARQA 3HS8A 2A6JB 4NQTA 5L88L 2XKNA 3C5ZB 4GUPB 1GGUA 3DROB 3MYJB 3GWJA 3I9PA 3DXAB 3TNNB 2Y2WA 1CBVL 2BY0A 2ESVA 3DTDA 2BY1A 3MRFB 4CMHB 3O6FD 5JPMA 1B2WH 4GSDH 4OZFH 2NCMA 4TYUA 3VMPA 2J6EL 1IAII 2BNRB 1JYVA 4UDTB 4KKQA 2DQMA 1QPXA 1EGJL 4Z0XB 5F70A 1JK8A 3EYFA 5IW6B 5D7LE 3RJQB 4ONFH 2NY6B 3HC4H 4R5XA 3IFLL 2OTPA 4Y4KD 4LESA 4HJ0D 4HWZA 4KK6D 1AD9B 3FCTA 4MMZA 1K2DA 2WY3B 4P06A 1ZSDA 3OXSA 3AREB 1D5BA 3KEHA 3RPIB 3SN6N 1DQDL 1WHPA 4I77H 2EO9A 4PPTA 1JUFA 4TUJA 2BIPA 1TG8A 4HXAL 1AD0A 2GABA 4G9FA 3UZVA 4A7VA 5GRVK 3LPWA 3QZWB 1NCUA 4LLWA 4PJXB 4ZPVA 2V7NB 1AMXA 2I25N 3B9AA 5GRXG 1MCNA 5MHSE 3EYSL 3CVHL 4XXWA 3G7TA 4CBZA 4XO8A 2G9KA 2NUPB 4MVBC 1RXLA 1AJ7H 4FABH 4BD4A 1IJNA 2Z7ZA 1TVHB 4RA3A 4P23B 4EOWL 3SBWA 1CPUA 2V8MA 4J4PA 4BQCA 5GGSB 3RL1B 1DVUA 3NJKA 4ODXA 1FZKB 4N0UA 2AXWA 1R24A 3GXPA 3KCPA 5FO7B 3DX8A 4FZEH 1WSST 2CJSA 3TO4D 1NIFA 2CHXA 4J7RA 3ULUD 4JY6A 2NY3D 5EG6C 4NNYA 3MRKA 2HJLA 2KMWA 2N01B 4HAFA 3SD5A 3VO0A 1P84K 1OEZW 3ZHNA 1P84J 4NQCB 3HG0A 3D85A 1IU1A 1T2XA 1E0OB 2EXWC 5DVPA 3ZKQD 3WJLC 3MBWA 5BRZA 1S7SB 5AZEL 4DKEH 2AJZB 1BD2A 1NKRA 5E1HB 2NY1B 4QRSA 1HNYA 5T1LA 2EIZB 3VXUB 3CZLA 1QFHA 4AW7A 4PJ7E 4OZFB 4X6BA 5I6XB 4N4YB 1IQDB 3NZHL 1EK3A 4V1DD 4M93C 4X6EB 3QZPA 1U3HC 1A3ZA 2H3NA 3QIBC 5JOEA 4GRLD 4MYPA 1M42A 1T83C 3DV6B 3O4LE 5HYSB 3TS8A 1FFTB 1AIFB 1A1NB 3FQUB 2OSXA 5ADOH 4TUJB 1E4HA 3V0WH 4G9DB 3QULA 3HZKA 4DP4X 4LSVL 4PJBF 3UJJH 2Z31D 1NDMA 5F1IA 4E5XA 3IGKA 1TETH 3DHUA 5FOBB 1UB6B 2BOCB 1ID5I 1MNUL 2ID5A 5AVUB 1KJMA 1SN0A 5SWZE 2A9AA 4QCIA 4OD2A 1PG7H 2H3XC 4M5YH 4JDTL 3HHMA 3QZBA 1BFSA 1HHKA 4R0LC 5I9QB 5I0DA 1WFJA 3RY4A 2GKIA 2WXLA 4NQDB 4JFVA 5DUPL 1INQB 3RQ3A 2A74A 1WBZB 1KXVC 1TQCC 5CEXB 2NYYC 2AFNA 2XX1A 2X0WA 3TIDB 5ICYB 3CG8A 1G9NH 5C9KA 4PI2A 3DARA 3D3VE 3PAUA 4JM2A 3GZOA 3MBXH 1U8NA 2BNQD 2CMRL 4XCYA 2OCFD 2IWGA 4K7PY 2H2SC 1A7BA 3FFCB 3KPRA 4YNYB 1KPVA 2GITB 2IH1B 3U48A 4JDVB 1JDDA 3W11D 3SDCB 4K5MA 3MJ9L 1BZDA 2H2PC 5KG9A 3KM1A 3KYMA 4B95C 5C09D 3J7HA 5E1IA 5DVKA 1KTRL 2VLRA 5DJ6A 5FYKH 2NW3A 3FQRA 5F9WC 1NLDL 4FNRA 3JVFC 1JF5A 3GXMA 2WSKA 4QHKI 5EZOL 4LCIL 3GJFA 1OM9A 3OKOA 3WFDH 1FP5A 4RVBA 3HZKB 3S8WA 3N91A 4LSTH 4FMKA 2KL6A 2YD7A 3VD2A 2QV2A 4PJDA 1P6FA 2JB5L 3ZGIA 1PKQB 1UB5A 2HLEB 4NHCH 3E80A 3TH3T 3IJSA 4MJIB 4WV1B 3S3CB 4ZX6A 1KGWA 1XR9B 2E74C 1N3NB 4FQIH 1FRGL 4Z76B 4PP1D 3I6KA 1WZMA 1RZKC 4QYOA 4CW1B 2OMZB 4NEHB 2R1XA 1HHHA 2G9HB 4Y16A 5I82A 3R8BB 5IEKA 5AL8A 2BSRB 2XHNA 1YEFH 2K9UA 2HVKA 4B5EA 3TO2A 3LRGA 2BNRE 2NXZC 4IDJL 3AFLA 3KEDA 1NAMA 3E7JA 3IGFA 5E08H 3FW6A 3SDXB 1E4XH 4JE4B 2R1XB 2VUKA 4XX5A 2YOAA 3H2QA 3HC2A 1JHLL 3NFPA 1PNDA 1FZJA 4JX0A 3LZLA 5ABZA 2I9LA 5E94A 2VLME 4FFWC 1NFIA 5D1ZA 5J89A 1G9NC 4X6CB 5TQ2L 4L5FH 3SDXF 3ZOAA 5GGUB 4YDNA 5IMOB 1XQ4A 5DO2D 1DUYA 3IN0A 2Y25A 1GZQA 5SWZA 3BIKA 5E4EC 4ZUUB 2VMCA 2YBGA 1RIUH 4LSRL 1U93B 3FN3A 3TXAA 4PJFB 1OAUH 1SN2A 5CGBA 3G6JA 4N2CA 3L4WA 5HYJE 4N9OB 4ZUTB 4DN4L 2XZAL 4N22A 2ICWA 1B3JA 1KEGL 4NM4H 3V4PB 1YLBB 1XGRB 2FX7L 3BUYA 3HKZA 4XP4H 5KS9E 1ZPUA 3HB3B 4FQIL 4IMKC 3V0DA 2H2SD 4EIBA 2WBJC 1ONQA 5K9JL 1JP5A 3MZGB 3NEXA 2NZIA 4U1JA 3I74A 2Z8WC 3V9CA 3BZEB 4MASA 3HNSH 1ZHLB 2D7TL 2NNFA 5BZXA 2FE0A 3TA3B 4Y7MA 2X28A 3UEQA 4OLXL 3BGFC 4QTHA 3Q06A 3EBIA 3RHWF 3GLEA 3L1GA 1C08A 3HVNA 5D1QA 1IAOB 1TTRA 2WTRB 4JJHA 1MVFA 5C7ZA 2V7HB 2Y1ZA 4MMXA 1G6VK 3T09A 4P9ML 4UT6H 4OJFL 5HI4D 3QVAA 1A9VA 1SLVA 2E27L 3S8GB 1Z2KA 3WNNA 4ZQTA 3ZDZE 1NGXB 4EZKA 3ZKXB 4P4RB 2YMXL 1IFHL 3FQWB 1PFOA 4HHAA 3RI5K 3ZN6A 4UNTA 4U1LB 5INCB 4MAZA 2XVBA 3AY4C 5IQMA 3IXTA 4ZQKB 3A3YB 4ZO6A 1J8KA 3FB5A 4OZGE 4X6DF 2X1PA 4ZAKA 3FU7B 1SYSA 5DMGC 3S7GA 1SJMA 3FT3B 4S1SL 5F7UA 3NN8A 4P2QD 3ZTDC 3O8XA 2DTMH 4GQ9H 4HJ1A 5DFVC 1KCUH 2ZWNA 5F7YC 3EYQC 4CN4A 1V3KA 1UHVA 1J8HA 1WK0A 1BVNP 2R0LL 3AU0A 3PREA 4AG4L 4NYLB 4PVNA 2V8LA 1AP2B 3MUY1 3T4YA 4FQXA 3CMOH 4NKMB 2QHRH 4PYHA 3NIFF 1G6RL 4AEIL 1MREL 4ZZKA 3QG7H 4WLCA 1IZJA 4BZ1A 4WEEA 1HSAB 1D9KB 3PRZA 3N41B 1U3ZA 1A6WL 4OD3H 1P1ZB 3B3BA 5AAPA 5H35A 3T6QC 4AIZA 5C0AB 1XF2B 1HL5A 2B9BA 2UZXB 2EZ0C 3SCMD 3UJIH 3VSVA 4ZO8A 4J3UA 4PV8B 3MLWH 4QJ3B 2WAQA 4DP5X 4ACPA 2IQAA 2MSPA 1KIPA 3GMPA 1Z9SB 3B1TA 4MNHA 3IE9A 4X99A 4JANB 4N0CD 3ZIYA 4M4PA 1MNUH 5KVDH 3VA6A 3NVQA 1G7QA 4PJBA 4OKVA 1HEZB 3D85D 2E46A 3D2UA 3VXSA 4LPYA 2TRHA 1BWMA 4ZJ9A 3QQDB 4WWOA 1MCHA 3MUUA 3IVKA 2FBJH 1H6EA 3HFMH 3PJSA 3NJIA 4FQ1L 1DQLL 3UEZA 1PYWA 5L4FA 3DXAE 1ZTXE 1T1ZA 2VXUH 2AAVA 4YHIB 3RJDA 2IALB 1PD6A 2EIZA 3MFFB 2OM5A 4ZW3A 4P0DA 5FR3A 1MHCA 4BELD 3MNZB 1P9MA 2WUBH 4QMEA 4OCNC 2BC4B 4PJ8A 2EO1A 1DBKL 1II4E 3BFOA 4ES8A 1U3HB 3L3HB 3QIBB 4OZHF 1U8HA 2A6DB 5ID0A 3L4UA 5L2KB 3L4XA 3JBG7 3RNQB 4QDGA 1YZZA 3ILPB 4OGQC 1ES0A 3V10A 2V9UA 3TN0B 4RESB 4TULL 3FUMA 3LN9A 4LKXB 3WIFA 3C6SB 1HJBC 4YOKA 4NIKB 3UZQB 4G70B 3F83A 4MMZB 3LKRA 3BLBA 4OCLC 4F7EB 5A2LH 4HJUA 2BFGA 4RGNB 4WVRA 3FB7A 3T6WA 3TZVB 4P2RB 5C07E 4EIUA 1KJMB 2OTUA 1GPOH 5AOKA 2WXKA 5DEGB 3N43B 4ODUA 3CFEA 2FLRT 1QSFE 1YHPA 12E8L 5F93C 3K6IA 3PL6A 4JFFE 2X3CA 1OQXA 4D3CL 1EHLL 5EOCH 2R56H 3SJVD 3HZYA 3LIZA 1HHJA 1JV2B 4X5WB 1X7QA 2NX5D 3U4AA 4E2OA 1TR7A 3IDIB 5K59E 3FCTB 1LP9A 2DJUA 3SJVB 1J9RA 3EJUA 1IUZA 4DO4A 5LHDA 1A4JA 3Q48A 3L5IA 2WC7A 1KYFA 1HKLH 1ROWA 2Q76B 1J0KA 2XYBA 1QZNA 1MEXH 1E8YA 5E1AB 1RZKL 1TIUA 1FQ9C 1EFXB 5JHDA 1YQVH 3DJZA 5IKCB 4WAFA 3QJHB 4P46B 2G3MA 1JZ4A 4OM0L 1UXSB 1F1DA 4B27A 2CBTA 3FQWA 2D0GA 6FABH 3AADB 3D3VA 1O7VA 2QFRA 1TJXA 3OAWA 3ZDXE 1HE8A 3EYOA 3MMEB 3PDOA 2VO8A 4LCCA 2BP0A 1VEPA 1LEGB 4PUBH 3WMSA 4WHTA 3S0PA 3BD5A 1VZIA 1UURA 2P5ED 3K6FA 4GG8B 5E2WH 4YSQA 2VL5A 5E99L 1JFHA 2B7DT 1DZ0A 3HNVL 5BO0D 4LLVB 3TV3H 4U1MB 3ARSA 2APBA 3ENEA 1AGEB 4ODTL 3MODL 1J0ZA 1IAIL 1KN4H 4AKPA 1FGVL 2UZIL 5FO2A 4XOAA 4NO0D 2DL2A 2VIRB 4F5CA 3P77B 3V2AR 4QGTA 4YAQB 1Q0EA 1I3RB 1M53A 3GTNA 1DQKA 1KT2A 4Z7NB 1UA6H 5T33H 2WKLA 4AZ8B 4QRPB 5E2JA 3T0EE 2HRPL 4ZI8A 5TGBA 2VR6A 3V79C 5BV7C 2Z4QB 2WCGA 1OCWH 1D7BA 1N59B 5DJYA 3MPCA 5C0CA 4R90L 4AQZA 1NMBH 3DV4A 2AJVH 2IBZY 1N5YH 3T3PB 1FYTA 4N1HB 1CD0A 4NO2A 4PSRA 5D7LB 2FYYB 2AJSL 3CC5A 3DLQR 2VABB 2H4EA 4KKCC 1FHGA 1HILB 3ZKMC 3GUTA 1EUTA 2FB4L 1DDHA 4YEEA 5GZOD 3VI3E 4PJ5D 4OZIE 3P4LA 3C5SA 1B2YA 1J0IA 4WO4A 4X6CA 4YHML 5I30H 4GBXD 4JFUA 4W9GC 4AIOA 3KPRD 4RMUA 2CJUH 2FX9H 3EFOA 4BGLA 5IUCA 1F4YH 1HIML 1MI5E 1KTLB 4YX2H 2X6BA 3WKPA 2DWEB 4Q9RL 5KSVA 2QQKL 2YD5A 5T3XD 2DQIH 1B6UA 1TYEB 3S35L 3MUJA 3G5XA 1ZPLA 5F7DB 4ABQA 1CFTA 4LOEA 2DN7A 3ABZA 3O8XC 2AXGB 2LT9A 3P11L 1KGUA 1KXQA 1QATA 3X1EA 4TNFA 5L0QB 3Q01A 5FYJL 1AGDB 1G1YA 2DTML 1NCBL 2FL5B 1Y18B 1TQUA 2AANA 2VWEE 4GG6A 5BOPA 4P2AA 3BSZH 1MAML 1H15B 4EKJA 3RWJA 4KK8C 1WUZA 4FXKA 2BPBA 3G08A 1KYUA 5D2NA 4AUJA 1NQBA 1RZ7H 3QB7C 4MWFA 3L5WB 1R3LB 1Z0NA 1NIAA 3NCXA 1OWRM 1ROCA 3AG1B 3LRSB 1MN4A 4MMXC 5FUZL 2WWMC 4MD5A 5EZLB 2FJUB 2ZUQC 3D39D 3DBXB 4S0TD 5DC9B 1F4XL 4NJAL 3WAJA 1SLXA 1YMMD 4WK2B 5E8NA 3VTTA 4E42B 5D1ZI 4L3FA 2F5AL 1IGJB 4MTMA 3T2OA 3U0WH 1BZ8A 1T6BX 2EYTB 5EUOF 4JO4L 2P7TA 3FCBA 1VFMA 5JXEC 2HYMA 3ZKXC 3FOLA 4JM2D 5JUEH 3ULUE 2WZPD 4AH2A 3FUHA 3IXTB 5FM5M 2BXZA 5EC1A 4BSWB 2MEJB 4JO2H 1MH5B 1RERA 2R69A 5M94B 3BWUC 4MBRA 3JWDH 3TPUA 4H8WC 2QBWA 2E9BA 3EJPA 4V2CB 1DJXA 1SXZA 1RJLA 1N10A 5MEPA 3HB3D 4G71B 2AJ3B 3JZYA 4AOFA 3DXAA 2VO5A 2Q8BL 1XAKA 5KEZA 2I5YL 3OZLA 1S5IL 5SWZD 4NQEA 3BPLB 5JYMA 3FQ4A 5TFSL 4JQIH 5F7WC 1NIEA 1K85A 1YN6A 4MAYB 4GW1A 3FTWA 1EERB 4BUHA 5EIQA 4KXCA 3MSPA 3SGEI 2B77A 1A22B 5TTRA 4CKQA 3I84A 4AL8H 1L7TL 4OT1L 2YUZA 4XPBL 2OW6A 1CVRA 3HG2A 5JIHA 3FZUD 3SPVB 4IDJH 3HMWL 3X3FH 1DJYA 5I0WA 1KFGA 2O1AA 5CSZB 2G2RA 4Y16D 4YZWA 2QSTA 3KNBA 3CFQA 2XSKA 3Q1EA 2DEWX 4GAJH 4I89A 3GZPA 4HC1L 1XWVA 4HWEL 4A7GF 2KDGA 3BIKB 4ZUUA 2MCG1 1LGVA 3C9NB 3BKCH 4BFNA 3O6KH 2YD1A 4FKEA 5HYSA 4H1LG 4AYBA 1BX2A 4TV3A 1G4RA 2VOTA 2XZCL 3VXQA 2SEBA 3OAYH 1QSVA 3ARGD 3OL2A 3UTTB 2CG9X 3A47A 5IHWA 2GTQA 4U1HB 4KK8D 4UOJA 1O6SA 2DDQH 1RAMA 4RZCA 3TCTA 3BCDA 1AXSB 4IBTA 2A83A 3MRIB 4M93B 2FYYA 2O6CA 2ZE0A 2H7WA 1G43A 43CAB 2XPGA 1UM4L 3PNRB 4HUUB 4YVNA 3EUUA 2FWSA 2IANA 2ZCKL 3FK3A 5EBMA 4ZXBD 3VX0A 1M9WA 4HS3B 2N7AA 3BQVA 4LMQE 3KAAA 4XPAH 1O6SB 3NSJA 3TWCH 2UVEA 3WSQH 2VLJE 4XGZB 4YDLB 4AYDC 2Y3AA 3UYPA 4L9LC 4AJ0A 3WEBA 2N7BA 2AK4A 5EPMB 2XZQL 3V52L 5C9JB 4Z18A 5LNEA 1FNEA 3ZK0A 1EEZB 1VACA 4JREC 2FQFA 3DUHA 4P23A 4I8DA 2VN4A 2GYSA 4P5KA 1HHGA 1I9RL 4NC2B 1FNGB 3PY9A 4WFFE 3V7AE 3VG0H 2P45B 2DQUH 4TLSA 1WBXB 2GCYA 1D6EA 1KBGL 2VZVA 3OAUH 1TZGH 4NRXA 4UIKH 4OZIA 3WYRA 5T3ZH 3GSRB 4KKLD 3ZTJG 2B2XL 2X6AA 1E28B 2NNRA 4F92B 2HTLD 4TULH 3Q5OA 5BUAA 1AG0A 2NYKA 2QKIA 4MWFB 3ELQA 4H2CA 4MJ6A 3RGVC 1S7XB 2FUQA 3BP5B 4HHWA 3QS3A 1GIGH 1TQCB 4OZIB 1ZV5A 4XP1H 2E86A 4XMPL 7TAAA 3DURA 3NPSC 1RMFL 4GXVL 5CHNB 1MFMA 2VM9A 1SXCA 3DX6A 5HDRA 4LE8A 1A4AA 2VCOA 3I2CH 4Y7OC 3GLZA 2WVVA 1QI4A 1OP5K 2LU7A 4XI5D 2QMKA 4BV1A 3AGVA 1EEYA 4JGMA 5CP3A 1NBYB 4X7SL 3MZTA 1JPGB 2YRPA 4RX4A 1GGYA 5C7XH 1BWWA 4Y9CA 1RJZA 4QRTA 3GTTA 1S5IH 2KLTA 3C5JB 2R9HD 3X13A 3EO0A 4Z5RB 4IKLA 3C5ZA 1PS3A 4UQ3B 1WA0X 2C1PB 4PBDA 2BVEA 5L4MA 1P5VB 5I19H 1YMHA 2BDNH 2F54A 1E4KA 2WXMA 3ARBC 3G04B 1IB5A 1XFPA 2B4CC 2C9UA 2CUMA 3IN2A 3OAZH 2NY1D 3G9AB 1R75A 4TLTA 4TVPH 2WTOA 3EH1A 1DANU 1MEXL 4IRJB 3N3EA 3VD4A 3LIZL 3QQ3B 1AS7A 3OPZL 4LEOB 1FVDB 2X7LB 4MS6A 1MCJA 1H9VA 5JA8B 3HC3L 5L7XL 2OXGA 4ANVA 2QVTA 2DLHA 3ZQXA 5J6GA 1N64L 4O2EB 5F1SA 5JQIB 1QRNE 2JB6B 5L4IA 2FX8L 1CXLA 2WCPA 4PLKC 4PYGA 1AD9A 1FORH 4TRPH 1JPFA 4FTVB 1SVBA 4LSUH 4JCMA 4NNXB 4X5PA 4KQ4H 3ZR6A 1AHWA 1XF5B 4HFUL 1S8DB 4A2DA 3DBSA 4K23L 4J2XA 2Y69B 3I9GL 2FZ3A 3L3JB 3MTXA 1DVTA 4WI0A 3F7KA 4X7DC 3BCFA 5IGXH 5DT1L 5BRQA 5GS0L 5JXEA 4G43B 1BMZA 1RK1B 2YK1L 4Q56A 4OLYH 3ZZLA 1MJ7L 1U8JB 1IGYA 1BBJB 3WNKA 4O02A 3DX2A 3QO1A 4B7LA 3B9KB 1OAZL 3K74B 2E9WA 3LHPL 1XD1A 1KTCA 2W9EH 4NN7B 3EHBC 5GGSA 3RL1A 1QKZL 3DSNB 4HOWA 3T1FB 2ZG3A 4PRPD 1MIEL 3MJ8A 2YAMA 5K33A 4LRNL 4IMLB 2P52A 4PY8J 3GUTB 1NGWA 3FO0H 4HALA 4X80L 1M57B 4FNPA 1OT2A 4WQOA 3DRQA 1Z3GL 3TYFB 5HGBA 4NRYA 2ATPB 4MJ4A 2BSDA 4P4RA 5L9DL 1OF2B 4PWHA 1QVOA 4C56D 4ZUVA 5D7SH 4ANKA 4JKPL 4LCCC 2ALAA 3LKOA 4CILA 4M3KB 4JN2B 5HDOA 3BC9A 1S9YB 1ZE3H 3RX8A 4Z3JA 5IQOA 3BIAX 5DDHA 2VW4A 3NP4A 5EZLA 1XCQB 1BMWA 2AABL 2Y4SA 3ZTNL 4HK3N 3WO3B 4UMSA 1AJ7L 2N1TE 4PGDA 2BNUB 1RHHB 3Q2CA 3QCVL 3EFDH 3R8QA 1FBIL 2BIQA 4P3WA 4S1DD 5G4NA 5CBAB 4LL9A 4K94C 1JK8B 3G5YB 1X4ZA 4MA8L 3V8OA 4PGBA 4WTWA 2YN3A 3MOAH 2PYEA 1KCBA 5FYKD 4HS8L 3NABL 2W0FB 4MJIA 4WV1A 1NGQL 4OJYA 3UBXG 4LASL 1WGOA 1UXLA 1MW1A 2ZUWA 4TNVK 3BWUF 3UAJC 3ES6B 1QLRA 3HS0C 2VXTH 1RP9A 4DUWA 4DTGL 4BCZA 3EJQA 4L1SA 2D3LA 4A68A 3Q05A 3T0VA 3GEFA 5E99H 3CFTA 2B5IC 2AV1B 4E9YA 5J9PA 1AR1D 3T6VA 2B0SH 3PPEA 5A6IA 1R3KA 3PWLB 1I7TA 3QUMA 2PW2B 1FC1A 1PY9A 3LSOA 3JT0A 5D1QC 3CZNA 4I1NB 3B34A 1KJ3L 2CE6A 1JGVL 2DYPD 1F2QA 4DKAA 4H1LB 3PFUA 1T6WA 3TO4A 2GBAA 1WCBB 4ZMQA 4FABL 4N1CA 1GA2A 1JGEA 2DI7A 4KDTA 1FYTB 4ADIA 1PAMA 2DIJA 5ERWB 3O0RH 4PJ6A 2VRKA 3QEQB 4KU1A 5HDLA 1O7DE 5EF2A 4YUEL 4U2ZA 3CGTA 4LBAA 5GZNA 1OP9A 1HAWA 3T3ME 3WO4B 1RZFH 5IFJA 1QSZA 3S36H 3BO8B 4NKDA 4KC3B 2QL1A 2VZ1A 3UERA 2ENJA 2PCFB 3CN0A 4MQXC 1I8IA 3MREA 3SZKC 1BZ7A 1AQDB 5AW5B 4S1DC 2ATKB 2NY5C 1SJEB 3CCHA 4GI9A 1ZGLP 1A6ZB 2JJSC 2PYEB 5FUCC 1PZCA 2WXGA 2CPUA 1Z0MA 1E3FA 3QDGA 3D09A 1IGJA 5MEQB 3JYBA 3KWWB 1RZIB 2V2WB 1S7VB 2IGTA 5ESAA 2Y3NA 4RSVA 2B16A 2Q7AA 4XC3L 1TTUA 4OF3A 4I18B 1D6VL 2JKTM 4UOW1 5HYJB 4EO5A 1XVSA 4OCSH 2O6PA 4OF8A 1I9JH 1QFWM 2CGZA 5KVEL 2XA8H 2FNWA 1Q90A 4PS4H 5K59F 3BGMA 2VJ0A 2Y06L 2WMPA 1Z32X 2IXQA 2P42B 4FFVD 3MLRH 2G0KA 4U1NB 4MD0B 2BIHA 4QO1B 4FJZA 2R7EA 3QR0A 4U6YB 4AEEA 1D3CA 2IFFL 4UBDC 2YA2A 3TEYA 3T0EB 3GGWA 4X9YA 3L17A 2OL3L 3O81A 5DSCB 2CM5A 4IDLA 1A25A 5HHNB 1EO5A 1HI6A 1JHLH 2RH0A 3DRTB 5KTEL 1D2PA 2OMXB 4EI6A 1S9VB 5DD3H 3VXRA 2K45A 4G6JH 5TDOA 2NYYD 1J8SA 2CDFA 2VDOH 5IZ7A 3P9LB 5EH1A 3U30C 4HX1B 4PJFF 4E9WA 1T1XB 4L3EE 5AW0B 3SCMC 4G5ZH 1HSAA 5MI0C 4FKHA 3FSVA 1YSOA 1U36A 4G6AD 1P6AB 2AMGA 3WEXA 4I1RA 5DI8B 4EIZC 5HYSG 3T8VA 1OARL 4XBEL 2BRRH 4GBXA 1CF8H 4YPGA 4J39A 2CDFB 1UVQB 4ICXA 3BAJA 3V4PA 1NCJA 3FRUB 1AFVL 4WDIA 4E5XB 2R1WB 2IDFA 3OKLB 1FNSH 1WBXA 2GCYB 2JKSA 2CJUL 4NT6B 4WTZA 2CRMA 3MN8A 3TESA 5I17A 4LLUA 4DTGH 4FNLL 3I6GA 3GPSA 1DQVA 3OQ3B 3KL5A 5DTFA 1Z3RA 3EADA 4KWUA 2YPVA 4IOIA 1C5BL 4JPWH 2IGFL 1WVZA 5FLVA 5EFIA 1U95A 4MZ3A 3BDYH 3CZFA 3UGXA 1NMAH 4DN3H 1R19A 2CNYA 1D5MA 3QRGL 3RUGF 5A7EA 5JIIA 4FFTA 3GIVA 3MFFA 4Y4HB 4F7MB 2AXGA 2H6OA 4FQQB 4UT9H 5DRXA 1ZVNA 1A9BA 4P99A 1J9TA 1BXAA 5AVTB 2XIBA 4EUPB 4L1TA 2UYLB 4RCAA 4G6FB 1E3XA 2CO2A 1EO7A 2HT4C 5LGHH 3OLDA 2XXGA 1FGVH 2UZIH 1P5UA 3KS0J 4HKXB 2XZCH 1SHMA 4L2YA 2Y07L 1CD1B 3KLAB 5JW3H 2PW1B 1OARH 2BWIA 3M7OA 3C8DA 5IHZB 3ULUC 3UX9B 3JV6A 2PTUA 4X5QA 4DK3A 4KXBA 1OALA 3TLRA 4NPJA 2UXFA 4EDXA 4OZFA 4X6BB 1FZOB 2OTUB 2NY4C 2VC2L 3Q6GH 3T4AB 1HYRC 4FQXB 4NKMA 3LEXB 3FHEA 4ZX3A 3LS5L 2FSEB 4K3JL 3VXPA 5C0DA 1EFQA 1EGJH 4BFRA 1DTUA 2AP2A 4FI8A 1AGBB 2O5YL 3O3AA 5DZVA 2X70B 5D9SA 5DTFB 1F11B 1UXMA 2OSYA 3GLAA 5DS2A 5D2NB 4FS0A 2FQEA 1MQ8A 4UAOB 2JXMA 4CC0A 2XFGB 1WH0A 5I73C 1C8QA 1IC7L 4Y1AD 4DZ8B 4P2RD 5D7IA 1PJ9A 3CVHA 3ILQD 1U3HD 3QIBD 3VI4A 5IBUB 2QQKH 1HNFA 3K72B 3U25A 5CINL 4PLJC 5AW2B 2J6WA 2ATPA 2D7OA 4P59L 5GJSL 3ULUL 1H6FA 3QQDA 3WLWC 3M46A 1IAOA 3F6IA 1C12B 5KSVB 1W0WB 3ALXA 4GP4B 4TQEL 1MCIA 3VRIA 1WJ3A 3PUUA 5IFHL 1AACA 1EZVY 3GEWB 3VB9A 4H8PA 2JVUA 4W9EC 1NC4A 4V1DB 3ZRCC 1EANA 3APMA 4ZFGL 1CXEA 3CPUA 4UAHA 4M8QA 3UBHA 2BSRA 2WB7A 1EGJA 2D8KA 3IE4A 3AQYA 3BKYL 5EOQH 4L4VE 1ZK5A 1NTDA 2ZXGA 2NXYB 5AB2A 4J2QA 4LIQH 2AEQL 1QRNB 5AYTA 4BFOA 3AACA 1IBGH 5A6LA 2JIXD 4OZHE 4KHTL 3R0MA 3ESOA 2VDNH 3GBNH 3CVHH 2CRYA 2HB0A 3L08A 1XF4A 4G6FD 3EOBB 2V3EA 3U6RB 3BPLC 4CVZB 5F6HI 4NN5B 4FQ1H 2QPDB 1RH8A 4F15B 2ORBL 4BFIA 1OD7A 4U6TA 5AVZB 2H2PD 3MR9A 1ZLWK 2OP4H 5I6OA 1EHLH 4PUBL 2P5WA 4KK6C 2AABH 3I50L 3MLZL 5E2WL 4ADGA 4ISVA 5GIRB 1GKEA 1TQWA 4Y0GA 3RBGA 2OMTA 5KZCB 3RWFA 4X6DE 4E9RA 1IGML 3QGVA 5D72L 4Z3IA 2NCEA 1EUUA 2YWYA 4MX7B 3TT3L 4NKOB 5GRWA 2AW2A 5A3IC 4B9CA 3ZLQC 3BFWA 3TEWA 2VN7A 4P3DB 2YWZA 1OM3L 2IMNA 1IEBB 3ISYA 1SRDA 2YPKB 3QIWD 4RGMB 5DZPA 2OFQA 4IRZH 3REWB 4X6FA 3FHQA 4NFDA 5DK2B 3VTAA 5C0BB 1PEZA 3AS3A 2B14A 1YJDL 2WQVA 2Z1KA 3D3VB 1KPUB 1C7SA 4ABUA 2WO3B 1T1ZB 3KJ4C 2Y5QA 3WFEL 5I15L 4J3OG 1F86A 2D7NA 3U1QA 1JNLL 2VLJD 2QLVB 5E56A 4OBSA 5CD3A 5DJXB 1UYWH 3HG4A 5T3XL 4J8RA 2RMNA 3WU1A 3JTTA 4XNZC 3VI4E 2LU3A 1TETL 5KBNC 2I5YH 5BW7C 3MGOB 3DURB 4UILH 1DVFD 4I18C 2K8QA 2DYRB 5IOPB 3EF7A 2MTAA 2JWYA 4DGYH 1GYVA 3IJHB 1FFNB 2FATH 4UBDD 3B2MA 5H2BA 4A39A 5JDSB 5KBPA 4UYPA 4QNPE 3RFZA 4TTDC 5HGHA 3RHWK 4FFVC 3WFCL 3FB7B 4PR5B 3TJEH 1E8XA 4KY1L 3SDYH 3H7BA 3IS1X 5BO1H 2PPFA 4OCRH 1HJCA 3IFLH 5A16A 3CFEB 2VLKD 2MCMA 2LVEA 3CJJA 5FA4A 2EDMA 3HBQA 3RTQD 1A7PH 3UTZB 4PCTA 3U46A 5BJTB 4FJ6A 3FO2A 4YEFA 4EN3D 4JKWA 3RGBA 3P40A 4DEWA 1K72A 1ZV2A 3EOAA 4N2IA 3ZZSA 3QUHA 1FYTE 2IDQA 2EVHA 4XO4A 2GI0A 2ADJB 3K72A 1XGQA 1YUHA 4M7ZB 1G84A 3U46B 5F71A 1KTLA 2H8PB 3RGVB 3OZ9L 3EO1A 3LRHA 5KW9L 2PXYC 5A2FA 5HJDA 3V8CA 1I8LC 4LSUL 4KKCD 2GHWB 1KB5A 4PCYA 1G94A 2VN3A 2O4EA 1AXSA 4PRNA 2P5WE 4XVSL 2C8NA 4JQXA 3NRFA 1I7ZB 4H1LH 1A2YA 2J72A 3UDWA 3AJ7A 3MRMA 2BW5A 3ELAT 4IKKA 3OJDA 4W81A 3POHA 3AAZB 1HWHB 4DF9A 2YAFA 1VPOH 4JHAH 3CFDA 4NQSA 4UQBA 1Q72H 1QPKA 5CMAB 3CHXA 4TSBH 4Y9FA 4K73A 1EAJA 2R27A 3PU7A 4K07A 4UOZA 3W39B 3F12A 4N2BA 4P2QE 3RBSA 5A3ID 1D5BB 3RPIA 5C9JA 1L9OA 2WVSA 3MJ7B 4KKAD 3O11B 1JCKA 1ZANH 1EEUA 4KAQL 2G5BA 1GJIA 2VM3A 5F8RC 5ICZA 3BUYB 4NJAH 5C2UB 5E5MB 4JG1L 1X9UA 5IB5A 3OAUL 1PZ3A 1JPFB 4F37K 1I8AA 2X4UA 3ZO9A 4CMMA 2OR9L 1A9BB 4HWBL 4GSDL 4POZD 1USQA 3GHEH 3ABGA 2HFFB 4XPBH 5AOJA 5JPNA 4BYHA 2JKNA 1JL8A 3Q8CA 1FL5A 5IV2B 5FYKE 4LSTL 3GSQB 4RFOH 4RMQA 2LAGB 5EB9A 1J88A 1JZIA 4MDJB 3FO1B 3QORB 3NFNA 5KANI 5D7IF 5FO7A 3DX8B 1HQRB 1IGCL 2WKOA 1CL7I 4O9HH 2CDEB 5EZIH 3BPNC 5EHFA 3KCWA 4QHLA 1MFNA 4XCYB 2NR6D 4CJ1A 1KZYA 3BP7A 2OMWA 5J6HB 4GP5B 5PCYA 2FWOB 5C2BH 4E41E 3BEVB 4K94H 1EXUB 2CDEA 1SMOA 3MLVL 2QVKA 3BEWB 4NQDD 3GSNL 5IB2B 2QQNL 25C8H 5E8EA 3QI9C 1MFAL 1KBGH 3FOMA 2BY2A 4RMTA 4KKPA 4IS6A 1QBML 4M1GL 4X4KA 7PCYA 1UVQA 4KNTA 3EOYG 3ARFA 1E4WL 4O58L 4RAVA 4YQXL 1JNNL 2J43A 1VGKB 2B0SL 3ROOA 3AC0A 3VYOA 3CUPA 5JORA 2NRDA 1BVLA 2EDWA 2VLLA 5AYUH 5T1KD 4NPYB 4BZ1L 3N1QC 4KI5F 4XN1A 5JXAH 2CKNA 4OGAD 2BM3A 3P4OB 2Z7WA 3APDA 5TK2A 3PL6D 4JE0A 5AKVA 3TEXA 1KC5H 3N50A 3OR7B 1ULVA 2XBTA 3PP4L 1L6PA 2VDKH 2AJXH 4F1SA 3B2XA 3ISWA 4QRFA 2FJFA 4Z1PA 4KTGA 3LB6C 4JQIL 1OLLA 4B7IA 3DUSA 3EH2A 3K6OA 2MCPL 3GIVB 2HUHA 1RUPL 2Y23A 3CHOA 3IF1A 5H37H 2GFBB 1HXYB 4E41D 3WFHA 1K9TA 4LP8A 5I6PA 3DMMB 3WIHA 1GC1L 5E6IC 1OSPL 4XMTA 5LKNA 4BA0A 3LZNA 1HQRA 2DI8A 2FHCA 2XKNB 2NLJB 4YSAA 3BZFB 3CFJB 3DIFA 3D0AA 3HRZC 4HQQH 4AE0A 1AGCA 5D7SL 4D2NA 4DFIA 3KR3H 3VI4B 2VDQL 4APQC 3WS6A 3GM0A 3H8NA 1BJ8A 4I9XA 4QHMA 4RGOH 1INEL 2PO6B 1N2RB 1V3LA 1YG9A 2JI3A 5AW3B 5ADPL 1IGTB 1U8IB 4FTVD 3DHPA 1DBAH 3EO1B 3A24A 4X0NA 2P8LB 1NFDA 3MRJA 1QMUA 4PG2A 3IMVA 5KS9A 4PMFA 2APTA 1VF5C 2D7QA 3D6GA 2WXQA 4JR9H 3UL4A 5TPWH 3VRJA 4OIBA 4ZTPL 3UO8B 1JXFA 2C26A 3T8XA 2IBZX 5C0DB 2OV0A 2RALA 3CN2A 1PG7L 2HRHA 1SOXA 3DWTA 4F15C 1S7VA 3ETBF 3K71A 2EE9A 2VXTL 3BWSA 1BJMA 1E67A 2EC9T 3B2PA 1E5CA 2WLMA 3QUXB 1NUGA 3ARBB 3HI1A 4QHNA 4TVPD 3O0LA 2F1EA 4NKDB 3MV7B 1QSFB 3BVNB 1KDIA 1KT2B 1WV7T 2YFNA 3I9GH 4HT1H 4HMDA 4BCYA 3C6EA 3MKKA 4KQ0A 4LSRH 3HIZA 5I6LA 5IIEB 1CTNA 3IBOA 1E4JA 5HDWA 4E9XA 1ASQA 4ELDA 1S6NA 1YMMA 2D3VA 1KB3A 4IU3A 1M1XB 1QSFD 2J8UF 5T5NF 1EO8H 2QVMA 4BWWA 5F0PB 3T2LA 4HKBA 4MQ7A 3F84A 2EEFA 2YZ1A 4NZUL 3L48A 3QEHA 3SJVE 4CVXA 4ZMLA 4OGYL 2YEZA 4MNQA 4KUCD 2KLSA 3IKKA 3MRBA 4IBLT 3RNKB 1DN0A 4XWOC 3Q9QA 1M4KA 4FG2A 4FXGC 4HKJB 3VCLA 3RGVD 5I76B 1PJWA 3FB5B 3LV3B 3LNIA 3MCLH 1VJSA 1EA9C 3P69A 4ODHH 5CP7A 3SE3C 1G7HB 3L3KB 4IQHA 1I7RA 4XXDB 1OWWA 3U0TA 1OW0C 3FU0A 1AHMA 1NMCB 2JKWA 4KJQD 4L3ED 5I26A 1ITBB 2Q76A 1GMIA 4PREB 2IG2L 3BLPX 2RTTA 1PGRB 3P4MB 3CZUB 1LD9A 1N3NA 1I7TB 3QUMB 4NCC1 2XNAA 3LXCA 5GRZA 4YBLB 1DQMH 2F54D 2K6WA 4U4IA 5E8DH 4H25A 4WFHD 3S36X 2X4PA 2UUDH 1XEUA 4YDVA 5D7KD 1EZSA 2VXUL 3Q8FA 1YUKB 1H0DB 4BJLA 3PPSA 3V4VB 1JZ6A 1LO0H 1JVKA 3EGSB 3RL2A 3GKZA 4M5ZH 2XPZA 4TLUA 1GVIA 1D5IH 2W0PA 4GG8A 4XHQA 5IG7A 4HXAH 2QVIA 2DRUA 3OR6B 3P9LA 1A6UH 3FFOA 3X12A 4FLHA 3D2TA 3NQIA 1DQDH 2BOCA 5IQLA 3ZX1A 1CL7H 4PLJD 3RWCA 3GSRA 3L3GB 4YBHA 4P5TB 4FNTA 2KS0A 4L1BA 1ZA6A 4U7SA 1TLMA 2Y2TA 1BGXH 1DCEA 5DZNA 3OKNB 3WTYA 1LE5A 2XWBA 5FXCH 3ARGC 5F3HB 1I7UB 3P0YH 1BM7A 4PW9A 2NY6C 4MNQB 5AD0A 2BINA 2X4TB 1L3NA 4Z3EA 2R7EB 4U6YA 4OD1H 5C0BD 2UZYB 3DOHA 3Q2NA 1DLFH 1YRKA 3KXFB 4JFWA 4U05A 5L6YL 2WXHA 3QWRA 2BP5M 4AYGA 1O0VA 3GXUB 3MNZA 2CO6A 3OKEB 4LDCA 4KROB 3L4YA 1KG0A 3EGDB 4IMLA 1G7PA 1DQIA 3FULA 3QFGA 2ARJQ 3QFDB 2OMUA 1RIHH 2IVFC 1ADQH 1GOHA 4NFBA 5CBEB 3Q13A 1LO4L 2IO5A 2ROXA 1U6AL 2JI1A 3MRIA 4JPVL 3DVNB 3U4KA 3EGDA 4CSTA 1T5WB 5B21A 4MX7A 3P4NB 4HDIB 3BT2L 2NUPA 3A22A 1ADQA 3VE0A 1SGKA 3K0YA 3O2DH 4JKLA 4BH8A 1JHTA 3K4ZA 4YDIH 1KNOB 1NIDA 2OL3H 1P4IL 2ZIDA 4YXKL 1FNLA 4ZMZA 4F7PA 4BFBD 4DAGH 3WN5C 1AR1B 5C0AE 1M7XA 5I8OH 1L9TA 2CH8A 2ZUYA 3QNYB 3SGJC 4G82A 3EKCA 5DJ8A 1WFIA 2YRZA 1U21A 4LHUD 4EVNB 2JSFA 1ZIAA 4YSCA 1E9OA 4TPRH 1JDAA 2XRAL 2HN7A 3NIFE 2GJJA 3PWUB 5E9DB 4RFEA 3QUZA 2Z34A 4ICWA 3HLKA 3NN8B 1H3TA 4Y4KA 4YIQA 2OMVA 1ZVYA 1V3JA 4DSYA 3UROR 5EU6D 2E7DA 3M8OH 4IOSD 2FD6L 3QUKA 2V5SA 1H19A 3IJ7A 1NCOA 4L1DA 2MTPA 3QJRB 4OF6A 1SHWA 4JL1A 2W81C 4N6RA 4Z0BH 5CUSL 1X5XA 3D06A 3VXSB 1S7TB 4TNWF 2NY4B 3BUQA 5E2UL 5IBUG 3T4AC 3RYMA 4CA4A 4GS7C 3M7FB 3SDXA 4JRYA 4FXLA 4P9HL 4G1EA 1WPCA 1EDYA 2Y07H 5B38G 1QO3A 6PCYA 3I3BA 4XVTL 4R5VA 3ZY7A 1C5CL 2ERJC 4OB5H 1LEGA 2LHAA 1BHGA 1HXYA 4R84A 3VXSE 4LPTA 3TPUB 2G2PA 4PWFA 2DQEL 5D2NC 1LHZA 1TTFA 3IFNL