2C34A

Leishmania mexicana icp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
116
structure length
116
Chain Sequence
GSHMIAPLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWTRVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYVVLVKPRKRGHHTLELVYTRPFEGIKPENERYTLHLNVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INHIBITOR OF CYSTEINE PEPTIDASES
publication title The Structure of Leishmania Mexicana Icp Provides Evidence for Convergent Evolution of Cysteine Peptidase Inhibitors.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Inhibitor
total genus 10
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c34A00
3CBJB 3CBKB 3E1ZA 2NNRA 2NQDA 2OULB 3M86A 3M88A 3PNRB 2FO8A 2C34A 2WGNB 2H7WA
chains in the Genus database with same CATH superfamily
5D8JL 3BVVA 5AG8A 1ZEAL 2ATPB 4ODTL 2CDEB 4NC0B 1NLDH 3BLBA 3HE7C 4TL5A 3MJ6A 2CDGB 4GXVH 5BQ7B 3CHPA 5KVGE 1TLKA 4KK6C 1OPGL 2P28B 4AMXA 2AK4A 1ETJA 1YJDH 1I7ZB 4KXAA 4XGZA 4XO4A 4UDTB 4DERA 5AB9A 5HYSG 2OXGB 3AG1B 8PAZA 2IDSA 4U1HB 4O51A 4PVMA 5EEVA 2BXZA 2O5YL 1HJBC 3K8KA 1RLBA 2X4QB 4HCFA 5J6SA 3S36L 3ZGIA 1F41A 1X5FA 1MHCA 3E9TA 1WCQA 2QMJA 2KPWA 3ME0B 4G8AC 2PF6A 1L9SA 3PL6C 1RU9L 1VKXB 2WBWB 3RA7H 4K71C 2BNRB 4ERSH 5AL8A 1P2CB 2VMJA 4IYKA 2LV4A 1FBIH 4TNWK 4G82A 1JYWA 2PYED 2IH1B 2AXWA 4OZ4B 3GBNL 2GY7B 2EE9A 2VLRB 4X9HA 4DPRA 1OQXA 3AW5A 1GXEA 1ZK5A 4N90D 3UERA 4QRPB 3PFQA 3ZDXB 3FQYA 1IBDA 3QS3A 4XNXH 5IMKA 4GQ9H 2XG4B 4AIEA 3S8WA 1OTSD 3B1TA 3LN4B 1HOCB 1N0LB 2WQXA 1EANA 3L3GB 3Q05A 5FV1L 3FF8A 3FT9A 1AGCA 4IKIA 4L29B 4BCYA 1FVEA 4NQVB 4V1DA 3H9SE 4NCC1 5KANG 5CCGE 3TONA 4ZFGL 1U58A 4KZDH 4TSAL 1YEKH 2XNAA 3MBEA 3X13B 3HPLA 2Q8AH 1W72H 1EFXA 1HL4A 3WXVL 1XR9B 2QR0B 1MKFA 3SPVA 3ELQA 2FBJL 2CO3A 2RIKA 3HN5A 4GSDL 4ZUWA 3RG1C 2NYZA 4Y9BA 4XN2A 3R06B 1P7BA 3L4CA 4G9FA 5DVNA 5EULV 3WFEL 3NCMA 3LKSA 1HDMA 2UX6A 3L3DA 4UTCA 3MNMA 2OMWA 3RU8L 2X05A 4XVJL 1XSKA 4PJFE 5DVMA 2ED7A 2OYLA 4H2AA 4B3VA 3UGXA 1V7ML 4JFPB 4R0LB 3GRWH 5GGSB 4P4RA 4XHQA 4KI5C 4ZUTA 3AY4C 4FX5A 2VAAA 3QUYB 3BVXA 3T0XA 2Y7SA 4MCMA 3E2HB 4HOMA 1BVNP 2WB1A 4JRYE 1Q0XL 3ZO9A 1N8ZB 3AU1B 1U91A 4L4JA 3K8MA 1YMHA 4J8RB 1UYWH 2X6CA 3D09A 4PR5B 1RD6A 3EG9B 4LXFA 1CD1A 5F9AC 3GXFA 2ENSA 5I6NA 2R56L 1QSVA 1T22A 3ESUF 4N24A 2ENYA 4F2ME 2YBRA 2XU9A 3T8MA 4JFFA 5I1HH 5AKVA 4ZS6D 4IMLB 1GZHA 3NZSA 3UAEA 2Y24A 3CVIL 3DX2A 2TAAA 3IRZA 1CVSC 1FVDB 5I15L 2FGWH 3BH8A 4XAWH 3JWNH 1S9XB 4KZEH 3QFJA 1A7QL 4DP9X 2MKLC 3N55A 3KXFD 2DICA 3O9WD 1SJVA 2OK0L 2CR0A 1N2RA 2JELH 1WZ1H 4RZKA 5LBSH 4G6KL 4Y88A 4D3CL 2Z31C 5I8EB 1QOKA 4HUWB 3TJEH 2BZCA 2DH2A 2JWYA 3VFGL 1IRAY 4XBPB 3QDHA 4KUZL 3HLAB 4BFOA 2EVIA 1FGVH 1N0XH 5IQ7H 1KCVH 1MCBA 4OSUH 1HEZA 5DS1A 4ZNEA 3LH2H 2ITCA 3QWNA 5FO8A 4JCLA 4Q0XL 4OUOA 4BE6A 2J57A 1UCBH 5KVDL 4Q89A 5E5MB 2DIEA 4XPTL 3EGDA 1MFBL 3MROB 1BXXA 3CFDA 3STBA 4Z7WB 4LAQL 3NRPA 4XO5A 3COOA 2NYYD 2XTLA 5AKSA 2FJFB 2W81C 2OW6A 4PRPA 1KCSL 4A7TA 1RIVL 3L1EA 3P0YL 3HPJA 1ROCA 2Z0UA 1G1CA 1JRHI 1K6QL 5J1AB 2KBGA 1U8MA 2DLEA 4DZ8A 1F3JB 2WKOF 4GRWE 4E68A 4KK9C 1SYSA 3V0AC 3L1GA 3VTTA 1CFTA 1U8QA 2C9SA 4C47A 3NJNA 4WSKA 3I3DA 1RIHL 5JZ7C 3EO0B 3HE7D 1SF3A 2GBAA 3H3PL 1NWOA 2EXYD 1AQMA 1UM4H 3C5ZC 3FSWA 3JTSB 3AAZA 4YSEA 1LEKA 1N68A 4RGMB 3Q2CA 4DGIL 3KPRD 4UM9D 4ZPVB 3GZKA 4N0CC 3KPQA 3PL6A 3BUYA 1EO8H 3QUXA 1CPUA 5D2LA 4UCFA 4Z7QF 3MZTA 1G6RB 2CBTA 1SY6L 3LQZB 2C4XA 5GS0H 2IFFH 1UA7A 1WTGT 4OCRL 5JPNB 3MKKA 3QG7H 2ZYRA 1Z1WA 1HI6B 1KCRL 1WUZA 5AVZB 5GS3A 4R96B 1QNIA 1M3IA 2EDDA 3VSQA 3WMPA 1M7UA 4L3FA 3U82B 3UPRB 1G9ML 5D1XB 3KPSE 3NRQA 4Z7VB 2JQMA 2PO6B 4Y1AA 5F6HJ 4B9IA 2X2HA 2BW5A 5GGSY 3LN5A 2ADJB 2VM4A 3B3IB 2BFGA 1EGJH 1ZMYA 4MNQD 2ZYSA 2OZ4L 2HRHA 4RMTA 4L3ED 4LLMB 5DDHB 5LDSA 1ACYL 2CLZB 5T1DH 1NGQH 4ODWA 3MXVL 4YFLF 4BQ8A 3KLQA 1WD8A 2UVFA 4FA6A 1KSRA 3IJ8A 4LF3B 1UWGH 5CLWA 4X8GA 1C5DA 4LVNB 1HN1A 3OTTA 4AYGA 4XNUL 1NOAA 3TCXA 5FO7A 1FZJB 2CLVA 1CLZL 4N86A 2Q3AA 5AALA 5DT1L 4W93A 4UAOB 5LVEA 3T6QC 5EIIA 2GYSA 4EDWL 1NOFA 2ENPA 3NIFF 3QCTL 1USQA 1YY9C 1IE4A 4YE4L 3FT4A 3KLAA 4FFTA 3SGEH 4PJ9A 5L8KB 3S8FB 1NDMA 1LEIB 2R4SL 3MV11 3ISRA 4IS6B 5LWYH 3DROB 1SVZA 4X4XA 4QXGH 3A6CL 3L8QA 4UV7L 3VFPB 2DBLL 3CVHA 3D39E 1MAJA 4HHWA 4F8QA 4OJEH 5TE4H 4YC2B 3EHBB 2EQDA 2YXMA 2DN7A 2BVOA 5AD0A 3MZGB 1Z9OA 3KYAA 4N9GA 1G1KA 3MTRA 4XP1L 2O6CA 4H88L 4F8TA 1KOAA 1CI3M 3CMOL 2WVUA 4PJ8C 1PIFA 1WC7A 2A9ML 3QHFL 5DJ0A 5B3SB 5JW4Q 1EJOH 1KTCA 2AK4B 4U2YA 4XGZB 1UKQA 3Q2LA 3IPBA 5KVGH 1QI5A 3VDBA 1T4KA 4KDTC 1DBML 4PJCF 5EZJA 2R2HA 5CJ5A 4XVTL 2G5BB 4O51B 4P04A 4CBZA 1JWSA 1LK3H 1MHCB 3QUKA 1NCIA 3UTPE 2R4RL 4LSVL 5GZOA 4PGCA 1G9HA 1KGCD 1KFAL 5LG6A 4F8PA 1KTLA 1MF2H 2DLIA 1O5DT 1S5HA 2Z31A 4YSRA 1UJ3A 2C9XA 1MVUA 2VDOB 3QWRD 3DETC 2GI7A 1M1SA 3ASOB 3BJLA 3KZ8A 2V2TA 1OLZA 1BVOA 1CL7H 3TCLA 4ZMYA 5IW6A 3DO4A 1P6AB 3WNKA 1ND0A 2AVFA 3QQ9D 4D9QD 4YSCA 4ESKA 3O6KL 2EO9A 4RIRA 2GJ6D 1EAQA 5HHOE 5C3TA 3RTQC 2FWOA 4MNGA 1AGCB 3P11L 3ZT6A 1FVEB 4U6XA 4NS0A 5ID1A 3FHQA 1VZGA 4V1DB 3QDME 4NBXB 3OXSA 4NWUH 1U58B 1ZLDA 2AJVH 2XNAB 1PX8A 1ZLUK 1GCYA 3MBEB 3BUIA 3RVXC 3UPAA 3HPLB 1OF2B 3QZNA 3VDAA 3BSZL 2LHAA 1D6VH 1EFXB 2NRDA 4M1DH 4M6AA 5GXBB 1MI5D 1V3MA 5KEZA 4CSPA 3HZ3A 3SPVB 5FFOA 1IARB 4Z0BH 4URKA 5HHVH 4ZTPH 4ZUWB 3VD7A 2B4CL 2MEJB 2RHEA 3FU3A 1AMYA 3QYCA 4KFMA 4Z7UE 2PW2A 1S7UA 4XP4L 3D4ZA 4G9FB 4LP8A 1ITBB 1EVUA 1R5VA 1HDMB 1S3RA 3L3DB 3LKSB 4ABWA 4PY8I 2OMWB 3NDYE 3O3UN 4UQEA 4TSCH 2X4OA 2EIKB 3GHBH 3E0GA 1NMBH 1RZJH 2AK1H 1SVCP 2ZP0T 4C54A 4KKPA 4P4RB 4QHUA 4QYOA 4ZUTB 5F21B 5KVDE 4DO6A 2VAAB 4FGMA 2HT3C 3LRMA 4KRPB 5CMAA 4EUPA 2IBZX 1MRFH 4ISVA 2HRPL 1U91B 4LHUG 1YMHB 2AS5M 4OZGF 3T0ED 3RVWC 1MFCL 1NL0H 3HJEA 4JR9L 4JFHE 4NXKA 4GRLD 3LDBB 1T22B 2YBRB 2CK2A 3SQOH 3D3VD 3MJ9L 4JFFB 5CEZE 5IF0A 1TSRA 1U6AH 4XPHH 5E94A 4ZUUA 5LBGA 4OVVA 3BH8B 2BSDA 3FF7A 2N1TE 5E2VH 1QFWI 4OIFA 1OE3A 3QFJB 2W95A 3NN8A 3RY6A 4HJ0D 3VH8A 1N2RB 4BGLA 3S3BB 4KXBA 1ROWA 1S3KL 3UC0H 2FWSA 2LLGA 2YSSA 5EUOA 2XKUA 1MPAL 3GEWB 3RHWK 4AOFA 2VZOA 3WIHH 1XEDA 4P23D 1HEZB 2WXGA 1YYLH 3NRFA 3OAUH 5EF1A 4R3SA 4K3GA 2DQEH 2ITCB 3PWLA 5FO8B 2V2XA 5D4QA 2BOCA 1QW8A 2OKMA 2XG5A 1YNLH 25C8H 1WQVT 1G7JA 5I28A 3EGDB 1P1ZA 3F85A 2Q1EA 5JHDE 4JM0A 2EEXA 5IOPA 3CFDB 4Y2DA 2Y06H 1RY7B 5DRZA 4G7YH 3K72A 2VKWA 2YLHA 4PRPB 3SDCC 1F6LL 1DFBL 4NZTL 5C0DA 4NGHL 5IJCC 1RI8A 2E27L 1ZGLP 4D2NA 3IGLA 3HPJB 4G5ZL 1RMFH 5ADOH 1XXDC 2CDFA 1U8MB 4DP4X 4DZ8B 2H0EA 1SYSB 3GFUA 4R97C 3ZKXC 4AQ8C 1CFTB 1U8QB 1J5IA 1E5UI 5EOQH 4I77H 1PY9A 4X6DE 2VDRL 2GABA 4NNXA 1GGYA 3LKNA 1QWHA 1PVHA 3BVDB 4WUUE 2GSGA 2Z91B 3BD5A 1GAFL 4PJ8D 5ALCH 4UNVA 1JZFA 4H7VA 2FSEA 3AAZB 1LEKB 4ADIA 4GMSL 5BUPA 1KYFA 3JVGA 3F12A 3OZLA 3WIFA 1ZCRA 3MX0A 3RX7A 1T1WA 2VDQH 3ESNA 3RWHA 1GOHA 3FCUB 3FAWA 3KPQB 4NRZA 3PL6B 3BUYB 5AW2B 3QUXB 4XP5H 5HVWA 5D2LB 4MA1B 3KLKA 1ZVYA 4JDTL 3BRFA 4K71B 3RPKA 2JJVA 4Y19E 5ISZE 5D9SA 4KROC 3QRGH 2CJTA 5CINL 1N67A 3VXRD 4JUTA 4U0QB 3ALPA 1KB9J 1ZWIA 4KO9A 1YEJL 1LO4H 2VM3A 4G6JH 5J6HA 4Y1AB 3CZLA 3B83A 4LCYA 5D8JH 3DETD 2IDQA 3LN5B 1QEXA 3PWPE 1ZEAH 3Q8CA 2OMXA 4ODTH 3RTQA 1NKRA 3WOVA 2NYKA 3L4ZA 1RXLA 5IVNA 3N6YA 4FJZA 4ODWB 3POCA 4EI0A 4Q9CA 3UMTA 4TNVK 2OBGA 4K7PX 4PWHA 5D7KE 4RMRA 4H1LA 2DMBA 4C56E 4DEPC 4EBQL 2YMTA 1BEYL 3UCQA 1C5DB 1O6SA 1A4KA 2XICA 2APXA 1GTFA 2HLFC 4NNPH 2E7CA 4HULB 5BO0D 5FO7B 2CLVB 2O5YH 2ZX8A 3S36H 4C4KT 3BDXA 4Q7DA 1SQMA 5EIIB 1HE7A 3Q8AA 3FT4B 1RU9H 3KLAB 4PJ9B 1NDMB 1SUHA 4RBPK 2WLJA 2MCAA 3GXPA 2P5WA 4X4XB 2OFQA 5FFGA 5IQLA 3CK0L 1FCGA 3CVHB 3LB6C 3P3RA 3UP1A 4RMVA 2HTKC 1R33A 1QD0A 3GBNH 5KN5A 5TPWL 3ZL2A 5F88A 4LCWE 2NOYA 4JQIL 4F20A 2BVOB 5EPMA 2FQFA 5AD0B 4HS3A 4MCNA 4N9GB 3S35X 3CNKA 4PRHD 1S7TA 4NB7A 3ILQD 1YEHL 3O2DL 4ONFL 3HOGA 1WC7B 4TTDD 2ALAA 2HT3D 5CM1A 5DJ8A 1IM3A 1BQ5A 5DJ0B 2Q3XA 3QISA 4UT6A 3NJVA 4ZFGH 2X4PA 1T4KB 4TSAH 4L3AA 4G72B 2YXVA 2R2HB 3F84A 4CVWA 2EIZA 2V9QA 3WXVH 1JWSB 1MWAA 1LK2A 3O8XD 2JKRM 3QUKB 1Q1JL 1WG3A 2FBJH 4AYMC 1KCUL 4GSDH 4WO4D 5FYLD 4PGCB 1EZUA 5IWLC 4V2BA 1F3DJ 2VISA 1KTLB 2Z31B 3JZ7A 1S5HB 2PABA 1UJ3B 1MVUB 1GR7A 5G55A 5E5UB 3RFRA 2QHLA 2WOBA 4LOFA 3WMSA 1XL6A 1D7CA 4XVJH 3QP3A 2ZUWA 4WCYL 2WWNA 2V2TB 2KLRA 3ABZA 3TCLB 4BSWA 5IW6B 1V7MH 3PQYA 3FU0A 1M6OA 2BIPA 1GHFL 1ND0B 4IGBC 5EO1A 1UD4A 3RGVD 4YSSA 1LM8V 1HZHL 2EVFA 1D7FA 4RIRB 1Q0XH 3IMBA 4E41A 2FWOB 1DQML 4MNGB 1ED3A 1OK0A 1XD0A 4U6XB 5ID1B 4K15A 1ZS2A 2DF3A 4QLWA 2KH2B 3OXSB 4V33A 3GIZL 3SDCA 4JRXD 3D2UD 3C5JA 3US9A 1MCNA 1CICC 1QPXA 2BCKA 2D9QB 5HGDA 1UADC 3QA3A 3SBQA 2YMXL 5J57B 3TO4A 3RX8A 3T3PF 1A6AA 4UINL 2QPUA 2W9DH 4AQ8A 4XVUC 5I15H 3TBVA 1WICA 2C3VA 4UQ3A 4ABUA 1F2QA 2N59A 5FYKE 1A7QH 3C8KA 2PW2B 3WTYA 1S7UB 2ZUQC 2WKOA 1R5VB 1OLLA 2VO8A 2OK0H 3LIZL 1ADWA 1GZQA 4G6KH 4D3CH 3WY3A 2X4OB 4K23L 2H2SC 2BVQA 3VFGH 1TTGA 4U1GC 4KUZH 4QHUB 3V5DA 2VERA 3T3MB 1PG7W 2WKGA 4QYOB 4IMKC 2J8UE 2G5UA 3LVTA 1DSFL 4XPAL 3TFKC 2HWZL 3WNIA 2PWHA 5CMAB 3RUGF 4EUPB 4ISVB 4Q0XH 4YGVA 5KVDH 1I9JL 1PG7L 4PRID 4JO2L 4PLKC 1S5IL 4XPTH 4C83A 1WBXA 4W4OC 2APBA 2DAVA 1MFBH 5GIRA 2FTAA 1FE8L 1QFUL 4LAQH 4PJAF 1FO0L 3V4VA 1JRHL 4I48A 2VDKL 2EINB 5DZOA 1TCMA 1KCSH 5CBAA 4KROD 1RIVH 2DM4A 3D9AL 4KH2A 3P0YH 3KPMA 4CRPA 4ZUUB 4YHOH 2I5YL 5E6ZA 2NSXA 3VRLF 2ODIA 3RJDA 1K6QH 4BA8A 4I18C 5D1ZA 3NN8B 1JSYA 1ZVNA 4MA3A 4YBQD 2PYFA 3VH8B 4KTEL 4UTAL 5IB4A 4XHJC 1RIHH 4U6HA 1NEUA 2YSSB 1CWVA 3H3PH 5EUOB 4AQEA 4AQ1C 4MXWH 4R3SB 4L1BA 3CU7A 1RZKC 3QE5A 4DGIH 3PWLB 2HMIC 2V2XB 3VFRA 2HLFD 3B9KC 2BOCB 2CRYA 1GIGH 2XG5B 5ES4B 1JHLH 2CR3A 4GAAA 1G7JB 4XXCA 4AVHA 1P1ZB 4XCNA 1AJ7L 1SY6H 3IE9A 4JFOA 1TYEB 4X8XA 1AHKA 5IOPB 4Y2DB 1VFAA 3RLSA 4OCRH 2BXYA 2VLRE 5DRZB 2FHBA 1SHXA 1QSED 3K72B 1BVZA 3WENA 4POUB 4JY5L 4MGXA 5C0DB 5I74C 3NCWA 3TH2T 1G9MH 2RAMA 3LZRA 3PP4L 3D0LA 5FGRA 2WN3A 3GF8A 4M00A 2PKDA 2PPAA 2CDFB 2Z8WC 3SKMA 3EH4B 3V7MA 4P57A 1GH7A 2OZ4H 4FFWD 3OQRA 1ZLSL 2FT8A 2LOEA 1ACYH 4M6OL 1CD9B 3TF4A 1PPIA 3SPCA 4NNXB 3LKNB 3MCLL 1BVKA 2GSGB 4Z8FH 2FSEB 3F12B 3D85A 4IBTA 3SKNA 5IMMA 1JF5A 1L7TL 4KJWC 4XNUH 2A74A 3WIFB 1A0QL 3CBRA 3MX0B 1TQVA 1T1WB 3RWHB 3U7WL 1YEIH 3ZTNL 4NRZB 1CLZH 4LLYA 5E51A 3U6XS 1JK8A 3ZTCC 5DT1H 4OI9A 4EDWH 2E56A 3QCTH 3PREA 4YE4H 3SKOA 1Q9LA 4PM1A 2B5IB 5IREA 4MCZA 5D9SB 1V05A 4WFFE 2R4SH 3CFJA 5T3ZD 3RJOA 1PY0A 3RDJA 5K9OA 3A6CH 5E4OA 2DBLH 5EDXA 1WCBA 3ZT7A 1ZWIB 2W9EH 3EZJB 1BM3L 2YUWA 1WAAF 3LZFL 2C9PA 4PJEF 1A6WL 3IRPX 2IWEA 4PLJC 5J6HB 1NAKL 2KERA 1WAPA 4LCYB 3FFCE 3VDCA 4DO5A 4N0UA 5A43C 2VXSL 3FZUD 2OMXB 4XP1H 3RTQB 3QDGD 4H88H 4AGNA 2YQ3A 1IIKA 4KKNA 2A9CA 3CMOH 1M4KA 3CN4A 3GBEA 2A9MH 2D0GA 4H1LB 1A9BA 3QHFH 4I3SL 1CICA 1VERA 4WEEA 4YDIL 5KSBE 3TT3L 4G2AA 1O6SB 1A4KB 3MNZA 2Z1KA 2WLNA 1DBMH 3KG5A 4DWHA 4XVTH 4XNBA 4P2OC 3PUCA 4WHYH 1AZRA 3FUEA 4PBWD 4LSQL 3DX0A 1YNKL 3FU7A 4MWFA 4PVNA 2N7AA 3B2UD 2R4RH 4K3DL 4LSVH 4AV5A 1PCXA 3MU3A 2C5DC 1PGRB 4L8CA 4QIRA 1MAKA 2Z34A 4XVUD 2P5WB 2MRYA 1H8OA 3RBSA 2OPCA 2YGVA 4ODSL 5KN5B 4W9ZA 5F88B 4N26A 3LN9A 1DSYA 5EPMB 3TBWA 1IQWL 4HS3B 2H2SD 4TULL 4K4KA 1V5JA 3EFFA 4R7VA 5E0FA 3EJRA 1IO4C 3O6KH 1S7TB 3VFTA 1ZV9A 2EP6A 2CLRA 2WXJA 1X4ZA 4AV4A 4A2GA 5DJ8B 1IM3B 3P11H 4X9GA 1WGOA 3OHXA 3QUHA 3OF6D 4NQQA 1WFMA 1SEQL 4OZGA 2X4PB 4XBMA 4MLIA 1ID2A 4PLKD 1L9MA 3BSZH 2EIZB 3FN9A 5CEYA 1MWAB 3CZEA 1LK2B 2WD0A 4C59B 5GGQL 3FPYA 5DHDA 2B4CH 2ICWA 2VRKA 5EF2A 3BPNB 2VISB 5DZVA 3IN2A 4R26L 3RNKA 5HDOA 2H3KA 4XP4H 2EC9T 3EDJA 2H32H 3F65A 2X6UA 4FQQA 2BSTA 1I3UA 4AQ1A 2FIRT 2L7JA 5C0RL 5EOCJ 1PKQA 4BSWB 5E8EA 1OP4A 3O3AA 3HZVA 3PQYB 4K55A 1M6OB 4JAMA 5EO1B 2GKIA 4NAMA 4UNTA 1I85A 4O5LL 4R2GB 1ODUA 2IEPA 2NW3A 3MREA 1WS7A 1TXKA 3QGVA 4E41B 5C0BD 1ED3B 2HRPH 2F6AA 4WEUD 1J8HD 1IC4L 5TFSL 5JLZA 3QAQA 3BZDA 1MFCH 4JR9H 1CQYA 4R5VA 3JV6A 3OKEA 4ZO9A 1OP5K 3SDCB 5D1XE 3C5JB 4WJ5A 1TKWA 1YY8B 2BCKB 2BW4A 4LDOB 5HGDB 3JXAA 3QA3B 4BKTC 3TO4B 5IFHL 1QFWL 1A6AB 1DVZA 2P80A 3MJ9H 4JHZA 4BM7A 2CJSA 4PGJA 2J6WA 5T5FL 3KM1A 4QXUH 3ZKXB 2QPFA 4JFXA 3TBVB 3OG4B 2C3VB 4UQ3B 1OHQA 3N43F 4GP5B 3C8KB 2OJZL 2WK2A 3QO1A 4QO1A 1NCBL 1A66A 3TLRA 5IMLA 1GZQB 3MLZL 1S3KH 3T09A 1OEZW 2I7OA 4JUSA 2BVQB 4N85A 4R84A 5BRZD 3RIFF 1GKEA 4NAQA 1MPAH 4WWPA 4FKEA 5HJBA 3V5DB 5CCKL 4K5MA 4H20L 1SHWA 3BLPX 5CZRA 1RUAL 1L3WA 2AXHA 1LO3L 4G6AC 4YFLI 3V6BR 1UASA 1OB1A 4KJWD 4YGVB 1FFRA 4XN9A 2VMEA 1MCJA 2ZSWA 4NQEA 1IC7L 5BV7L 5C07E 4C83B 1WBXB 4Z7QB 3FPXA 2AV1A 5GIRB 2VSMB 4HSQA 4GLRI 2GSIA 3K0YA 3WNMA 3V4VB 1PNDA 2HLEB 2J71A 1MCEA 3JZYA 5K9KA 4I48B 4J23A 2E7LC 1DFBH 4IRZL 4NZTH 4PN6A 5CBAB 2FSDA 1LHZA 4NGHH 2E27H 3KPMB 1E42A 3L3HA 4X7TA 4ZOBA 3DECA 4M5TA 2ADIA 4PLJD 4JFVA 5D1ZB 4MA3B 2PYFB 3VD0A 2EADA 5DVPA 4DEPB 5IP4A 2NNCA 2YD5A 5IB4B 4L4TA 4U6HB 5GHWL 3I6LD 3QH3A 3KBPA 1T7ZA 4B60A 1KTRL 1HZKA 3UAJD 3MNWA 1KCKA 3BQUD 3TEYA 3TF7C 4AQEB 1BWWA 3QIWA 4OIAA 4GMSH 4XO3A 3OMIB 2JLLA 4H8PA 4TL4A 4ZMZA 3D5OF 3VFRB 3MRQA 1M2VA 4JDTH 4E0RA 4N90E 1WIPA 4XCNB 4DK6A 4JFOB 1QRND 2ETWA 1VFAB 3DHJA 3NIFB 3TA3D 1ZA3A 1EEUA 2NW2A 4GXUN 3FUKA 1LEGA 2BOLA 5CINH 2YEVB 4WVRA 4K8RC 1Q9WA 1U2YA 4KY1L 5DVKA 4BDVA 3HRZA 2GAZA 4XVSH 3I84A 3D0LB 1CS6A 1ZDSA 1XWVA 3BD3A 4P57B 1P7KA 4M7JL 2ZWNA 3BLKA 4JJOA 3QQ4A 3V0DA 3V0WL 5JOFA 4X8CA 4FNLL 3BUPA 4JB9L 5E7FA 3W0WD 4PIBA 2EABA 1GJIA 2YK1L 2GTWA 3GB7A 1BVKB 2EE0A 1FSKC 1YUKB 3PWVA 1XIWC 1BEYH 1OV8A 2DQCL 3D85B 5AOMA 3SKNB 5IMMB 5LAXA 2A74B 4BFIA 4BFJA 1EEZA 5FUCE 1EBPA 2ZE0A 4LLYB 1JK8B 2GJZA 5EIIG 4FS0A 2P8LA 1CXFA 4HUVA 3SKOB 3T2PA 1Q9LB 1PZDA 4MCZB 1JGLL 2ZUYA 4M9PA 3CFJB 2R2CA 2ZTBA 1KBVA 1OCRB 3CK0H 1WCBB 2RB8A 3MODL 5AOIA 4G8GA 3MV9D 4N22A 5TPWH 1AI1H 3RKPA 5K33A 4JQIH 4H0IA 1CTMA 1RSYA 4F5CA 2WXPA 2VSCA 4MAZA 3WFBL 5LGJA 3VXMD 2V5MA 1T66D 4OJYA 1BMWA 1YEHH 3CFCH 3P0VL 3O2DH 4NM4L 4ONFH 1JZJA 4LHJB 2VO5A 1A9BB 3L3JA 3HE6D 1CICB 2JMRA 5C2UB 2G3XA 4CADA 3KXFE 3V9FA 2I32A 2O5NA 4JFFE 5LCVH 3MNZB 3HG1E 3WY1A 2XC8A 1DO5A 5AOLA 3PE9A 5JIHA 3UTSA 1GOFA 1SRDA 2B1HH 4I85A 2P48B 3D08A 1UEYA 1KXHA 4KKQA 3FU7B 1OAUL 1Q1JH 4MWFB 1KCUH 5D7LA 2YZ1A 5ELIA 1R1CA 1NCNA 1P84K 4NRXA 4L8CB 1E43A 3TBCA 3O3EA 4DZBA 4HPYL 2FCBA 1FPTL 2VRAA 2UV3A 5DHMC 4DAGL 5A2KH 4LESA 4K5OA 2OQJA 3LV3A 3AWFA 5CD5D 4DHLA 4WCYH 2JKIS 3GM0A 2YAPA 5DZ9A 1MCQA 3HAEH 1GHFH 3EFFB 3S37X 1OALA 5ALBL 4UOQA 2JNZA 1HZHH 3LD8C 3VGGA 1BG9A 3VFTB 1IC0A 4HF5L 1FN4A 1DDTA 4JVWA 4NPYB 2CLRB 1INDL 2NT1A 2QLYA 4MVBC 4PJGE 3QZMA 1DQMH 3RUGA 3ZE2B 3CZFA 3OHXB 4Z7NE 4PRPE 3E3QE 3HKFA 4OZGB 3Q8BA 4Y5VA 1B4RA 2E6QA 3Q1SL 4WNQA 1NC4D 1PLGL 1UD3A 1M53A 5CEYB 2YMXH 4F37F 4PJAA 1MUJA 4D8PA 4N1EA 1BQKA 3TYGL 3TJHD 3C60A 4UINH 2ADGA 4AYBA 1QZ1A 2ICWB 3BCFA 1JYNA 2JCCF 4HWNA 3SB3A 3KPRE 3RNKB 3V9EA 4YHNA 5EU6D 3TH3T 4BSVA 5E6UB 4G80A 3FK3A 3LIZH 2HKFL 2XLLA 4FQQB 2BSTB 5B1AB 4AQ1B 5CUSL 4K23H 1CLVA 2WSPA 1PKQB 3TO2A 2VDNB 3OKKA 2F8VA 5E8EB 3HZVB 3P3SA 3SYQA 4JAMB 4G1EB 1SOQA 5E6IA 2VUOA 4XPAH 1DSFH 4GI6A 2HWZH 3FYIB 3GDBA 3PDGA 3QHZL 4FYRA 2NW3B 5D70L 3MREB 3CFUA 2E7HA 3EUDA 2ZOTA 3BKJL 3IF1A 5H37H 3PXHA 3PYCA 1PG7H 5JLZB 4JO2H 1S5IH 3BMVA 4MNQE 4L3EE 3JV6B 3MV7E 3OKEB 2PP8A 4O58L 2TRHA 1TJMA 1DVUA 3QXAA 4WJ5B 1FE8H 1QFUH 1TKWB 1U8CA 1FO0H 2CUHA 5I74B 4JFDA 1IFGA 1JRHH 2JJTA 2QQLL 3D9AH 3CN2A 4XN1A 4RDQF 2DMCA 3HMXL 4BZ2L 5B7FA 2I5YH 4K8RD 3INOA 1GY1A 3SN6N 3MV01 1FHGA 4JFXB 3ARFC 4FD0A 3TIDA 1L4IA 3IWUA 1UD2A 2OX5A 3QO1B 4QO1B 2EIEA 3V6FA 2WXFA 4DP5X 4LKCA 4KTEH 5IMLB 1YMMA 4UTAH 1JGUL 4NIKB 3DYPA 2A77L 4S1DC 1DUYA 2L04A 5DO8A 2J7LA 5GGRA 2OS7A 4HJTA 2AK4D 1WLHA 4ANKA 3P4NB 4YHML 3TBTA 1OB1B 4QNPF 3KBFA 4P8QA 3KNBA 2ZSWB 2JQAA 2XWCA 3AVEA 4NQEB 4WI0A 2I85A 3JUYA 1AJ7H 2AV1B 5B1BB 3OKMA 4E36A 2GSIB 5AW7B 1E7VA 4KI5E 4OFIA 5K9KB 2XYCA 1FFNA 2H0FA 3FTUA 4ONOA 3LKPA 1PIGA 2BVUA 4JY5H 5HI4C 2OMYA 3H4HA 1A5FL 3S4SA 4AGLA 3PP4H 4F1SA 1WAAA 2FO4A 4FQJL 3L3HB 5ACLA 2EYRA 4U1NA 4X7TB 5I1DA 4KX9A 2ADIB 1AKPA 4M7ZC 3Q6GL 5CR8A 1ZLSH 5DEZA 1JNNL 4P48A 3FRPA 3LY6A 4M6OH 3AFLA 4L4TB 1FL3B 1TO5A 2C3WA 2HFGL 3MCLH 3QH3B 3IVKA 4QYAA 1P5VA 2UWEE 4BZ1L 3MNWB 1QFHA 1ORSA 3QIWB 4GQPH 5EZPA 3WCYA 1JYVA 3QDJD 4BHUA 1KY6A 1L7TH 2WYIA 4Z3GA 1A0QH 1MW1A 5JA8B 2H2PD 3U7WH 3CVDA 4QI3A 3ZTNH 2Z35A 3MRQB 1EFXD 2MTAA 4FTVA 3IS1X 1M2VB 1MY7A 4E0RB 3BPCA 2XV6B 1D5ZA 3VG0L 1XD1A 3UX9B 1ZA3B 2NW2B 5ID0A 2MNJB 3DLQR 1LEGB 3L16A 4GQRA 4W9GC 5E1AA 5D7EA 1NFDA 3TURA 1IE5A 1Q9WB 4G9FD 3K71A 3LZFH 1BM3H 4BDVB 3GBLA 3JWOC 3AMLA 3HRZB 2GAZB 3UBXA 1A6WH 1FA4A 5HHQA 1NAKH 2WYTA 1T2JA 7PCYA 1QWNA 3LNEA 5T3XE 1KWGA 2G4GA 3T4AC 3BJ91 3L9YA 1DHKA 3NFSL 2VXSH 1P7KB 4PW4A 3TNNA 5JOFB 3QQ4B 2IF7A 3RGBA 3ARSA 2ICES 2R15A 1ECYA 2GTWB 5SWZA 2NY3C 3IGUA 4M61A 3QUMA 3GB7B 2Y3NA 4H1LG 4WWNA 5F0PB 4I3SH 5J6GA 4LSSL 2J5LC 2H1PH 2QV2A 4YDIH 3PWVB 5DJAA 1KB5L 5FYLL 3WKYA 3K6IA 1H3TA 1EK3A 3K74B 5LAXB 3WFHA 4BFIB 4OCSL 1YNTF 2X42A 2WVSA 3T6VA 1EEZB 2ATKA 5FEBA 3SGJC 1KDIA 2GJZB 1QWUA 1NCWL 1YNKH 2WNGA 4LSQH 5DEGA 4ZW6A 2P8LB 1K72A 3MJWA 4NENB 4K3DH 4HUVB 2WKLA 3KEDA 4CMHC 5SWQA 4EXKA 2FUTA 1PKOA 2GBTA 1IB5A 3CU1A 4FI7A 4Y0GA 2XV0A 5DLLA 2XXGA 2ZUXA 2X3AA 2VN5A 1AR1B 1TYRA 4N8PA 4XXDA 5HI5C 3CX5K 1RUPL 2GB2A 4GW5A 4Z9KB 4LRIA 4G8GB 2D7TL 4ODSH 3QRBA 5LGYA 1WSST 5MHSE 2EIJB 1WE5A 3ETBJ 4N2CA 5E4IA 4JQVA 1IQWH 2HJLA 4KV5E 4M8RA 4TULH 1D9KD 2B59A 4LLAA 3D3VE 1DTUA 5F71A 5LGJB 5JXED 3PP3K 5E56A 2WLIA 4JGMA 4TQEL 1KELL 4YPGA 2RCSH 3L3JB 2VH5L 2J6EL 4CADB 1J1XL 1SEQH 2O4EA 1OXYA 4NQDD 5AL0A 3ZKSD 1ET7A 3MBXL 4OGZA 3QORD 3UTSB 4W9CC 3IDJA 3LH9A 5KSAC 3KCWA 3MUJA 2AJZA 5GGQH 3ARFA 3WD5L 5CO1A 5D7LB 1AP2A 3QEQB 2KL6A 3L7EA 2DL2A 5C0NC 4NRXB 2VKXA 3O3EB 4NQUA 4R26H 2ZOLA 5EUOE 4DZBB 1TZIA 2X3CA 5BZZA 3K6OA 1NIBA 3FU9A 3SY0A 2OQJB 3LV3B 1CLOL 5C0RH 4H40A 3IDYC 1OANA 2V3DA 1JMZA 1AMXA 2HYMA 1D5BA 1OSEA 2OTPA 4YK4C 2JKJA 3SEPA 4O5LH 2O72A 1FN4B 1XVSA 5CGBA 1A7NL 1Q90A 1OKEA 2BS71 4Y4KA 3RUGB 3CZFB 1LD9A 2PPCA 4FMKA 4OVUA 4RLDA 4Y5VB 4WNQB 3V7AG 2XSKA 4KUCF 1P5UA 5LG1A 4FDWA 2GHZA 3NSJA 4HKXA 4PJAB 1MUJB 4D8PB 5IFHH 1OO2A 1QFWH 3C60B 3G5XA 3LQAC 1WZMA 3QARA 5T5FH 2ADGB 1H3VA 1MNUH 4LVHC 1QNZL 4XNZC 5I1KL 2BNUA 5GSVA 5K1VA 3ARDA 4U1LA 2OJZH 1NANI 4YHNB 4RGNC 1FRGL 1NCBH 4BSVB 1I8LA 3FQRB 4G80B 5T1LA 2Z8RA 1TYJA 5DURD 2BS9A 3MLZH 2C9QA 5DLML 4EQ3A 5HDBF 3W9EA 1E4XI 3TO2B 3OKKB 5MP6L 4DN4L 1JZ2A 4F15C 3ILPA 3LRSA 3PHSA 4DNLA 4YHLL 5CCKH 4H20H 5E6IB 4G6FB 4H8QA 3VXRE 3DX8A 3VQ2C 4AVKA 1RUAH 1UOVA 4OV6F 1LO3H 2Y1AA 3IF1B 5MENA 3QEGL 4CU7A 5EV7A 5BV7H 1IC7H 4UIMA 3OKDA 4JFUA 4E2OA 2HA1A 5ICXA 3QXAB 1RHFA 3DMMA 4MDRA 1U8CB 2JKNA 4JFDB 5EU3A 2K70A 5C71A 1CBJA 3RZWA 1E6OL 4IRZH 1E8WA 4DUWA 5E8DL 2XBTA 1DBKL 4B5EA 3H0TA 1ZPLA 4HJ1A 5C08A 4URTB 2OL3L 3TIDB 5C0EA 2OX5B 3TWYA 2CUIA 2B1AL 5CLXA 4FABL 3V6FB 3BMWA 3ULSA 1B4JL 3B7RL 5FAAA 2QVMA 4HIIA 4LKCB 3ULVC 5BZXA 2HUEA 3VD4A 2EE6A 5GHWH 4ELME 3KLHD 3VNZA 3BKCL 3O0RL 2GPZA 4NT6A 1DUYB 3UPCA 1CB4A 1YPZE 1JBJA 5GGRB 4UQ2A 3QULA 2NY3D 1I8MA 2DKMA 4G71B 5K1JA 2V5SA 1ZT4A 4HLEA 4QRUA 5T3ZL 2R0WL 3TBTB 4R5TA 4L18A 1HAWA 4X6CF 2CR6A 1H3PL 3KNBB 4JHWL 5G4MA 1VIWA 2EDEA 4WI0B 2P5WE 4N0YL 5ANMA 3EBAA 1VESA 3OKMB 1FHNA 3L7FA 4XWOD 2FX8L 2H1LM 1I7RA 1FFNB 1TPXC 4MQ7A 4PREA 3LKPB 4P5KA 5IM7A 2OMYB 1QW9A 3S4SB 2HKAA 5DA0B 2EC8A 4LIQE 2FNWA 3LOWA 2FO4B 3ARZA 5D6CA 5FUZL 4F2FA 2EYRB 4U1NB 1XGYL 5I1DB 4G8EA 4KKRA 5FR3A 3CDYA 3AQYA 3GI9L 1IAIM 4M7JH 3V0WH 2IAMC 4FNLH 4JB9H 3FRPB 2A6KA 2YK1H 1EIBA 4TN9A 4F91B 2DMGA 1G5GA 3IVKB 3BW9A 1P5VB 1J86A 3GMNA 4HCRH 1ORSB 5KSAA 1A3LL 3LXUX 5JW3L 1TQSA 4YHPA 4YSQA 5L0QC 4NRYA 2Z35B 3ZYIA 2FLMA 3T2NH 1NEZA 4FI8A 4FTVB 4X4MA 2HG0A 3WUZA 3BH4A 1NIEA 2XPYA 4L37A 2HKHL 2VN7A 3BH9A 3BPCB 5FKPA 3WTVA 1A4AA 2KUTA 1ZLEA 3PU7A 1D5ZB 2VSDA 5T5NF 2XWTA 2QPEB 1JGLH 2R39A 4HPOL 2FZ3A 1N7ML 3L5WA 5CSGA 5ID0B 5E1AB 5C0ND 1PSKH 1NFDB 2WW8A 4WFHD 3PQYE 2IGTA 3K71B 3UBXB 3MODH 3AB0B 1RFDL 4PJHF 4X4ZA 5HHQB 4JRXE 4DGYL 1AGFA 3VGFA 3LD8B 5H8DA 1XZWA 2IPUG 3P3UA 2IMNA 2VDML 4ONGL 4OB5L 3TNNB 5D7JA 1DUZA 1KJ2A 2DIJA 3WFBH 1HINL 3UBFA 4NM4H 2L7EA 5SWZB 1L9TA 4WI3A 4M61B 3QUMB 3NSDA 3VSUA 3BFQG 4NQSA 5J6GB 4G42B 4N0RA 3ROOA 4YSDA 5DJAB 1LWHA 4X9FA 3DARA 1XB3A 1J8RA 3WFHB 1UH3A 3K5RA 5F8QC 3DGGA 5JTWA 2X6BA 2ATKB 2IDUA 4I2XB 1OAUH 4FZ8L 5DEGB 5GSRA 4KQ4L 4WI4A 1SDDA 2KI6A 5CZXC 3U9UA 5AW9B 4KO5A 2F9BT 2N0MA 1CIUA 1E90A 5SWQB 2JCCA 1YJDC 3N1PC 4NQCD 4HPYH 3AQXA 1KENL 3QNYA 5D93C 1FPTH 2B77A 4HHGA 2IAND 4LNRA 4XXDB 5CS7A 3HBGA 2VMCA 4GW5B 4DAGH 1J11A 1HH6A 3CFTA 4R8WL 1N5YH 5GGRY 3VD9A 2LR4A 2HJLB 3BOVA 3IFLH 3R4DA 4HHAA 5GS2D 2B59B 2XXMB 5ALBH 3LS5L 1PMYA 3AS3A 4Y4FC 4ZW5A 4DQAA 4Z7QE 4HF5H 2WLIB 2J8OA 4ZFZA 3UTQA 1INDH 1HHGA 1AQDA 3GMQA 4PG9A 4YPGB 3D06A 4A7QA 4LVOB 4YNYA 5CFHA 1NA8A 1QKZL 2VCOA 3PABA 4QTHA 3WLBA 1KYUA 1PLGH 3GS4A 4W4NA 2ZCKL 2G3ZA 3IDJB 3LEYL 1OP5H 1P7QA 4TUOA 3TYGH 2XV2A 2AJZB 4NP9A 5FM5M 3ARFB 4IBUA 2NY1B 1AP2B 3FCGA 2D7OA 3L7EB 1ACZA 4LARH 5B1JC 4A55A 3VMOA 3OJDA 3ZR5A 1UCTA 5F0LB 1CXIA 2ZOLB 3L48A 4HUMB 4GPVA 3N43B 1BXVA 1TZIB 4HOXA 2FH6A 2HKFH 2IOMA 3DI3B 5F7UA 3SY0B 2V4LA 5CUSH 2JFCA 3F7RA 4KKAC 5CILL 3ULVD 1X4XA 5HI3D 5BMFL 4FYSA 2ODHA 1D5BB 1MIML 4A2HA 4JM2A 1EEYA 3QHZH 4QRQA 4DTGL 1AO7D 5KJRH 5D70H 1RZGB 4JCMA 3BKJH 5E1QA 3US1A 1CDYA 4HBCL 4JFTA 4IRSC 4AYEC 4XH2A 1VZHA 4Y4KB 1LD9B 1V3JA 3BYTA 1G7HA 4GSXA 5E95B 1Q9KA 1MG3C 3D25A 3DK0A 4PI0A 15C8L 4O58H 1N26A 1P5UB 3HMWL 1CDHA 1LWJA 4BXVA 4HKXB 3QUZC 5LXVA 2QQLH 3G5XB 3NCBB 3B56A 1L9QA 3HMXH 4BZ2H 4KAQL 1VSCA 2EC9U 2BNUB 4M6NL 5ERWA 5GSVB 3QYMA 3ARDB 3BZFA 4KY2A 4U1LB 2WJ5A 5CJXC 3LMJL 4GUOA 3VI3F 2G75A 1CGWA 5T1LB 5TGBA 1SJMA 1JGUH 1U3YA 5D55A 3NFPA 5IEHA 2EACA 3W9EB 4AEHL 2A77H 2XRAH 4PJCE 5T3ZE 3C5SA 3ILPB 3LRSB 5LKNA 3SPHA 1OOAA 5DMGD 1IL1A 1C1EL 4Z78A 2H3NA 5GGVL 4FG0A 2C1OA 4YHMH 4OLUL 2YUXA 3JWNC 3NUKA 4P2RA 3P73A 4X5WA 4HKZA 2PMZA 5MENB 4QEGA 1SXAA 3NK4A 1HKFA 4RWHA 1KIRA 4WU7A 4UIMB 1OSYA 3OKDB 4YBLC 3ZE0E 4HJIA 5ICXB 2GI0A 2VUYA 3ZL4L 2FJSA 3DMMB 4WI8A 5L6YL 4HIQA 5EU3B 1NCTA 1SXSA 4N8VA 1U33A 2QTEA 3NZHL 3VYOA 1WITA 2G2NA 2E0PA 1A5FH 4NNYA 3GLZA 3H0TB 2P49B 2CHWA 4FQJH 2GBUA 2YR3A 5C08B 5C0EB 2J88L 3Q6GH 2JJSA 3ULSB 4N5ED 3J2PA 3PDOA 1AVAA 1JNNH 2WHVA 2BPBA 4HIIB 5EBWA 1HT6A 4NUGL 5A3ID 1NM9A 3KPOA 1V10A 2MFNA 2XTJC 4KJPD 5C09D 4H8UA 3SO3B 5HPMA 2FJHA 4PJ7E 4ZX4A 1R47A 4PV8A 5IOKA 2WGNB 1G7IA 1HXKA 4NT6B 4BZ1H 4UQ2B 3VU1A 1JPGA 3QULB 5F44A 1I8MB 1UT9A 1XGTA 4WW2A 5DHVH 5GRUL 1BYOA 3UFIA 1ZT4B 43CAA 3TS8A 4QRUB 1GCFA 1EHAA 1XCXA 4RMBA 1ITCA 3UC2A 1I31A 1OT4A 1CDGA 2OI9C 4M02A 4N8UA 3JYBA 1ADQL 1KTJA 5ANMB 4G70B 3U7YL 9PCYA 1B0WA 3UDWC 3BAEH 3L7FB 3UZQA 2R1WA 4KPHL 5KWYC 1I7RB 4MQ7B 1D5RA 1U3HC 2LAGB 2X4NB 4PREB 4TLSA 4HJSA 4P5KB 4V11A 5IM7B 5DGQA 4EF3A 2PNDA 2R1XA 2QDWA 4MS6A 2WLZA 4GFXA 4M1CC 2J5WA 1PQZA 5D6CB 5EEUA 4C58B 1VCAA 3A4FA 4XX1G 4G8EB 4Y4FA 4Y2LA 1X5YA 3C6LD 1HWHB 1NGXA 3NFSH 2ZXCA 2B0SL 2F7RA 1H15A 2DQGL 2B20A 1ZV2A 4OZGE 4OJFL 3V2AR 2A6KB 1E4HA 1EXHA 3C12A 4EI5A 4AH2B 5E24E 3BW9B 4J6IA 2UXFA 3VW3L 4LLUA 3MLVH 4LSSH 3GMNB 1ZVSA 1KB5H 5FYLH 5CN3A 5KSAB 1GS7A 2P5PA 3GSWB 2JCWA 4OCSH 2HPOA 2J2ZA 2NCMA 4LASL 2XQYK 4NRYB 1D2OA 4YHPB 1P0SE 1NEZB 1NCWH 4DIXA 4RMSA 3BH9B 4PJIA 5FKPB 1MZYA 1MCPL 1SMOA 1KTKE 2XWTB 1HESA 3K4AA 2YD2A 4ANUA 2FZ3B 3L5WB 3A21A 1PKQE 5JQIB 1ZE3H 5ACMA 2ISDA 4UNUA 1J8HE 3U0WL 1Z3RA 1JDAA 1BQHA 1RUPH 1U3ZA 3LXAA 3T0VA 1Q72L 2D7TH 5DWPA 5EN2A 5FOBA 1AGFB 3W5NA 2VR9A 3G5YA 1MJUL 3Q5OA 5HHPA 4HETA 4AJYV 1LP9F 2VTFA 4X5RA 1TTBA 4KKAD 5D7JB 1DUZB 1KJ2B 1QACA 2BWQA 2KZBA 3FN3A 1G6RL 4ELKA 1F18A 3A3YB 1U8NA 4TQEH 2PCPA 1XT5A 2EYSA 2IIJA 1KELH 1T5WA 4B9JA 1BMZA 4NQSB 5ESVA 3QS2A 1E50A 2K3TA 2VH5H 3T71A 2J6EH 4C55A 3ROOB 2EYTA 1U3JA 3GRWA 4OLWL 4XE0A 4YSPA 5AVYB 3DA0A 3QUZA 5HGBA 2BNQA 5CJQL 3MBXH 1FCCA 3DGGB 2QVFB 2WP3O 3VXUA 1UTDA 3KHQA 2W88A 5BRZE 4OD1L 3KGSA 1LLAA 5GSRB 3WD5H 2Y6SC 4JKLA 5L2KD 1SDDB 4RGNB 4MZ3A 3U9UB 1L9NA 5E8NA 2F53A 4MMYA 2N01B 1OM3L 1AGEA 3K3QA 4CVUA 3KH3A 2ZP8A 2JCCB 1A9VA 4I1NB 4FQ2L 3QNYB 5D1ZD 4XXWA 2KQMA 4F15B 4LNRB 1J1OL 2DTSA 1OAZH 3U6XA 1HH6B 1CLOH 2Y7OA 3GBML 2VZ1A 4HHAB 3E8VA 2CQVA 1QABA 5M94B 1I3GL 4NQEE 2VR6A 3HC3L 4ZFZB 3UTQB 3VA2C 1A7NH 1HHGB 3D12B 3MGOA 5MEPA 1AQDB 3FO9A 3FQNA 3GMQB 3KLSA 4PG9B 3R7RA 4Y1SA 2NX5D 5EIVA 3MCG1 3ZO0A 3TA4D 4K8RL 4YNYB 5F9WC 4ZMVA 3WLBB 2VLKD 3NA9H 3PABB 4QTHB 4WWOA 1Y1UA 4LO9A 3I6LE 1FNAA 2P5ED 3OR7A 4S1QL 1P7QB 4TUOB 3HFML 4DGUA 3MUY1 5D1QC 1QNZH 1FDLL 5I1KH 4KTDL 2C9RA 2H0PA 1YAZA 4ICWA 4IBWA 3OJDB 3EYSL 4LQ1A 1E4XL 1WHOA 1LL1A 1FRGH 3AG2B 3UYPA 3AU0A 2WBKA 2CD0A 4NERA 4XNYH 1E4JA 5DLMH 5F6HI 5MP6H 2YLKA 4DN4H 2XTJD 4YHLH 2DEYX 4JM2B 2C4FU 4Y16C 3SODB 4DEUA 2VJXA 1TDQA 1EEYB 4QRQB 2J56A 3GC3A 1B0IA 1J5HA 1IFHL 4A68A 3FCSA 4GLRH 3OLDA 3W2DL 4PRAA 2BX5A 2VDPB 3QEGH 4K73A 4XH2B 2VDOL 1H6TA 4X6CA 1ZPUA 1MJ7L 1G7HB 1TPXB 1Q9KB 1MW2A 3BN3B 3D25B 4QOKE 4PJDF 3CC1A 3OWEA 3C2SA 3U1SL 3W0WE 3TTYA 3I02A 1VPOL 1S9YA 1PY4A 3JQOB 2F5BL 4GXFA 4TXVB 4J27A 1R3HA 2Y2TA 5E8DH 1DBKH 1H5BA 2AJSL 3H3KA 5ERWB 3OZKA 5A2JH 1EBAA 3BZFB 1XX9C 2OL3H 3ORJA 1C8PA 1ES0A 4FABH 2B1AH 5DQJA 1B4JH 2G75B 3HS0C 2O26U 5TGBB 1CGVA 2AQTA 4HIXL 3N85L 1JK9A 3NFPB 5IEHB 4KKBD 4TUJA 3IJSA 3BKCH 3O0RH 4A38A 2HT2C 4U7SA 5GS1A 3C5SB 4R7DA 1JGDA 2ZCHL 2N56A 3IXTA 4Z78B 2H3NB 2O5ZL 4ODVL 2C1OB 4F7KA 5T3ZH 4W9FC 2R0WH 4P2RB 3P73B 2OMNA 4HKZB 4X5WB 5FWQA 1BMGA 3AT0A 2RH0A 4LT7A 1H3PH 1XF5A 2JK5A 4JHWH 4JO1L 3DXAA 4J3VA 2QSQA 1KIRB 4WU7B 3WO3B 4N0YH 4PV1C 2OYMA 3WG7B 4GRMA 2IPTL 4PBXA 1M05A 5GJSL 2NY7L 3VXME 2R9HC 4ZO8A 4G8GE 5E1GA 4AE1A 2FX8H 4J3OG 1RL1A 4N8VB 2J1XA 1IKNC 1W6LA 4ZXBD 4JREC 2QPDB 3S4SG 3TP4A 2PTVA 1T5KA 4P9ML 4NNYB 3OJMB 4OQTL 4Y8DC 2A0LC 1JE6A 5FUZH 1A21A 3VG9C 2Z4QA 1XGYH 2CM6A 2KZKA 5AAPA 3KWUA 4AQZA 3GI9H 2ARWA 1ID5I 4RX4A 3PDOB 1UKSA 4R4ND 5EBWB 7TAAA 3FRPG 5KBMA 3KPOB 1O75A 4LSTL 5HPMB 4EAEA 1QHQA 2FJHB 3IB4A 3L3KA 4NC1C 4PV8B 1G7IB 1MXGA 4PBDA 4XOAA 3ZYZA 4RA0C 1JPGB 2E3VA 1CDUA 1XGTB 4AJVA 1FH2A 4WW2B 3PJNA 1A3LH 4K7PL 43CAB 3T3PE 1O9ZA 3QEQE 4HWBL 1K9TA 4K5PA 5HHME 2ZXDA 4ZX6A 2WYHA 3NTCL 1E2ZA 4WI9A 1LGVA 1FL5A 4X6DF 1F00I 2HKHH 5SWSD 2YAHA 4Q6YA 4HSAC 1PZ2A 1P4IL 4JPIB 4XOCA 4EOWL 1A6PA 1NDTA 1CTNA 1RK0A 1ET8A 2WNKA 5D93B 2Y6SD 3B5GA 3UZQB 2R1WB 4HPOH 1N7MH 5D96B 3WEXA 5I75C 1BF5A 1S78C 3ATDA 5A1AA 3QXUA 3FH8A 1NC2D 2R1XB 4Q6IC 4LK4A 3UBXG 4EKJA 2Z9TA 1RFDH 4J3BA 4U4IA 3V8CA 4DGYH 4ANVA 2QKIA 3K6FA 2X4RA 2ZXWB 4TVUA 3QXWA 4PWEA 4Y4FB 2VDMH 4JQXC 1NGXB 4ONGH 4OF0A 4RMWA 2EDMA 1S7QA 4NN6C 3RUGE 1QFWM 1Q94A 1H15B 5MEQB 1HINH 2WNWA 1NMAH 2QSCL 3MRKA 4RESB 2BZ7A 4EI5B 2D2CC 2ITDA 1WWWX 3F64A 3W39A 2O30A 2WXIA 4LLUB 3BPOC 3S35L 3E6HA 2CIKA 1ZVSB 1REIA 2IPKB 3M45A 4PJAE 5EU6E 2VC2L 3OSVA 3FBKA 2J2ZB 1OAXH 3PPEA 5D1QA 4IKKA 4NOBA 4X7CC 4TVPD 3VRLE 3G6JF 5EC1A 2UY6A 4FZ8H 4KQ4H 4PJIB 4X9YA 1Y6MR 2O6DA 4QT5A 5F9JA 3RBGA 3O6FC 4HSCX 3U7AA 2NLJA 4PB0L 2FLRT 3B9AA 3VGEA 3ZX1A 3VQLA 4IKLA 4J8QA 5IVXF 1M9WA 5CN1A 4NKOA 2VL5A 1UWEL 4WDIA 3U1QA 1BQHB 3M88A 3EO1A 5FOBB 1E2WA 1KV7A 5EN2B 3QB7C 3BI9X 4FXKA 5F9OL 1CE1L 1KLGA 3G5YB 5HHPB 2R2EB 2AV7A 3HI5L 1RZQA 2BP8A 3ARGC 5I82A 2OZNA 2GHWB 4PB9L 3LS5H 3NH7L 3NT0A 4LSUL 4ELKB 1JVKA 4NJAH 1U8NB 2MPAL 4LOUC 2PCPB 3WNLA 2EYSB 2WWMC 1FZMA 1T5WB 4CMMA 1YQ2A 3QNFA 1L0QA 5ESVB 2ZUTA 4JFDE 3O4OC 2QSVA 1C12A 5DHEA 3MLWL 2FATH 5LBVA 2EYTB 3FCTB 2NNAA 4M8UA 3K1KC 5CSBA 3EYVA 3QUZB 2NZ1A 5HGBB 2QV4A 1QKZH 3ZBMA 2NSMA 1IZJA 4IBZA 3VI4E 4GXUM 4U7MA 4JO3L 2XCMC 1KNOA 2ZCKH 1KYOJ 3CPLA 3VXUB 3TEWA 3LEYH 3D07A 2X5PA 2ZKHL 1OOWA 3VD1A 2ZG3A 4G59C 4NSKA 2EEAA 4MMXA 2F53B 2O93L 2Y7LA 2ZF9A 1AGEB 1HSBA 2JSFA 3N1QC 1JZIA 4L8SC 5IZ7A 4HX1A 1TG8A 3KYKH 5ESAA 1R5WA 1BZOA 3U2IA 1MFVA 1MCLA 2KYIA 1O9WA 5CILH 5I5IA 3QXDA 4F2MA 5BMFH 1UATA 1MIMH 3GTVA 1KN4L 3H2PA 3L6FA 3AXIA 4A2DA 3BQVA 2K7PA 3VSVA 1THCA 4DTGH 5DRWA 4MBRA 3WS6A 5MEPB 4HMDA 1JAEA 3GSNL 3MGOB 4XTRC 3FO9B 3FQNB 5DZJA 3E80A 4HBCH 3VVVA 1U4FA 3KS0J 1RP8A 3Q2WA 5DF0A 3TOPA 4FHJA 3SDDC 1GGTA 5GS2H 1HKLL 5L4MA 2YD7A 1J12A 4PJEE 4MXQD 4N6QA 1YAIA 2R9HD 4CILA 4MD0A 2WLHA 2H6PA 2YN5A 2AQRA 4TVSa 4KAQH 4JKNA 4M6NH 2AERT 4E9WA 3HVNA 4WFED 1LO5A 2XQBL 2A0LD 4AW7A 5CKAA 4NI6A 3X1EA 1JXKA 3ULUD 1G7MA 4G1MA 2P46B 5F89A 3UYPB 3EJCA 4MCYB 1CQKA 4EZMA 3US0A 1XSJA 5EO0A 2D9CA 2ESVA 1F4YL 4DKTA 4AEHH 5K59E 2PLTA 3FUDA 2OSYA 4POZC 3S3CB 5MEOA 4FTVE 1JXFA 1WBYA 1C1EH 1I1AC 5GGVH 2NDGA 2OI9B 4M8QA 5GJTL 4OLUH 5LAPA 3VFNA 3FCSB 4PRAB 3UG5A 1JZGA 3ILDA 5DJ2A 1VJSA 2VXQL 3JV5A 4OU3A 4TRPL 4X6CB 4YDLB 4PRDA 1W0WA 3ZL4H 4FFZA 3T2LA 3I02B 1EUUA 5B8CC 1A6UL 1FLTX 2YHGA 1S9YB 3NZHH 5TE7L 1PZAA 1WISA 4KH9A 3TZVC 3PG2A 3JSSA 1WJ3A 2CM5A 3DDGA 1CF1A 1EMTL 4YSAA 1R3HB 4JQXA 3QXVA 2DW5A 1AR1D 1S78D 3CFKA 5AYUL 1H5BB 5C0JA 3WU1A 3IPEA 4J7RA 2X12A 4ZBJA 3MPCA 4A2MA 2AXJA 4PJ5D 1G84A 1ES0B 2J88H 5DQJB 3IJHA 3P40A 1MNNA 2DWTA 3PV6A 5FGBA 3T08A 1JK9B 1NUDA 2H5UA 4TUJB 2GW5A 3FSVA 3HG0A 3IJSB 4IK7A 5JYMA 3AITA 4YDVA 5GS1B 4DFIA 2F5AL 4R7DB 1JGDB 4ZFFA 4IOSD 1PNCA 3IXTB 4WEMB 4I2XE 5D72L 1X4YA 3IS0X 3GDCA 1ZIBA 4XBGA 2EXWC 4FQPA 3UTSD 1U0QA 1XF5B 2JK5B 3DXAB 4GI8A 3BXNA 4YUEL 4HAKA 1EJFA 1W15A 3U7YH 4GRMB 5D7LD 3OD3A 1M05B 4J39A 4XO9A 3F00A 4WF7A 2BRRL 4KPHH 1PCSA 2IV8A 3O6FD 5D4JA 1XXFC 2WXHA 2DWSA 3FUMA 3H2QA 1DSWA 1Q4NX 4S0TD 4BD4A 4JLRA 2X70A 2AMUA 1H3XA 2Z4QB 3UTTE 3NIGF 1IM9D 2Q2EB 4OFQA 5BO1L 1NGYA 2B0SH 3T0AA 4DN3H 3GMOA 1HHIA 2DQGH 5B4MD 3RJQB 2H41A 5LLIC 2QFPA 1T89C 4OJFH 2WAHA 1AS7A 3ARGD 1Y1DA 3SE4A 3MGTA 3NCFB 3L3KB 3ETTA 1CGSL 1S7SA 3BWZA 3RWEA 2WQAA 5KAQG 3KM2A 3VW3H 2H9GA 4KX7A 2WWMD 3OV6A 1JTPA 2WPGA 2W59A 3D39A 4TQPA 1ZJBA 3LQAL 4BK5C 3VQMA 3H42L 2JB6A 1A4JA 2NR6D 3MLYL 1HXMA 3ATAA 5EEXA 4LASH 1DQTA 2WTOA 4AL8L 1IIIA 4KRMB 2X4TA 3FN0H 1FL5B 1BHGA 4L1SA 3WO4C 1IC5L 3RPIA 4HG4J 1MCPH 4IK6A 2E4TA 5GRJL 3D6GA 4EDXB 1RK0B 2ZWKA 4FERA 4DK3A 4G6MH 1T0NA 1KPRA 3WEXB 1KCWA 1HH9A 1BD2E 1FNEA 3U0WH 1VZIA 4BUHA 2BH0A 5AVTB 1Q72H 2QKIB 2X4RB 2DIBA 1MJUH 4AYFA 4FLQA 2D3NA 1WWAX 3OPZH 5INDA 4FC3E 4GO9A 5EU5A 1S7QB 1G6RH 5CCJA 3HS8A 1Q94B 1AXTL 2F2HA 2JXMB 2WQVA 1IC1A 3MRKB 3T0DA 2XWXA 3CIQA 4FRWA 5F9WB 2ITDB 3W39B 1DN2A 2ZG2A 5T8IA 4QJ4B 3E6HB 1C7SA 2CIKB 4ZMWA 2ERJC 1CD0A 2VR5A 4UQDA 1C5CL 3IDGA 3D34A 4OLWH 4ZODA 5AOJA 1D2PA 3BX7C 2YGOA 5CJQH 3AC0A 3OLIA 5AYTA 4PGZA 4WU5A 3ARYA 1Q0EA 5D1QB 3SDDD 5KVEL 4UMGA 3GRBA 5HDQL 4OD1H 5EC1B 3X12A 3WI9A 1TNNA 1Z9NA 2UY6B 5J11B 3BUBA 3B43A 1KMGA 3GRGA 4QT5B 3HG3A 1FGNL 2EDXA 4N0FA 3ULVL 2NLJB 1OM3H 4UIKL 1Q1PA 2O1AA 5EDSA 1BVLA 4HD9A 4XCEA 5DMJB 4NKOB 2VL5B 3ESMA 4WDIB 5F8RC 1J1OH 3DO7A 3EO1B 1YMMD 4Y16B 4QKXB 1P9MC 3GBMH 4JANA 1KLGB 1NPJA 2AV7B 4MAYD 3DURA 4NFCA 2ZOOA 2BP8B 4XNDA 1MIEL 1I3GH 3F7LA 2QQNL 1OARL 3HC3H 1I1AD 2XQ0A 4RFEA 5DMIL 1FZMB 3I9GH 5C0GA 2BERA 4Z7UA 3B9DA 2EDNA 4CMMB 1J0KA 1UZ6F 3JVFC 3CHXA 1YA5A 3WJLA 1C12B 3AXHA 2NNAB 4K8RH 1TQBC 3EYVB 3IDMA 3QZPA 5DS8A 3NJXA 4JDEA 2HG5A 4PJDA 3GKWL 1KNOB 3U83A 3CPLB 4J3OD 2ICEA 4S1QH 2XUWA 1I1YA 3CLWA 1TF4A 4AENA 4I9WE 2FE0A 1NANH 2QSTA 4TOYL 3B6SA 3LXCA 3D4YA 3R0NA 4NSKB 3QK0A 4MMXB 1FDLH 4KTDH 1J9QA 4CC4A 2NY4C 1HWGB 5I73C 3EYSH 1HSBB 2BSEA 1E4XH 4KITB 3MBWA 2PXYA 4HX1B 5ESAB 3GQFA 5ITFA 1R5WB 3ARBA 3WUWA 5GZNA 4N2NA 5B38A 2CZNA 4NN7C 3D52A 2DI8A 3QXDB 4DEWA 4F2MB 1OSZA 3RVTC 3IGKA 3L6FB 3H8NA 2APFA 2B4CC 2R69L 3GXNA 5DRWB 1DJSA 1IFHH 2ZUVA 4CDHA 1DQVA 1NH6A 4ELDA 1JHTA 3W2DH 5E00A 4OF5A 2VDOH 4YMPA 1H3GA 1MJ7H 1IQDA 1F6AA 2X3BA 4ZUSA 5JPMA 3RHWF 3U1SH 1FP5A 3U25A 3GO1L 5FM5O 1VPOH 1HL9A 3EOTH 3QQXA 4AWJC 1KB9K 2F5BH 4MD0B 2P24A 1XAKA 2CBMA 2H6PB 1AE6L 4I1PA 2NXYB 2FWUA 1AG6A 1YQVL 1LVEA 1SY6A 1FH5L 1LO5B 2FYYA 3VTMA 1ASPA 4GG6F 2XY1A 1DJYA 1G7MB 1TIUA 4G1MB 4ABVA 5I6KA 3EXJA 3QBTB 5F89B 5JHDA 4HIXH 5T1KA 3CSGA 3N85H 5EO0B 2ESVB 4WFGE 2NMSA 4NUJA 3CUPA 4ES8A 1IILE 1SUJA 4GYBA 5F72S 4D7BA 1TVBA 1V3LA 3AS1A 5MEOB 2ZCHH 5BUGA 5HYIA 3MCKA 1WBYB 4WFHE 2ITFA 3HN8A 2O5ZH 2OZ4A 4M8QB 4ZO7A 5D71L 3O2WL 3VFNB 4KKLD 1GS8A 4GRWB 3HG4A 5DJ2B 4JO1H 4J12A 1BF8A 3WKML 3R1GL 4X6DA 3TEZA 1HCZA 2IPTH 4PRDB 1W0WB 2NY7H 4L5FE 5GJSH 4GBXD 4AYSA 4EZLA 4N8VG 1UEMA 3BZ4A 4RQQA 3AGVA 4WGKA 1MAML 4FP8H 3Q1EA 4P9MH 1FNLA 4OQTH 1ZTXE 3CFKB 4P2QD 5C0JB 4OLEA 4KGJA 1T0MA 2NY0C 4XCFL 1B4LA 1BF2A 3RL2A 5AWNL 3IJHB 4BKLA 1S7WA 3PV6B 3BC9A 3BPOB 4FMVA 1IBBA 5JO5B 4Z3IA 3GLAA 4A7UA 4LSTH 2MOGA 2OSLA 4ZQTA 1OTUC 1PLBA 1DEEA 1Z9PA 4YDVB 5A2BA 4ZFFB 1NMCC 2YMOA 4K7PH 5DYOA 2IANE 4RGNE 3SBPA 1XDTT 3HRPA 4HWBH 1TQCC 5KUMA 1JZ7A 2W0KA 4ZI8A 3UAFA 4UQAA 2B3RA 1GYAA 4XBGB 4U49A 1SEBA 3NTCH 3PWPA 4FFYL 2JCCE 3BXNB 3TPUA 2AP2A 3G6JA 4QRRD 4LOEA 3KDMA 1P4IH 2NY1D 5EG6C 4EOWH 2E9JA 2H26A 2V37A 3MCYA 1F56A 5IJKA 5JIQA 1CZ8L 5F1IA 4RA3A 1L5GA 3BGMA 4FXGA 5IVXA 2MQ0A 2PCXA 3B5TA 4J3XA 5CFAA 4NM8L 2X70B 4C4BA 3IDUA 5AKRA 3QFDA 4W6XB 1JD7A 1Z0MA 2GITA 2K45A 1R0AL 1NGYB 3V0VA 3GMOB 2K8QA 1MVFA 1HHIB 2FK9A 2FH8A 2C34A 3BD4A 3V4VL 1UGNA 3KPLA 4G7VL 3MGTB 3ZL1A 2CO6A 3RWEB 1SOSA 3S35H 5DFAA 1NM4A 1CFMA 2H9GB 3V52L 4Y4KD 3D39B 1AXIB 4PTTA 2VC2H 1E2VA 4BRVA 4TS6A 4HVBA 2JB6B 1A4JB 3BT2L 3RDTC 3T6ZA 4CKQA 1HXMB 2LW3A 4E9YA 4LCWA 4XP6L 1GGBL 2BWDA 2Z7ZA 2YQ2A 3ULVE 5F7HA 2X4TB 3OC5A 1AY1L 2ZJSL 1X5MA 1X5LA 5DFVC 3MOBL 2XFGB 3RPIB 3NBNA 2CIIA 3PHAA 4WWKC 2GC7C 2CCLA 4PB0H 1AO7E 1T0NB 1KPRB 5DCCA 1HH9B 1YC8A 1FI8C 1FNEB 2NY4D 5FLUA 1UWEH 2GC4C 3X2QB 2EH7L 4NPJA 4HU8A 1H8NA 2FX9L 2HFFA 2LLLA 3K1DA 1B9KA 2ZXBA 1CE1H 1DANU 5F9OH 3KVDD 1I1CA 5E8PA 3HI5H 4AYFB 4MA8L 4P46A 5DO2D 4DP1X 2A3TA 2CE6A 4DKAA 5INDB 5EU5B 5ACZA 4PB9H 3ARVA 3NH7H 4LSUH 5AFAA 5L9DL 2F8XC 5LBSL 2JELL 3U2JA 4B95C 2H32A 1WFNA 2MPAH 3QZWA 2VLME 3CLFL 3S37L 4LQFL 3EIFA 3MLWH 3UOAB 1X9UA 4AIZA 3IDGB 5TK4A 2JKSA 2QGEA 4JN1H 4KK5C 4WU5B 4U0RC 5DFTA 1H6EA 4JO3H 1CDIA 1E6JL 5CF3A 3X17A 2Y23A 2ZKHH 3X12B 3W56A 3MOQA 4FE9A 1NIAA 2QDVA 3VYNA 3IFPA 4IRJC 4XNMA 4N0FB 4AK2A 1G7LA 2AQ1A 5EMYA 1COBA 2VZVA 3O11A 1BVLB 4CJ1A 1SMDA 4FQCL 4XCEB 5HD8D 3A47A 2P8PA 3MJ9A 3DO7B 1QBAA 3PFUA 4F93B 4JANB 3DURB 2FHCA 4P2RE 4F9LC 3A4DA 1KN4H 4RVBA 2Z8VC 4JKMA 2X2UA 2X10A 3NA4A 3K5SA 2W91A 2OSWA 2RD0A 4GJTB 3HHMA 4RFEB 5C0GB 3GSNH 4NJ9L 4Z7UB 1BBDL 2WY3B 2YD6A 1UM4L 1IGTA 2APSA 4LU5L 1YG9A 1T6WA 3O4LA 3IDMB 4DJMA 5DS8B 1I9IL 1HKLH 4JDEB 4GY4A 1CC3A 2HG5B 4PJDB 2X0VA 2ICEB 1JCKA 3FDWA 1R24A 1EZVY 1I1YB 4LL4A 4LZKA 5C0AE 4AENB 4O2CA 4BQBA 2J8UA 4F9PA 2PWGA 3B6SB 4O9HL 2APTA 3NCCB 1KTDA 3ZTJG 4OLVL 3DBSA 1CN4A 4Z7NF 3RE0A 5DRNA 2XQBH 4HJEA 4QWWD 3MBWB 2PXYB 5ITFB 4JDVA 3SDAC 4A39A 3ARBB 3ULAB 2BSCA 5B38B 1BV8A 1F4YH 5JHMA 4FEIA 5CP3H 1OSZB 3OGCB 3HR5A 3QC6X 1YEGL 3QAZC 4Q6KA 2FEDD 4CSZA 3T5WA 5GJTH 5T1DL 3VXSD 4JPQA 1JHTB 1MCFA 1OK8A 3MN8A 3UTZA 4EN3C 2E6JA 2OP4H 4GP8B 4BCXA 4LMQI 3UEZA 2VXQH 2YAFA 1IQDB 1RULL 5IFAL 4ZUSB 2EKJA 5JPMB 4UT9A 4AITA 4ZMLA 2WJ7A 4U1HA 4IU2A 2X1QA 1A6UH 4LLVA 5GGTL 2CG9X 1M42A 5TE7H 5BS0D 5DMYA 2P24B 1EMTH 1BVNT 1GYVA 3FU6A 3Q2VA 1SN0A 1UA6L 5AYUH 2BZDA 1JZDC 2FO8A 4XMKL 4BWTA 2FYYB 3D69A 5K5YA 2X1XR 1JNJA 4Q52A 3NEEA 3RFZA 2R2BA 3PJLA 3G7TA 2NTFA 4UB0L 4E9XA 5JHDB 1HWWA 4F7TA 5T1KB 5FWRA 2WXLA 4NUJB 3CUPB 3GXIA 4G9DA 4GW1A 4PCSA 5CLTA 1L9PA 2F5AH 1TVBB 5H94A 3FO0L 1E8YA 3VXQA 3MCKB 5D72H 1AHMA 1C5BL 4B7LA 4YN3A 2KPNA 2YS4A 4JZJA 5CNHA 2BSBA 3OAWA 1BZQK 2YKKA 1WGVA 5DJZA 4HAFA 3LZPA 5E2JA 1EJOL 3S88L 4MMZA 4YUEH 3S8GB 1G7PA 2XBZA 4X6DB 3CVCA 3BN9D 4JEGB 4M48L 1S7VA 4OZFA 4WJG3 5DFVD 5EHFA 3CFQA 4AVIA 2BRRH 1MRDL 3BZ4B 4RQQB 3J27A 5J3HC 5FA4A 5FYJD 3QZOA 3QWQB 1OGAA 1RCYA 1CMOA 1T0MB 1LJMA 3MACL 5TF1L 2X88A 3RL2B 5E9DE 5BO1H 3W1ZA 1TTFA 1FNSL 4BKLB 5C0FA 5D6DA 1S7WB 4EN2A 1DLHA 2ZZUT 4WV1C 5MI0B 5L2KE 2ERJB 1DJWA 3PWNA 3QR0A 3BSHA 2OSLB 4TVPL 1DEEB 1CGSH 2DD8L 3DX6A 5KBLA 4OY9A 1SFDA 5E2UL 3NPSC 4LVEA 3I9PA 4JZOA 3FT0A 3LQAH 4YLQT 3H42H 4N2EA 5DYOB 5ECJE 1AZNA 3MLYH 3FFCA 4AL8H 4IRJA 1PLCA 2UUDH 2WAQA 3O2DA 1SEBB 3PWPB 5F7MC 2AZUA 3TPUB 3G6JB 5E1IA 5F70A 1IC5H 3UO1L 4CGTA 1VLXA 5GRJH 4NPKA 3VXOA 1VACA 1XH0A 4GSRA 1D7DA 4F24A 4M1DL 4Q2ZA 5F1IB 1V8HA 1L5GB 1QAWA 3BGMB 4C4KO 4E5XA 5F6IB 5KSBA 5HDBE 3VGBA 3JWNE 2NX5E 3L4UA 4FXGB 4IOFC 1HIML 2K9FB 3P0GB 1YDPA 1WAEA 3W11C 5IVXB 1FYTD 2F1AA 1FVDA 2VLKE 3L3OA 3QFDB 3QI9A 2EO1A 2H6OA 4L4VD 4KX8A 1TJXA 5I19L 5INCA 2Q10A 2GITB 4AGMA 5AAWC 2P5EE 2YRLA 2XOTA 4RWYL 1RH8A 3V0VB 3WTUA 4JM2D 1AXTH 4NO0A 1SJHA 1THAA 2G60L 3EJPA 4YWGL 3AWEA 3KPLB 5EF3A 2CO6B 4MRBA 2AK1L 4D94A 1OTSC 1C5CH 4PTTB 5HTSA 1RVFL 3STZA 2WLKA 2XHNA 2H3XC 4LCWB 5KVEH 1AKJD 3QJOA 3J8F7 5HDQH 2D3VA 2XTJE 4Z7AA 5I73B 2EUXA 1G94A 4ANWA 3MKGA 2DPKA 2XTSA 2CIIB 1FGNH 2B2XL 2YIHA 3GSVA 4XZ4A 3BPLB 4D8OA 1UJTA 4GAFB 4UIKH 2NY6B 5GPRA 2EDRA 2CRMA 2EIBA 4NN7B 2ED6A 2E9IA 3QNXA 3MTXA 5FO2A 1M9SA 1NPUA 4MJHA 1BPLB 2BY3A 2P44B 1GOGA 1XBDA 1S7RA 3X1BA 2HFFB 4OD2A 4YL9A 5J13C 5E8PB 2I27N 3VXNA 4X6FA 3SPGA 2A6DA 5ACZB 4EN3A 1MIEH 1Y07A 4X6CE 4CC1A 2A73A 1UH4A 2H32B 2QQNH 1OARH 2FJUB 3EYQC 3LIZA 3QZWB 4XPGL 1BQUA 5DMIH 3UG3A 3HZKA 2F61A 2E9BA 2YAOA 1B6DA 3MLRL 5DD0L 3RYMA 4AIZB 5CGMA 1K3IA 2A1WL 1QTPA 2Y22A 4JFEB 1NCAL 1KXTA 2VJ0A 3GKWH 4B53A 3ULUL 4OTXL 1YNLL 2UXGA 3EGXA 3SCMD 4A6YL 4TOYH 2MIZA 2WO4A 3H56A 5F93C 3QJFA 1KBPA 5J12C 3IFPB 3W57A 2FWLB 4XNMB 1G7LB 1QUPA 3ASWA 3AMKA 1UVQA 2MHAA 1CYXA 3O11B 4ZS6C 3Q01A 1FO0A 1DQKA 2YEZA 4OJCA 4DP6X 1QMUA 2P8PB 5KVMC 3MRHA 2DYPA 1X5HA 2I9LA 2VLJA 4CN1A 4EZJA 1EDQA 3ZDWA 3O9WC 1VCBC 4NXSA 1DQIA 3OKLA 2A38A 4AVJA 4HBQA 2R69H 1A02N 3PJSA 2Y5TA 3SYOA 1TQWA 4XPFL 1WZLA 2AJUL 3DPBA 3MQIA 1QRKA 1II4E 4NUPA 1FZOA 2B7DT 1AD0A 1IGTB 1FNGA 1O7VA 1XTLA 3LNIA 3O4LB 3MV8D 1E4KC 5IHBA 1J0ZA 4AUYA 3GO1H 1PX3A 4YO0A 4APXA 3BP4A 4PJHE 3M1BA 1T2QL 1R24B 1UQSA 3H9HA 4O2CB 2J8UB 2EUWA 1AE6H 1S9KC 3EH5B 1Z5LA 3DBXA 4Z3FA 2NYYC 1KTDB 3PF2A 1FH5H 2ENJA 3N1GC 5DRNB 4IS6A 1KIUA 1P4BL 3QRGL 4G43A 4JDVB 5C07A 1TO4A 2ZUUA 4JO4L 2DH3A 4XMVA 4YHYB 4HKBA 1NMCB 5A2AA 4HH9A 2TSBA 3HR5B 3U2SA 2E46A 4HUXA 3Q8FA 1PW3A 2ZSVA 5C0CE 4JFZL 3QXTA 1YVLA 4W9IC 2Q6WA 5D71H 2EXYC 3O2WH 4ZFOA 2M1KA 5FCSH 2VDRB 3UTZB 5LHDA 4GT0A 1NCOA 4K94L 2RQ8A 1FWXA 4AYDC 3WKMH 4Y4HC 3R1GH 2YSTA 2BFVL 4NNPL 2G5BA 4IU2B 2G9HA 4LLVB 3HJ0A 2FHFA 4JPVL 1AZCA 3KH4A 1HU8A 1P69B 1MAMH 2AF2A 1PFOA 2W60A 3CBKB 2F7OA 1H6FA 3CFBA 4EZKA 4IOFD 1XGPA 5KW9L 3W11D 3D69B 3LIUA 4XCFH 1MFNA 1ZDQA 3NIGB 4TVPE 5AWNH 5BV7C 3RFZB 2R2BB 1HL5A 4GOSA 5DC0A 2NTFB 3O0LA 3POHA 4F7TB 1N18A 4L1DA 2V5YA 4IDJL 4OCYL 1NAML 3F58L 3VFSA 4G9DB 4GW1B 5I1CL 4H8WL 2W1NA 5D1QE 2YPLD 1SN5A 5H94B 3V0FA 1WDAA 5CSZA 3VXQB 5I2IA 5DHYA 2BNQD 4JZJB 4DO4A 4M7LT 4YR6A 4TSBH 4Y5YA 5I76A 5DJZB 4FFYH 3LX9A 5C92A 2QLVB 3MYJA 1WIUA 4MMZB 5CJBA 1G7PB 2UY7A 5HYJB 4ELMF 1F8TL 1FJ1A 5T1MA 4OZFB 1S7VB 3DVFA 4KGLA 4MJID 5IROD 3BP6A 1YPZF 2WQRA 1OF2A 2F53D 4GP4B 5DZLA 4BH7A 5ICZA 2PWEA 3KR3L 1CZ8H 3SDYL 4UOZA 3GSRA 3FTZA 5FA4B 2F54D 4I4WA 3BIBX 5IGXL 5I9QC 4NM8H 1H19A 1OGAB 3OVUB 1PEWA 2BVTA 1P4LA 2Y7MA 3SYCA 5EOCL 1R0AH 5C0FB 1DLHB 3RWGA 2PCYA 4N2KA 4EI6B 4ZAKD 4BZYA 3APNA 3PWNB 1NUGA 3OJ2C 4G7VH 3V4VH 4POYA 4FJ6A 5F7YC 3ZRCC 4ZTEA 1OAYL 1RKRA 2CXGA 3DX6B 3EYQD 3WN5C 1MW0A 3V52H 3MSPA 4JZOB 5JHBA 5BXFA 4N2AA 2YAQA 3BT2H 1TMCB 2BVPB 4KRNA 1FL6A 4XP6H 1GGBH 1NCUA 3FFCB 4J28A 4IRJB 2IH8A 4M3KB 4WO0A 5C1MB 5I0VA 2YGQA 3MRPA 4XOEA 1OWRM 1AY1H 2ZJSH 5F1SA 3RZCD 1Z0NA 3MOBH 3G04A 5DZAA 4FTDA 1U2CA 3VXOB 5AUMA 1UB6A 1VACB 3VI3E 3V0IA 1E5ZA 4ZX3A 3HB3D 1NFIA 3CHQA 3CN3A 4Q2ZB 3TYFA 4E5XB 5KSBB 3SE3C 3KXFA 3EW3B 4AC2A 3K4ZA 3O9WA 3HG1A 2EH7H 1YDPB 1RSFA 2MTPA 1TNMA 2NSQA 2W9DL 5F7BA 2VUKA 2WVVA 2FX9H 3L3OB 1NGZA 2BIMA 2PPDA 3QI9B 3QIUD 4MJ4A 3VQ1C 1X7TA 2NT0A 1A3RL 5INCB 4GI9A 4MA8H 2Y2YA 3TVMD 1FAIL 2WXQA 4JG9A 5BCAA 2C7UA 4NO0B 5HJ3A 3VAEA 1SJHB 1UZGA 5L9DH 5HGHA 3CN1A 5I6PA 2E86A 3CLFH 1N6QH 4EIGB 3CPUA 4QCIA 3S37H 3QQ9C 5HVHC 4LQFH 5I71C 3C2AL 3WJMA 3DHUA 2MMXA 3STZB 2HTLC 4X5PA 2AQQA 3VFUA 2DWXA 2EDQA 1O9VA 2GIMA 4Z3HA 2VQ4A 2FO1A 3LS4L 1E6JH 4HZ1A 1RHHA 1ETB1 2LABA 3KPPA 3P3YA 4EIZC 3B8SA 3D18A 3IKCA 1U21A 5KVFL 5I24A 1A64A 4NC1E 2IDTA 3GSVB 3L5IA 3WBDA 1VFMA 4PJGA 4FQLL 2ESVE 4I0PA 2APWA 2JLPA 4WGVB 2DS4A 2Z93A 2VR8A 4FQCH 4Z6AT 4CUCA 3N41F 2O6PA 3QNXB 4P4KC 3TEXA 3MNDA 5LNEA 4LL1A 4YHOL 4GNKB 5T5FA 5FHBL 1S7RB 4OD2B 4IEFA 1GJUA 4GIOA 3HE7A 3B2DC 2NY2B 3VWKD 3VXNB 4X6FB 4TQ8A 1XSIA 1JV2A 2NUPA 2A6DB 4EN3B 4W9JC 2A73B 4AEFA 4R83A 5KG9A 4X98A 1CXKA 3KPRA 2D31A 4NJ9H 4UM9A 3SBWC 1BBDH 3HZKB 5B7MA 3FC8A 4UZSA 2VZTA 3LPWA 2CUMA 2QGBA 2QVKA 2Z91A 3WS3A 4LU5H 4Z1PA 3WHE0 4HK0A 3GD1C 4XNAA 4QHMA 3R19A 1DBJH 5CZKA 4MXWL 3L4TA 5H4ZA 1I9IH 3N40F 4Y4HD 1KXTB 3T0EC 4NCDA 1GIGL 1XSOA 3EGXB 1CI5A 1JHLL 4R4BA 4XE5B 3QQ3A 4O9HH 5I6OA 2E7MA 3N1FC 3QJFB 1QLEB 4GRLC 5AZ2L 1N12A 5SX5H 4CN4A 3QUML 4OLVH 5KS9F 2ZONA 1XF2A 1UVQB 2MHAB 4N8CL 3L45A 3ML8A 4HWZA 1FO0B 3ECVA 2VDKB 2YEZB 4MNQA 4RX4D 3FTYA 4KTGA 4L3EA 3WUWG 3MV7A 4IRZA 3T65A 2OMVA 1EDYA 3LPPA 5B38G 3MRHB 2DYPB 2I9LB 2VLJB 5BVJA 1OTTD 2E59A 3T6XA 3D4CA 3FUNA 4FG2A 4HJ0C 4R90L 4RMQA 1SXBA 3LRHA 2WIIA 3BHBA 4WUKL 3JT0A 1YEGH 3OKLB