2C34A

Leishmania mexicana icp
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
116
structure length
116
Chain Sequence
b'GSHMIAPLSVKDNDKWVDTHVGKTTEIHLKGNPTTGYMWTRVGFVGKDVLSDEILEVVCKYTPTPSSTPMVGVGGIYVVLVKPRKRGHHTLELVYTRPFEGIKPENERYTLHLNVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INHIBITOR OF CYSTEINE PEPTIDASES
publication title The Structure of Leishmania Mexicana Icp Provides Evidence for Convergent Evolution of Cysteine Peptidase Inhibitors.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Inhibitor
total genus 10
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2c34A00
2C34A 3CBKB 3M86A 2NNRA 3E1ZA 2H7WA 3M88A 3PNRB 3CBJB 2OULB 2WGNB 2FO8A 2NQDA
chains in the Genus database with same CATH superfamily
2I60H 4FEMA 1T2JA 3H0TA 2BSDA 4YDLC 1SN0A 3QPQC 1M2OA 2YK1L 5EZLB 2WN3A 5ID1B 3SODB 5ITBL 2OX5A 4HLZG 3QJHA 5IFJA 1U8QA 3MRJA 3O3EB 5FOBB 2XFXB 4IKJA 2FUQA 1NIEA 3HS0B 4D94A 3DHMA 4RAUB 1F2QA 2OP4H 4JY4A 3T0VA 4YFEA 1JZJA 5BV7C 5K59E 4I85A 2XG5A 4HCIA 3T3PF 2FBJH 1BQLL 5JORB 3FU0A 1H19A 3BVNB 4UT7L 5SWZD 2OYPA 1DVZA 3CPLA 4JGJA 4XH2B 1KN4H 3EIFA 4YDVA 4ANVA 1HDMA 3R8BB 4BRJA 2Y7OA 2W38A 1GHFL 4OCMC 4PFEA 3MLYH 1KIPA 4U4BA 2G30A 4QXUL 3MYJB 3ZR6A 4C54A 1Z0MA 3Q6FB 2J3SA 3MLXH 5ADOH 1DVFA 4KPHH 1FAIH 2N0MA 2A6DA 1HIML 4QRUA 4BEIA 4ZXBD 3E0GA 2ADGA 4UU9B 5IJCC 4P46D 4ANKA 3GUTA 1LTXA 4G42A 1Z32X 4XPGH 2R51A 2OYLA 5B3NA 3S5LG 4PLJD 1VKXA 2BP0A 15C8H 3QEHB 3WDJA 3BJ91 3T8XB 4LT7A 3KPQA 4H1LH 5IG7A 4TTDC 4IEFB 3S3SA 4WW2C 1HHKA 3LKQA 4ZFFB 2F8VA 4I88A 5A40E 4FHBD 3VGAB 3MCKB 4P9MH 2QPDB 3V4PB 4HCRL 5AW5B 1N12A 2JJSA 5MP6L 1T3FA 5I8CA 4YX2L 5ICYB 2E7LC 5DZLA 4AG4H 1KJVB 4IBYA 3UPRB 1KC5L 3GJFB 3OHMB 1MHCB 3WLWD 1CU4L 1U91A 3IJHA 1UVQB 3VGBA 1OK0A 5I17B 2ZNWA 3G5VA 4F8TA 4KZDL 4F2MA 3L08A 3I2CH 5FA4A 4KHTL 1BIHA 4JKPH 3QWNA 1S3RA 3KDMB 4NKOA 2APWA 3CC5A 5JIDA 5CBAA 2W0FB 4PRHB 1AI1L 3HLKA 2FWLB 4X99B 5DRWA 2VXVL 3UZEA 5CBEB 5JW4R 2MJWA 4GIAA 3HE7C 4Q56A 5EU4A 1E30A 2EE9A 1UWGH 1A9EA 1IFRA 4LLWB 4M93B 4PJEA 1SLWA 2FB4H 2AJUL 5DURD 1LLAA 3G6AA 3ILPA 4OZIA 4XVUD 1G84A 2IAMD 5JHLL 5B1JA 4KKCC 3BVXA 4P0DA 2Y2WA 4A6YB 4IRJC 3L3IA 43CAB 3WY4A 1S5IL 3TONA 4FX5A 4Z0BH 5JDJA 3QCUL 1K5WA 1AZVA 1C12B 4A7GF 3BPLB 3ETBJ 4Z7WA 5L2KA 1MW1A 35C8H 3O0RH 4WHYG 2BY0A 2H5UA 2Z9TA 3CDGB 2C1PA 4PWIA 5DO2D 1I1YA 1ZSDA 4BH8B 3NJNA 2E59A 4GSRA 4MX7B 3H1ZA 3RWHA 4R26L 1DDTA 3KPTA 3L9BA 1A6UH 4BK5A 4L8CB 4K3JH 1E5YA 5GHWL 3BSGA 4LEXH 3IBOA 4G43B 5FCSH 2FJFB 4IRZA 2PP9A 4F33B 1Z3GH 4X7EC 5GGQH 5SWZA 4N0FB 1CFNB 2WP3T 4ELMA 2UY6B 4H2CA 4JFPB 2OR9H 3BT2H 1WGOA 3AG1B 3H9HA 4WFEE 1BXUA 4Z0XA 3SYAA 1N59B 2VIRB 1BBDH 2R0KL 5DFTA 5D2NA 1FNEB 1RZJH 5B1KA 1ML0A 2OW6A 3O45A 3S4SB 1IM3D 4M5TA 5EU6A 2IOIA 1TJHH 4JDTL 1EMTH 5DQ9B 3UABA 4MSWA 4RMWA 4F91B 1WC7A 4D7BA 3NZSA 1TETL 4P9HH 1AYRA 3AS0A 3H7LA 1MG2C 3SE6A 4FABL 1BDYA 3L8QA 4D7PA 5AVSB 3MRBA 3MRLA 4PJGB 4ZJ9A 1WISA 1AYOA 3QQ3B 1YEGL 4KUZL 3RTLA 4U1KB 1J5CA 1QW8A 4J6RL 3VWJC 2VDML 5ESVA 3U4KA 1T83A 1O0VA 4QIRA 3BKCL 1ETA1 5K69A 4WTZA 2MHAB 3SOBH 3SYCA 4Z77A 1FZJB 3WFBL 2ID5A 2ZWLT 5J1SC 3BP4A 3OKEB 1EFQA 2ZD0A 3MJ8B 3V5HA 3OKMB 5D70H 2YARA 2D31A 1I1FA 1NAKL 2IGLA 3RWDA 4MYWB 4AT6A 1XGRB 3HPLB 4RQQB 3V6OA 2IF7A 4X42A 1OGTA 5IMKB 1NL0L 2D7NA 5FHAH 2M83A 3PLYA 1IBGH 1LDPH 4NPYB 3UAJD 1KSRA 5AKTA 3S37L 3SKOA 3TGXA 1MW0A 2KERA 3AU1B 4ZSOB 4P23B 3RI5K 3C75A 1ADQA 1BG9A 1KXQA 4G1MA 1LE9A 4P5TA 4JFEE 3RWIA 1ZXKA 4A67A 3GXPA 1Q90A 3GK8L 4M8VA 2J7LA 1PEZA 3QZPA 4NRZA 5IVXE 4XMKL 2XX1A 2YZ8A 2IAMA 3FPXA 2DDQL 1BZEA 2QVMA 2JNZA 3PHQB 5TQ0L 4CDHA 2HKHL 3DPBB 1DCEA 4W68A 3GZPA 1JHTA 3B3IB 3DX9A 3D50A 1OT4A 1URLA 2QADD 2IPUG 1EJ8A 1AD9A 1LD9A 3EJJX 2VM3A 3QZWG 5H37H 5D6CB 4I2XB 4RA0C 4S1RL 1SJEA 5KTEH 2IQAA 2NYYD 3UPCA 2BSED 1K3IA 1Q38A 3QUYB 4M61A 4FFZL 4HOMA 3WE6A 2B39A 4I0KA 2RCSH 4WFED 3OKNB 3NRPA 1WIPA 1QEWA 3E8UL 3L3OA 4W9EC 4WI4A 1EGJL 1MCFA 4K5MA 4LMQI 4MJ4A 4ZPTB 1CI3M 4F1SA 3CSTA 5EBMA 3X2QB 1FN4A 3PP4H 2NW2A 4XB3A 1SY6A 4BZ1L 1YNTB 1AXSB 2OMZA 1UM5H 4WEUD 4ODTH 3KYOA 4WCYL 2GFBB 2JCCB 1XTLA 2CKBL 3H3KA 1C08A 3II2A 4GQZA 4KX7A 4MCZA 1F02I 5I30H 1IRAY 4PGEB 4AM0B 2JLLA 3B2MA 3MUY1 1XZWA 2E5EA 3F3HA 5LCVL 4B50A 4QO1B 2CZNA 3O3BB 4OZFG 2PPEA 3T5WA 3VRIA 1T2QL 2ALAA 1IL1A 2GEEA 3GSVA 2MKLC 3WNMA 2WLJA 2D7TH 4P5MB 1J0IA 1PX3A 4HWEL 3BC9A 4PJXE 1XF5B 4NZTL 1CXKA 2PXYA 4HIHA 4E5XG 1KBPA 4JZOA 5EBLB 3RDTC 4DETA 5FFGA 3FZUD 5J6SA 1FYHB 4OZGA 5I71B 3CJJA 1PZSA 1ZHLB 5AZ2H 2DQFA 3TA3D 1I82A 3RURA 1MSPA 1E5UI 4OZ4A 1SXAA 4PJAF 4U4IA 1UCBH 3HG1E 4H44C 4TUKH 4Y19E 2QPEB 3NSCA 4ELKB 4HJ0D 2NY4C 1KCUL 3BZ4B 2GIXA 1SLUA 2B5IB 3GMMB 4MA8L 4YHZH 2FX8H 1JPEA 3HKFA 4JFED 4XP9L 2A6IB 2D9CA 4IBWA 3CNKA 2RH0A 1A3LL 1IGYA 5HVHC 1M7UA 2E7CA 4XAKE 3X17A 2VXTH 1HE7A 4G8AC 1FDLL 1GAFL 2EECA 1BW8A 2I27N 5E7FA 3TURA 3DARA 5D5ME 1Q9LA 2GITA 2UZYA 5IIEB 1ACYH 4N8VB 3W9DA 1S7WA 4JM4H 3UG3A 1Q0XL 5AVTB 4I3SL 3BLPX 1KDIA 4KROB 2F54B 1LO0H 2DW5A 3B2DC 4KBPA 5I1GH 3DJ9A 1FV1B 3C2AL 3JV5A 3WFDL 3DX6B 4ABVA 4YDKH 3H55A 3W9EB 4GAFB 3MRQB 4EZJA 4M5ZH 5KJ7E 3UYRL 1PX8A 4K9EC 4LZKA 4BWUA 3OJMB 3VFUB 1BOGA 4NKIL 1V7MH 2XNAB 1GMEA 3G9VA 1SVZA 5G5DB 2EAEA 2RACA 2G60L 1TJGH 1RLBA 2DJ4A 2J1XA 2JJVA 2J8UB 1AQMA 1AZNA 4ZX5A 5I5MA 1ORSB 3VAEA 5I74C 4L4VB 1VB9A 1VACA 5F0PB 5CEZL 1RPQA 4PP1C 2VDRH 4LLUB 2Y07H 4ZTEA 4CRPA 2BRRL 3LIZL 1KB5A 2UX7A 3O4LE 4WW1B 2WBJD 3SCMC 3AACA 3FTUA 3K2UL 2ZOLA 5E1AB 5H94B 1OM3L 1OAUL 4N2BA 4FKHA 1W6LA 4K07A 2FO4A 4OGZA 5HI5C 1S9YB 3CQFA 2GSGA 1LWRA 2AW2A 4M00A 4P4RB 4Z3EA 2GG1A 1AS6A 1XSIA 4QLRA 5IF0A 1DTUA 1IAOB 5B3JF 5AWNL 2NW3A 4JPVL 3U7WH 4JHVA 4X6CA 2D0HA 1YEEH 3NH7H 5KAQG 4NZUH 3IVKA 1W8EA 5AALA 1K5NA 3I3BA 3N2JA 3HG1D 4UT6A 2O72A 4Y19D 4X4KA 2B59A 4CADA 4C4KT 2R39A 1A3ZA 1SMDA 2UXGA 1CIDA 4LOUC 4JRXB 1FVEB 2TAAA 2XVGA 5AVYB 1R3HA 1F4HA 2D7PA 2GJ6E 4HEMA 4BQCA 4XAKD 2VDQL 1LP9A 1Z5YD 4YHOH 3B9KA 3M1OA 1RZKC 1SXSA 3L3HA 5HYJB 1LE5A 2V5RA 3W81A 1NJ9B 1RU9L 2IDTA 5KBMA 3HZVB 3NGBB 2N7BA 1KXVC 5DVKA 3WJLC 4PJBE 1B3JA 5TF1L 1GGCH 3BKML 3QXWA 4GUCA 5DEZA 3WIAA 5KSAB 1CLVA 2PN5A 4YQXH 4DHLA 1WFTA 1J5OH 4FLQA 2FLMA 4WF7A 5INDB 4DP9X 1E40A 1JV5B 2NSXA 3EYFB 4HOXA 3ARBD 3SE4C 4N1EA 2MPAL 3FB7A 4RGOL 4GKZA 4N0RA 2CBPA 3SDCB 3HS0C 3I9IA 1U2HA 3ISWA 3D0VB 1Z66A 3O3UN 4IRSB 3KCPA 4FQ2L 5AUMA 3MODL 3NAAL 2CLZA 5I8OH 1ACZA 3IJSA 2J12B 1YNLH 2JIXB 2Y1AA 4N4YB 3GSQB 2Q8AH 1U8MA 2MNJB 3ZL2A 2PYFB 4HH9A 4LCWE 4R9HA 4UDTB 3VXNB 4XCCL 3GZQA 5HDWA 5CEYB 5TDPA 2NTFB 3KJ6H 3O4LD 4X6FA 3US9A 4ZRGA 3TT1L 4LSQH 3QDJE 2XXFA 4QTFA 4J5VA 1FAKT 3ES6A 1BZOA 3SGDH 2IWKA 2HT2C 2DWSA 3W82A 1QRNB 3OAUL 4D9RE 4LIQL 5ECJE 1CD1B 4N8CL 2SEBB 5BO1L 3FOLB 5CLTA 4EN3A 1IT9H 3JUYA 3QEQB 3FN3A 3QUKB 3AXLB 4HUUB 3WY3A 1Y6MR 2YMXH 3A4DA 4HISA 4YEEA 3VFNA 1MCPL 2IH1B 2NZ9D 3MA9H 2WKOF 5JIHA 3I3DA 5D1QA 5HDQH 5C2UB 2GBVA 5ESAA 2PR4H 5FA3B 5K1JA 1U2CA 5AAMC 5HJDA 2VLLA 2IPUK 1TKWA 3VGAC 1I7RA 1V55B 3CXDH 4PGJA 4QY8B 3GQFA 2GJ6D 1U4EA 1MCKA 5DS8A 1ZTMA 1HI6A 1J0KA 4KITB 2MWCA 4K8RL 4MAYA 4GXUM 4UQEA 1GW6A 5BVPL 3K71B 3JVGC 1ZWIB 2AV7B 3NACL 5GRVL 3QWOB 5I15H 4BIKA 2DLFL 2XA8L 2X40A 4LSUH 1IE4A 3QRGL 4JZNB 3N40F 4WNQB 1A2YA 2R7EA 4AGLA 1F11A 5DO8A 3IU3A 3DV4B 4XZUA 5FO8A 5I18L 4HKZB 1FGVH 2V6HA 1CFQA 1UXSB 1TMCB 4F15B 1H3UA 4G8FA 4M93C 1GPOL 1NUFA 4MXWH 1R5IA 5F9JA 1RVFL 1T89C 3EH4B 5ALBH 5EOTB 5A2IH 3KZ8A 1OV8A 1RZGA 4MMZB 3CFKA 2WUCL 5IB1A 3TT3L 4KI1A 2UXVA 2FEJA 3BPLC 1EPFA 2ZIDA 3IDJA 4OLUH 5GZOC 2EXWD 5JTWA 3ARBA 4XGZB 4Q9RL 1INEH 2NZIA 2ZE0A 4AITA 3W3BA 3K6IA 3HC4L 5F8QC 1IFGA 1CFTB 3C5XA 5F9AC 4MMXA 3UIYA 1GH7A 1KLUA 2YD1A 5JHMA 3QDME 4WJ5B 3ULVH 1Y1DA 1AZRA 3V6FB 4QF1A 3OAYH 4GQ9H 2NY5H 3QXAA 1OWRM 2C3VB 5B4MD 4ZFZA 3RIKA 2VO5A 1D6VL 3QDJD 1UD5A 3V4VH 4U1GB 2DPKA 3NQIA 3WO3B 3KEHA 5F7UA 1MFEL 4WSGA 4JKWA 4D9RD 4HFWB 5IB3A 4IBTA 1UH3A 2JVUA 5IKCA 4ZMXA 1ZD6A 3MGOB 4HUKB 3NCEB 2DS4A 4P2QA 1WBYA 3O6FB 4XMVA 5HDBE 2YHGA 3CX5K 3NN8A 1KBGH 2HCZX 3VA2C 1C5DA 5IB2B 2P5EE 3KR3H 5L9DH 1Q9WB 5IWLC 1RSYA 2OTWA 2WUBH 3NT0A 5EOQL 3HB3B 2HRHA 2R0ZL 2BPBA 1Q94A 1NFDF 3SD5A 4AE1A 5BVJA 5I1AB 5D7IF 4R3SA 5DUPL 4DTGL 4YHKH 3RUGF 4ZOEA 3THML 4HIJB 4P4KB 3S88L 1CD0A 1S7SB 3S3BB 1T0MA 2XICA 1KPVA 1ZAGA 1BGXL 3MLSL 1GA2A 5JHAA 3PWLB 4ISVB 4PV8A 5FDWA 1IAIM 4I18C 5E2UH 3DUSB 3JWNG 2GY7B 1OVZA 4XR8C 4OZHA 1DJHA 1DR9A 2ICWB 5I9QB 1ZOXA 2ROYA 3CVDA 5BUPA 1XGPA 4FL4B 4OJDH 1J1XL 4LMQE 5AEAA 5IEHB 1TUPA 4G59C 3DVNA 1IQDA 1XD0A 4M56A 3GD1C 3ATFA 2H47C 3IGAB 4P23C 1OSZA 2R4SH 1XIWD 3JQOB 3G04A 4M8QA 4GO9A 3QNYB 3N85H 2ED9A 1G43A 1HH9A 5DLLA 1ZCRA 2IBGA 3WFHA 3AGWA 3FN0L 2FJHA 4DP6X 2V8MA 4R6UA 2NCMA 4XCEB 2EXYD 5DHVB 5E9DE 5D1ZB 2P1YA 1H6UA 1MCHA 3G5XB 4JBSA 5FM8A 2VDKH 5IJVA 2VR9A 1T03H 3Q6GL 3BZEB 1J11A 4AEHL 1OOWA 4YL4A 4JFYA 2LT9A 4QNPF 3QDMD 2IIJA 3K4DA 3LNEA 1D7CA 3B2UC 3V0HA 4Z7VF 2JB5L 4B9CA 1C1EH 1URZA 3QUYC 1HESA 2XZQH 1KGWA 3S5ZA 2ZX9A 1J8HA 1JF1B 6CGTA 5JLZB 1OXYA 2W1NA 4AIZB 3BFOA 3LKNA 1I8KB 2NUTB 1A7PL 1X5MA 1IVLA 4NQDB 4XC1L 2OXHB 4IMKC 4L3AA 4OJFH 5BUGA 2EUXA 3MACH 1MCNA 2YN5A 4U6XB 5FGRA 3VCLA 3QORB 2Q3ZA 3PV6B 4TOYL 2AQ1A 5E8NA 2BVEA 4IK6A 3T0DA 2CHDA 1RP8A 2KYIA 2P5ED 2R1WA 4P2OB 3ZHNA 1JWUB 4J3XA 1QG3A 1HOCA 4C4BA 1IGFH 5D71L 4OLWL 4L3FA 4YNYB 1TQBB 4GI8A 4ACPA 4DO6A 4NHUA 5PAZA 4B53A 5TQ2L 1SFDA 3BSZH 4UT9A 1BIIB 4PH8A 1IX2A 1IGCL 4UQCA 1IAMA 1PDKB 3UBGA 3MU3A 4ZD3L 1NANH 4M29A 3L7EA 4DGVH 2FGZA 3MNZB 2Z93B 4X0NA 1KPRB 3LTVA 2ZYHA 3EH2A 2VL4A 4L8BA 1ZANL 2K9UA 5CINL 1T1WA 5I71C 2Z31D 4KVCL 4G6KH 4MXQC 1EA9C 2AQSA 2XPGA 4Q6YA 1RURH 4XHQA 1CI5A 4ZUUB 3LEVH 1UOLA 2HFEB 3KPOA 2B5IC 2QL1A 5AOIA 3MR9A 1TLMA 1CDCA 2H2SD 3VXOA 3IETA 2DJUA 3OR6B 1L9TA 5K9OB 1JF5A 3MRDA 4N6QA 3TPUA 2H9GA 2WOYA 1AS8A 1RKRA 2EDDA 3UJJH 1EDHA 4O2FA 4F8OA 4KZCA 5E9DD 1CZ8L 2NLJB 3CWGA 4LCCA 4X6DF 3SKMA 1KACB 3O8XA 3IJEA 2JH2A 4P57B 2PTTB 2AAVA 3FN9A 4KROC 4JB9H 2P5WE 5B38A 2NDFA 3AFLA 3WELA 2DOCA 4B6ZA 2ZUTA 3WFCL 5LNDA 5C0DA 1J1PH 2CO3A 4BSWB 2HTLC 5J1AB 3LD8B 3TTYA 5BS0B 2O6FA 1NWOA 1OO2A 3ME0A 4HWBL 4F1ZA 2KUTA 3MAWA 5T5NF 3FU9A 4GMTH 4YJZL 5LBSH 2VABA 3K5RA 2F5BH 3UG5A 5FUZH 3DDFA 1MG3C 3KWTA 2YQ3A 3IJYB 2WOBA 5T1JA 2IV9A 3IE9A 5J06A 3Q13A 1FLRH 1GSMA 1S8DB 3FQRB 2H2PD 4HLZH 3PIQB 5KJ4A 4A7UA 4ADIA 1HXYB 4OAWA 1TYJA 1X7TA 3MLRL 1DEEA 4TSAH 1FZOB 1T22A 3AMKA 1YUHA 3PHAA 5FYKL 1B9KA 4UI2A 3UDWC 3SPHA 3T0BA 1E42A 4JPKH 4KKRA 2PETA 2AF2A 4XP4H 4MJ5B 5D72L 3IAGC 3HAEH 4TUOB 4Z3GA 3RIAF 1E0OB 3QW9A 1DN0B 5E8EB 5C7XH 4GAYA 2G0KA 3GSNA 1TU2A 3KPLA 3MV7E 3BXNA 5JR1H 4KK9D 4A39A 2L04A 4N2NA 3JTTB 5F0MB 4DIXA 5TE6L 3P4OA 4AZ8B 4KNQA 5IMLA 2XQBH 2UZIH 4WWKB 1XL4A 5KBLA 4MB1A 4OGQC 3KYAA 1I53A 5CP7A 3L81A 4LU5H 3N6YA 1FNGA 3WEXB 2G5UA 2D4FA 2P8LB 1YEFL 4U05A 1ERNA 1IAIH 2OMBA 2XCMC 1UB6A 2D4DA 3FC8A 1HILA 5T8IA 5I1KH 4JEGB 3DBXA 2XTLA 3PHSA 4QHMB 3DO4A 4WHCA 4MS8C 3S8WA 1A8ZA 2X89A 1XGTA 3D3VE 4R7NA 5TFSH 2DWDA 1C7SA 2A6KA 3LEYL 3SQOH 3WENA 1AOZA 4RA3A 5HYEA 3RRQA 1BZ8A 5FYKU 5GJTL 2B7DT 5HYQA 4X6EA 4DGYL 4AEFA 3I6GA 1P6AB 3NGBC 4LKCA 2FECL 1P2CB 2B15A 4JFOB 2AKRB 4G80A 2P5WD 2VLJB 4LCYB 1D5RA 4EDXB 5L4IA 4WDIB 4W6YB 4XPHH 5C09A 1E4XL 4WGWB 5C0IB 3M8OL 3ZDYB 3OB0K 3TO4B 3RJDA 2HVJA 4RDQF 3QG7H 1QHOA 1HJCA 2V7HA 5HHNB 5JXAH 3T04D 1FWXA 3MTRA 4MD4B 5TF0A 3RB7A 4XHJC 5J6GA 5CD5D 2KI6A 4RETB 3QZLA 1WHOA 3SDCC 3OKDA 4IRSC 1JTOA 3FL7A 1A3RH 4AL8H 3RPIA 2MCPH 4KXDA 4H8PA 5I28A 3PAZA 4PRIE 4YC2B 1YMME 3NFSL 5BPPA 4AWJC 5DVNA 1E43A 4XP6H 3FHEA 3LMJH 3BWUC 1FFPB 1RJYA 3EW3B 4FNUA 1T21B 1EHKB 2GVYA 2WTOA 2Z91A 3D85D 3RX8A 2BY3A 4O2EA 3RHWK 3BGMA 3PAVA 2FGWL 1IGML 4HOZA 1WA2X 2ZYIA 2ZTBA 1H9DA 4KMQA 1INQB 3U6RA 4F9LC 2XJLA 4MD5B 3OMZA 2YQ2A 1WWAX 4KY2A 4NO0B 2J21A 5L4MA 4PS4L 1GZPB 4GQPH 3TZVA 3FFCA 2WO4A 3MV7D 4AXWA 1DVTA 2IPKA 3C5ZD 2H8PB 1PYWB 1MEXL 2EYRA 3JSSA 2OMVA 3NOIA 1EIBA 3ULSB 2BVPB 4X7DC 1UWYA 3RWFB 3HG5A 4PJ5B 3IYLW 1T20B 2JTDA 3HN3A 4ORGB 1I9RH 2JLPA 3LNHA 1MUJA 1XEDA 1BAGA 4AYEC 4L3EE 4Y5XB 5C6TL 4AYBA 2BY1A 4XCYA 1U8LA 4BFRA 2QGEA 4X6BB 5FLUA 1H5BB 2BVYA 4UQAA 1PU0A 2IQ9H 5IW1B 2V2TA 3X13B 1QABA 3D3VD 4HG4K 4FZ8L 4FXLA 2ZX7A 3LXCA 5LWYH 1PAZA 2O61A 2QVFB 2FEDC 5CSZB 3AMLA 5HI3D 4QT5A 1Z7JA 2EIBA 3RVTC 4UM8A 2Z65C 2BXYA 4JUTA 1RZFL 3CCHB 1IKNC 5A2AA 5E08H 4Y2OB 2EZ0D 2H26A 3GBML 5C0AE 4GKNB 4UDUB 3B7SA 5EHFA 5I6PA 2DF3A 5ID0A 3DTDA 5C0RH 1YEHH 1EXHA 5FM5M 1VZIA 2ADIB 5JO5B 5EUOE 4POYA 2YAPA 1A7BA 4IDLA 5MI0B 1DQVA 3ARZA 4YLBA 2VZ1A 1NC2D 2P7TB 3QHTC 5DD6A 4F15C 5LHDA 5FM5O 4U6HB 1QTPA 1KB9J 1JUFB 2K3TA 4XN4A 5F7DA 3VM7A 2WTRA 4KU1A 4J6IA 1V05A 3BEWA 3FO2A 3GMOB 3O2DL 1OAKL 2CGZA 4MMZC 2KBGA 2WXPA 1JXFA 2R69H 3C6SB 2DM2A 3PNWA 2EE3A 2EEDA 4HF5H 1QWNA 4ZNCD 3ZDYF 1O6SA 4ZUWA 1H0DA 3FU7A 2QDVA 5DWUL 1FVCB 4PVMA 2AXHA 1JZHA 3IXTB 4FNQA 4OD3L 4KI5C 4PRID 1YMMD 3SDDA 3VFOA 2ZZUT 1PD6A 5E95B 5JW5B 3O6LH 2JE8A 3QXVA 4KAQL 3V4PL 5LGHH 2HT3C 5DVOA 2WLIA 3OF6A 3SPIA 4K7FB 1CDYA 2ZUQB 3BDXA 4HV8B 2NZ1A 1ROWA 2KPNA 1KCRH 5CIPA 1MAML 2RQEA 3V0GA 1CXEA 3D05A 1NLBL 2L7QA 3GIZH 1W72A 3EO0B 4N3TA 3ZTJG 4GP8B 4R7LA 4TPRH 1SLVA 5HJ3A 1X9UA 4YPGA 1E6JL 3D85A 4U1GC 5GJSL 4GP4B 3GBEA 3MBXL 2Y4SA 1JD9A 1OANA 4EE2A 1R4XA 3PGFL 1HZHL 2FIKB 3FQWA 5T5FL 3MUUA 5JOFA 3AU0A 1FG9C 5CZXC 2W9DH 3V7AG 1T7XA 3KLAB 5A16B 3ZYOA 1JF6A 4K7PL 2AVFA 1N5AB 3ZKXB 2L4OA 4NAMA 1I85C 3O6FC 1CGXA 3OWRA 5C08E 3DO7A 3AABA 1SBSH 5JIIA 3MV7A 2VQ1B 1KCKA 3AAZB 4R5TA 4HHAB 4B41A 1R0AL 3PAUA 4L3ED 2VXSH 3S5LA 1AR2A 4R7DA 5GSRA 4UUJA 3HB3C 1Y7VA 3RTQD 3WMQA 3UTZA 3Q1EA 1A02N 4M43H 3D18B 4P4KC 3EJZD 1FFNA 5F7YC 1JV2B 2X70A 4AX3A 5IK3A 1EEZB 1DBJH 5C0AD 2VW7A 4IDJL 4AKPA 1SOQA 4QCIA 1QLEL 1T5WA 1FE8H 1NCHA 2Q2LA 4CNIB 2EUZA 4IGBD 5CCJA 3R06A 2ATPA 5I8EA 3U1SL 4KK6C 1MPAH 4HUMB 3EOAA 1WS8A 1FFTB 5I9QC 4WY7H 4FL4C 4U31A 4ABUA 5IW6B 5ERWA 4TTGA 1ZHNA 1OIOA 3C60A 2X7LB 3BAKA 4U6VH 2C4FT 5AW7B 1U3HD 5A6IA 4WEBL 1HCFX 3QR0A 3EYVB 5CCHE 4KRNA 4KQ3H 4LOVA 4HUVA 2J57A 4Y4HD 4BV1A 2CIIA 3ZTDC 1JP5A 4NQXB 4X7FC 1FC2D 5IVXF 1QX1A 4Z7QE 2R8SL 4ZFGL 4XC3H 2JXMB 1LJMA 1LDSA 2DYPB 2BVOA 4NZDA 2OS7A 4YEFA 5D7JD 1I9IL 3RGVD 3CFUA 5D1ZC 3DIFA 4UIMA 2OPCA 1MIMH 3G6DH 3TEZA 5AYUH 3JWOL 2KHAA 4HMCA 5AL8A 4OTXH 1AG6A 2VN6A 4PR5B 3F6LA 5HHPA 2G2RB 1QPPA 3CUPB 3K46A 3F01A 3F6IA 3CDCA 4PRIA 3RQ3A 3MBWA 4XBEH 4PB0H 5ESQB 2VZOA 2GTQA 4KJQC 3JT2A 4H4NA 2VDRB 4U0QB 2MNWA 2XTSA 3N44F 2IDFA 1P4IH 1CDUA 2A1WH 3BQUD 2DH3A 4ODSH 1KF9B 2QV4A 4LP5A 2KDYA 1NPUA 5FK9A 1KWGA 2Q86B 3T6ZA 4TRPH 4RWHA 3QUXD 2IGFH 1DQIA 1YEJL 2VXQL 2J1WA 4KY1L 3S36L 1UOKA 2FATL 3QORC 5C08D 3S2AA 5GGSY 3HZ3A 3QQ9D 1RZ7L 4HBCH 2QKIB 1CXHA 1CGUA 1XH3A 4AYFB 4D0DA 4P2OC 4GIOA 4HJGB 1NFIB 2GBTA 3BUBA 4HS3A 2W91A 4K9JA 1TQBC 2YPVA 3E6HB 4H0LC 3VFSB 2PCPB 4G6FD 1RJZA 3TN0B 4EMZA 1WFNA 2KPWA 3KNBB 3ALPA 1BD2E 4KTDH 4OLEA 1ECZA 2DQEL 3UAAA 1WWCA 2BO0A 3QH3A 4PJXF 1QI4A 3VXPB 1QR1A 4CVXA 1CTMA 4PY7A 1BVNT 4ENEC 2HP4A 5IR1B 4UB0H 1GTFA 1M56B 4NBYB 2E27H 2J5WA 1DFBL 1IBHA 1CFMA 4MBRA 1JPTH 3CBRA 4OCYH 3TCLB 2VUOA 5IHBA 1U8CA 3B7TA 1ZE3H 5DRNB 1HH6A 3S96B 3QCVL 3DRTA 2ESVA 2VN7A 5GS2D 4IGBA 1RUKL 5EUOA 5TH2B 2PCFA 2J6EL 2VLRA 5GISL 3DX8B 1BFOA 1FZMB 3ZHKA 1PD1A 3BX7C 3D2UB 1L5GB 3HMWH 3CZSA 1MJ8H 3ZRSA 1SDYA 4DEPB 3FB8B 5I8KH 1OGAA 4OCXL 5D5MF 3JTSB 3OKOA 3KLHD 3ARYA 4HCGA 3K80A 4XMZA 3L2MA 4NC2B 3PJLA 4CN6A 5D7LD 1NLDL 1L0YA 3X3GL 5A2BA 1YSOA 2UV3A 3SPCA 1MVFA 1BJMA 2F1BA 4PJCF 2Q6WA 1UWEH 3D0LA 4H26B 3QZWA 1UZGA 3LD8C 5A2KH 3X11A 2O6PA 3GMNB 1OP9A 3WKPA 5C0GA 4A2LA 2B0SL 4GRMB 3LN5B 3RA7H 1MKFA 1GGYA 2HVKB 1GGUA 3VD4A 4K4KA 4UINL 3GBLA 2WNKA 3PHOB 2CG9X 4ZOAA 4X9BA 4ONOA 5B22A 1MRCH 1IMHC 5C86A 2IC2A 3L4YA 5HGHA 2AK4B 4JY5H 4E9XA 3D1MC 4C83B 3BLKA 1VEMA 1H6TA 2Q1EA 4ZQTA 4CVZA 3A6OA 4N6RB 4YUEL 1WJ3A 1DEDA 3C5SB 1MCJA 4XMLH 3VD2A 2YXMA 4GKLA 4HPHA 5C08A 3MRPA 4OCNC 5JZ7C 1S7QB 4HX1B 3WIFB 4QRTB 3EHBD 4MZ2A 1OTUD 3I50H 1BD2D 3A67L 3T8MA 5LNGA 3AS2A 2AJZA 3V55A 4YFLF 1EDYA 2Y0SA 1G9NH 1KTDA 4OZFA 3OD3A 1MWAL 4HFUL 5DC9B 5HHVH 4Z8FH 3ZYIA 2NXZD 3HMXA 4WWKC 4G6JL 4A38A 4NNXA 1T0NA 3RBSA 2X2YA 1T1ZB 3DHPA 2XTJE 5CJ8A 1WTGT 3FT9A 3KPSB 2I07A 2O1AA 1T6VN 4RLDA 4YO0B 4B9IA 1VFBB 1CE6A 4KTYA 2NY1B 4KNUA 1QTSA 5AL0A 2AJVL 1PZBA 3ETBF 3LQAC 1TTRA 2BMKB 1NMAL 3DROA 4CGTA 1NGQL 1NUDA 2PKDA 1D5MB 2YAQA 4EI6B 1BPVA 5GGRB 1QUNA 1X9QA 3P77A 4M6OH 4BZ2H 4LLMB 4NAJA 3BZ5A 1HL4A 3L4TA 1L7IH 1JPSL 1TZGH 2BOLA 4WI0B 3G6JE 1AKJB 1OSPH 3EO9L 1P84K 2EACA 4PAZA 3LRLA 4V1DE 4Z76B 4TLTA 3N43B 1O7DC 2CLVB 4POZC 5BJTA 1OW0A 4HALA 4GRLB 4PRDB 5CHNB 3RPKA 3QHFH 4PJBF 4WU7A 4Y7OC 2X6MA 1ZGLA 3RX9A 2VQ4A 4IIZA 2CJSA 1ZLVK 2MIZA 4F7MB 4PV1C 5GS0L 4PUBH 4NOFA 3VXTA 1ZPUA 1E9OB 4NT6B 2YUZA 4HKJA 5GRXG 4BSJA 4L29B 3TO4C 1LMKA 3ZJAA 4DVRL 1C5BL 4WO4D 1QRKA 3B34A 3GSUB 5KW9H 1KG0B 2A9NL 5D7LA 5LDUA 2CM6A 3MRCB 2EYSA 4ZFOB 4D3CH 3S6CA 1CFSA 1U8NA 2Z35B 3D4GA 4UWQB 4GB9A 3HC0B 4ZAKB 5KZCB 5EZJB 3AVEA 2ZPKL 4G8GA 4GINA 5SX4I 5IQ9B 5EO9A 1OAZL 3SDAB 1L9PA 4X9FA 4LNRA 4FKEA 4YC2C 3CVHH 1RZJC 2BP3A 4M1CC 2LQRA 5D1XE 4NQEA 2E4TA 1NCCH 3QXDA 3V6ZB 2WZAA 2CH8A 2FT6A 3X1NA 1CTNA 2KC0A 2VOTA 4JRYB 4QOKD 4PS8A 5EMYA 1MLCB 3QWRA 4LLDA 4TSCL 3B5GA 4LSPH 1BOYA 1SYVA 3STZA 1LEGB 2XYCA 4UZGA 1FGNL 2H3NA 2Z0BA 1ZLSL 3L3GB 4NKMA 1T04A 2DY2A 1EAPB 1M2VB 5T3XL 3KVQA 3UTSB 2R2BA 1NCDH 2OL3A 3KXFE 4JN1H 5CU5A 5DZOA 5GGTA 3TEUA 4FULA 4EIGB 3I02A 4U49A 1OK8A 4UQ2A 3D9AL 1ZLDA 2IG2L 2DEYX 1JDAA 4MZ3A 1JWMA 3LS5H 5HVGB 4Q2ZB 5FW7A 2DQJL 3DV6B 2WXHA 3MV9A 4PS7A 5FR3A 4ETYA 1BD2A 5SWSB 3DOSB 5PCYA 4ALAC 1EEUA 1JNHB 4BDVA 1WZKA 2F15A 4OD1L 1YPZF 3IEAA 2XTJD 4MVBC 1U41A 2KQMA 1XR8A 1BQUA 2GK2A 3A24A 5FECA 4OQTH 4Y5XC 3NQKA 3VH8B 4NENB 3NESA 1F6AB 4H0IA 3QPKA 3SBWC 1S9WB 1H5BC 2WC7A 1JGEA 3PP3H 1MIEL 2DQGH 2HLEB 3LHPL 3TO2A 3WKQA 1Z9MA 4P49A 1B4JH 4UQDA 3U0TB 2QTEA 4EI5A 1KXTB 5DJYB 1CF8H 5KVFL 4NQCE 4G71B 1OF2B 5D7KE 2UWEE 3FQUB 3NCYP 3QQNA 4MJ2A 1SEBB 4V1DD 3HBPA 3NA9H 3BHBB 4FTVB 4D8OA 3JWNE 4XAWH 4QXVA 4F8NA 5EU7E 5I1JL 1D9KD 4O2CB 5I1IL 1XZ0B 3ROLA 4LQFL 5MI0C 4R90H 4TVUA 2H32A 1ZVNA 4ZUTA 1MREL 1DBML 5D4HA 3PWJA 3FPYA 1EV2E 2ETWA 2NT0A 1IQWH 1NCAH 2X1WL 1OE3A 4EQ2A 3TPKA 1DP0A 1UCTA 3JWNH 4GUPB 4LEOB 3BIBX 1IFHH 1E5BA 4K5OA 2EIMB 3GMPB 3QULB 2C7FA 2J20A 4FQCL 1BWWA 1CDJA 4PJHB 3VXSE 3MA7A 1AIFA 1F3RB 4PWJA 4XMUA 4DZBB 4G1EA 2J2ZB 1F3JB 4YWGL 5ACLA 3ULVF 4LB8A 1V7NH 4GUOA 2NY3D 1Y0LA 2VZVA 4M62L 4PJIA 3D7PA 3UTOA 1E5CA 4O51A 1OAXH 4PGCA 4G6AC 5D1XD 1QASA 5KVEL 1AO7A 2VLME 2FLRT 3MREA 3T6QC 3AGVA 3H2QA 1G6RB 2YSTA 4DT2A 3GMRA 4PJFB 4EKXA 2ZUQC 3M45A 4HMEA 1NBVL 3I9GH 3KWUA 2NXYD 1PIFA 4Q58C 4G8IB 2D73A 1RMFH 1R5WA 1S9XB 1TYRA 4FFYL 4CVUA 3HIZA 3D12B 3KXFD 2W0LA 1EO5A 1FJ1A 4FP8H 3EOTL 4PVBA 4QOKA 2KS0A 4MJIE 4FXKA 2AK1H 1J0ZA 1CT8B 3JWDC 1BQHB 5DMGC 1RL1A 2VSMB 4BKLA 1KXHA 1DJGA 1KIUB 3KGRA 5CF3A 3RFZB 4XNAA 1G7MA 3WKYA 5JPMA 1A4CA 1GZQB 3MRKA 3RWJB 4BH7A 4GXUN 1EANA 4QR7A 5JHBA 3ZKXC 5HDBF 3TV3H 2WSDA 3P2TA 2Q87A 1HQ4A 1BVKB 1EWHA 3QJSB 4O9HL 1F4AA 1A1OA 4IW4C 5E2TL 1J9CT 1KJMB 3L17A 4OLYH 1OCRB 4M3JA 3S35H 4LCUB 4HCRA 5FGBC 2A77H 4OUUB 3TP4A 3CFCH 3CK0L 3K2IA 1KCLA 3V5DB 3ZMRA 4CJ0A 1P5UB 4XVSL 3VFVA 3CDZB 1GC1C 2HAZA 5HGBA 2AJ3A 4QYOB 4HJEA 4GG6A 3BKYH 4KJPC 5BMFH 3TBTA 4NQCD 5KVGH 4FYRA 3RL1B 5D7KD 3T77A 3KD4A 3X1GA 3HLAB 4ZS7H 1FCCA 3D08A 3MJ7A 3OKLA 4JDZB 4BE5A 2ZX8A 5DZVA 5FWRA 1NKRA 3VXQA 3G5ZB 1GGIL 3DYOA 3PCYA 5KYWA 4HK0B 4RSYA 1SJHB 4J4PD 4F7PB 5E5RB 2FJSA 3T2LA 4G6MH 3FCUB 3ZL4L 5JHLA 2CBTA 1AGDA 2ED8A 4HUNB 1UUSA 2CR0A 4RIRB 2QVKA 4I4WB 1U58A 2PF6A 4Z3IA 4Y9BA 3PWVB 1D9KA 1Z2KA 2X4OA 1TTAA 3RG1C 3TX4A 2LOEA 4FQPA 3VXSD 4LPYA 1U42A 1E8YA 3DVIA 2C26A 2HRPL 1SQ2N 3RY6C 1U8OB 2WXQA 5IVZA 5LKNA 2BC4A 3QXUA 4ADJA 3U0PB 2VRAA 5FKAA 3WDIA 2AJYL 2UZXA 1J05A 1ZHBB 2UYLA 3RZCD 2VLMD 3D4ZA 3QA3B 4HEPG 2X3CA 3MUJA 3DA0A 4XN9A 4GXVH 1R33A 4X8JA 3GSXB 3UBXB 2C3HA 4GQQA 1UH4A 1HKLH 3IGUA 3IK2A 3T1WA 4FNTA 3WXWL 4YXLL 2AP2A 1P4BL 4Q0XL 1JPGB 2JK5B 2WZPD 4IYKA 2Q7AA 1EEYB 2H1PL 2IALB 1RQ5A 5IGXL 2CO6A 2BOBB 1E4JA 1BAWA 2NR6C 3QCTH 2Y36L 1R3KA 4MJID 4Z7UE 1LK3L 3V0JA 4KXZI 3TBBA 1ASPA 4R8WH 1KYDA 5T1MB 3HAEB 1I8LA 1A65A 5LXGH 3B5TA 1VGEH 3FUKA 4P3CL 3P30H 4TQEH 1KGIA 1K2DA 1B6DA 4XMXA 5BZXA 2IFFH 4JO2H 3EYSL 3DC0A 5F0LB 1KNOA 2JELH 1CPUA 3VFPA 1C9SA 3QIWB 1E9PB 1HCVA 2QKIC 3OPZH 2YRLA 5ANMB 4MKTA 1OTTC 3RDJA 1WT5C 4ZMTA 1O9WA 2XN1A 3CX2A 2NNAB 3GTVA 3MBEB 4HJIA 1ASQA 5DRXB 4HA1A 5C71A 3CV5A 2X4UB 2F7QA 2HWZH 2OJEA 1G0YR 2PP7A 2RTTA 3GXMA 3T0EE 3UMTA 2WLLA 5DYFA 4U1SB 1ILUA 2BJML 1Z9SB 3DXAB 2ZXGA 3E80A 3VXRB 1T1YB 3TN0C 4FXGB 3FXIC 3TYFB 3FT3A 3DX7A 1UJ3B 5E6YA 4J3UA 4LSRL 4ZX4A 1YMHA 1ZA6B 3W1ZA 4MNGB 4IOIA 2R1XB 3WYRA 1A4BA 1HC1A 1HAWA 1YAIA 3CZNA 1DUYB 1CICA 4Y2DA 4ES8A 4GG8B 3BW9A 3WHXB 1A6WL 5JPNA 4FFVD 5A7BA 3WTTA 2VISB 1W91A 4NQCA 2VDLH 2PP8A 4AV4A 5DLML 2JWYA 2F7OA 3UADA 1JNLH 1U6AH 2J25A 2C9PA 2QSCH 4J4PA 5MEOA 2WGNB 5T1KA 3P2DA 3SY6A 4O02L 2XX0A 2HFFB 2Y25A 4DEPC 4C56E 1N3NA 4DGWC 4OGAC 3ULUE 2EABA 3OX8A 1IO4C 3F5WB 5EU5A 3UXFA 3ARFC 3QNXA 4Q9QL 1NCGA 5D7HA 1KMGA 1MZZA 1G7HB 2ZSWA 1P9MA 1KCSL 1MFBH 2LTQB 3NFPA 4UZUA 2ERJB 4DKEH 3GRBA 4MHHG 2WVVA 2VAAB 4PTUA 1W2KT 5EA0H 3HPJB 1E3XA 1HHJA 1N0LA 2WTPA 3A6CH 3EBHA 3ULUH 4FFZA 1D5BB 4BFGA 2APSA 3CVIL 4U1JB 4C47A 3SE8L 4MNHA 2R9HD 4AQEB 1VJSA 2VLKE 3OM3B 3EYQD 1J9QA 1NGZA 5F9DC 3BVWA 1BZQK 3SJVB 3PPEA 1NMBH 1EGJA 3AREA 4KVNL 2R27A 3F7LA 4Q14A 5DJ0A 2GJZA 4BZ1A 3TBYA 4FYSA 3T65B 3RL2B 3RY4A 5CJ5A 1CGWA 3DGGB 3P73B 5CJOH 4LASL 5IY5B 4RVBA 1D5XB 2CKBA 2UX6A 3HR5A 4GPVA 3T6WA 3CVCA 3WMSA 2AITA 4F9PC 3O11A 2I60L 5DK3A 3VI3E 1SDDB 1WVZA 5KSVA 1VIWA 4JHWL 5GRWA 3VGGA 2X38A 1WZ1H 4LIQE 5DI8A 4LQ1A 1I7ZA 4LBEA 1F3DJ 5LCVA 4B3EA 1ZRUA 3ARGB 3QJRB 3T0ED 2PTUA 3H0TB 4ICXA 2GYSA 2QHRH 4Y4FA 3TF4A 3JUZA 3BDBA 5LBGA 3PWPE 5DMIH 1ZS8B 2OX5B 4PREA 4DVBA 4HUWB 2OP4L 5J3HC 3QJHB 5IFJB 1U8QB 5MEQB 3MRJB 1E4KC 3C08H 1ZMYA 2NMSA 2FBJL 3VE0A 3ILQC 4NCC2 4JY4B 2L7JA 2VERA 2XZAH 2E7DA 2XG5B 3P69A 1KN4L 1TCRA 2B1HH 4XE0A 4UM9D 4KJWC 5FHBH 3GYRA 3MLYL 1A6AA 2XJKA 5CP3A 2ROXA 3TXAA 3CPLB 4YDVB 2NNFA 2X9XA 1HDMB 3MLXL 3SO5A 4JPIA 1LILA 2IWGA 4KPHL 2NY1C 4OKDA 3S5YA 1FAIL 3HC3H 2V33A 1KIPB 2ZQKA 1IIIA 1Q9KA 4G9DA 4UQIM 3VX1A 3BAXA 1H3GA 5F21B 5FO9A 1X3DA 2XN9E 5ANHA 5BV7H 1I4FA 3PUCA 5LJYH 2WAQA 3PG2A 1QAWA 5KVDH 4QRUB 4XPGL 4A68A 2ADGB 1C16A 4ZS6C 4C56D 4L1SA 3NPSB 2V3DA 3N41F 3ULUD 15C8L 1REIA 1RERA 4G42B 1EJ6A 4N25A 4E41E 4FQJH 5IMMB 1SYSA 3HBQA 4GRLC 1QW9A 4D0BA 1VKXB 2BP0B 2GEQA 3VYNA 5KSBA 3Q3GA 3L5WA 3KPQB 2GT9A 2OFQA 4FXTA 4P9ML 5IG7B 4R0LA 2EVHA 2DMBA 4GLRI 1XBDA 4PP2A 3LKQB 4OGYH 4U1LA 2VLKD 1KWKA 3TJEH 4TN9A 4WUUE 4Z3JA 2AERT 4NDMA 4AG4L 2NY5C 2NY2B 3R19A 1QHQA 2K3HA 1T3FB 2H1XA 4M02A 5A3ID 5I8CB 3GRWA 1CBJA 5C0ND 4PWKA 2QFPA 3I2CL 3R4RA 4JKPL 4ZAKC 5GS1A 1U91B 3IJHB 4P2RE 3FRUA 4XNMA 3ZHDA 5IFAH 4PG2C 5DD0H 3G5VB 4Z7UA 4F2MB 4N2LA 3SDAC 5GPRA 4EUPG 2YKKA 5FA4B 5K9JH 1SQMA 4Z5RA 3NTCH 3PWUA 2FB4L 3CC5B 5CBAB 5KVMC 3CU1A 4KGLA 5DRWB 2FH8A 3KVPA 2KLSA 5I5RA 3ZE0E 1A9EB 4PJEB 4NKDA 4QRSA 2OKMA 3FCBA 3QI9D 1HJBC 3G6AB 3ILPB 3LIZA 4Z0BL 2PR9A 2DIBA 4OZIB 3EYOA 2XACC 2HPTA 4A7VA 1W0WA 3E3QC 4Y4KB 4JG1H 3PWPD 3RNKA 5E8DH 35C8L 3O0RL 2YD7A 3TESA 2EVJA 2P28B 1WWBX 2JKRM 3V7AE 4Z7WB 5L2KB 1KBKA 4X7SH 4ATTA 2BVQA 2NY0B 4OJEH 1XF3A 2PYEE 2C1PB 2WWOA 1I1YB 1ZSDB 1JYVA 3DMMB 3Q8FA 3WNNA 1SDAB 5EC1A 2F7IA 3W0WE 3A0OA 4LEXL 3RWHB 4K8RD 4IHOA 3F84A 2F61A 3QNFA 4HIXH 2P80D 1Z3GL 5FUCC 5GGQL 4NC1C 2FIRT 1PKQE 3QARA 5EN2A 2OR9L 3BT2L 3SKJH 1R5VA 2XN9D 3WIIH 1IM9D 4UM9A 5HPMB 4U7MA 5SWZB 1BBDL 1MFCH 4ELMB 2H7WA 3U4BH 3WCYA 3ASWA 3H9HB 1L3WA 4Z0XB 5F96H 2NTSP 5DK0A 5D2NB 4E41D 5B8CA 3QFJA 4P9HL 2ITFA 4HVBA 2E86A 3L5IA 4MXVE 5EU6B 1LEIA 2YPLE 4DCQA 4OJAA 2HA1A 1ODUA 2HSIA 4MSWB 1WC7B 3WTYA 3DUUA 1OCWH 5EIQA 2AXJA 2ZXEB 3F2LA 4JFXA 3SGKC 3VGFA 3ZT6A 3EBAA 3MRBB 3MRLB 1U21A 5IM7B 1A7RH 4AUUA 3SOBL 3QUMH 3G5WA 5D7SH 3VB8A 4QRPE 3QJTB 2PPCA 5ESVB 4TLUA 4DK3A 4P2RD 4KMTH 1UGKA 4E42A 1G4RA 5D70L 4Z77B 3TF7C 1KGCE 2XWXA 3NJIA 4FE9A 5JDSA 3BP4B 4PIBA 1EK3A 3CBKB 3V5HB 2GIMA 4E0RA 5DFAA 4MASA 3F00A 2D31B 4LOEA 5FHAL 1I1FB 1Z0NA 3EFDL 3RWDB 3W5MA 1IBGL 4HZAA 1LDPL 4AT6B 3SGJA 4BUHA 2HKAA 2UVEA 1LHZA 2NT1A 4UILH 4N9OB 1OGTB 1EHXA 2AXGA 3HE7D 3FTYA 2L0DA 5DTFA 4BQ8A 4APQA 3IMSA 3SKOB 3BO8A 1A47A 2V17H 1NIDA 1MFMA 4G1MB 2XQYG 3FQTA 3VI3A 3WOVA 1LE9B 3HC2A 2XUWA 4KKCD 4L5FE 4P5TB 4IRJD 2EE2A 1JYWA 1S9VA 4TLKA 3ZKMC 3FTXA 3VRLF 1XF2A 3WNKA 1UXMA 1E6OH 4NRZB 4BFKA 2I7SA 3RFZC 2PYED 3S98A 3QZOA 3PWPA 1JHTB 1HWWA 3DX9B 4BM7A 5HVWA 4QXTA 5TE7L 4PRNA 4L5FH 5F1SA 3W0WD 2FWOA 4RNRA 1AD9B 1LD9B 4J3OC 4G9FA 1G0DA 3W37A 2WIIA 1F45A 5FO7A 1GIGH 1SJEB 1WP6A 4L48A 2IQAB 3LQMA 4DQOH 4BQBA 3X1BA 2RCSL 1J0HA 3ESMA 4M61B 2R0LH 3MRNA 2PWHA 2FVNA 3T0XA 3WE6B 2I69A 2X0UA 3GM0A 1P5UC 4FC3E 3PP4L 2WXGA 2CIKA 5JHDE 3SDXE 4JQVA 2AGJH 1UM5L 2IXQA 3NJHA 3L3OB 1NC4D 3AB0B 4TNVF 4FNRA 4ODTL 4XP1H 5EBMB 1FN4B 1JCKA 4YXHH 3FTGA 1QBLH 3UC0H 1IM9A 2EIKB 2OMZB 2YPLD 5HHQA 2WZ6A 4X9IA 1YEKH 3EOBA 3J2PA 4YSRA 4AOFA 2OZ4H 3GNMH 3X3FH 3KYOB 5I30L 1EFXD 1EHLH 5ITFA 3J8F7 4LRIA 2VDOB 4LVOB 2GY5A 1A21A 1A5FH 1C08B 1U8HB 4JJHA 3CN0A 5DXWA 4E41A 2ZUSA 4MCZB 1N5YH 3AQXA 2YBRA 3AM8A 4BSVA 3QDGA 1WBXA 2K0RA 2D03H 5GGVH 3B2PA 2DKMA 1MY7A 2G2NA 2Q7NA 1O7SA 1GMIA 3VYPA 2QMKA 4ZTPH 4TUJA 5BW7A 4QRPD 4L2YA 1IL1B 1IBDA 3GSVB 1EHAA 4RGMB 4YXKH 3UJTH 3VWJD 4Z7QF 5DZ9A 4S0TD 1KGCD 1M4KA 3CMOL 2PXYB 4HIHB 5AZ2L 3QC5X 4IJ3B 2NRDA 2C7UB 4HU2A 3MX0A 4Z3HA 3N9GH 5E7BA 5KS9E 3O3DA 3EFOB 1UCBL 2G9HA 1JXGA 3POHA 4OZGB 4TUKL 5CXPA 2ZG2A 4RSVA 2DQFB 3VRJA 4P2RA 1E9QA 5EEXA 1L9SA 1T5XA 1VHPA 2FX8L 4OZ4B 4YHZL 3DKHA 1MOEA 4A37A 1AHKA 2VXTL 4OCRH 1YCSA 7PAZA 3KGSA 4GNKB 4WAFA 3LIUA 2CPCA 1IGYB 2WCSA 4L1BA 2W0PA 4JM2D 1FHNA 1ACYL 1XXFC 4N2EA 1YY8A 4JM4L 5FYKE 2CNZA 3ISRA 4BA8A 5EEYA 5GSVA 1RIUL 4ODBD 4I87A 1Q9LB 2GITB 1LO0L 5EUKA 3W9DB 1PG7X 2QQKH 1S7WB 1X5FA 2ZYSA 3HZMA 4GJTB 2LLGA 4ABWA 5I1GL 1U33A 2YA0A 1HZLA 1HFUA 3QIWC 3SGEH 3MNWA 4LEEA 3VI4F 4YDKL 1FI8C 1AQDA 2WJ7A 4W70A 3SE3C 4PRPE 4M5ZL 3IT8D 4PVNA 3MBEC 1RJLA 2EO7A 1S3KH 5K33A 1P4LA 5T5NG 3MLTA 2Y1ZA 3DSNA 3P0GB 4MHHI 1BEYH 1V7ML 5CU9A 4FXGC 5JHDD 4ECNA 3LZFH 2XC8A 1DYZA 1VFOA 1CVSC 4W9JC 4OJYA 1BMZA 2Z7ZA 3C5JA 1TJGL 3C9NA 4AKQA 4HGKC 3FO0H 3LPFA 4LHQB 3QIUB 5KAQF 1JGIA 4I89A 4G8EA 4JDEA 5F1NA 1U95A 2ZWYA 4HJUA 1FYTA 2BNRA 2VDRL 2VMCA 2CHNA 1KYFA 2W9EH 2Y07L 4U2YA 2NQ3A 2Y3AA 4K9EH 1AJ7H 3OWEA 1VACB 2K4AA 5JIPA 5DEFA 4UNIA 5FGCE 3PY9A 4FQHA 3K8LA 3LZNA 1IGIH 4AQ8A 4QJ5B 3FUFA 2Z64C 5D4QA 2IPTH 3WHE1 4U2ZA 1KENH 1XB6A 1PLBA 4W93A 2ZOLB 2FO4B 2C1OA 4JFTA 2GSGB 5K39A 3U7WL 4GFTB 1YEEL 3NH7L 3AITA 2BS71 4NZUL 5IF0B 4G7SB 1PZ2A 4M6AA 2NW3B 4PJDE 5C9JA 2LTQC 5HBBA 3RDTD 2ERJC 3QJZA 4GI9A 1AZUA 4X6CB 1BV8A 4A2HA 2AQRA 4IMLA 4DPCX 4DPRA 2DI7A 5GZNC 3CVHB 3IVKB 5L4FA 1K5NB 3ZZSA 2FX9H 5JXEC 4YE4H 4YHNA 4PJ8D 5CZRA 2B59B 1G7IA 5ICUA 2YUVA 4N8UA 4CADB 4JQIH 4OIAA 1SPDA 5D2LE 1UENA 4TSBH 3HFMH 4YHOL 5CZVH 2NY4D 4MYPA 2Z7UA 1R3HB 5DJCA 5E6ZA 1X4YA 1E27A 4DP4X 4G82A 1LP9B 1NOAA 2DWTA 3FU6A 1GOHA 5FYKD 3B9KB 5F97E 4L4TA 3L3HB 3V0FA 5B7FA 1LE5B 3OMNB 1GGCL 1P69B 4EOWH 2F5AL 3EZ8A 5HHME 4YQXL 3HRZA 3KYMA 4H20H 4DF9A 1J5OL 4Y2LA 4XPAH 4KRLB 2Y7LA 4JM2A 3RGBA 4N2AA 2K7QA 1OE2A 3IFLH 4PRPD 1TVDA 4N24A 4F58H 9CGTA 1CXFA 4PCKA 3T3MB 1CL7H 3BGFB 3TH3T 1EEQA 1RZKH 2K8MA 3HFFA 4JE0A 4KRMB 3U7YH 1FO0L 1HCYA 4FYQA 2VMDA 4RISH 5I82A 5CMAA 1F41A 4UTBH 3B9EA 1EXUA 2BDNH 2FZ3A 3CQPA 1IC4H 1JNNH 5FYLH 5I8OL 4JFHE 1YNLL 3KCPB 4FRWA 3W5NA 4HIEA 3RWEA 4KKAC 3OJ2C 5CJBA 5AUMB 1T0PB 4ANWA 5J8OA 1SF5A 3FAWA 2Q8AL 2CLZB 3TEWA 1T7YA 3IJSB 2ICCA 3DETC 5BZWA 1AQHA 1CF1A 1HS6A 2HJLB 1BX2B 2ZKXA 1M57B 3KJ6L 2WVUA 1U8MB 5HXMA 4KUCD 5T1LA 5AG8A 4LSQL 3NCJH 1M53A 5BXFA 1L6ZA 1JVOA 4R4NC 1JVLA 5TDPB 2WYZA 4PP1D 5J12B 1IC1A 3UGEA 3RWCA 4JANA 4X6FB 3MHZA 4H1LG 4L1HA 2O6CA 4BCXA 2X53A 2H0EA 3ES6B 1IT9L 1RHFA 4P59H 1G7QA 4AIEA 4YDMA 2YMXL 3NPSC 2FQFA 3G6JF 3MA9L 2BIHA 4N5ED 3WUZA 2R2EA 1WO2A 3GIVA 4L0PB 3TM6A 4EN3B 5HDQL 2FX7H 1DFXA 2BZCA 1XXDC 5I6XB 3AT8A 2PR4L 4OGXH 3W39A 5IJKA 1JHKH 4N2KA 5HP5A 5A6MA 3K8KA 4CL7A 3TL5A 5D1QB 3FTWA 2FHBA 4HIPA 3U46A 3CXDL 1SZNA 5ESAB 3APNA 1RIVH 4WUKH 2HN7B 5CAYB 2VLLB 1PL3A 1TKWB 1I7RB 4HWBA 4XBGA 1BJ8A 3DK0A 3HUJB 3V10A 4PBDA 2X4RA 4WTWA 1J87A 3B7RL 5E5MA 2NY2C 3KGUA 2JJSC 4LOUD 1HI6B 4ODHH 5DS8B 1U3NA 2JI1A 4PJ8A 4MAYB 5DCCA 2OSLA 4UBDC 3MXWH 2BP5M 2YFNA 3B1UA 2QSQA 5HHMD 1FGVL 1A2YB 2R7EB 1V8HA 4JZJA 2D2OA 1RLWA 1F11B 4K23H 5C07B 2VMEA 5ICZA 4OI8A 3IU3B 3QUZB 3PWNA 1NOLA 4XZUB 3UGXA 5FO8B 1FFOA 4MXWL 4PTTA 3UZEC 4XO3A 5ALBL 1CFQB 1RPKA 1WAPA 2EDQA 4GW1A 4PRHE 2XRAH 5EBWA 4G8FB 5HHXH 4PY8J 1Z1WA 3GJFH 5F9JB 5DWPA 4XTRC 2APVA 5B1JC 5H4ZA 4Y4KC 4OLUL 1ZV9A 4F7CA 5JIKA 1RZGB 3CFKB 3NJJA 4NFBA 1INEL 1DANU 2QPUA 5IB1B 3S34L 5F7HA 1OCCB 3IDJB 3IDNA 3T3MF 1H6FA 3MLWH 3VXUA 4JFHD 3ARBB 4FFTA 3S35X 3U0WH 3EJYC 2Z92A 4HC1H 4LXFA 5EC2A 2Y5TA 3D48R 2DYRB 5FPIA 3DMMC 4QJ3B 2WLMA 2CWRA 3ULVL 2W60A 4GQ9L 4A6YH 2NY5L 4M7KH 4MMXB 4LP8A 1KLUB 4BK5C 4N85A 3LRKA 3O3AA 3V4VL 2E75C 3IKCA 5LBVA 2ZUVA 3QXAB 4CC0A 2X3AA 4F24A 4ZFZB 4ODVH 3L7FA 3R4DA 2IANA 1A9BB 2PPFA 2ENYA 4JFFA 3QEGH 5AAWA 5IB3B 5HD8C 5IKCB 3WG7B 2HT2D 5AVXB 5D2NC 1M3IA 2UWEF 4HGWA 4JMXA 4MA7H 4L8SA 1KBGL 1JCVA 2EEXA 4P2QB 3KR3L 5L9DL 5DUJA 1U8PA 2A0LD 4XN1A 1KLGA 3STLA 2WUBL 1EVTC 3MGAA 3NN8B 1RZIA 1JXDA 1C5DB 3G9AB 4NFDA 4NKQB 2OTWB 2Y6SD 1U8JA 4PLKC 4KNSA 4YHKL 3VFTB 2EKSA 3ASNB 1GZHC 1F00I 1Q94B 5BVJB 4DKTA 2QDWA 4TKWA 2KZWA 1A0QH 4R3SB 4GAGH 4ZMPA 1YYLL 5HSFA 2A3TA 1T83C 1TJXA 3BE1H 4YFDB 2IH8A 1LO2H 3BGAA 4NB7A 1T0MB 5E2UL 1KPVB 5EH1A 1E2VA 4X4ZA 2XWDA 4DWHA 4X4XA 4PJAE 4GO8A 2VN4A 4PV8B 4YDIH 2OW7A 3BMVA 5FDWB 2V8LA 2E0PA 4HJJH 5E9NA 1RIHH 2N1KA 3WNJA 4OIIL 3DNKA 3V6OC 4OZHB 5C3TA 4PRHD 4CU6A 1E5AA 1XGPB 4WK4B 1CQKA 2I9LA 2NQDA 1LO5B 2XY1A 2R4SL 1ED3A 2VR7A 3GT6A 3HCVA 3TC9A 4A2DA 3DVNB 3RJOA 3N85L 3VMNA 4O5LL 5H37G 1SXNA 4F80A 5BRZA 1FG2A 1OSZB 5HYSG 5FOJA 1ONQA 5IHWA 5D4JA 3OQ3B 4P5TC 3G04B 4ZSOE 3U36A 3L2LA 4M8QB 5FLVA 4U1IA 1XO8A 3RIAK 1HH9B 2V2XA 2CK0H 2F19H 3EYUH 4FG2A 3WFHB 2XIDA 1T03L 2VDKL 4XVUC 2FJHB 4A7GA 5CLWA 1J48A 2E9IA 5GZOD 3LNGA 4OF5A 4FCAA 3PQYB 4FI8A 2H0FA 2GAZA 1UFUA 2X88A 4X5PA 4DP5X 1OOAA 2IH3A 2MCMA 5IJVB 3UP6A 1VCBC 1FL5A 1C1EL 2E4FA 4JFYB 2XZQL 3L4ZA 4ZMZA 2BSCA 1U3ZA 1UHVA 3II3A 3MRIA 5CGYC 4I2XE 1GS6X 5I76A 2Y06H 4WTXA 5JW4Q 1JS4A 1NTDA 3LKSA 4FQQA 3MCLH 1J8HB 5EF0A 4LK4A 3KLLA 3N55A 5FX3A 3N1FC 2FD6H 1B2WL 1E4WH 2X6VA 1C8QA 4OJFL 3H9SE 3LKNB 3L3OC 3MACL 3MKKA 4NJ9L 2ICWI 3M6DA 4NJAH 3NZHH 4OKVA 4R96A 2P4AB 5F0JB 1PFOA 4QRRA 5AB0A 2OMWA 2YA1A 3VCLB 4PRAA 1Y18A 5I1CH 4TULH 2OTUA 1Q0YH 3CE1A 1IGFL 4TF4A 5E8NB 2PPDA 2BINA 4LVOC 5IT2H 2R1WB 4QXUH 5GRZA 1FPTL 2JCCE 4GRWH 3L3JA 3BSZL 1MNUH 3WHE0 3O2DA 1HIMH 3K6NA 3X12A 4NHUB 2X09A 2HUEA 3QEHA 3MQIA 3V6BR 4AEIL 4DGVL 3CHOA 3IU4H 5B3JE 3L3KA 4XVTH 5MENA 1V54B 2PXYC 3L7EB 4G6KL 2W0KA 3R1GH 4HAFA 4IJ3C 4RGNB 4N9GA 3V4PA 1RURL 1YJDC 4K2UH 1UQSA 1DCLA 4DEUA 2ODIA 1VERA 1TQCB 1OP4A 4L8BB 5AW8B 1T1WB 1HHGA 3LEVL 4G5ZH 2XPGB 4ZX3A 3UPRA 2J6WA 3ZLQC 1UVQA 2HB0A 5I17A 1USQA 3KPOB 2EINB 1R6VA 3K8MA 4KFZC 3MR9B 1BJ1H 1UA3A 4P23D 3VWKA 4HWZA 4FYTA 5T5FA 3UJJL 3VXOB 1CGSH 2OM5A 4RMUA 3G5YA 4E9RA 4IBZA 3HNVH 3MRDB 3TPUB 2H9GB 1U3JA 1LYQA 3JXAA 3CBJB 5M95B 4O2FB 4MBOA 4JB9L 2BHZA 3SKMB 1Q1PA 3D30A 4N3UA 3FSOA 3O8XB 4CSSA 3IJEB 3DHUA 2Y7SA 1J1PL 1M1SA 2J4WH 4W9GC 4YSQA 1QSZA 5B38B 2B77A 2XQ0A 2Q76A 2XY2A 5EZIH 2EDKA 1IZKA 2F54E 2OSXA 5C0DB 5DZPA 4GMTL 3RVVD 5E4EB 2F7PA 5LBSL 4C57C 1DSFH 2F5BL 1G9MC 3J07A 3QUYD 4PCSA 5FUZL 1KBBA 4AW7A 3ME0B 2W80C 2XWTA 1MCSA 2FT7A 4JLRA 1ET7A 4AMKH 2HTKD 3ELQA 3H9SD 3EJSA 5AB2A 2VABB 1A4JA 2ICWJ 3BIAX 4NZRH 1WD9A 1M9SA 4XNBA 4KK8C 8FABA 1A1MA 3WTWA 4F33A 4TSAL 1N19A 3QR1A 4KRPD 3SE9H 4F93B 5DA0B 5C92A 4EZKA 1U93A 1HWGB 4OAWB 4JR9H 3VACA 4PWFA 4XCFH 1DEEB 3M1BA 4JPKL 4Y88A 4L18A 4MAUH 2FQDA 1T22B 4WFFE 1YUHB 4XP4L 3ZMNA 2J8UE 4QHUA 3CN4A 4LCVA 1KBWA 3OC8A 4L4VE 5C7XL 2K6ZA 5JR1L 4MDJA 2RA1A 2ZAHA 4JHUA 4W4OA 1DVSA 1F6LL 1AG0A 4XMPH 1X5LA 4RMQA 3R0MA 5DS1A 1TU2B 3KPLB 3D06A 3BXNB 3CHSA 4NO3A 2XQBL 2UZIL 2ZWNA 3RB5A 3ULUF 4KO9A 1RUMH 1AFVH 3K6DA 4KHXH 3P4OB 4RFOH 3SYPA 5LGJA 4XOCA 3VG0H 5IMLB 1ETZA 4H5SA 1I7TA 4U1KA 1IAIL 2W5PA 4UTCA 5CP7B 4MXQD 1XV8A 4CBPA 2GW5A 2I26N 1FNGB 4NFCA 1XF1A 4L05A 5I1KL 2Y9RT 4PJAA 2WAHA 1FZJA 4I5BA 3FZUC 5E2VH 3S3DB 3MZGB 5M94B 4ONHA 3KW7A 1UB6B 3NSFA 4JGMA 1HILB 1ZV5A 5TFSL 5B1BB 1Y1UA 3DBXB 4ZOBA 3PYCA 5DQDH 5GS3A 3SQOL 3KPPA 3JV4A 4JRXE 1P7QD 1I9EA 1XGTB 4R7NB 2DWDB 3DIVA 3B9KC 2VXQA 2A6KB 1NUGA 2DIAA 5HYQB 3I6SA 3I6GB 4XPHL 4UQ3A 4LKCB 3KPRA 2CGYA 1SUJA 5FW6A 4APXA 1SJMA 5ADPH 3QG7L 2ALWA 4KROD 5C09B 3SPJA 4PJ9A 5JXAL 4CKQA 2WCGA 3A6BH 4YSTA 2HJKB 3BGFC 3PHQA 3U2JA 4AV5A 2HVJB 2B9AA 3EDJA 2NY6B 3B3IA 2V7HB 4A63A 2HTLD 5BQ7A 3HJ0A 1UD6A 5F6HI 4JFZH 4RAVA 1HE8A 1A3RL 3MV8A 4AL8L 5J6GB 2X28A 3FCTA 4JFUA 2MCPL 1VF5C 4TQ8A 3AG4B 3VD1A 1BPLB 1L4IA 3OKDB 4XP6L 3ZGIA 3FAXA 1MDAA 3LMJL 3QHZH 1AQKH 3RPIB 1CGTA 1MZYA 3ZGHA 5I0VA 1F56A 3S9DB 3L95A 5CEXA 4JO4H 4F27A 1ET8A 3MKGA 1EJFA 3MRHA 4X8GA 2VR4A 3H9SA 3UCQA 2EDHA 3UO8B 1RJYB 2J72A 2DKSA 2Z91B 4B96A 4O2EB 4WFFD 2WVTA 2MNUA 4PV9A 4YZFE 3BGMB 4M3KB 4R97B 1BF2A 5KVFE 3FOMA 3IRZA 1QLFA 4L4VD 4ZMQA 4CMMA 5E8OA 3U6RB 3FUNA 1IEBA 1ZV2A 3CFBA 4JCWA 5J12C 3FTVA 3X14A 5F7MC 1UT2A 1CD9B 2FEEL 1FL6A 1F90H 2V9RA 3WEMA 1XGQA 1O6TA 2M1KA 5LN8A 3TZVB 1HEZA 3FFCB 2W81C 1A9VA 3TNMB 2Q9OA 4AXWB 2IPKB 3B9AA 3BAYA 4B9PA 2R29H 4WCYH 1QRNE 1X6LA 4EN3C 5J57B 2V2WB 4MLIA 5DC2A 1I9RL 2X4TA 5I6XC 4LSDA 4I3RH 2ARJA 2ITCA 4YBLB 2VUKA 4W81A 1I8UA 1HK6A 5F7FA 3ABGA 5D1QC 2Q3XA 3JV6A 3BH9A 2E9GA 4NUJA 5F88B 4WKXA 1MUJB 1B0GA 1DE4A 2IQ9L 4ANUA 5CWSA 4ZMYA 5KUMA 4XCYB 1IGJB 3AY4A 1S4IA 2LVEA 3D39B 1U8LB 5EBLA 2FR4B 4WW2F 5LWYL 3UPAA 3ILDA 4JRXD 2V2TB 2PW2A 1DDHA 5D96B 4MAYC 3GHBH 5E08L 5LB1A 3ARTA 32C2B 3KBFA 4QT5B 5GRJH 4UM8B 5C0RL 1YEHL 2C9RA 3GMMA 4XX1E 3EDKA 5F3HB 2H26B 2CD0A 3DX1A 4LHUA 4NP9A 4QHLB 4U1NA 3KM1A 5ID0B 1P7QA 3BT0A 1JZ4A 3LNDA 4NQQA 3L13A 2DRUA 3CFTA 5DD6B 5KSAD 2ZUUA 1BVLA 2GSMB 2B4CL 1TQTA 2R69L 2WB1A 2AMUA 1J86A 2WV3A 1AGEB 3LB6C 1PQZA 4PEEA 3TJPA 1TR7A 4HF5L 5F6HJ 5F7DB 2WTRB 1ZT4A 2I32A 3FO2B 3BEWB 4XB8A 5EEZA 3WN6A 3D52A 2DQTH 3T2NH 4KFMA 3P0VL 1R34A 3PNWB 5IBLC 1HQRA 3FULA 4XHJD 1KOAA 3FRPA 1NEUA 2Z34A 1O6SB 3O6LL 4ZUWB 1H0DB 1MWAA 5LGHL 3FU7B 3ARBC 3GKWH 3QJXA 3SDDB 2BSBA 3VFOB 4EZMA 3TWYA 3W9EA 4BK8A 1R1CA 3LRSA 1KCRL 1HINH 3GIZL 1ZLUH 4F8PA 4MMXC 2GCYA 1P0SE 4JL2A 2JIXD 3VFUA 4EAEA 4TPRL 4UOJA 5EDXA 4FNPA 2ZCZA 4AYMC 5CIPB 1JK9A 2MQCA 2XNAA 3AJ7A 1I1RA 2CDGA 4JHBA 4WKZA 4YS4A 5IQOA 3OSVA 1W72B 1J9SA 4HJTA 5HJ3B 2L7EA 3GRWH 5C3IA 1PJ9A 2W9DL 1OLZA 2ADYA 1UD2A 5LG1A 3SZKC 2XHNA 2J8UA 3OC5A 3WD5H 3RY5A 3FQWB 1IBZA 5JOFB 2VN3A 3WTUA 1QRND 1EERB 1SBSL 1T7ZA 2Z8SA 3ARQA 2JFCA 1OP5H 4DGIH 2GKIA 2DTSA 4MXVF 2X4NA 4MDIB 2JV6A 1Z9LA 2PWDA 2VXSL 3IFNH 3QJVB 4ZO9A 4JPSA 3KE0A 2WKOA 4PLOB 2Y1YA 2CO1A 3EJUA 3VFWA 5EIIA 5JQ6H 3WKNA 1S9YA 4JPWH 3S5LB 4R7DB 5GSRB 4UUJB 4PSPA 4W9LC 1Y6NR 4OLVH 1OHQA 2NNCA 4Z7OB 1RK1A 4M43L 3TFKC 2ORBH 5EU3B 3UTZB 1DL7H 2VCOA 3TVMA 3VH8G 1SEQH 3LDBB 3QZNA 4PHZA 3WL9A 1DBJL 4Z7NB 3F7PC 2GHWB 5F93C 1FFNB 1FE8L 3PGDA 4KK5C 3IKKA 2X70B 3MPCA 5C9KA 3B43A 3MVSA 3RVTD 5IK3B 5C7ZA 1MPAL 5F9OH 2MCAA 1LQSR 4M4PA 4WY7L 3AG2B 4QCIB 1T5WB 5AKSA 3R06B 2ATPB 2NY7H 5I8EB 3SHSA 2HVBA 4P2CG 4EUPA 4NUPA 4U6VL 5CKGA 4J7RA 5L8JB 5ERWB 1NJ9A 3IN0A 1ZHNB 4KQ3L 2DWYA 3C60B 3N0AA 1M7IA 4XC3L 3F05A 5DYOA 3MO1B 1LK2B 1XGYL 5IB5B 5FIEA 2WO3B 4HUVB 5KSAA 1CYGA 1OAQL 5JW4M 4RRPA 2PMZA 2CIIB 3GXNA 4DH2A 4IBLT 1MIML 3G6DL 2AANA 4PLNC 5AYUL 3ZE2B 5I0XA 3E38A 2BVOB 1MRFH 4N68A 2C9AA 3DIFB 1PGRB 1G1KA 1QSEE 4XBEL 4BHUI 4OY9A 2GJJA 2HT3D 2NCEA 3LXBA 4RDBA 5DQJA 3KPMA 1LMIA 2Q20A 4X8CA 3GDBA 3MBWB 3ARSA 1BAFH 1P4IL 2A1WL 4ODSL 2AAAA 3QS3A 3GRGA 1T6BX 3E1ZA 2A73A 1OAJA 4L8DA 4TRPL 4ZDHB 5DHVH 2IGFL 2XV2A 3SDXF 1BCIA 2CUIA 4MB4A 2UXTA 2YGNA 5A6LA 1UT1A 5FK9B 3DHJA 1B88A 3FU3A 1I1AA 1BLIA 1CVRA 1FNHA 3DJSA 1QACA 4X8XA 2EDNA 5B4MC 4HBCL 5B3SB 1BQHG 1QSFA 5CZXD 3GGWA 4XNXH 4NQDE 2CLRA 4QHKJ 4KQ0A 5E24E 4N0UE 4OSUH 1G7LA 2W07A 3O6FD 1JHLH 1XH3B 5CJXA 3KLQA 3CN1A 4D0DB 5J9PA 5HDOA 3CZLA 1II4E 2XPYA 3BPOB 4HS3B 4FQXB 4J3OG 2OV0A 2UY7A 2E7HA 2DI9A 2W65A 4DUVA 4KTDL 4LDEB 3I9AA 5KYUA 3NABH 3HB3D 2JTYA 2X1XR 3OHXA 1RJZB 3DJTA 4ODUA 2VL5A 4GIPD 1NFDA 2OXGA 5FYJH 4DN4H 5D7IA 5KYYA 4HPYH 5SX5K 3RUGA 3KBEA 4P4KD 2COQA 3CQQA 4RGNC 4OFVA 2E27L 3BP6A 5KS9F 4CILA 4BQ9A 1QR1B 4J2XA 4CVXB 1TQCC 3NIGB 4OCYL 4PY7B 2IJ0C 1AS7A 4M8UA 3WIHH 4U7KA 2AV7A 3NRFA 4XN2A 2I7OA 1U8CB 5KSUA 2DKUA 3TJHD 1HH6B 4RFEA 3DRTB 2I25N 3CFMA 1CFVH 2XOTA 3HMWL 2VR6A 5GGSA 2ESVB 5AKVA 1MJ8L 1PSKH 4C55A 2IO5A 1IB5A 2DLFH 4IGBB 5EUOB 1YEIL 5I8KL 2PCFB 2VLRB 3FQXA 1BFOB 4G7RB 1EH9A 3M1CA 2YAOA 3LRHA 5E1GA 5T3ZH 4V33A 1UXSA 4ERSH 3HBGA 3NSYA 1OGAB 4FLRA 1P6FA 2VAJA 4WVRA 3GS4A 2A83A 3OKOB 4FKKA 4YFLI 1Z5HA 3BQVA 3RGHA 4M7ZB 1QSED 3O8XC 4U6TA 3MFFA 5D1ZD 1F86A 1UWEL 4NM4H 1CE1H 1ZXQA 4NPKA 3FK3A 1F18A 1RK0A 3NCYS 1R3IH 4PVLA 5E6RB 2O4EA 2Q6WB 3UBXG 1Z9PA 1UKTA 3QZWB 4Z7VA 1ZKAA 2RIKA 5E4EC 4XOBA 3RA7L 3K72A 1ZT7A 3X11B 2Y69B 4JPQA 5BS0E 5JOPE 5C0GB 3FH7A 1MRCL 2YD5A 2VNCA 2C34A 4HLJA 4WJ5A 3V0AC 5KBKA 2LU4A 3Q06A 3ARRA 4R7XA 1S5HB 2CXKA 4JY5L 3HAEG 4P3DA 2C3VA 4NQDD 3OGCA 1FF5A 5CGTA 5HGHB 3GI8H 3IMTA 4BA0A 2DM7A 1J5DA 4X4ME 4XMLL 4AVKA 4MQ7A 4B0MB 3SB3A 2FWUA 4XODA 4CVZB 2ARJQ 4N22A 4JFDE 4WI5A 3ESVF 5AAPA 4NNYA 4P2OD 3I50L 4KUCF 1WLHA 1E28A 5C08B 3U9PL 3MRPB 5IZ7A 2EDTA 4X83A 1G9NL 2KQNA 4MMYA 1NBYA 3QYMA 2BWQA 3APFA 3BVDB 2AJZB 1A7QH 2RFXA 5EFIA 4H8WC 1F4YH 3U82B 5HHVL 4Z8FL 1KTDB 3BAEL 4FG6C 1WDAA 1MI5A 1WE5A 1MHPH 1A6TA 4JMNA 6TAAA 2YLHA 2ENSA 2VXUH 4PJDF 2D3LA 1ZLVH 4LSSH 5I6MA 4NNXB 1T0NB 3R7QA 2ED6A 1BBJA 2WM0A 1AE6H 4ETQA 1UM4H 4I77H 2EDYA 3GJEB 1CE6B 1J8SA 5D2LF 2XBTA 3SGDI 4M6OL 3V8OA 2DQCH 5MEPB 2EDWA 4BZ2L 2ADFH 1UUNA 2IBZX 3DROB 5F1KC 4DJMA 1L7IL 1TZGL 4QJ4B 2CBMA 2O5ZH 1AY1H 1IC5H 2OA9A 1OSPL 3P77B 4NZ8A 3L4XA 3SZ6A 2ICWA 2PTVA 2WWKO 1DQQA 3ECBA 3KH3A 3QHFL 5I0DA 3ZE1B 3KG5A 3ZY7A 4XPBH 3EFFB 3SPGA 3O9WD 5HDLA 3NCFB 4PUBL 5I26A 4DK5A 1J5IA 5BJTB 5JQIB 2GTZA 1GGTA 3LQAH 3BP5A 3N0PB 4WU7B 1LNUA 4X6DA 1BMWA 1ZGLB 3MOBH 1O7DE 5CSGA 5IJDC 2F53A 3VXTB 4HXAH 2Q8BH 5KW9L 2VLJE 4HKJB 1BMGA 2VJ8A 4D3CL 1DQDL 2E46A 3MXVL 1BFSA 4HUXA 2NY6C 1QSEA 3DIDA 4M6NH 4NNPH 2YSSA 4R4BA 1NEZG 2Z3FA 2ZWZA 5FM4A 3ZDYE 4UNTA 4AMWA 5IV2B 1V3MA 5D7LB 1MHEA 5JOPD 2EYSB 5K9KA 2BIMA 4WI8A 3FUIA 3K6FA 3N50A 2P49B 4KTGA 2WSKA 5TK2A 2CDFB 3WSQH 3CVHL 1FORH 1CLOH 3CLEH 4AJWA 4IU2B 4G8GB 1NCCL 3QZBA 4OBRA 3EF7A 3WUWA 1TNMA 1XCWA 2KLTA 4LARH 4LNRB 4NN7C 1E3ZA 2EDEA 4NQEB 4XN5A 3QXDB 3LSOA 1UADC 5F9WB 4LSPL 5E1IA 4B27A 1GW0A 4AIZA 4JFDD 1HOEA 2CJTA 4LLDB 4R97C 3ZTNH 3ZZQA 3WNLA 5DJAA 1GJIA 4JN1L 1NCDL 3LN4A 3STZB 4N0UA 4MGXA 2H3NB 4NKMB 2CO7A 1T04B 1L0QA 2R2BB 3JZ7A 2OL3B 3LS5L 4O02A 1BG1A 2V9UA 3ILEA 2EIJB 3TZVC 4FQIH 5INCA 1PZ5A 4UQ2B 1JGUH 3CFJA 1IAKB 1JWMB 3LXAA 4ZXBA 3K6OA 4QYAA 4PG9A 3MV9B 1GTNA 1P7HL 4DOHB 2XKSA 4P46A 4YBLC 2O5YH 2WN2A 4OQTL 3U7AA 2O6DA 4BDVB 5EZPA 4WWKD 2EXSA 1BIIA 2CU9A 2H1LM 3HZKA 4PJ5E 1HAUA 1XR8B 2X87A 5FECB 2Y7MA 4I0PD 3FSAA 2DQGL 1AACA 1CC3A 5CNHA 3UEZA 2O5XH 3ZT5A 1B4JL 3I9PA 1KPRA 1BYPA 4XPTH 4IM8A 1CF8L 5D4IA 4IK7A 1JGEB 4A2EA 2MQ3A 5D96C 3TO2B 1LO4H 5EF2A 4ALAH 3GB7A 1JTPA 4DP8X 2KZBA 3NA9L 3QO0A 1MCQA 4WRLA 4EI5B 3BRFA 4UV4H 4YL9A 1WBZA 4XAWL 4J27A 4I18B 1OE1A 4MWFA 2K45A 5I16A 2Z8RA 3QFGA 4N2DA 3LPPA 2WNXA 1BM3H 2EO1A 4XMTA 2XVKA 3ATAA 3V79C 2YD9A 4POZD 5BOJA 3ROLB 1IQWL 1NCAL 1B9ZA 4FQ1H 2VLJD 3TLRA 2HG5B 2DJMA 2H32B 4X0KB 1IFHL 1SFHA 4ZUTB 3ZE1F 3O9WA 4G7YH 3PWJB 4WWNA 2C3WA 4ADGA 4LF3B 3TO4D 3DYPA 3GZOA 2OJZH 3PGCA 1L9NA 1PZCA 1V7NL 4U7SA 5KBNC 2R23A 4WGVB 3MA7B 2VSKB 1OAXL 1QSVA 4Z3TA 4G1EB 1UJTA 1BECA 5H4YA 3SDDC 2L3BA 1Y0LB 3V0EA 4PJIB 4O51B 4PGCB 4CGUB 1AO7B 3MREB 3O2WL 2IOMA 5CD5C 1ZTXE 4WWID 2MMXA 2MEJB 4N2GA 1DJWA 3GMRB 5L8LB 1AP2A 2AXFA 2CRIA 1RMFL 4HWBH 3IS0X 2AK1L 1XDTT 2L8AA 4L1TA 2GPZA 2WHVA 1Y07A 1QBMH 4GRWB 4M9PA 1R5WB 4X4MA 1ZTXH 3KYKH 1FJ1B 3PIQA 4JO1H 4QOKB 4NO0D 4FXKB 4JFDA 1JDDA 4W9KC 3V9EA 1FZOA 4BKLB 3HEIB 4MQXC 3TV3L 4GMSH 4H1LA 3RX5A 1G7MB 5CD3A 1MLBB 3LS4H 5JPMB 2AQPA 1CR9H 1YYCA 3DX2A 3MRKB 4BH7B 4PWEA 5JUEH 2XDHA 1X7SA 4OLYL 1K72A 3S35L 4TUOA 1QO3A 3V52L 1OM9A 1IM3A 1HQ4B 1GL4B 2A77L 2F18A 1RCYA 4ZW3A 3CFCL 4XBMA 1KFAH 3JWDH 4HSQA 4MVBD 1AGFA 3Q5YA 3VG9B 2H6PA 2VDPH 1T4KB 3ZKND 5BMFL 5KVGL 3QK0A 4PJGF 3QAZB 3IJ9A 3VFVB 4ZS7L 5HGBB 3EOYG 4GG6B 2EO9A 2WO2B 3FO1A 4E9TA 3LDBC 4I0PA 5C6WH 3T77B 1EO8H 3WEXA 5EO1A 2P8LA 3FONA 3V9FA 4EF3A 1L6PA 3MJ7B 2A7BA 3OKLB 1OCZB 3DK2A 1BF5A 3PFQA 1XH2A 2HLFC 3VXQB 5AOJA 2X6BA