2C3NA

Human glutathione-s-transferase t1-1, apo form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
239
structure length
239
Chain Sequence
GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3nA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3nA01
5INYA 2IMKA 1OC3A 2H75A 1B48A 2YN1A 4MMMA 4FYCA 2PBJA 1B9YC 2J9HA 2K18A 3O3TA 2F8AA 2OKAA 4MJCA 1Z6MA 4OFTA 3TRXA 2H74A 2HRKA 4XIHA 5JCUA 5KN3A 1UN2A 5IIZA 2PERA 1V9WA 3QOUA 4IVFA 3GIXA 4KSMA 6GSYA 3FEUA 5F0GA 3L9UA 4HJ2A 5IMAA 4PGTA 4TW5A 2L4CA 5IMVA 3L9VA 4BVYB 2OJLA 4DEJA 1EGOA 2J23A 5DCGA 4IBPA 1WMJA 5CRWA 2F9SA 3CRUA 5ECQB 4EO3A 1K3LA 4FO5A 2H6ZA 4WF5A 1UC7A 3ZVJD 4J56E 4MCUA 4E8EA 2I3YA 3IXRA 2VLUA 2IMDA 1M9BA 4AGSA 3F0IA 1YF1A 1CQGA 3J7Yb 5B8AA 4N10A 5G30A 1GSDA 5HFGA 4WF4A 4BPYA 1A0RP 3R2QA 3FKFA 4KH7A 1XPVA 2WZ9A 2YWNA 2KUCA 3F3RA 1AW9A 2OACA 2JU5A 1TK0B 1W89A 4EL1A 2BTOT 2PVQA 3IBHA 3KXOA 3DXBA 3DKSA 1O8XA 1PL1A 3W6GA 4WXTA 3L4NA 4PXOA 1KTEA 5EPFA 1GL8A 1TRVA 3RPNA 5EY6A 2F3MA 2G2QA 2FLSA 2C0DA 1U3IA 3A3TA 1TK5B 1USBA 2VD1A 4DSSA 2VL2A 1G7EA 2OBIA 4POBA 1S3AA 1SJZA 1G7OA 2N5FA 4CDOA 3UIWA 2CT6A 2TRCP 2HYXA 2VL3A 2C0FA 3GTUA 3TKSC 4YQUA 4ZB6A 3HJOA 2P0GA 3KP8A 3F63A 2VLTA 2DJJA 3TDGA 1LU4A 4TXOA 5J5NA 4J2FA 1A23A 1ZZYA 2GLRA 4MK3A 3UOMA 4EXJA 2V1MA 2IN3A 2XPEA 1MDKA 4ZB9A 4MF6A 4ZBBA 3ZZXA 3UVHA 3FZ5A 3TJBA 17GSA 3H1NA 1GSEA 5H5QA 5ABRA 3TKPA 4TR0A 4GF0A 2L6CA 4LMVA 2AYTA 4ISDA 1O73A 4FIWA 2H1GA 5H5SA 3VPQA 2DJ2A 1PSQA 4L8EA 1U87A 4Z7XA 4KSOA 4L0UA 2C3NA 1AQWA 2DC5A 1J9BA 3HCZA 3EU3A 4EE0A 1AQXA 4RQRA 2ES7A 3ZREA 3GNJA 4ECBA 5DQSA 2PU9C 1A2JA 1MEKA 4XS1A 2JSZA 1CQHA 4NHWA 1GP1A 4I6XA 5EVOA 2YP6A 1QQ2A 2WJUA 1SD8A 5DAKB 4POMA 5FHIA 5D9VA 4QQ7A 1DUGA 3DMLA 3Q18A 2F8FA 2LV3A 5FWGA 3E9JB 1SKRB 4GXZA 2GSRA 4I5QA 2HRKB 3G7YA 1XOAA 2IMEA 2DJ3A 3GL5A 4RI7A 2MMZA 5CP1A 3RBTA 2YANA 3GMFA 3DGQA 2GZZA 1XVQA 2IMFA 2NVLA 1X9MB 1GRXA 3M1GA 2NBSA 5J9BA 4GLTA 3C1RA 2AV4A 1VF1A 4CW9A 4NWYA 3KEBA 1WE0A 1SK2A 2GS3A 2V32A 1T7PB 1EV9A 5ECLB 3HY2A 3IK9A 4IKHA 2G0FA 4J57E 2N5AA 3QAGA 1A2LA 5G1KA 2V6OA 1N8JA 2I4AA 1PL2A 5HR0A 1FVKA 4HEA2 1M99A 2REMA 2GQLA 1BYEA 4AJ7A 5J4UA 1XZOA 5ECSA 1XBSA 3VWVA 1OE8A 4HZ4A 1AUCA 5KN0A 5IO0A 1PA3A 2VO4A 1V57A 4EF0A 1UVZA 4O32A 2CAQA 3WYWA 3HHVA 3UMAA 3QPMA 4G0KA 2C8UA 2M72A 3ZIVA 3CSHA 5DQYA 5D73A 4BVYA 2VIMA 3ED3A 4IS0A 2C1YA 3G7IA 3IDVA 5JCWA 2IPAA 2C0EA 2XBQA 2P5QA 5LNKe 3HA9A 1JFUA 3VI5A 2A2RA 3LEFA 1V58A 2CAIA 4MF7A 1AAZA 2GGTA 3GYKA 3CTFA 3M0FA 4PQ1A 2VCTA 1TOFA 1HQOA 5DALA 5HFIA 1X9WB 19GSA 3BJ5A 2FWEA 4FYBA 4KCAA 2CVKA 1YJ6A 3I9V2 4JEDA 4ZL9A 1SYXA 2XC2A 1QXHA 3GTUB 1OC9B 3NIVA 3MWHA 5IO2A 5G5FA 4KDYA 4MZBA 4I97A 2LRCA 1F2EA 4AJ8A 4TXOB 2OE0A 1EOHA 3PH9A 2R3XA 3IV4A 2B7JA 3K8NA 4PUAA 5J3RA 5IMZA 2CVBA 4XS6A 3KMNA 2F51A 1EZKA 2HE3A 1IYHA 4TOPA 2O87A 3KJYA 1OKTA 2V6KA 2CX4A 1NHYA 4XCSA 2AAWA 4MA9A 1V98A 2GT5A 5CRDA 3KH9A 3UVTA 1J0FA 5ID2A 2H8LA 3C1SA 4MJBA 3HZ4A 4KB3A 3W8SA 2HSHA 3HVXA 2JSYA 2LSTA 5HR3A 3TKSA 1DSBA 5B7CA 5CYYA 4NHZA 5KEJA 4GTUA 2MBTA 2YV7A 3MAKA 1U88A 5C00A 3EVIA 4ZXGA 3C8EA 3IC4A 3TJJA 5H5RA 2K9FA 4HQSA 1K3OA 4PNGA 4Q5NA 1M2DA 1HYUA 1J08A 1XWBA 5AISA 4HUAA 1XCCA 4KCEA 2WFCA 3CMIA 3MNGA 1FAAA 3UBLA 2R6KA 2VCZA 5LCZA 4WR4A 1EOGA 2YZUA 1VRSD 2MMOA 2DJ0A 1ABAA 3UARA 2YPMA 4IGJA 4F82A 1QMVA 2ON7A 4BL7A 2EIRA 3P2AA 1U3AA 5CAXA 5KN1A 3QMXA 1K0OA 3ME8A 3CBUA 4F03A 1F3BA 5IMFA 2GZPA 2VD0A 2L6DA 5ECMB 2L59A 3O6TA 2LJRA 3KD0A 4K7OA 4PX1A 1B4QA 1M0UA 3BD2A 4KX4A 1EEMA 2CZ2A 4MLYA 5D9WA 4N11A 1Y25A 3TOTA 1MDJA 2HRFA 3ZMLA 5A5KA 3A2VA 1MDIA 4MPGA 3BCKA 1TTZA 2KP2A 1ILOA 3C7MA 2WB9A 3FW2A 2FNOA 2E2MA 2HRAA 5J9CA 4ZBAA 2FA8A 5IMDA 2I1UA 1DBYA 3VWUA 1FW1A 4ZBDA 3HKRA 2H0HA 4IJ3A 3A2XA 1LBKA 1XFLA 1RK4A 5GSSA 4F0CA 5B6NA 2H71A 2K6VA 3LJRA 3HZ8A 4XRAA 4MJEA 3ZFLA 3VI7A 4BA7A 3ZL5A 4JU5A 4IP6A 3KMOA 4JBBA 3JCML 1X0RA 4G19A 2H30A 2FD3A 3GKKA 3LFLA 2MZCA 3TGZA 1JZRA 1XWCA 5D93A 4AF2A 3EE2A 2H1DA 4JR6A 5DBQA 4KNDA 4XRDA 4OD7A 1EEJA 3ZLPA 2KLXA 4IP1A 4LMWA 2H70A 5B6MA 2FWGA 2X64A 2WULA 1RW1A 1URMA 5DALB 2L5OA 1OC8A 1JZOA 2CZ3A 2RUFA 3DYRA 5FT3A 2VUPA 1Z9HA 1F3AA 3KH7A 3UAPA 1SK0A 2X8GA 4NXIA 2OA7A 2C80A 1SKWB 3ERGA 4K6XA 3RAZA 1GWCA 3FK8A 22GSA 4IQ1A 2EIQA 1TKDB 2AUVA 1H75A 5COHA 2HNLA 1EWXA 2GSTA 4EUYA 4K0NA 3D4MA 3IK7A 5CNWA 3HD5A 2LUSA 5IOXA 2MBSA 1TW9A 2ON5A 1WP0A 2VCWA 4KA0A 4HU7A 4OO5A 3M9JA 3PPUA 4WETA 4WKWA 2JL4A 2HQTA 4O5RA 4NV2A 1OC9A 2FUG2 5ID2B 1FG4A 4N0ZA 5F8BA 3OR5A 2IIYA 3HDCA 1Z3EA 1M2AA 3TKSE 4IQAA 3ME7A 2JACA 2CX3A 2H73A 4LLRA 4ML1A 2WRTA 4FH8A 1KBNA 3GH9A 1WRYA 3WD6A 3IA1A 4LL1B 5KN2A 3CRTA 2ALBA 2KHPA 2LTKA 2XHFA 1JLVA 1RQMA 3Q6OA 1FVJA 6GSUA 2H1AA 1TP9A 4PURA 3CTGA 1FO5A 4ZL8A 2B5XA 2WCIA 5IMCA 3EU4A 4GSNA 4G2EA 1GLPA 3DVXA 3GRXA 3UBKA 2LJKA 1XIYA 2KOKA 5GAPD 5IM9A 3G9BA 2PPTA 2H0IA 5CRGA 2HXKA 3QFBC 2VAFA 4GSTA 1BEDA 2MMNA 1I5GA 4L0WA 4I8BA 4BL7B 4MZWA 3ZFBA 3GKNA 1SKSB 1QUWA 1K0NA 2IFQA 1YKCA 1GNWA 2HFDA 2FWFA 1GSSA 2NPBA 3F3QA 3DRNA 2RUEA 3TCOA 1GTBA 1QGVA 1NW2A 2H0GA 3L78A 3TUEA 1BG5A 2RM6A 1VF4A 2IJYA 4YQMA 1TRUA 3KCMA 4PQIA 3NOFA 4JZQA 3KGKA 16GSA 4G9HA 1OKDA 5C04A 3FY7A 2LJAA 3HVSA 2PWJA 5D9TA 4G0LA 2N5BA 1WWJA 2E0QA 1PX6A 1QFNA 2ZUPA 3TKRA 3C73A 2WGRA 5IQYA 3GA4A 1SL0B 2M46A 4HQZA 3W8JA 2CQ9A 2GVPA 1TK8B 1SJ6A 3GV1A 4ULXA 4O7HA 4P3YB 4X43A 4KDXA 3VWXA 2GSSA 4MABA 2HRNA 3D21A 5AGYA 1SK1A 3TJKA 1I9DA 2FWHA 2H1BA 3FR6A 2MMAA 3RHCA 4V1Ap 3H93A 1TRSA 1XW6A 3H4KA 5G2ZA 3D4TA 1JLWA 4N30A 3FR3A 2LNTA 2PN8A 3VLNA 3E3EA 5GAND 4XHMA 1T00A 3LG6A 2L4QA 1TXXA 4NAXA 1TDIA 4GWRA 3PR8A 4O92A 4HDEA 2QKEA 2OADA 4V1Ag 1TI1A 1AC1A 1XWKA 2QC7A 2FY6A 1OYJA 3D22A 4MH2A 4EVMA 1B4PA 3FZ4A 2DMMA 5LD0A 3QAWA 4V2LA 2VOCA 3APOA 2KP1A 1TU7A 1THOA 3KTLA 2VL9A 1WOUA 3GSTA 5EL8A 3WGEA 1GULA 5DJMA 3WT1A 2B1KA 3SBCA 1TI3A 4E8HA 4HI7A 2GSQA 1X5CA 4IW9A 2VL2C 2CA8A 3KP9A 1YEXA 5E4WA 2VCXA 2B3SA 1R26A 3F6DA 3U6VA 1BQ7A 4XS4B 1A0FA 3GKMA 4DVCA 4KDUA 13GSA 4Q5FA 4ZIJA 2H66A 2YNXA 2XPDA 2HZFA 1ZOFA 3BCIA 1PMTA 4JRRA 4TVEA 5ELGA 6GSTA 2K8VA 3D6IA 2K8SA 1PKWA 2LRNA 2WDUA 1TJDA 4IJIA 2VCQA 4EC0A 1Z7PA 1A2MA 1GTIA 3HYPA 2X8CA 3GHAA 4NMUA 1EGRA 1GSUA 1THXA 1O85A 1Z6NA 3QFAC 3MDKA 4KAEA 1SJIA 1A8LA 1V2AA 2B5YA 2PGTA 2H01A 3VFIA 3GH6A 2YJHA 4OFNA 4OCFA 1WIKA 5E59A 2IFQB 1T1VA 1SENA 2GQKA 3VWWA 1OAZA 4HZ2A 4K0GA 3DWVA 1ERUA 1O8WA 4YAPA 1EV4A 4AJ6A 3O76A 2GZYA 2LQOA 4MDCA 3CSIA 1PKZA 5F07A 1ZYEA 4HS1A 3ZYWA 3KZQA 6GSSA 1OE7A 1VGLA 4Q5QA 1GUKA 1W4VA 3QAVA 1MTCA 3TRPA 1ERTA 1TRWA 3DVWA 2H6YA 3RPPA 5JWRB 2O85A 1VF2A 3H79A 1HNAA 3IE3A 2CV4A 2HSMA 1GTUA 4ECIA 4BVXB 2JZSA 2GDRA 1PRXA 1X5DA 2AB6A 1A8YA 1FOVA 3VK9A 2OBKA 1AIUA 3LORA 4D73A 1YY7A 3A5WA 2GTUA 2YZHA 5ECKB 2C0GA 3IRAA 1K0BA 3I6AA 3EURA 3EMPA 3N9JA 2IL3A 4GRFA 5F05A 2A4VA 4OWYA 2I81A 5D9XA 1S3DA 2DIZA 1AQVA 4PUFC 1YEPA 3C71A 2V2GA 1ERVA 3RHBA 3KIJA 2O7KA 1OVNA 4KE3A 4QL9A 2DLXA 4POKA 4MF5A 4ML6A 4WR5A 2H6XA 1U6TA 3ISOA 2PUKC 2HZEB 1JZDA 1ML6A 1GNEA 1ERWA 3KTBA 2DSAA 2TRXA 4JR4A 1YZXA 1ON4A 4PNFA 2H76A 2NTOA 1GLQA 3MSZA 3FYGA 2LEGA 5GSTA 4HOJA 3F6FA 3ZVJA 4ZB8A 4F9ZA 4DSQA 1HNBA 3Q19A 2M80A 3I69A 2D2ZA 1R7HA 5ELAA 2CVDA 1LJRA 2QGVA 1EP8A 3IAM2 2NDOA 3TOUA 1GTAA 2O8VB 4GCIA 4K2DA 1FB6A 4PQHA 5CO3A 2R2JA 3GURA 5ECIB 3U5RE 1B9XC 2Z9SA 1T3BA 4TRXA 3F4SA 2P31A 3EMXA 3GN3A 5G31A 4ECCA 3P7XA 2OE3A 3GL3A 1ZMAA 3NZNA 2ZNMA 4KUNA 4POLA 1PGTA 4KF9A 1HD2A 2TIRA 3V1WA 2RM5A 1R5PA 3IOSA 4V2NA 2B5EA 1TU8A 3FHKA 1XVWA 4RQXA 4L5LA 4XS4A 4L5OA 3D5JA 1XW5A 1GH2A 3GX8A 3A2WA 1ZCPA 1M2BA 1ST9A 4ACSA 3WGDA 1FB0A 1NSWA 1XOBA 3ZMKA 1XWGA 1SD9A 3APSA 4EKZA 1K0CA 3FZAA 4HJMA 1N2AA 5GZZB 2R5GA 3GSSA 4OO4A 1B8XA 2E2GA 2RIIA 2HT9A 1O7UA 2YV9A 2LRTA 2DJ1A 1G6YA 3LGCA 3D0ZA 1PQNA 3G7JA 4G0IA 4TR4A 2OE1A 1H4OA 5CREA 6GSWA 2LKUA 4IHUA 4F2IA 3M9KA 3F4TA 2VM2A 2R4VA 2FGXA 3QCPA 3ERWA 2HSMB 1SL2B 1S3CA 3LSZA 4RUVA 2HLSA 2YWIA 2DIYA 3ZTLA 4YH2A 3VURA 2IWTA 1SU9A 3CXGA 3LYPA 1PN9A 2RLIA 1Q98A 1YKAA 4EDZA 3HJPA 2WS2A 1G6WA 2C4JA 2EIOA 2VCVA 3EWLA 1ACVA 5BMUA 4TKYA 2C3TA 2H72A 2PMTA 4JE1A 4ZILA 3F4RA 4NV5A 1O6JA 1ZL9A 3VPTA 2JZRA 2LNSA 2XBIA 4D73B 4MH3A 1F37A 5ECHB 1MD3A 1MD4A 4GSSA 3UL3A 2B7KA 5DVBA 3TRQA 14GSA 2VLVA 2FCHA 11GSA 3FRCA 4WEYA 3WGXA 2IMIA 3BOAA 4FYUA 2P5RA 2VM1A 1A24A 3J7Yk 1AXDA 2YOIA 4BVXA 2PVOC 4IELA 1NM3A 4USSA 4MJAA 3LXZA 3IHQA 5CRHA 5DDLA 2R37A 3M3MA 1K3YA 3BBYA 6GSXA 2YJ7A 4BWQA 3TKQA 3R3EA 5A4UA 4X0XA 3CSJA 2E7PA 2BJXA 1KEBA 2B6MA 3E0UA 1JHBA 1DE2A 5A4VA 1Y6EA 4X1UA 1T4YA 3L0HA 2C3QA 5AN1A 1BJXA 1M9AA 1SL1B 6GSVA 2EC4A 4ECJA 1HNCA 3LWAA 5IPGA 2GQMA 3LXTA 4TR1A 3GFKA 2YCDA 3UJ1A 1E6BA 1YQ1A 2ZCTA 1IYIA 5DJLA 5HR2A 3FZ9A 5L71A 3H8QA 4RI6A 4K8MA 5HR1A 4BWSA 5D96A 2HZEA 2HSYA 2GT6A 2MYGA 3EYTA 2A2SA 2AJQB 1K0DA 1F9MA 2DBCA 3L9SA 3FR9A 4F0BA 1V40A 1PX7A 3IAS2 1F6MC 2X99A 3APQA 1BX9A 5ECOB 1WJKA 2QSIA 3I43A 8GSSA 1K0MA 1YF0A 2DMLA 3GKXA 2UZ8A 1NHOA 3ERFA 4OFMA 1VF3A 2LS5A 3HJMA 1O81A 1ZYQB 3QD9A 9GSSA 5JWOB 1X9SB 4NPBA 3M8NA 1WPIA 3EINA 3IPZA 4OMVA 2HI7A 3KM6A 3TJFA 4MZCA 3N5OA 1GSQA 4Q5RA 3RDWA 2DJKA 1SYRA 2H19A 4DSSB 1T4ZA 1XXUA 1PD21 3CYNA 5ECRB 3GUSA 3F9UA 4GQCA 4CHSA 1XW9A 5AIXA 5F06A 1K0AA 4XTSA 1E2YA 2YWOA 3Q74A 4ILFA 4YAVA 3DIEA 4K7NA 4N0VA 4TN8A 3ZITA 1DE1A 4I2UA 3US3A 5IOWA 4PTSA 20GSA 3AY8A 3ZIJA 2X8HA 4KGIA 1BAYA 1Z7RA 2LQQA 1G0TA 2L57A 1XWAA 4K9ZA 4K1FA 4I2TA 1UA5A 5JWQB 5HFKA 5HQPA 1M7TA 1QK8A 5G1LA 5AIVA 3ZRDA 3IC8A 1R4WA 4H86A 1Q4JA 1GSYA 2L5LA 4V2MA 1FHEA 3SWLA 3P8WA 1GUHA 3IR4A 2HSNB 4MPFA 1C72A 4G10A 1R5AA 3WT2A 4ZL7A 3PINA 3S9FA 1GUMA 12GSA 3QDNA 1Z5YE 3LYKA 5J41A 4LA1A 2I9HA 2FHEA 4WBJA 5ECNB 4TR3A 3EC3A 2YWMA 4ID0A 4OCEA 5JCGA 4QL7A 3PGTA 4YQVA 1EP7A 3DEXA 4HU9A 4MP4A 3HVVA 3P90A 3QR6A 5A4WA 3HXSA 3TB2A 2V41A 4K7IA 2JZTA 4KW6A 4WBRD 5IPHA 3TJGA 18GSA 1T8EB 5G5EA 4EDYA 2AHEA 1JZWA 5ECPB 5B8BA 1YDKA 5DCHA 1X5EA 10GSA 1GSFA 2FA4A 4FQUA 3GX0A 2O89A 4DSRA 2B1LA 1KNGA 2JADA 1ZGNA 3F8UA 5D8IA 2BMXA 4IN0A 3LQ7A 3DD3A 4LL4B 7GSSA 4TR1B 4TXVA 5ENUA 5DAKA 3UEMA 4GQFA
chains in the Genus database with same CATH superfamily
5INYA 2IMKA 1OC3A 2H75A 1B48A 2YN1A 4MMMA 4FYCA 1YVLA 2PBJA 1B9YC 2J9HA 2K18A 3O3TA 2F8AA 2OKAA 4MJCA 1Z6MA 4OFTA 3TRXA 2H74A 2HRKA 4XIHA 5JCUA 5KN3A 1UN2A 5IIZA 2PERA 1V9WA 3QOUA 1N25A 4IVFA 3GIXA 4KSMA 6GSYA 3FEUA 5F0GA 3L9UA 4Z2UA 4HJ2A 5IMAA 4PGTA 4TW5A 2L4CA 5IMVA 2WVXB 3L9VA 4BVYB 2OJLA 4DEJA 1EGOA 2J23A 5DCGA 4IBPA 1WMJA 5CRWA 2F9SA 3CRUA 5ECQB 4EO3A 1K3LA 4FO5A 2H6ZA 4WF5A 1UC7A 3ZVJD 4J56E 4MCUA 4E8EA 2I3YA 3IXRA 2VLUA 2IMDA 1M9BA 4AGSA 3F0IA 1YF1A 1CQGA 3J7Yb 5B8AA 4N10A 5G30A 1GSDA 5HFGA 4WF4A 4BPYA 1A0RP 3R2QA 3FKFA 4KH7A 1XPVA 2WZ9A 2YWNA 2KUCA 3F3RA 1AW9A 2OACA 2JU5A 1TK0B 1W89A 4EL1A 2BTOT 2PVQA 3IBHA 3KXOA 3DXBA 3DKSA 1O8XA 1PL1A 3W6GA 4WXTA 3L4NA 4PXOA 1KTEA 5EPFA 1GL8A 1TRVA 3RPNA 5EY6A 2F3MA 2G2QA 2FLSA 2C0DA 1U3IA 3A3TA 1TK5B 1USBA 2VD1A 4PI2C 4DSSA 2VL2A 1G7EA 2DKIA 2OBIA 4POBA 1S3AA 1SJZA 1G7OA 2N5FA 4CDOA 3UIWA 2CT6A 2TRCP 2HYXA 2VL3A 2C0FA 3GTUA 3TKSC 4YQUA 1SVOA 4ZB6A 3HJOA 2P0GA 3KP8A 3F63A 2VLTA 2DJJA 3TDGA 1LU4A 4TXOA 5J5NA 4J2FA 2VKZG 1A23A 1ZZYA 2GLRA 4MK3A 3UOMA 4EXJA 2V1MA 2IN3A 3MYDA 2XPEA 1MDKA 4ZB9A 4MF6A 4HSCX 4ZBBA 3ZZXA 3UVHA 3FZ5A 3TJBA 17GSA 3H1NA 1GSEA 5H5QA 5ABRA 3TKPA 4TR0A 4GF0A 4QMKA 2L6CA 4LMVA 2AYTA 4ISDA 1O73A 4EIPA 2WW3A 4FIWA 2H1GA 5H5SA 3VPQA 2DJ2A 1PSQA 4L8EA 1U87A 4Z7XA 4KSOA 4L0UA 2C3NA 1AQWA 2DC5A 1J9BA 3HCZA 5J4VA 3EU3A 3RFRC 4EE0A 5A34B 1AQXA 4RQRA 2ES7A 1PFOA 3ZREA 3GNJA 4ECBA 5DQSA 2PU9C 1A2JA 1MEKA 5J40A 4XS1A 2JSZA 1CQHA 4NHWA 2WW0A 1GP1A 4I6XA 5EVOA 2YP6A 1QQ2A 4AKIA 2WJUA 1SD8A 5DAKB 4POMA 5FHIA 5D9VA 4QQ7A 1DUGA 3DMLA 3Q18A 2F8FA 2LV3A 1YEWC 5FWGA 3E9JB 1SKRB 4GXZA 2GSRA 4I5QA 2HRKB 3G7YA 1XOAA 2IMEA 2DJ3A 3GL5A 4RI7A 2MMZA 5CP1A 3RBTA 2YANA 3GMFA 3DGQA 2GZZA 1XVQA 1M3JA 2IMFA 2NVLA 1X9MB 1GRXA 3M1GA 2NBSA 5J9BA 4GLTA 3C1RA 2AV4A 1VF1A 4CW9A 4NWYA 3KEBA 1WE0A 1SK2A 2GS3A 2O36A 2V32A 2H1LA 1T7PB 1EV9A 5ECLB 3HY2A 3IK9A 4IKHA 2G0FA 4J57E 2N5AA 3QAGA 1A2LA 5J47A 5G1KA 2V6OA 1N8JA 2I4AA 1PL2A 5HR0A 1FVKA 4HEA2 1M99A 2REMA 2GQLA 1BYEA 4AJ7A 5J4UA 1XZOA 1XBSA 5ECSA 3VWVA 1OE8A 4HZ4A 1AUCA 5KN0A 5IO0A 1PA3A 2VO4A 2A2PA 1V57A 4EF0A 1UVZA 4O32A 2CAQA 3WYWA 3HHVA 3UMAA 3QPMA 4G0KA 2C8UA 2M72A 3ZIVA 3CSHA 4G01A 5DQYA 5D73A 4BVYA 2VIMA 3ED3A 4IS0A 2C1YA 3G7IA 3IDVA 5JCWA 2IPAA 2C0EA 2XBQA 2P5QA 5LNKe 3HA9A 1JFUA 3VI5A 2A2RA 3LEFA 1V58A 2CAIA 4MF7A 1AAZA 2GGTA 3GYKA 3CTFA 3M0FA 4PQ1A 2VCTA 1TOFA 1HQOA 5DALA 5HFIA 1X9WB 19GSA 3BJ5A 2FWEA 4Z2TA 4FYBA 4KCAA 2CVKA 1YJ6A 3I9V2 4JEDA 4ZL9A 1SYXA 2XC2A 1QXHA 3GTUB 1OC9B 3NIVA 3MWHA 5IO2A 5G5FA 4KDYA 4MZBA 4I97A 2LRCA 1F2EA 4AJ8A 4TXOB 2OE0A 1EOHA 3PH9A 2R3XA 3IV4A 2B7JA 1ZYNA 3K8NA 4PUAA 5J3RA 5IMZA 2CVBA 4XS6A 3KMNA 2F51A 1EZKA 2HE3A 1IYHA 4TOPA 2O87A 3KJYA 1OKTA 2V6KA 2CX4A 1NHYA 4XCSA 2AAWA 4MA9A 1V98A 2GT5A 5CRDA 3KH9A 3UVTA 1J0FA 5ID2A 4PHZC 2H8LA 3C1SA 4MJBA 3HZ4A 4KB3A 3W8SA 2HSHA 4O5QA 3HVXA 2JSYA 2LSTA 5HR3A 3TKSA 1DSBA 5B7CA 5CYYA 4NHZA 5KEJA 4GTUA 2MBTA 1S4BP 2YV7A 3MAKA 1U88A 5C00A 3EVIA 4ZXGA 3C8EA 3IC4A 3TJJA 5H5RA 2K9FA 1K3OA 4PNGA 4Q5NA 4HQSA 1M2DA 2EFHA 1HYUA 1J08A 1XWBA 5AISA 4HUAA 1XCCA 4KCEA 2WFCA 3CMIA 3MNGA 1FAAA 3UBLA 2R6KA 2VCZA 5LCZA 4WR4A 1EOGA 2YZUA 1VRSD 2MMOA 2DJ0A 1ABAA 3UARA 2YPMA 4IGJA 4F82A 3CQFA 1QMVA 2ON7A 4BL7A 5A34A 4N3ZA 2EIRA 3P2AA 1U3AA 5CAXA 5KN1A 3QMXA 1K0OA 3ME8A 3CBUA 4F03A 1F3BA 5IMFA 2GZPA 2X4AA 2VD0A 2L6DA 5ECMB 2L59A 3EPTA 3O6TA 2LJRA 3KD0A 4K7OA 4PX1A 1B4QA 1M0UA 3BD2A 4KX4A 1EEMA 2CZ2A 4MLYA 5D9WA 4N11A 1Y25A 3TOTA 1MDJA 2HRFA 1BG1A 3ZMLA 5A5KA 3A2VA 1MDIA 4MPGA 3BCKA 1TTZA 2KP2A 1ILOA 3C7MA 2WB9A 3FW2A 2FNOA 2E2MA 2HRAA 5J9CA 4ZBAA 2FA8A 3A5IA 5IMDA 2I1UA 1DBYA 3VWUA 1FW1A 4ZBDA 3HKRA 2H0HA 4IJ3A 3A2XA 4YKFA 1LBKA 1XFLA 1RK4A 5GSSA 4F0CA 5B6NA 2H71A 2K6VA 3LJRA 3HZ8A 4K5SA 4MJEA 4XRAA 3ZFLA 3VI7A 4BA7A 3ZL5A 4JU5A 4IP6A 3KMOA 4JBBA 3JCML 1PN0A 1X0RA 5A5HA 4G19A 2H30A 2FD3A 3GKKA 3LFLA 2MZCA 3TGZA 2DKHA 1JZRA 1XWCA 5D93A 4AF2A 3EE2A 2H1DA 4JR6A 5DBQA 4KNDA 4XRDA 4OD7A 1EEJA 3ZLPA 4AKXB 2KLXA 4IP1A 4LMWA 2H70A 5B6MA 2FWGA 2X64A 2WULA 1RW1A 4CY8A 1URMA 5DALB 2L5OA 1OC8A 1JZOA 2CZ3A 2RUFA 3DYRA 5FT3A 2VUPA 4AKHA 1Z9HA 1F3AA 3KH7A 3UAPA 1SK0A 2X8GA 4NXIA 1I1IP 2OA7A 2C80A 1SKWB 3ERGA 2O5VA 4K6XA 3RAZA 1GWCA 3FK8A 22GSA 4IQ1A 2EIQA 1TKDB 2AUVA 1H75A 5COHA 2HNLA 1EWXA 2GSTA 4EUYA 4K0NA 3D4MA 3IK7A 5CNWA 3HD5A 2LUSA 5IOXA 2MBSA 1TW9A 2WZSA 2ON5A 1WP0A 2VCWA 4KA0A 4HU7A 4OO5A 3M9JA 3PPUA 4WETA 4WKWA 2JL4A 2HQTA 4O5RA 1SVMA 4NV2A 1OC9A 2FUG2 5ID2B 1FG4A 4N0ZA 5F8BA 3OR5A 2IIYA 3HDCA 1Z3EA 1M2AA 3TKSE 4IQAA 3ME7A 2JACA 2CX3A 2H73A 2EFEA 4LLRA 4ML1A 2WRTA 4FH8A 1KBNA 3GH9A 1WRYA 3WD6A 3IA1A 1SVLA 2WVYA 4LL1B 5KN2A 3CRTA 2ALBA 2KHPA 2LTKA 2XHFA 1JLVA 1RQMA 3Q6OA 1FVJA 6GSUA 2H1AA 1TP9A 4PURA 3CTGA 1FO5A 4ZL8A 2B5XA 2WCIA 5IMCA 3EU4A 4GSNA 4G2EA 1GLPA 3DVXA 3GRXA 3UBKA 2LJKA 1XIYA 2KOKA 5GAPD 5IM9A 3G9BA 2PPTA 2H0IA 5CRGA 2HXKA 3QFBC 2VAFA 2A4HA 4GSTA 1BEDA 2MMNA 1I5GA 4L0WA 4I8BA 4BL7B 4MZWA 3ZFBA 3GKNA 1SKSB 1QUWA 1K0NA 2IFQA 1Y1UA 1YKCA 1GNWA 2HFDA 2FWFA 1GSSA 2NPBA 3F3QA 3DRNA 2RUEA 3TCOA 1GTBA 1QGVA 1NW2A 2H0GA 3L78A 3TUEA 1BG5A 2RM6A 1VF4A 2IJYA 4YQMA 1TRUA 3KCMA 4PQIA 3NOFA 4JZQA 3KGKA 16GSA 4G9HA 1OKDA 5C04A 3FY7A 2LJAA 3HVSA 2PWJA 5D9TA 4G0LA 2N5BA 1WWJA 2E0QA 1PX6A 1QFNA 2ZUPA 3TKRA 3C73A 2WGRA 5IQYA 3GA4A 1SL0B 4K2XA 2M46A 4HQZA 3W8JA 2CQ9A 2GVPA 1TK8B 1SJ6A 3GV1A 4ULXA 4O7HA 4P3YB 4X43A 4FXYP 4KDXA 3VWXA 2GSSA 4MABA 2HRNA 3D21A 5AGYA 1SK1A 3TJKA 1I9DA 2FWHA 2H1BA 3FR6A 5A5HB 2MMAA 3RHCA 4V1Ap 3H93A 1TRSA 1XW6A 3H4KA 5G2ZA 3D4TA 1JLWA 4N30A 3FR3A 2LNTA 2PN8A 3VLNA 3E3EA 5GAND 4XHMA 1T00A 3LG6A 3RGBC 2L4QA 1TXXA 4NAXA 1TDIA 4GWRA 3PR8A 4O92A 4HDEA 2QKEA 2OADA 4V1Ag 1TI1A 1AC1A 1XWKA 2QC7A 2FY6A 1OYJA 3D22A 4MH2A 4EVMA 1B4PA 3FZ4A 2DMMA 5LD0A 3QAWA 2WVZA 4V2LA 2VOCA 3APOA 2KP1A 1TU7A 1THOA 3KTLA 2VL9A 1WOUA 3GSTA 5EL8A 3WGEA 1GULA 5DJMA 3WT1A 2B1KA 3SBCA 1TI3A 4E8HA 4HI7A 4GDFA 2GSQA 1X5CA 4IW9A 2VL2C 2CA8A 3KP9A 1YEXA 5E4WA 1M3IA 2VCXA 2B3SA 1R26A 3F6DA 3U6VA 1BQ7A 4XS4B 1A0FA 3GKMA 4DVCA 4KDUA 13GSA 4Q5FA 4ZIJA 2H66A 2YNXA 2XPDA 2HZFA 1ZOFA 3BCIA 1PMTA 4JRRA 4TVEA 5ELGA 6GSTA 2K8VA 3D6IA 2K8SA 1PKWA 2LRNA 2WDUA 1TJDA 4IJIA 3HMJG 2VCQA 4EC0A 1Z7PA 1A2MA 1GTIA 3HYPA 3MIXA 2X8CA 3GHAA 4NMUA 1EGRA 1GSUA 1THXA 1O85A 1Z6NA 3QFAC 3MDKA 4KAEA 1SJIA 1A8LA 1V2AA 2B5YA 2PGTA 2H01A 4O5UA 3VFIA 3GH6A 2YJHA 4OFNA 4OCFA 1ZYPA 1WIKA 5E59A 2IFQB 1T1VA 1SENA 2GQKA 3VWWA 1OAZA 4HZ2A 4K0GA 3DWVA 1ERUA 1O8WA 1BF5A 4YAPA 1EV4A 4AJ6A 3O76A 2GZYA 2LQOA 4MDCA 3CSIA 1PKZA 5F07A 1ZYEA 4HS1A 3ZYWA 3KZQA 6GSSA 1OE7A 1VGLA 5BRTA 4Q5QA 4AKGA 1GUKA 1W4VA 3QAVA 1MTCA 3TRPA 1ERTA 1TRWA 3DVWA 2H6YA 3RPPA 5JWRB 2O85A 1VF2A 3H79A 2X49A 1HNAA 3IE3A 2CV4A 2HSMA 3HVNA 1GTUA 4ECIA 4BVXB 2JZSA 2GDRA 1PRXA 1X5DA 2AB6A 2EFCA 1A8YA 1FOVA 3CHXC 3VK9A 2OBKA 1AIUA 3LORA 4D73A 1YY7A 3A5WA 2GTUA 2YZHA 5ECKB 2C0GA 3IRAA 1K0BA 3I6AA 3EURA 5A1NB 3EMPA 3N9JA 2IL3A 4GRFA 5F05A 2A4VA 4OWYA 2I81A 5D9XA 1S3DA 2DIZA 1AQVA 4PUFC 1YEPA 3C71A 2V2GA 1ERVA 3RHBA 3KIJA 2O7KA 1OVNA 4KE3A 4QL9A 2DLXA 4POKA 4MF5A 4ML6A 4WR5A 2H6XA 1U6TA 3ISOA 2PUKC 2HZEB 1JZDA 1ML6A 1GNEA 1ERWA 3KTBA 2DSAA 2TRXA 4JR4A 1YZXA 1ON4A 4PNFA 2H76A 2NTOA 1GLQA 2UV8G 3MSZA 3FYGA 2LEGA 5GSTA 4HOJA 3F6FA 3ZVJA 4ZB8A 4F9ZA 4DSQA 1HNBA 3Q19A 2M80A 3I69A 2D2ZA 1R7HA 5ELAA 2CVDA 1LJRA 2QGVA 1EP8A 3IAM2 2NDOA 3TOUA 5KOWA 1GTAA 2O8VB 4GCIA 4K2DA 1FB6A 4PQHA 5CO3A 2R2JA 3GURA 5ECIB 3U5RE 1B9XC 2Z9SA 1T3BA 4TRXA 3F4SA 2P31A 3EMXA 3GN3A 5G31A 4ECCA 3P7XA 2OE3A 3GL3A 1ZMAA 3NZNA 2ZNMA 4KUNA 4POLA 1PGTA 4KF9A 1HD2A 2TIRA 3V1WA 2RM5A 1R5PA 3IOSA 4PI0C 4V2NA 2B5EA 1TU8A 3FHKA 1XVWA 4RQXA 4L5LA 4XS4A 4L5OA 3D5JA 1XW5A 1GH2A 3GX8A 3A2WA 1ZCPA 1M2BA 1ST9A 4ACSA 3WGDA 1FB0A 1NSWA 2O3EA 1XOBA 3ZMKA 1XWGA 1SD9A 3APSA 4EKZA 1K0CA 3FZAA 4HJMA 1N2AA 5GZZB 2R5GA 3GSSA 4OO4A 1B8XA 2E2GA 2RIIA 2HT9A 1O7UA 2YV9A 2LRTA 4W66A 2DJ1A 2WW1A 1G6YA 3LGCA 3D0ZA 1PQNA 3G7JA 4G0IA 4TR4A 2OE1A 1H4OA 5CREA 6GSWA 2LKUA 4IHUA 4F2IA 3M9KA 3F4TA 2VM2A 2R4VA 1FOHA 2FGXA 3QCPA 3ERWA 2HSMB 1SL2B 1S3CA 3LSZA 4RUVA 2HLSA 2YWIA 2DIYA 3ZTLA 2HSNA 4YH2A 3VURA 2IWTA 1SU9A 3CXGA 3LYPA 1PN9A 2RLIA 1Q98A 1YKAA 4EDZA 3HJPA 2WS2A 1G6WA 2C4JA 2R0CA 5KOXA 2EIOA 2VCVA 3EWLA 1ACVA 5BMUA 4TKYA 2C3TA 2H72A 2PMTA 4JE1A 4ZILA 3F4RA 4NV5A 1O6JA 1ZL9A 3VPTA 2JZRA 2LNSA 2XBIA 4D73B 4MH3A 1F37A 5ECHB 1MD3A 1MD4A 4GSSA 3UL3A 2B7KA 5DVBA 3TRQA 14GSA 2VLVA 2FCHA 11GSA 3FRCA 4AI6A 4WEYA 3WGXA 2IMIA 3BOAA 4FYUA 2P5RA 4Z2RA 2VM1A 1A24A 3J7Yk 1AXDA 2YOIA 4BVXA 2PVOC 4YKGA 4IELA 1NM3A 4USSA 4MJAA 3LXZA 3IHQA 5CRHA 5DDLA 2R37A 3M3MA 1K3YA 3BBYA 6GSXA 2QA1A 2YJ7A 4BWQA 1XG8A 1S3RA 3TKQA 3R3EA 5A4UA 4X0XA 3CSJA 2E7PA 2BJXA 1KEBA 3CWGA 2B6MA 3E0UA 1JHBA 1DE2A 5A4VA 1Y6EA 4X1UA 1T4YA 3L0HA 2C3QA 5AN1A 1BJXA 2R0PA 1M9AA 5A1NA 1SL1B 6GSVA 2EC4A 4ECJA 1HNCA 3LWAA 5IPGA 2GQMA 3LXTA 4TR1A 3GFKA 2YCDA 3UJ1A 1E6BA 1YQ1A 4E68A 2ZCTA 4X4JA 1IYIA 5DJLA 5HR2A 3FZ9A 5L71A 3H8QA 4RI6A 4K8MA 5HR1A 4ICYA 4BWSA 5D96A 2HZEA 2HSYA 2GT6A 2MYGA 3EYTA 2A2SA 2AJQB 1K0DA 1F9MA 2DBCA 3L9SA 3FR9A 4F0BA 1V40A 1PX7A 3IAS2 1F6MC 2X99A 3IHGA 3APQA 1BX9A 5ECOB 1WJKA 2QSIA 3I43A 8GSSA 2WVXA 2R0GA 1K0MA 1YF0A 2DMLA 3GKXA 2UZ8A 1NHOA 3ERFA 4OFMA 1VF3A 2LS5A 3HJMA 1O81A 1ZYQB 3QD9A 9GSSA 5JWOB 1X9SB 4NPBA 3M8NA 1WPIA 3EINA 3IPZA 4OMVA 2HI7A 3KM6A 3TJFA 4MZCA 3N5OA 1GSQA 4Q5RA 3RDWA 2DJKA 1SYRA 2H19A 4DSSB 1T4ZA 1XXUA 1PD21 3CYNA 2WW2A 5ECRB 3GUSA 3F9UA 4GQCA 4CHSA 1XW9A 5AIXA 5F06A 1K0AA 4XTSA 1E2YA 2YWOA 3Q74A 4ILFA 4YAVA 3DIEA 4K7NA 4N0VA 4TN8A 3ZITA 1DE1A 4I2UA 3US3A 2EFDA 5IOWA 4PTSA 20GSA 3AY8A 3ZIJA 3LW9A 2X8HA 4BIKA 4KGIA 1BAYA 4K5RA 1Z7RA 2LQQA 1G0TA 2L57A 1XWAA 4K9ZA 4K1FA 4I2TA 1UA5A 5JWQB 5HFKA 5HQPA 1M7TA 1QK8A 5G1LA 5AIVA 2OT3A 3ZRDA 3IC8A 1R4WA 4H86A 2QA2A 1Q4JA 4MNNA 1GSYA 2L5LA 4V2MA 1FHEA 3SWLA 3P8WA 1GUHA 3TU3B 3IR4A 2HSNB 4MPFA 1C72A 4G10A 1R5AA 4EIQA 3WT2A 1TXUA 4ZL7A 3PINA 3S9FA 1GUMA 4CY6A 5BMUB 12GSA 3QDNA 1Z5YE 3LYKA 5J41A 4LA1A 2I9HA 2FHEA 4WBJA 5ECNB 4TR3A 3EC3A 2YWMA 3FMWA 4ID0A 4OCEA 5JCGA 4ZB7A 4QL7A 3PGTA 4YQVA 1EP7A 5J4YA 3DEXA 4HU9A 4MP4A 3HVVA 3P90A 3QR6A 5A4WA 3HXSA 3TB2A 2V41A 4K7IA 2JZTA 4KW6A 4WBRD 5IPHA 3TJGA 18GSA 1T8EB 5G5EA 4EDYA 2AHEA 1JZWA 5ECPB 5B8BA 1YDKA 5DCHA 1X5EA 10GSA 1GSFA 2FA4A 4FQUA 3GX0A 2O89A 4DSRA 2B1LA 1KNGA 2JADA 1ZGNA 3F8UA 5D8IA 2BMXA 4IN0A 3LQ7A 3DD3A 4LL4B 4A5PA 7GSSA 4TR1B 4TXVA 5ENUA 5DAKA 3UEMA 4GQFA
chains in the Genus database with same CATH topology
5INYA 2IMKA 1OC3A 2H75A 1B48A 2YN1A 4MMMA 4FYCA 1YVLA 2PBJA 1B9YC 2J9HA 2K18A 3O3TA 2F8AA 2OKAA 4MJCA 1Z6MA 4OFTA 3TRXA 2H74A 2HRKA 4XIHA 5JCUA 5KN3A 1UN2A 5IIZA 2PERA 1V9WA 3QOUA 1N25A 4IVFA 3GIXA 4KSMA 6GSYA 3FEUA 5F0GA 3L9UA 4Z2UA 4HJ2A 5IMAA 4PGTA 4TW5A 2L4CA 5IMVA 3L9VA 4BVYB 2OJLA 4DEJA 1EGOA 2J23A 5DCGA 4IBPA 1WMJA 5CRWA 2F9SA 3CRUA 5ECQB 4EO3A 1K3LA 4FO5A 2H6ZA 4WF5A 1UC7A 3ZVJD 4J56E 4MCUA 4E8EA 2I3YA 3IXRA 2VLUA 2IMDA 1M9BA 4AGSA 3F0IA 1YF1A 1CQGA 3J7Yb 5B8AA 4N10A 5G30A 1GSDA 5HFGA 4WF4A 4BPYA 1A0RP 3R2QA 3FKFA 4KH7A 1XPVA 2WZ9A 2YWNA 2KUCA 3F3RA 1AW9A 2OACA 2JU5A 1TK0B 1W89A 4EL1A 2BTOT 2PVQA 3IBHA 3KXOA 3DXBA 3DKSA 1O8XA 1PL1A 3W6GA 4WXTA 3L4NA 4PXOA 1KTEA 5EPFA 1GL8A 1TRVA 3RPNA 5EY6A 2F3MA 2G2QA 2FLSA 2C0DA 1U3IA 3A3TA 1TK5B 1USBA 2VD1A 4DSSA 2VL2A 1G7EA 2DKIA 2OBIA 4POBA 1S3AA 1SJZA 1G7OA 2N5FA 4CDOA 3UIWA 2CT6A 2TRCP 2HYXA 2VL3A 2C0FA 3GTUA 3TKSC 4YQUA 1SVOA 4ZB6A 3HJOA 2P0GA 3KP8A 3F63A 2VLTA 2DJJA 3TDGA 1LU4A 4TXOA 5J5NA 4J2FA 2VKZG 1A23A 1ZZYA 2GLRA 4MK3A 3UOMA 4EXJA 2V1MA 2IN3A 3MYDA 2XPEA 1MDKA 4ZB9A 4MF6A 4ZBBA 3ZZXA 3UVHA 3FZ5A 3TJBA 17GSA 3H1NA 1GSEA 5H5QA 5ABRA 3TKPA 4TR0A 4GF0A 4QMKA 2L6CA 4LMVA 2AYTA 4ISDA 1O73A 4EIPA 4FIWA 2H1GA 5H5SA 3VPQA 2DJ2A 1PSQA 4L8EA 1U87A 4Z7XA 4KSOA 4L0UA 2C3NA 1AQWA 2DC5A 1J9BA 3HCZA 5J4VA 3EU3A 4EE0A 5A34B 1AQXA 4RQRA 2ES7A 3ZREA 3GNJA 4ECBA 5DQSA 2PU9C 1A2JA 1MEKA 5J40A 4XS1A 2JSZA 1CQHA 4NHWA 1GP1A 4I6XA 5EVOA 2YP6A 1QQ2A 4AKIA 2WJUA 1SD8A 5DAKB 4POMA 5FHIA 5D9VA 4QQ7A 1DUGA 3DMLA 3Q18A 2F8FA 2LV3A 5FWGA 3E9JB 1SKRB 4GXZA 2GSRA 4I5QA 2HRKB 3G7YA 1XOAA 2IMEA 2DJ3A 3GL5A 4RI7A 2MMZA 5CP1A 3RBTA 2YANA 3GMFA 3DGQA 2GZZA 1XVQA 2IMFA 2NVLA 1X9MB 1GRXA 3M1GA 2NBSA 5J9BA 4GLTA 3C1RA 2AV4A 1VF1A 4CW9A 4NWYA 3KEBA 1WE0A 1SK2A 2GS3A 2V32A 2H1LA 1T7PB 1EV9A 5ECLB 3HY2A 3IK9A 4IKHA 2G0FA 4J57E 2N5AA 3QAGA 1A2LA 5J47A 5G1KA 2V6OA 1N8JA 2I4AA 1PL2A 5HR0A 1FVKA 4HEA2 1M99A 2REMA 2GQLA 1BYEA 4AJ7A 5J4UA 1XZOA 1XBSA 5ECSA 3VWVA 1OE8A 4HZ4A 1AUCA 5KN0A 5IO0A 1PA3A 2VO4A 2A2PA 1V57A 4EF0A 1UVZA 4O32A 2CAQA 3WYWA 3HHVA 3UMAA 3QPMA 4G0KA 2C8UA 2M72A 3ZIVA 3CSHA 4G01A 5DQYA 5D73A 4BVYA 2VIMA 3ED3A 4IS0A 2C1YA 3G7IA 3IDVA 5JCWA 2IPAA 2C0EA 2XBQA 2P5QA 5LNKe 3HA9A 1JFUA 3VI5A 2A2RA 3LEFA 1V58A 2CAIA 4MF7A 1AAZA 2GGTA 3GYKA 3CTFA 3M0FA 4PQ1A 2VCTA 1TOFA 1HQOA 5DALA 5HFIA 1X9WB 19GSA 3BJ5A 2FWEA 4Z2TA 4FYBA 4KCAA 2CVKA 1YJ6A 3I9V2 4JEDA 4ZL9A 1SYXA 2XC2A 1QXHA 3GTUB 1OC9B 3NIVA 3MWHA 5IO2A 5G5FA 4KDYA 4MZBA 4I97A 2LRCA 1F2EA 4AJ8A 4TXOB 2OE0A 1EOHA 3PH9A 2R3XA 3IV4A 2B7JA 1ZYNA 3K8NA 4PUAA 5J3RA 5IMZA 2CVBA 4XS6A 3KMNA 2F51A 1EZKA 2HE3A 1IYHA 4TOPA 2O87A 3KJYA 1OKTA 2V6KA 2CX4A 1NHYA 4XCSA 2AAWA 4MA9A 1V98A 2GT5A 5CRDA 3KH9A 3UVTA 1J0FA 5ID2A 2H8LA 3C1SA 4MJBA 3HZ4A 4KB3A 3W8SA 2HSHA 4O5QA 3HVXA 2JSYA 2LSTA 5HR3A 3TKSA 1DSBA 5B7CA 5CYYA 4NHZA 5KEJA 4GTUA 2MBTA 2YV7A 3MAKA 1U88A 5C00A 3EVIA 4ZXGA 3C8EA 3IC4A 3TJJA 5H5RA 2K9FA 1K3OA 4PNGA 4Q5NA 4HQSA 1M2DA 2EFHA 1HYUA 1J08A 1XWBA 5AISA 4HUAA 1XCCA 4KCEA 2WFCA 3CMIA 3MNGA 1FAAA 3UBLA 2R6KA 2VCZA 5LCZA 4WR4A 1EOGA 2YZUA 1VRSD 2MMOA 2DJ0A 1ABAA 3UARA 2YPMA 4IGJA 4F82A 1QMVA 2ON7A 4BL7A 5A34A 4N3ZA 2EIRA 3P2AA 1U3AA 5CAXA 5KN1A 3QMXA 1K0OA 3ME8A 3CBUA 4F03A 1F3BA 5IMFA 2GZPA 2X4AA 2VD0A 2L6DA 5ECMB 2L59A 3EPTA 3O6TA 2LJRA 3KD0A 4K7OA 4PX1A 1B4QA 1M0UA 3BD2A 4KX4A 1EEMA 2CZ2A 4MLYA 5D9WA 4N11A 1Y25A 3TOTA 1MDJA 2HRFA 1BG1A 3ZMLA 5A5KA 3A2VA 1MDIA 4MPGA 3BCKA 1TTZA 2KP2A 1ILOA 3C7MA 2WB9A 3FW2A 2FNOA 2E2MA 2HRAA 5J9CA 4ZBAA 2FA8A 3A5IA 5IMDA 2I1UA 1DBYA 3VWUA 1FW1A 4ZBDA 3HKRA 2H0HA 4IJ3A 3A2XA 4YKFA 1LBKA 1XFLA 1RK4A 5GSSA 4F0CA 5B6NA 2H71A 2K6VA 3LJRA 3HZ8A 4K5SA 4MJEA 4XRAA 3ZFLA 3VI7A 4BA7A 3ZL5A 4JU5A 4IP6A 3KMOA 4JBBA 3JCML 1PN0A 1X0RA 5A5HA 4G19A 2H30A 2FD3A 3GKKA 3LFLA 2MZCA 3TGZA 2DKHA 1JZRA 1XWCA 5D93A 4AF2A 3EE2A 2H1DA 4JR6A 5DBQA 4KNDA 4XRDA 4OD7A 1EEJA 3ZLPA 4AKXB 2KLXA 4IP1A 4LMWA 2H70A 5B6MA 2FWGA 2X64A 2WULA 1RW1A 4CY8A 1URMA 5DALB 2L5OA 1OC8A 1JZOA 2CZ3A 2RUFA 3DYRA 5FT3A 2VUPA 4AKHA 1Z9HA 1F3AA 3KH7A 3UAPA 1SK0A 2X8GA 4NXIA 2OA7A 2C80A 1SKWB 3ERGA 2O5VA 4K6XA 3RAZA 1GWCA 3FK8A 22GSA 4IQ1A 2EIQA 1TKDB 2AUVA 1H75A 5COHA 2HNLA 1EWXA 2GSTA 4EUYA 4K0NA 3D4MA 3IK7A 5CNWA 3HD5A 2LUSA 5IOXA 2MBSA 1TW9A 2ON5A 1WP0A 2VCWA 4KA0A 4HU7A 4OO5A 3M9JA 3PPUA 4WETA 4WKWA 2JL4A 2HQTA 4O5RA 1SVMA 4NV2A 1OC9A 2FUG2 5ID2B 1FG4A 4N0ZA 5F8BA 3OR5A 2IIYA 3HDCA 1Z3EA 1M2AA 3TKSE 4IQAA 3ME7A 2JACA 2CX3A 2H73A 2EFEA 4LLRA 4ML1A 2WRTA 4FH8A 1KBNA 3GH9A 1WRYA 3WD6A 3IA1A 1SVLA 4LL1B 5KN2A 3CRTA 2ALBA 2KHPA 2LTKA 2XHFA 1JLVA 1RQMA 3Q6OA 1FVJA 6GSUA 2H1AA 1TP9A 4PURA 3CTGA 1FO5A 4ZL8A 2B5XA 2WCIA 5IMCA 3EU4A 4GSNA 4G2EA 1GLPA 3DVXA 3GRXA 3UBKA 2LJKA 1XIYA 2KOKA 5GAPD 5IM9A 3G9BA 2PPTA 2H0IA 5CRGA 2HXKA 3QFBC 2VAFA 2A4HA 4GSTA 1BEDA 2MMNA 1I5GA 4L0WA 4I8BA 4BL7B 4MZWA 3ZFBA 3GKNA 1SKSB 1QUWA 1K0NA 2IFQA 1Y1UA 1YKCA 1GNWA 2HFDA 2FWFA 1GSSA 2NPBA 3F3QA 3DRNA 2RUEA 3TCOA 1GTBA 1QGVA 1NW2A 2H0GA 3L78A 3TUEA 1BG5A 2RM6A 1VF4A 2IJYA 4YQMA 1TRUA 3KCMA 4PQIA 3NOFA 4JZQA 3KGKA 16GSA 4G9HA 1OKDA 5C04A 3FY7A 2LJAA 3HVSA 2PWJA 5D9TA 4G0LA 2N5BA 1WWJA 2E0QA 1PX6A 1QFNA 2ZUPA 3TKRA 3C73A 2WGRA 5IQYA 3GA4A 1SL0B 4K2XA 2M46A 4HQZA 3W8JA 2CQ9A 2GVPA 1TK8B 1SJ6A 3GV1A 4ULXA 4O7HA 4P3YB 4X43A 4KDXA 3VWXA 2GSSA 4MABA 2HRNA 3D21A 5AGYA 1SK1A 3TJKA 1I9DA 2FWHA 2H1BA 3FR6A 5A5HB 2MMAA 3RHCA 4V1Ap 3H93A 1TRSA 1XW6A 3H4KA 5G2ZA 3D4TA 1JLWA 4N30A 3FR3A 2LNTA 2PN8A 3VLNA 3E3EA 5GAND 4XHMA 1T00A 3LG6A 2L4QA 1TXXA 4NAXA 1TDIA 4GWRA 3PR8A 4O92A 4HDEA 2QKEA 2OADA 4V1Ag 1TI1A 1AC1A 1XWKA 2QC7A 2FY6A 1OYJA 3D22A 4MH2A 4EVMA 1B4PA 3FZ4A 2DMMA 5LD0A 3QAWA 4V2LA 2VOCA 3APOA 2KP1A 1TU7A 1THOA 3KTLA 2VL9A 1WOUA 3GSTA 5EL8A 3WGEA 1GULA 5DJMA 3WT1A 2B1KA 3SBCA 1TI3A 4E8HA 4HI7A 4GDFA 2GSQA 1X5CA 4IW9A 2VL2C 2CA8A 3KP9A 1YEXA 5E4WA 2VCXA 2B3SA 1R26A 3F6DA 3U6VA 1BQ7A 4XS4B 1A0FA 3GKMA 4DVCA 4KDUA 13GSA 4Q5FA 4ZIJA 2H66A 2YNXA 2XPDA 2HZFA 1ZOFA 3BCIA 1PMTA 4JRRA 4TVEA 5ELGA 6GSTA 2K8VA 3D6IA 2K8SA 1PKWA 2LRNA 2WDUA 1TJDA 4IJIA 3HMJG 2VCQA 4EC0A 1Z7PA 1A2MA 1GTIA 3HYPA 3MIXA 2X8CA 3GHAA 4NMUA 1EGRA 1GSUA 1THXA 1O85A 1Z6NA 3QFAC 3MDKA 4KAEA 1SJIA 1A8LA 1V2AA 2B5YA 2PGTA 2H01A 4O5UA 3VFIA 3GH6A 2YJHA 4OFNA 4OCFA 1ZYPA 1WIKA 5E59A 2IFQB 1T1VA 1SENA 2GQKA 3VWWA 1OAZA 4HZ2A 4K0GA 3DWVA 1ERUA 1O8WA 1BF5A 4YAPA 1EV4A 4AJ6A 3O76A 2GZYA 2LQOA 4MDCA 3CSIA 1PKZA 5F07A 1ZYEA 4HS1A 3ZYWA 3KZQA 6GSSA 1OE7A 1VGLA 5BRTA 4Q5QA 4AKGA 1GUKA 1W4VA 3QAVA 1MTCA 3TRPA 1ERTA 1TRWA 3DVWA 2H6YA 3RPPA 5JWRB 2O85A 1VF2A 3H79A 2X49A 1HNAA 3IE3A 2CV4A 2HSMA 1GTUA 4ECIA 4BVXB 2JZSA 2GDRA 1PRXA 1X5DA 2AB6A 2EFCA 1A8YA 1FOVA 3VK9A 2OBKA 1AIUA 3LORA 4D73A 1YY7A 3A5WA 2GTUA 2YZHA 5ECKB 2C0GA 3IRAA 1K0BA 3I6AA 3EURA 5A1NB 3EMPA 3N9JA 2IL3A 4GRFA 5F05A 2A4VA 4OWYA 2I81A 5D9XA 1S3DA 2DIZA 1AQVA 4PUFC 1YEPA 3C71A 2V2GA 1ERVA 3RHBA 3KIJA 2O7KA 1OVNA 4KE3A 4QL9A 2DLXA 4POKA 4MF5A 4ML6A 4WR5A 2H6XA 1U6TA 3ISOA 2PUKC 2HZEB 1JZDA 1ML6A 1GNEA 1ERWA 3KTBA 2DSAA 2TRXA 4JR4A 1YZXA 1ON4A 4PNFA 2H76A 2NTOA 1GLQA 2UV8G 3MSZA 3FYGA 2LEGA 5GSTA 4HOJA 3F6FA 3ZVJA 4ZB8A 4F9ZA 4DSQA 1HNBA 3Q19A 2M80A 3I69A 2D2ZA 1R7HA 5ELAA 2CVDA 1LJRA 2QGVA 1EP8A 3IAM2 2NDOA 3TOUA 5KOWA 1GTAA 2O8VB 4GCIA 4K2DA 1FB6A 4PQHA 5CO3A 2R2JA 3GURA 5ECIB 3U5RE 1B9XC 2Z9SA 1T3BA 4TRXA 3F4SA 2P31A 3EMXA 3GN3A 5G31A 4ECCA 3P7XA 2OE3A 3GL3A 1ZMAA 3NZNA 2ZNMA 4KUNA 4POLA 1PGTA 4KF9A 1HD2A 2TIRA 3V1WA 2RM5A 1R5PA 3IOSA 4V2NA 2B5EA 1TU8A 3FHKA 1XVWA 4RQXA 4L5LA 4XS4A 4L5OA 3D5JA 1XW5A 1GH2A 3GX8A 3A2WA 1ZCPA 1M2BA 1ST9A 4ACSA 3WGDA 1FB0A 1NSWA 1XOBA 3ZMKA 1XWGA 1SD9A 3APSA 4EKZA 1K0CA 3FZAA 4HJMA 1N2AA 5GZZB 2R5GA 3GSSA 4OO4A 1B8XA 2E2GA 2RIIA 2HT9A 1O7UA 2YV9A 2LRTA 4W66A 2DJ1A 1G6YA 3LGCA 3D0ZA 1PQNA 3G7JA 4G0IA 4TR4A 2OE1A 1H4OA 5CREA 6GSWA 2LKUA 4IHUA 4F2IA 3M9KA 3F4TA 2VM2A 2R4VA 1FOHA 2FGXA 3QCPA 3ERWA 2HSMB 1SL2B 1S3CA 3LSZA 4RUVA 2HLSA 2YWIA 2DIYA 3ZTLA 2HSNA 4YH2A 3VURA 2IWTA 1SU9A 3CXGA 3LYPA 1PN9A 2RLIA 1Q98A 1YKAA 4EDZA 3HJPA 2WS2A 1G6WA 2C4JA 2R0CA 5KOXA 2EIOA 2VCVA 3EWLA 1ACVA 5BMUA 4TKYA 2C3TA 2H72A 2PMTA 4JE1A 4ZILA 3F4RA 4NV5A 1O6JA 1ZL9A 3VPTA 2JZRA 2LNSA 2XBIA 4D73B 4MH3A 1F37A 5ECHB 1MD3A 1MD4A 4GSSA 3UL3A 2B7KA 5DVBA 3TRQA 14GSA 2VLVA 2FCHA 11GSA 3FRCA 4AI6A 4WEYA 3WGXA 2IMIA 3BOAA 4FYUA 2P5RA 4Z2RA 2VM1A 1A24A 3J7Yk 1AXDA 2YOIA 4BVXA 2PVOC 4YKGA 4IELA 1NM3A 4USSA 4MJAA 3LXZA 3IHQA 5CRHA 5DDLA 2R37A 3M3MA 1K3YA 3BBYA 6GSXA 2QA1A 2YJ7A 4BWQA 3TKQA 3R3EA 5A4UA 4X0XA 3CSJA 2E7PA 2BJXA 1KEBA 3CWGA 2B6MA 3E0UA 1JHBA 1DE2A 5A4VA 1Y6EA 4X1UA 1T4YA 3L0HA 2C3QA 5AN1A 1BJXA 2R0PA 1M9AA 5A1NA 1SL1B 6GSVA 2EC4A 4ECJA 1HNCA 3LWAA 5IPGA 2GQMA 3LXTA 4TR1A 3GFKA 2YCDA 3UJ1A 1E6BA 1YQ1A 4E68A 2ZCTA 4X4JA 1IYIA 5DJLA 5HR2A 3FZ9A 5L71A 3H8QA 4RI6A 4K8MA 5HR1A 4ICYA 4BWSA 5D96A 2HZEA 2HSYA 2GT6A 2MYGA 3EYTA 2A2SA 2AJQB 1K0DA 1F9MA 2DBCA 3L9SA 3FR9A 4F0BA 1V40A 1PX7A 3IAS2 1F6MC 2X99A 3IHGA 3APQA 1BX9A 5ECOB 1WJKA 2QSIA 3I43A 8GSSA 2R0GA 1K0MA 1YF0A 2DMLA 3GKXA 2UZ8A 1NHOA 3ERFA 4OFMA 1VF3A 2LS5A 3HJMA 1O81A 1ZYQB 3QD9A 9GSSA 5JWOB 1X9SB 4NPBA 3M8NA 1WPIA 3EINA 3IPZA 4OMVA 2HI7A 3KM6A 3TJFA 4MZCA 3N5OA 1GSQA 4Q5RA 3RDWA 2DJKA 1SYRA 2H19A 4DSSB 1T4ZA 1XXUA 1PD21 3CYNA 5ECRB 3GUSA 3F9UA 4GQCA 4CHSA 1XW9A 5AIXA 5F06A 1K0AA 4XTSA 1E2YA 2YWOA 3Q74A 4ILFA 4YAVA 3DIEA 4K7NA 4N0VA 4TN8A 3ZITA 1DE1A 4I2UA 3US3A 2EFDA 5IOWA 4PTSA 20GSA 3AY8A 3ZIJA 3LW9A 2X8HA 4KGIA 1BAYA 4K5RA 1Z7RA 2LQQA 1G0TA 2L57A 1XWAA 4K9ZA 4K1FA 4I2TA 1UA5A 5JWQB 5HFKA 5HQPA 1M7TA 1QK8A 5G1LA 5AIVA 2OT3A 3ZRDA 3IC8A 1R4WA 4H86A 2QA2A 1Q4JA 4MNNA 1GSYA 2L5LA 4V2MA 1FHEA 3SWLA 3P8WA 1GUHA 3TU3B 3IR4A 2HSNB 4MPFA 1C72A 4G10A 1R5AA 4EIQA 3WT2A 1TXUA 4ZL7A 3PINA 3S9FA 1GUMA 4CY6A 5BMUB 12GSA 3QDNA 1Z5YE 3LYKA 5J41A 4LA1A 2I9HA 2FHEA 4WBJA 5ECNB 4TR3A 3EC3A 2YWMA 3FMWA 4ID0A 4OCEA 5JCGA 4ZB7A 4QL7A 3PGTA 4YQVA 1EP7A 5J4YA 3DEXA 4HU9A 4MP4A 3HVVA 3P90A 3QR6A 5A4WA 3HXSA 3TB2A 2V41A 4K7IA 2JZTA 4KW6A 4WBRD 5IPHA 3TJGA 18GSA 1T8EB 5G5EA 4EDYA 2AHEA 1JZWA 5ECPB 5B8BA 1YDKA 5DCHA 1X5EA 10GSA 1GSFA 2FA4A 4FQUA 3GX0A 2O89A 4DSRA 2B1LA 1KNGA 2JADA 1ZGNA 3F8UA 5D8IA 2BMXA 4IN0A 3LQ7A 3DD3A 4LL4B 4A5PA 7GSSA 4TR1B 4TXVA 5ENUA 5DAKA 3UEMA 4GQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INY A;  2IMK A;  1OC3 A;  2H75 A;  1B48 A;  2YN1 A;  4MMM A;  4FYC A;  2PBJ A;  1B9Y C;  2J9H A;  2K18 A;  3O3T A;  2F8A A;  2OKA A;  4MJC A;  1Z6M A;  4OFT A;  3TRX A;  2H74 A;  2HRK A;  4XIH A;  5JCU A;  5KN3 A;  1UN2 A;  5IIZ A;  2PER A;  1V9W A;  3QOU A;  4IVF A;  3GIX A;  4KSM A;  6GSY A;  3FEU A;  5F0G A;  3L9U A;  4HJ2 A;  5IMA A;  4PGT A;  4TW5 A;  2L4C A;  5IMV A;  3L9V A;  4BVY B;  2OJL A;  4DEJ A;  1EGO A;  2J23 A;  5DCG A;  4IBP A;  1WMJ A;  5CRW A;  2F9S A;  3CRU A;  5ECQ B;  4EO3 A;  1K3L A;  4FO5 A;  2H6Z A;  4WF5 A;  1UC7 A;  3ZVJ D;  4J56 E;  4MCU A;  4E8E A;  2I3Y A;  3IXR A;  2VLU A;  2IMD A;  1M9B A;  4AGS A;  3F0I A;  1YF1 A;  1CQG A;  3J7Y b;  5B8A A;  4N10 A;  5G30 A;  1GSD A;  5HFG A;  4WF4 A;  4BPY A;  1A0R P;  3R2Q A;  3FKF A;  4KH7 A;  1XPV A;  2WZ9 A;  2YWN A;  2KUC A;  3F3R A;  1AW9 A;  2OAC A;  2JU5 A;  1TK0 B;  1W89 A;  4EL1 A;  2BTO T;  2PVQ A;  3IBH A;  3KXO A;  3DXB A;  3DKS A;  1O8X A;  1PL1 A;  3W6G A;  4WXT A;  3L4N A;  4PXO A;  1KTE A;  5EPF A;  1GL8 A;  1TRV A;  3RPN A;  5EY6 A;  2F3M A;  2G2Q A;  2FLS A;  2C0D A;  1U3I A;  3A3T A;  1TK5 B;  1USB A;  2VD1 A;  4DSS A;  2VL2 A;  1G7E A;  2OBI A;  4POB A;  1S3A A;  1SJZ A;  1G7O A;  2N5F A;  4CDO A;  3UIW A;  2CT6 A;  2TRC P;  2HYX A;  2VL3 A;  2C0F A;  3GTU A;  3TKS C;  4YQU A;  4ZB6 A;  3HJO A;  2P0G A;  3KP8 A;  3F63 A;  2VLT A;  2DJJ A;  3TDG A;  1LU4 A;  4TXO A;  5J5N A;  4J2F A;  1A23 A;  1ZZY A;  2GLR A;  4MK3 A;  3UOM A;  4EXJ A;  2V1M A;  2IN3 A;  2XPE A;  1MDK A;  4ZB9 A;  4MF6 A;  4ZBB A;  3ZZX A;  3UVH A;  3FZ5 A;  3TJB A;  17GS A;  3H1N A;  1GSE A;  5H5Q A;  5ABR A;  3TKP A;  4TR0 A;  4GF0 A;  2L6C A;  4LMV A;  2AYT A;  4ISD A;  1O73 A;  4FIW A;  2H1G A;  5H5S A;  3VPQ A;  2DJ2 A;  1PSQ A;  4L8E A;  1U87 A;  4Z7X A;  4KSO A;  4L0U A;  2C3N A;  1AQW A;  2DC5 A;  1J9B A;  3HCZ A;  3EU3 A;  4EE0 A;  1AQX A;  4RQR A;  2ES7 A;  3ZRE A;  3GNJ A;  4ECB A;  5DQS A;  2PU9 C;  1A2J A;  1MEK A;  4XS1 A;  2JSZ A;  1CQH A;  4NHW A;  1GP1 A;  4I6X A;  5EVO A;  2YP6 A;  1QQ2 A;  2WJU A;  1SD8 A;  5DAK B;  4POM A;  5FHI A;  5D9V A;  4QQ7 A;  1DUG A;  3DML A;  3Q18 A;  2F8F A;  2LV3 A;  5FWG A;  3E9J B;  1SKR B;  4GXZ A;  2GSR A;  4I5Q A;  2HRK B;  3G7Y A;  1XOA A;  2IME A;  2DJ3 A;  3GL5 A;  4RI7 A;  2MMZ A;  5CP1 A;  3RBT A;  2YAN A;  3GMF A;  3DGQ A;  2GZZ A;  1XVQ A;  2IMF A;  2NVL A;  1X9M B;  1GRX A;  3M1G A;  2NBS A;  5J9B A;  4GLT A;  3C1R A;  2AV4 A;  1VF1 A;  4CW9 A;  4NWY A;  3KEB A;  1WE0 A;  1SK2 A;  2GS3 A;  2V32 A;  1T7P B;  1EV9 A;  5ECL B;  3HY2 A;  3IK9 A;  4IKH A;  2G0F A;  4J57 E;  2N5A A;  3QAG A;  1A2L A;  5G1K A;  2V6O A;  1N8J A;  2I4A A;  1PL2 A;  5HR0 A;  1FVK A;  4HEA 2;  1M99 A;  2REM A;  2GQL A;  1BYE A;  4AJ7 A;  5J4U A;  1XZO A;  5ECS A;  1XBS A;  3VWV A;  1OE8 A;  4HZ4 A;  1AUC A;  5KN0 A;  5IO0 A;  1PA3 A;  2VO4 A;  1V57 A;  4EF0 A;  1UVZ A;  4O32 A;  2CAQ A;  3WYW A;  3HHV A;  3UMA A;  3QPM A;  4G0K A;  2C8U A;  2M72 A;  3ZIV A;  3CSH A;  5DQY A;  5D73 A;  4BVY A;  2VIM A;  3ED3 A;  4IS0 A;  2C1Y A;  3G7I A;  3IDV A;  5JCW A;  2IPA A;  2C0E A;  2XBQ A;  2P5Q A;  5LNK e;  3HA9 A;  1JFU A;  3VI5 A;  2A2R A;  3LEF A;  1V58 A;  2CAI A;  4MF7 A;  1AAZ A;  2GGT A;  3GYK A;  3CTF A;  3M0F A;  4PQ1 A;  2VCT A;  1TOF A;  1HQO A;  5DAL A;  5HFI A;  1X9W B;  19GS A;  3BJ5 A;  2FWE A;  4FYB A;  4KCA A;  2CVK A;  1YJ6 A;  3I9V 2;  4JED A;  4ZL9 A;  1SYX A;  2XC2 A;  1QXH A;  3GTU B;  1OC9 B;  3NIV A;  3MWH A;  5IO2 A;  5G5F A;  4KDY A;  4MZB A;  4I97 A;  2LRC A;  1F2E A;  4AJ8 A;  4TXO B;  2OE0 A;  1EOH A;  3PH9 A;  2R3X A;  3IV4 A;  2B7J A;  3K8N A;  4PUA A;  5J3R A;  5IMZ A;  2CVB A;  4XS6 A;  3KMN A;  2F51 A;  1EZK A;  2HE3 A;  1IYH A;  4TOP A;  2O87 A;  3KJY A;  1OKT A;  2V6K A;  2CX4 A;  1NHY A;  4XCS A;  2AAW A;  4MA9 A;  1V98 A;  2GT5 A;  5CRD A;  3KH9 A;  3UVT A;  1J0F A;  5ID2 A;  2H8L A;  3C1S A;  4MJB A;  3HZ4 A;  4KB3 A;  3W8S A;  2HSH A;  3HVX A;  2JSY A;  2LST A;  5HR3 A;  3TKS A;  1DSB A;  5B7C A;  5CYY A;  4NHZ A;  5KEJ A;  4GTU A;  2MBT A;  2YV7 A;  3MAK A;  1U88 A;  5C00 A;  3EVI A;  4ZXG A;  3C8E A;  3IC4 A;  3TJJ A;  5H5R A;  2K9F A;  4HQS A;  1K3O A;  4PNG A;  4Q5N A;  1M2D A;  1HYU A;  1J08 A;  1XWB A;  5AIS A;  4HUA A;  1XCC A;  4KCE A;  2WFC A;  3CMI A;  3MNG A;  1FAA A;  3UBL A;  2R6K A;  2VCZ A;  5LCZ A;  4WR4 A;  1EOG A;  2YZU A;  1VRS D;  2MMO A;  2DJ0 A;  1ABA A;  3UAR A;  2YPM A;  4IGJ A;  4F82 A;  1QMV A;  2ON7 A;  4BL7 A;  2EIR A;  3P2A A;  1U3A A;  5CAX A;  5KN1 A;  3QMX A;  1K0O A;  3ME8 A;  3CBU A;  4F03 A;  1F3B A;  5IMF A;  2GZP A;  2VD0 A;  2L6D A;  5ECM B;  2L59 A;  3O6T A;  2LJR A;  3KD0 A;  4K7O A;  4PX1 A;  1B4Q A;  1M0U A;  3BD2 A;  4KX4 A;  1EEM A;  2CZ2 A;  4MLY A;  5D9W A;  4N11 A;  1Y25 A;  3TOT A;  1MDJ A;  2HRF A;  3ZML A;  5A5K A;  3A2V A;  1MDI A;  4MPG A;  3BCK A;  1TTZ A;  2KP2 A;  1ILO A;  3C7M A;  2WB9 A;  3FW2 A;  2FNO A;  2E2M A;  2HRA A;  5J9C A;  4ZBA A;  2FA8 A;  5IMD A;  2I1U A;  1DBY A;  3VWU A;  1FW1 A;  4ZBD A;  3HKR A;  2H0H A;  4IJ3 A;  3A2X A;  1LBK A;  1XFL A;  1RK4 A;  5GSS A;  4F0C A;  5B6N A;  2H71 A;  2K6V A;  3LJR A;  3HZ8 A;  4XRA A;  4MJE A;  3ZFL A;  3VI7 A;  4BA7 A;  3ZL5 A;  4JU5 A;  4IP6 A;  3KMO A;  4JBB A;  3JCM L;  1X0R A;  4G19 A;  2H30 A;  2FD3 A;  3GKK A;  3LFL A;  2MZC A;  3TGZ A;  1JZR A;  1XWC A;  5D93 A;  4AF2 A;  3EE2 A;  2H1D A;  4JR6 A;  5DBQ A;  4KND A;  4XRD A;  4OD7 A;  1EEJ A;  3ZLP A;  2KLX A;  4IP1 A;  4LMW A;  2H70 A;  5B6M A;  2FWG A;  2X64 A;  2WUL A;  1RW1 A;  1URM A;  5DAL B;  2L5O A;  1OC8 A;  1JZO A;  2CZ3 A;  2RUF A;  3DYR A;  5FT3 A;  2VUP A;  1Z9H A;  1F3A A;  3KH7 A;  3UAP A;  1SK0 A;  2X8G A;  4NXI A;  2OA7 A;  2C80 A;  1SKW B;  3ERG A;  4K6X A;  3RAZ A;  1GWC A;  3FK8 A;  22GS A;  4IQ1 A;  2EIQ A;  1TKD B;  2AUV A;  1H75 A;  5COH A;  2HNL A;  1EWX A;  2GST A;  4EUY A;  4K0N A;  3D4M A;  3IK7 A;  5CNW A;  3HD5 A;  2LUS A;  5IOX A;  2MBS A;  1TW9 A;  2ON5 A;  1WP0 A;  2VCW A;  4KA0 A;  4HU7 A;  4OO5 A;  3M9J A;  3PPU A;  4WET A;  4WKW A;  2JL4 A;  2HQT A;  4O5R A;  4NV2 A;  1OC9 A;  2FUG 2;  5ID2 B;  1FG4 A;  4N0Z A;  5F8B A;  3OR5 A;  2IIY A;  3HDC A;  1Z3E A;  1M2A A;  3TKS E;  4IQA A;  3ME7 A;  2JAC A;  2CX3 A;  2H73 A;  4LLR A;  4ML1 A;  2WRT A;  4FH8 A;  1KBN A;  3GH9 A;  1WRY A;  3WD6 A;  3IA1 A;  4LL1 B;  5KN2 A;  3CRT A;  2ALB A;  2KHP A;  2LTK A;  2XHF A;  1JLV A;  1RQM A;  3Q6O A;  1FVJ A;  6GSU A;  2H1A A;  1TP9 A;  4PUR A;  3CTG A;  1FO5 A;  4ZL8 A;  2B5X A;  2WCI A;  5IMC A;  3EU4 A;  4GSN A;  4G2E A;  1GLP A;  3DVX A;  3GRX A;  3UBK A;  2LJK A;  1XIY A;  2KOK A;  5GAP D;  5IM9 A;  3G9B A;  2PPT A;  2H0I A;  5CRG A;  2HXK A;  3QFB C;  2VAF A;  4GST A;  1BED A;  2MMN A;  1I5G A;  4L0W A;  4I8B A;  4BL7 B;  4MZW A;  3ZFB A;  3GKN A;  1SKS B;  1QUW A;  1K0N A;  2IFQ A;  1YKC A;  1GNW A;  2HFD A;  2FWF A;  1GSS A;  2NPB A;  3F3Q A;  3DRN A;  2RUE A;  3TCO A;  1GTB A;  1QGV A;  1NW2 A;  2H0G A;  3L78 A;  3TUE A;  1BG5 A;  2RM6 A;  1VF4 A;  2IJY A;  4YQM A;  1TRU A;  3KCM A;  4PQI A;  3NOF A;  4JZQ A;  3KGK A;  16GS A;  4G9H A;  1OKD A;  5C04 A;  3FY7 A;  2LJA A;  3HVS A;  2PWJ A;  5D9T A;  4G0L A;  2N5B A;  1WWJ A;  2E0Q A;  1PX6 A;  1QFN A;  2ZUP A;  3TKR A;  3C73 A;  2WGR A;  5IQY A;  3GA4 A;  1SL0 B;  2M46 A;  4HQZ A;  3W8J A;  2CQ9 A;  2GVP A;  1TK8 B;  1SJ6 A;  3GV1 A;  4ULX A;  4O7H A;  4P3Y B;  4X43 A;  4KDX A;  3VWX A;  2GSS A;  4MAB A;  2HRN A;  3D21 A;  5AGY A;  1SK1 A;  3TJK A;  1I9D A;  2FWH A;  2H1B A;  3FR6 A;  2MMA A;  3RHC A;  4V1A p;  3H93 A;  1TRS A;  1XW6 A;  3H4K A;  5G2Z A;  3D4T A;  1JLW A;  4N30 A;  3FR3 A;  2LNT A;  2PN8 A;  3VLN A;  3E3E A;  5GAN D;  4XHM A;  1T00 A;  3LG6 A;  2L4Q A;  1TXX A;  4NAX A;  1TDI A;  4GWR A;  3PR8 A;  4O92 A;  4HDE A;  2QKE A;  2OAD A;  4V1A g;  1TI1 A;  1AC1 A;  1XWK A;  2QC7 A;  2FY6 A;  1OYJ A;  3D22 A;  4MH2 A;  4EVM A;  1B4P A;  3FZ4 A;  2DMM A;  5LD0 A;  3QAW A;  4V2L A;  2VOC A;  3APO A;  2KP1 A;  1TU7 A;  1THO A;  3KTL A;  2VL9 A;  1WOU A;  3GST A;  5EL8 A;  3WGE A;  1GUL A;  5DJM A;  3WT1 A;  2B1K A;  3SBC A;  1TI3 A;  4E8H A;  4HI7 A;  2GSQ A;  1X5C A;  4IW9 A;  2VL2 C;  2CA8 A;  3KP9 A;  1YEX A;  5E4W A;  2VCX A;  2B3S A;  1R26 A;  3F6D A;  3U6V A;  1BQ7 A;  4XS4 B;  1A0F A;  3GKM A;  4DVC A;  4KDU A;  13GS A;  4Q5F A;  4ZIJ A;  2H66 A;  2YNX A;  2XPD A;  2HZF A;  1ZOF A;  3BCI A;  1PMT A;  4JRR A;  4TVE A;  5ELG A;  6GST A;  2K8V A;  3D6I A;  2K8S A;  1PKW A;  2LRN A;  2WDU A;  1TJD A;  4IJI A;  2VCQ A;  4EC0 A;  1Z7P A;  1A2M A;  1GTI A;  3HYP A;  2X8C A;  3GHA A;  4NMU A;  1EGR A;  1GSU A;  1THX A;  1O85 A;  1Z6N A;  3QFA C;  3MDK A;  4KAE A;  1SJI A;  1A8L A;  1V2A A;  2B5Y A;  2PGT A;  2H01 A;  3VFI A;  3GH6 A;  2YJH A;  4OFN A;  4OCF A;  1WIK A;  5E59 A;  2IFQ B;  1T1V A;  1SEN A;  2GQK A;  3VWW A;  1OAZ A;  4HZ2 A;  4K0G A;  3DWV A;  1ERU A;  1O8W A;  4YAP A;  1EV4 A;  4AJ6 A;  3O76 A;  2GZY A;  2LQO A;  4MDC A;  3CSI A;  1PKZ A;  5F07 A;  1ZYE A;  4HS1 A;  3ZYW A;  3KZQ A;  6GSS A;  1OE7 A;  1VGL A;  4Q5Q A;  1GUK A;  1W4V A;  3QAV A;  1MTC A;  3TRP A;  1ERT A;  1TRW A;  3DVW A;  2H6Y A;  3RPP A;  5JWR B;  2O85 A;  1VF2 A;  3H79 A;  1HNA A;  3IE3 A;  2CV4 A;  2HSM A;  1GTU A;  4ECI A;  4BVX B;  2JZS A;  2GDR A;  1PRX A;  1X5D A;  2AB6 A;  1A8Y A;  1FOV A;  3VK9 A;  2OBK A;  1AIU A;  3LOR A;  4D73 A;  1YY7 A;  3A5W A;  2GTU A;  2YZH A;  5ECK B;  2C0G A;  3IRA A;  1K0B A;  3I6A A;  3EUR A;  3EMP A;  3N9J A;  2IL3 A;  4GRF A;  5F05 A;  2A4V A;  4OWY A;  2I81 A;  5D9X A;  1S3D A;  2DIZ A;  1AQV A;  4PUF C;  1YEP A;  3C71 A;  2V2G A;  1ERV A;  3RHB A;  3KIJ A;  2O7K A;  1OVN A;  4KE3 A;  4QL9 A;  2DLX A;  4POK A;  4MF5 A;  4ML6 A;  4WR5 A;  2H6X A;  1U6T A;  3ISO A;  2PUK C;  2HZE B;  1JZD A;  1ML6 A;  1GNE A;  1ERW A;  3KTB A;  2DSA A;  2TRX A;  4JR4 A;  1YZX A;  1ON4 A;  4PNF A;  2H76 A;  2NTO A;  1GLQ A;  3MSZ A;  3FYG A;  2LEG A;  5GST A;  4HOJ A;  3F6F A;  3ZVJ A;  4ZB8 A;  4F9Z A;  4DSQ A;  1HNB A;  3Q19 A;  2M80 A;  3I69 A;  2D2Z A;  1R7H A;  5ELA A;  2CVD A;  1LJR A;  2QGV A;  1EP8 A;  3IAM 2;  2NDO A;  3TOU A;  1GTA A;  2O8V B;  4GCI A;  4K2D A;  1FB6 A;  4PQH A;  5CO3 A;  2R2J A;  3GUR A;  5ECI B;  3U5R E;  1B9X C;  2Z9S A;  1T3B A;  4TRX A;  3F4S A;  2P31 A;  3EMX A;  3GN3 A;  5G31 A;  4ECC A;  3P7X A;  2OE3 A;  3GL3 A;  1ZMA A;  3NZN A;  2ZNM A;  4KUN A;  4POL A;  1PGT A;  4KF9 A;  1HD2 A;  2TIR A;  3V1W A;  2RM5 A;  1R5P A;  3IOS A;  4V2N A;  2B5E A;  1TU8 A;  3FHK A;  1XVW A;  4RQX A;  4L5L A;  4XS4 A;  4L5O A;  3D5J A;  1XW5 A;  1GH2 A;  3GX8 A;  3A2W A;  1ZCP A;  1M2B A;  1ST9 A;  4ACS A;  3WGD A;  1FB0 A;  1NSW A;  1XOB A;  3ZMK A;  1XWG A;  1SD9 A;  3APS A;  4EKZ A;  1K0C A;  3FZA A;  4HJM A;  1N2A A;  5GZZ B;  2R5G A;  3GSS A;  4OO4 A;  1B8X A;  2E2G A;  2RII A;  2HT9 A;  1O7U A;  2YV9 A;  2LRT A;  2DJ1 A;  1G6Y A;  3LGC A;  3D0Z A;  1PQN A;  3G7J A;  4G0I A;  4TR4 A;  2OE1 A;  1H4O A;  5CRE A;  6GSW A;  2LKU A;  4IHU A;  4F2I A;  3M9K A;  3F4T A;  2VM2 A;  2R4V A;  2FGX A;  3QCP A;  3ERW A;  2HSM B;  1SL2 B;  1S3C A;  3LSZ A;  4RUV A;  2HLS A;  2YWI A;  2DIY A;  3ZTL A;  4YH2 A;  3VUR A;  2IWT A;  1SU9 A;  3CXG A;  3LYP A;  1PN9 A;  2RLI A;  1Q98 A;  1YKA A;  4EDZ A;  3HJP A;  2WS2 A;  1G6W A;  2C4J A;  2EIO A;  2VCV A;  3EWL A;  1ACV A;  5BMU A;  4TKY A;  2C3T A;  2H72 A;  2PMT A;  4JE1 A;  4ZIL A;  3F4R A;  4NV5 A;  1O6J A;  1ZL9 A;  3VPT A;  2JZR A;  2LNS A;  2XBI A;  4D73 B;  4MH3 A;  1F37 A;  5ECH B;  1MD3 A;  1MD4 A;  4GSS A;  3UL3 A;  2B7K A;  5DVB A;  3TRQ A;  14GS A;  2VLV A;  2FCH A;  11GS A;  3FRC A;  4WEY A;  3WGX A;  2IMI A;  3BOA A;  4FYU A;  2P5R A;  2VM1 A;  1A24 A;  3J7Y k;  1AXD A;  2YOI A;  4BVX A;  2PVO C;  4IEL A;  1NM3 A;  4USS A;  4MJA A;  3LXZ A;  3IHQ A;  5CRH A;  5DDL A;  2R37 A;  3M3M A;  1K3Y A;  3BBY A;  6GSX A;  2YJ7 A;  4BWQ A;  3TKQ A;  3R3E A;  5A4U A;  4X0X A;  3CSJ A;  2E7P A;  2BJX A;  1KEB A;  2B6M A;  3E0U A;  1JHB A;  1DE2 A;  5A4V A;  1Y6E A;  4X1U A;  1T4Y A;  3L0H A;  2C3Q A;  5AN1 A;  1BJX A;  1M9A A;  1SL1 B;  6GSV A;  2EC4 A;  4ECJ A;  1HNC A;  3LWA A;  5IPG A;  2GQM A;  3LXT A;  4TR1 A;  3GFK A;  2YCD A;  3UJ1 A;  1E6B A;  1YQ1 A;  2ZCT A;  1IYI A;  5DJL A;  5HR2 A;  3FZ9 A;  5L71 A;  3H8Q A;  4RI6 A;  4K8M A;  5HR1 A;  4BWS A;  5D96 A;  2HZE A;  2HSY A;  2GT6 A;  2MYG A;  3EYT A;  2A2S A;  2AJQ B;  1K0D A;  1F9M A;  2DBC A;  3L9S A;  3FR9 A;  4F0B A;  1V40 A;  1PX7 A;  3IAS 2;  1F6M C;  2X99 A;  3APQ A;  1BX9 A;  5ECO B;  1WJK A;  2QSI A;  3I43 A;  8GSS A;  1K0M A;  1YF0 A;  2DML A;  3GKX A;  2UZ8 A;  1NHO A;  3ERF A;  4OFM A;  1VF3 A;  2LS5 A;  3HJM A;  1O81 A;  1ZYQ B;  3QD9 A;  9GSS A;  5JWO B;  1X9S B;  4NPB A;  3M8N A;  1WPI A;  3EIN A;  3IPZ A;  4OMV A;  2HI7 A;  3KM6 A;  3TJF A;  4MZC A;  3N5O A;  1GSQ A;  4Q5R A;  3RDW A;  2DJK A;  1SYR A;  2H19 A;  4DSS B;  1T4Z A;  1XXU A;  1PD2 1;  3CYN A;  5ECR B;  3GUS A;  3F9U A;  4GQC A;  4CHS A;  1XW9 A;  5AIX A;  5F06 A;  1K0A A;  4XTS A;  1E2Y A;  2YWO A;  3Q74 A;  4ILF A;  4YAV A;  3DIE A;  4K7N A;  4N0V A;  4TN8 A;  3ZIT A;  1DE1 A;  4I2U A;  3US3 A;  5IOW A;  4PTS A;  20GS A;  3AY8 A;  3ZIJ A;  2X8H A;  4KGI A;  1BAY A;  1Z7R A;  2LQQ A;  1G0T A;  2L57 A;  1XWA A;  4K9Z A;  4K1F A;  4I2T A;  1UA5 A;  5JWQ B;  5HFK A;  5HQP A;  1M7T A;  1QK8 A;  5G1L A;  5AIV A;  3ZRD A;  3IC8 A;  1R4W A;  4H86 A;  1Q4J A;  1GSY A;  2L5L A;  4V2M A;  1FHE A;  3SWL A;  3P8W A;  1GUH A;  3IR4 A;  2HSN B;  4MPF A;  1C72 A;  4G10 A;  1R5A A;  3WT2 A;  4ZL7 A;  3PIN A;  3S9F A;  1GUM A;  12GS A;  3QDN A;  1Z5Y E;  3LYK A;  5J41 A;  4LA1 A;  2I9H A;  2FHE A;  4WBJ A;  5ECN B;  4TR3 A;  3EC3 A;  2YWM A;  4ID0 A;  4OCE A;  5JCG A;  4QL7 A;  3PGT A;  4YQV A;  1EP7 A;  3DEX A;  4HU9 A;  4MP4 A;  3HVV A;  3P90 A;  3QR6 A;  5A4W A;  3HXS A;  3TB2 A;  2V41 A;  4K7I A;  2JZT A;  4KW6 A;  4WBR D;  5IPH A;  3TJG A;  18GS A;  1T8E B;  5G5E A;  4EDY A;  2AHE A;  1JZW A;  5ECP B;  5B8B A;  1YDK A;  5DCH A;  1X5E A;  10GS A;  1GSF A;  2FA4 A;  4FQU A;  3GX0 A;  2O89 A;  4DSR A;  2B1L A;  1KNG A;  2JAD A;  1ZGN A;  3F8U A;  5D8I A;  2BMX A;  4IN0 A;  3LQ7 A;  3DD3 A;  4LL4 B;  7GSS A;  4TR1 B;  4TXV A;  5ENU A;  5DAK A;  3UEM A;  4GQF A; 
#chains in the Genus database with same CATH topology
 5INY A;  2IMK A;  1OC3 A;  2H75 A;  1B48 A;  2YN1 A;  4MMM A;  4FYC A;  1YVL A;  2PBJ A;  1B9Y C;  2J9H A;  2K18 A;  3O3T A;  2F8A A;  2OKA A;  4MJC A;  1Z6M A;  4OFT A;  3TRX A;  2H74 A;  2HRK A;  4XIH A;  5JCU A;  5KN3 A;  1UN2 A;  5IIZ A;  2PER A;  1V9W A;  3QOU A;  1N25 A;  4IVF A;  3GIX A;  4KSM A;  6GSY A;  3FEU A;  5F0G A;  3L9U A;  4Z2U A;  4HJ2 A;  5IMA A;  4PGT A;  4TW5 A;  2L4C A;  5IMV A;  2WVX B;  3L9V A;  4BVY B;  2OJL A;  4DEJ A;  1EGO A;  2J23 A;  5DCG A;  4IBP A;  1WMJ A;  5CRW A;  2F9S A;  3CRU A;  5ECQ B;  4EO3 A;  1K3L A;  4FO5 A;  2H6Z A;  4WF5 A;  1UC7 A;  3ZVJ D;  4J56 E;  4MCU A;  4E8E A;  2I3Y A;  3IXR A;  2VLU A;  2IMD A;  1M9B A;  4AGS A;  3F0I A;  1YF1 A;  1CQG A;  3J7Y b;  5B8A A;  4N10 A;  5G30 A;  1GSD A;  5HFG A;  4WF4 A;  4BPY A;  1A0R P;  3R2Q A;  3FKF A;  4KH7 A;  1XPV A;  2WZ9 A;  2YWN A;  2KUC A;  3F3R A;  1AW9 A;  2OAC A;  2JU5 A;  1TK0 B;  1W89 A;  4EL1 A;  2BTO T;  2PVQ A;  3IBH A;  3KXO A;  3DXB A;  3DKS A;  1O8X A;  1PL1 A;  3W6G A;  4WXT A;  3L4N A;  4PXO A;  1KTE A;  5EPF A;  1GL8 A;  1TRV A;  3RPN A;  5EY6 A;  2F3M A;  2G2Q A;  2FLS A;  2C0D A;  1U3I A;  3A3T A;  1TK5 B;  1USB A;  2VD1 A;  4PI2 C;  4DSS A;  2VL2 A;  1G7E A;  2DKI A;  2OBI A;  4POB A;  1S3A A;  1SJZ A;  1G7O A;  2N5F A;  4CDO A;  3UIW A;  2CT6 A;  2TRC P;  2HYX A;  2VL3 A;  2C0F A;  3GTU A;  3TKS C;  4YQU A;  1SVO A;  4ZB6 A;  3HJO A;  2P0G A;  3KP8 A;  3F63 A;  2VLT A;  2DJJ A;  3TDG A;  1LU4 A;  4TXO A;  5J5N A;  4J2F A;  2VKZ G;  1A23 A;  1ZZY A;  2GLR A;  4MK3 A;  3UOM A;  4EXJ A;  2V1M A;  2IN3 A;  3MYD A;  2XPE A;  1MDK A;  4ZB9 A;  4MF6 A;  4HSC X;  4ZBB A;  3ZZX A;  3UVH A;  3FZ5 A;  3TJB A;  17GS A;  3H1N A;  1GSE A;  5H5Q A;  5ABR A;  3TKP A;  4TR0 A;  4GF0 A;  4QMK A;  2L6C A;  4LMV A;  2AYT A;  4ISD A;  1O73 A;  4EIP A;  2WW3 A;  4FIW A;  2H1G A;  5H5S A;  3VPQ A;  2DJ2 A;  1PSQ A;  4L8E A;  1U87 A;  4Z7X A;  4KSO A;  4L0U A;  2C3N A;  1AQW A;  2DC5 A;  1J9B A;  3HCZ A;  5J4V A;  3EU3 A;  3RFR C;  4EE0 A;  5A34 B;  1AQX A;  4RQR A;  2ES7 A;  1PFO A;  3ZRE A;  3GNJ A;  4ECB A;  5DQS A;  2PU9 C;  1A2J A;  1MEK A;  5J40 A;  4XS1 A;  2JSZ A;  1CQH A;  4NHW A;  2WW0 A;  1GP1 A;  4I6X A;  5EVO A;  2YP6 A;  1QQ2 A;  4AKI A;  2WJU A;  1SD8 A;  5DAK B;  4POM A;  5FHI A;  5D9V A;  4QQ7 A;  1DUG A;  3DML A;  3Q18 A;  2F8F A;  2LV3 A;  1YEW C;  5FWG A;  3E9J B;  1SKR B;  4GXZ A;  2GSR A;  4I5Q A;  2HRK B;  3G7Y A;  1XOA A;  2IME A;  2DJ3 A;  3GL5 A;  4RI7 A;  2MMZ A;  5CP1 A;  3RBT A;  2YAN A;  3GMF A;  3DGQ A;  2GZZ A;  1XVQ A;  1M3J A;  2IMF A;  2NVL A;  1X9M B;  1GRX A;  3M1G A;  2NBS A;  5J9B A;  4GLT A;  3C1R A;  2AV4 A;  1VF1 A;  4CW9 A;  4NWY A;  3KEB A;  1WE0 A;  1SK2 A;  2GS3 A;  2O36 A;  2V32 A;  2H1L A;  1T7P B;  1EV9 A;  5ECL B;  3HY2 A;  3IK9 A;  4IKH A;  2G0F A;  4J57 E;  2N5A A;  3QAG A;  1A2L A;  5J47 A;  5G1K A;  2V6O A;  1N8J A;  2I4A A;  1PL2 A;  5HR0 A;  1FVK A;  4HEA 2;  1M99 A;  2REM A;  2GQL A;  1BYE A;  4AJ7 A;  5J4U A;  1XZO A;  1XBS A;  5ECS A;  3VWV A;  1OE8 A;  4HZ4 A;  1AUC A;  5KN0 A;  5IO0 A;  1PA3 A;  2VO4 A;  2A2P A;  1V57 A;  4EF0 A;  1UVZ A;  4O32 A;  2CAQ A;  3WYW A;  3HHV A;  3UMA A;  3QPM A;  4G0K A;  2C8U A;  2M72 A;  3ZIV A;  3CSH A;  4G01 A;  5DQY A;  5D73 A;  4BVY A;  2VIM A;  3ED3 A;  4IS0 A;  2C1Y A;  3G7I A;  3IDV A;  5JCW A;  2IPA A;  2C0E A;  2XBQ A;  2P5Q A;  5LNK e;  3HA9 A;  1JFU A;  3VI5 A;  2A2R A;  3LEF A;  1V58 A;  2CAI A;  4MF7 A;  1AAZ A;  2GGT A;  3GYK A;  3CTF A;  3M0F A;  4PQ1 A;  2VCT A;  1TOF A;  1HQO A;  5DAL A;  5HFI A;  1X9W B;  19GS A;  3BJ5 A;  2FWE A;  4Z2T A;  4FYB A;  4KCA A;  2CVK A;  1YJ6 A;  3I9V 2;  4JED A;  4ZL9 A;  1SYX A;  2XC2 A;  1QXH A;  3GTU B;  1OC9 B;  3NIV A;  3MWH A;  5IO2 A;  5G5F A;  4KDY A;  4MZB A;  4I97 A;  2LRC A;  1F2E A;  4AJ8 A;  4TXO B;  2OE0 A;  1EOH A;  3PH9 A;  2R3X A;  3IV4 A;  2B7J A;  1ZYN A;  3K8N A;  4PUA A;  5J3R A;  5IMZ A;  2CVB A;  4XS6 A;  3KMN A;  2F51 A;  1EZK A;  2HE3 A;  1IYH A;  4TOP A;  2O87 A;  3KJY A;  1OKT A;  2V6K A;  2CX4 A;  1NHY A;  4XCS A;  2AAW A;  4MA9 A;  1V98 A;  2GT5 A;  5CRD A;  3KH9 A;  3UVT A;  1J0F A;  5ID2 A;  4PHZ C;  2H8L A;  3C1S A;  4MJB A;  3HZ4 A;  4KB3 A;  3W8S A;  2HSH A;  4O5Q A;  3HVX A;  2JSY A;  2LST A;  5HR3 A;  3TKS A;  1DSB A;  5B7C A;  5CYY A;  4NHZ A;  5KEJ A;  4GTU A;  2MBT A;  1S4B P;  2YV7 A;  3MAK A;  1U88 A;  5C00 A;  3EVI A;  4ZXG A;  3C8E A;  3IC4 A;  3TJJ A;  5H5R A;  2K9F A;  1K3O A;  4PNG A;  4Q5N A;  4HQS A;  1M2D A;  2EFH A;  1HYU A;  1J08 A;  1XWB A;  5AIS A;  4HUA A;  1XCC A;  4KCE A;  2WFC A;  3CMI A;  3MNG A;  1FAA A;  3UBL A;  2R6K A;  2VCZ A;  5LCZ A;  4WR4 A;  1EOG A;  2YZU A;  1VRS D;  2MMO A;  2DJ0 A;  1ABA A;  3UAR A;  2YPM A;  4IGJ A;  4F82 A;  3CQF A;  1QMV A;  2ON7 A;  4BL7 A;  5A34 A;  4N3Z A;  2EIR A;  3P2A A;  1U3A A;  5CAX A;  5KN1 A;  3QMX A;  1K0O A;  3ME8 A;  3CBU A;  4F03 A;  1F3B A;  5IMF A;  2GZP A;  2X4A A;  2VD0 A;  2L6D A;  5ECM B;  2L59 A;  3EPT A;  3O6T A;  2LJR A;  3KD0 A;  4K7O A;  4PX1 A;  1B4Q A;  1M0U A;  3BD2 A;  4KX4 A;  1EEM A;  2CZ2 A;  4MLY A;  5D9W A;  4N11 A;  1Y25 A;  3TOT A;  1MDJ A;  2HRF A;  1BG1 A;  3ZML A;  5A5K A;  3A2V A;  1MDI A;  4MPG A;  3BCK A;  1TTZ A;  2KP2 A;  1ILO A;  3C7M A;  2WB9 A;  3FW2 A;  2FNO A;  2E2M A;  2HRA A;  5J9C A;  4ZBA A;  2FA8 A;  3A5I A;  5IMD A;  2I1U A;  1DBY A;  3VWU A;  1FW1 A;  4ZBD A;  3HKR A;  2H0H A;  4IJ3 A;  3A2X A;  4YKF A;  1LBK A;  1XFL A;  1RK4 A;  5GSS A;  4F0C A;  5B6N A;  2H71 A;  2K6V A;  3LJR A;  3HZ8 A;  4K5S A;  4MJE A;  4XRA A;  3ZFL A;  3VI7 A;  4BA7 A;  3ZL5 A;  4JU5 A;  4IP6 A;  3KMO A;  4JBB A;  3JCM L;  1PN0 A;  1X0R A;  5A5H A;  4G19 A;  2H30 A;  2FD3 A;  3GKK A;  3LFL A;  2MZC A;  3TGZ A;  2DKH A;  1JZR A;  1XWC A;  5D93 A;  4AF2 A;  3EE2 A;  2H1D A;  4JR6 A;  5DBQ A;  4KND A;  4XRD A;  4OD7 A;  1EEJ A;  3ZLP A;  4AKX B;  2KLX A;  4IP1 A;  4LMW A;  2H70 A;  5B6M A;  2FWG A;  2X64 A;  2WUL A;  1RW1 A;  4CY8 A;  1URM A;  5DAL B;  2L5O A;  1OC8 A;  1JZO A;  2CZ3 A;  2RUF A;  3DYR A;  5FT3 A;  2VUP A;  4AKH A;  1Z9H A;  1F3A A;  3KH7 A;  3UAP A;  1SK0 A;  2X8G A;  4NXI A;  1I1I P;  2OA7 A;  2C80 A;  1SKW B;  3ERG A;  2O5V A;  4K6X A;  3RAZ A;  1GWC A;  3FK8 A;  22GS A;  4IQ1 A;  2EIQ A;  1TKD B;  2AUV A;  1H75 A;  5COH A;  2HNL A;  1EWX A;  2GST A;  4EUY A;  4K0N A;  3D4M A;  3IK7 A;  5CNW A;  3HD5 A;  2LUS A;  5IOX A;  2MBS A;  1TW9 A;  2WZS A;  2ON5 A;  1WP0 A;  2VCW A;  4KA0 A;  4HU7 A;  4OO5 A;  3M9J A;  3PPU A;  4WET A;  4WKW A;  2JL4 A;  2HQT A;  4O5R A;  1SVM A;  4NV2 A;  1OC9 A;  2FUG 2;  5ID2 B;  1FG4 A;  4N0Z A;  5F8B A;  3OR5 A;  2IIY A;  3HDC A;  1Z3E A;  1M2A A;  3TKS E;  4IQA A;  3ME7 A;  2JAC A;  2CX3 A;  2H73 A;  2EFE A;  4LLR A;  4ML1 A;  2WRT A;  4FH8 A;  1KBN A;  3GH9 A;  1WRY A;  3WD6 A;  3IA1 A;  1SVL A;  2WVY A;  4LL1 B;  5KN2 A;  3CRT A;  2ALB A;  2KHP A;  2LTK A;  2XHF A;  1JLV A;  1RQM A;  3Q6O A;  1FVJ A;  6GSU A;  2H1A A;  1TP9 A;  4PUR A;  3CTG A;  1FO5 A;  4ZL8 A;  2B5X A;  2WCI A;  5IMC A;  3EU4 A;  4GSN A;  4G2E A;  1GLP A;  3DVX A;  3GRX A;  3UBK A;  2LJK A;  1XIY A;  2KOK A;  5GAP D;  5IM9 A;  3G9B A;  2PPT A;  2H0I A;  5CRG A;  2HXK A;  3QFB C;  2VAF A;  2A4H A;  4GST A;  1BED A;  2MMN A;  1I5G A;  4L0W A;  4I8B A;  4BL7 B;  4MZW A;  3ZFB A;  3GKN A;  1SKS B;  1QUW A;  1K0N A;  2IFQ A;  1Y1U A;  1YKC A;  1GNW A;  2HFD A;  2FWF A;  1GSS A;  2NPB A;  3F3Q A;  3DRN A;  2RUE A;  3TCO A;  1GTB A;  1QGV A;  1NW2 A;  2H0G A;  3L78 A;  3TUE A;  1BG5 A;  2RM6 A;  1VF4 A;  2IJY A;  4YQM A;  1TRU A;  3KCM A;  4PQI A;  3NOF A;  4JZQ A;  3KGK A;  16GS A;  4G9H A;  1OKD A;  5C04 A;  3FY7 A;  2LJA A;  3HVS A;  2PWJ A;  5D9T A;  4G0L A;  2N5B A;  1WWJ A;  2E0Q A;  1PX6 A;  1QFN A;  2ZUP A;  3TKR A;  3C73 A;  2WGR A;  5IQY A;  3GA4 A;  1SL0 B;  4K2X A;  2M46 A;  4HQZ A;  3W8J A;  2CQ9 A;  2GVP A;  1TK8 B;  1SJ6 A;  3GV1 A;  4ULX A;  4O7H A;  4P3Y B;  4X43 A;  4FXY P;  4KDX A;  3VWX A;  2GSS A;  4MAB A;  2HRN A;  3D21 A;  5AGY A;  1SK1 A;  3TJK A;  1I9D A;  2FWH A;  2H1B A;  3FR6 A;  5A5H B;  2MMA A;  3RHC A;  4V1A p;  3H93 A;  1TRS A;  1XW6 A;  3H4K A;  5G2Z A;  3D4T A;  1JLW A;  4N30 A;  3FR3 A;  2LNT A;  2PN8 A;  3VLN A;  3E3E A;  5GAN D;  4XHM A;  1T00 A;  3LG6 A;  3RGB C;  2L4Q A;  1TXX A;  4NAX A;  1TDI A;  4GWR A;  3PR8 A;  4O92 A;  4HDE A;  2QKE A;  2OAD A;  4V1A g;  1TI1 A;  1AC1 A;  1XWK A;  2QC7 A;  2FY6 A;  1OYJ A;  3D22 A;  4MH2 A;  4EVM A;  1B4P A;  3FZ4 A;  2DMM A;  5LD0 A;  3QAW A;  2WVZ A;  4V2L A;  2VOC A;  3APO A;  2KP1 A;  1TU7 A;  1THO A;  3KTL A;  2VL9 A;  1WOU A;  3GST A;  5EL8 A;  3WGE A;  1GUL A;  5DJM A;  3WT1 A;  2B1K A;  3SBC A;  1TI3 A;  4E8H A;  4HI7 A;  4GDF A;  2GSQ A;  1X5C A;  4IW9 A;  2VL2 C;  2CA8 A;  3KP9 A;  1YEX A;  5E4W A;  1M3I A;  2VCX A;  2B3S A;  1R26 A;  3F6D A;  3U6V A;  1BQ7 A;  4XS4 B;  1A0F A;  3GKM A;  4DVC A;  4KDU A;  13GS A;  4Q5F A;  4ZIJ A;  2H66 A;  2YNX A;  2XPD A;  2HZF A;  1ZOF A;  3BCI A;  1PMT A;  4JRR A;  4TVE A;  5ELG A;  6GST A;  2K8V A;  3D6I A;  2K8S A;  1PKW A;  2LRN A;  2WDU A;  1TJD A;  4IJI A;  3HMJ G;  2VCQ A;  4EC0 A;  1Z7P A;  1A2M A;  1GTI A;  3HYP A;  3MIX A;  2X8C A;  3GHA A;  4NMU A;  1EGR A;  1GSU A;  1THX A;  1O85 A;  1Z6N A;  3QFA C;  3MDK A;  4KAE A;  1SJI A;  1A8L A;  1V2A A;  2B5Y A;  2PGT A;  2H01 A;  4O5U A;  3VFI A;  3GH6 A;  2YJH A;  4OFN A;  4OCF A;  1ZYP A;  1WIK A;  5E59 A;  2IFQ B;  1T1V A;  1SEN A;  2GQK A;  3VWW A;  1OAZ A;  4HZ2 A;  4K0G A;  3DWV A;  1ERU A;  1O8W A;  1BF5 A;  4YAP A;  1EV4 A;  4AJ6 A;  3O76 A;  2GZY A;  2LQO A;  4MDC A;  3CSI A;  1PKZ A;  5F07 A;  1ZYE A;  4HS1 A;  3ZYW A;  3KZQ A;  6GSS A;  1OE7 A;  1VGL A;  5BRT A;  4Q5Q A;  4AKG A;  1GUK A;  1W4V A;  3QAV A;  1MTC A;  3TRP A;  1ERT A;  1TRW A;  3DVW A;  2H6Y A;  3RPP A;  5JWR B;  2O85 A;  1VF2 A;  3H79 A;  2X49 A;  1HNA A;  3IE3 A;  2CV4 A;  2HSM A;  3HVN A;  1GTU A;  4ECI A;  4BVX B;  2JZS A;  2GDR A;  1PRX A;  1X5D A;  2AB6 A;  2EFC A;  1A8Y A;  1FOV A;  3CHX C;  3VK9 A;  2OBK A;  1AIU A;  3LOR A;  4D73 A;  1YY7 A;  3A5W A;  2GTU A;  2YZH A;  5ECK B;  2C0G A;  3IRA A;  1K0B A;  3I6A A;  3EUR A;  5A1N B;  3EMP A;  3N9J A;  2IL3 A;  4GRF A;  5F05 A;  2A4V A;  4OWY A;  2I81 A;  5D9X A;  1S3D A;  2DIZ A;  1AQV A;  4PUF C;  1YEP A;  3C71 A;  2V2G A;  1ERV A;  3RHB A;  3KIJ A;  2O7K A;  1OVN A;  4KE3 A;  4QL9 A;  2DLX A;  4POK A;  4MF5 A;  4ML6 A;  4WR5 A;  2H6X A;  1U6T A;  3ISO A;  2PUK C;  2HZE B;  1JZD A;  1ML6 A;  1GNE A;  1ERW A;  3KTB A;  2DSA A;  2TRX A;  4JR4 A;  1YZX A;  1ON4 A;  4PNF A;  2H76 A;  2NTO A;  1GLQ A;  2UV8 G;  3MSZ A;  3FYG A;  2LEG A;  5GST A;  4HOJ A;  3F6F A;  3ZVJ A;  4ZB8 A;  4F9Z A;  4DSQ A;  1HNB A;  3Q19 A;  2M80 A;  3I69 A;  2D2Z A;  1R7H A;  5ELA A;  2CVD A;  1LJR A;  2QGV A;  1EP8 A;  3IAM 2;  2NDO A;  3TOU A;  5KOW A;  1GTA A;  2O8V B;  4GCI A;  4K2D A;  1FB6 A;  4PQH A;  5CO3 A;  2R2J A;  3GUR A;  5ECI B;  3U5R E;  1B9X C;  2Z9S A;  1T3B A;  4TRX A;  3F4S A;  2P31 A;  3EMX A;  3GN3 A;  5G31 A;  4ECC A;  3P7X A;  2OE3 A;  3GL3 A;  1ZMA A;  3NZN A;  2ZNM A;  4KUN A;  4POL A;  1PGT A;  4KF9 A;  1HD2 A;  2TIR A;  3V1W A;  2RM5 A;  1R5P A;  3IOS A;  4PI0 C;  4V2N A;  2B5E A;  1TU8 A;  3FHK A;  1XVW A;  4RQX A;  4L5L A;  4XS4 A;  4L5O A;  3D5J A;  1XW5 A;  1GH2 A;  3GX8 A;  3A2W A;  1ZCP A;  1M2B A;  1ST9 A;  4ACS A;  3WGD A;  1FB0 A;  1NSW A;  2O3E A;  1XOB A;  3ZMK A;  1XWG A;  1SD9 A;  3APS A;  4EKZ A;  1K0C A;  3FZA A;  4HJM A;  1N2A A;  5GZZ B;  2R5G A;  3GSS A;  4OO4 A;  1B8X A;  2E2G A;  2RII A;  2HT9 A;  1O7U A;  2YV9 A;  2LRT A;  4W66 A;  2DJ1 A;  2WW1 A;  1G6Y A;  3LGC A;  3D0Z A;  1PQN A;  3G7J A;  4G0I A;  4TR4 A;  2OE1 A;  1H4O A;  5CRE A;  6GSW A;  2LKU A;  4IHU A;  4F2I A;  3M9K A;  3F4T A;  2VM2 A;  2R4V A;  1FOH A;  2FGX A;  3QCP A;  3ERW A;  2HSM B;  1SL2 B;  1S3C A;  3LSZ A;  4RUV A;  2HLS A;  2YWI A;  2DIY A;  3ZTL A;  2HSN A;  4YH2 A;  3VUR A;  2IWT A;  1SU9 A;  3CXG A;  3LYP A;  1PN9 A;  2RLI A;  1Q98 A;  1YKA A;  4EDZ A;  3HJP A;  2WS2 A;  1G6W A;  2C4J A;  2R0C A;  5KOX A;  2EIO A;  2VCV A;  3EWL A;  1ACV A;  5BMU A;  4TKY A;  2C3T A;  2H72 A;  2PMT A;  4JE1 A;  4ZIL A;  3F4R A;  4NV5 A;  1O6J A;  1ZL9 A;  3VPT A;  2JZR A;  2LNS A;  2XBI A;  4D73 B;  4MH3 A;  1F37 A;  5ECH B;  1MD3 A;  1MD4 A;  4GSS A;  3UL3 A;  2B7K A;  5DVB A;  3TRQ A;  14GS A;  2VLV A;  2FCH A;  11GS A;  3FRC A;  4AI6 A;  4WEY A;  3WGX A;  2IMI A;  3BOA A;  4FYU A;  2P5R A;  4Z2R A;  2VM1 A;  1A24 A;  3J7Y k;  1AXD A;  2YOI A;  4BVX A;  2PVO C;  4YKG A;  4IEL A;  1NM3 A;  4USS A;  4MJA A;  3LXZ A;  3IHQ A;  5CRH A;  5DDL A;  2R37 A;  3M3M A;  1K3Y A;  3BBY A;  6GSX A;  2QA1 A;  2YJ7 A;  4BWQ A;  1XG8 A;  1S3R A;  3TKQ A;  3R3E A;  5A4U A;  4X0X A;  3CSJ A;  2E7P A;  2BJX A;  1KEB A;  3CWG A;  2B6M A;  3E0U A;  1JHB A;  1DE2 A;  5A4V A;  1Y6E A;  4X1U A;  1T4Y A;  3L0H A;  2C3Q A;  5AN1 A;  1BJX A;  2R0P A;  1M9A A;  5A1N A;  1SL1 B;  6GSV A;  2EC4 A;  4ECJ A;  1HNC A;  3LWA A;  5IPG A;  2GQM A;  3LXT A;  4TR1 A;  3GFK A;  2YCD A;  3UJ1 A;  1E6B A;  1YQ1 A;  4E68 A;  2ZCT A;  4X4J A;  1IYI A;  5DJL A;  5HR2 A;  3FZ9 A;  5L71 A;  3H8Q A;  4RI6 A;  4K8M A;  5HR1 A;  4ICY A;  4BWS A;  5D96 A;  2HZE A;  2HSY A;  2GT6 A;  2MYG A;  3EYT A;  2A2S A;  2AJQ B;  1K0D A;  1F9M A;  2DBC A;  3L9S A;  3FR9 A;  4F0B A;  1V40 A;  1PX7 A;  3IAS 2;  1F6M C;  2X99 A;  3IHG A;  3APQ A;  1BX9 A;  5ECO B;  1WJK A;  2QSI A;  3I43 A;  8GSS A;  2WVX A;  2R0G A;  1K0M A;  1YF0 A;  2DML A;  3GKX A;  2UZ8 A;  1NHO A;  3ERF A;  4OFM A;  1VF3 A;  2LS5 A;  3HJM A;  1O81 A;  1ZYQ B;  3QD9 A;  9GSS A;  5JWO B;  1X9S B;  4NPB A;  3M8N A;  1WPI A;  3EIN A;  3IPZ A;  4OMV A;  2HI7 A;  3KM6 A;  3TJF A;  4MZC A;  3N5O A;  1GSQ A;  4Q5R A;  3RDW A;  2DJK A;  1SYR A;  2H19 A;  4DSS B;  1T4Z A;  1XXU A;  1PD2 1;  3CYN A;  2WW2 A;  5ECR B;  3GUS A;  3F9U A;  4GQC A;  4CHS A;  1XW9 A;  5AIX A;  5F06 A;  1K0A A;  4XTS A;  1E2Y A;  2YWO A;  3Q74 A;  4ILF A;  4YAV A;  3DIE A;  4K7N A;  4N0V A;  4TN8 A;  3ZIT A;  1DE1 A;  4I2U A;  3US3 A;  2EFD A;  5IOW A;  4PTS A;  20GS A;  3AY8 A;  3ZIJ A;  3LW9 A;  2X8H A;  4BIK A;  4KGI A;  1BAY A;  4K5R A;  1Z7R A;  2LQQ A;  1G0T A;  2L57 A;  1XWA A;  4K9Z A;  4K1F A;  4I2T A;  1UA5 A;  5JWQ B;  5HFK A;  5HQP A;  1M7T A;  1QK8 A;  5G1L A;  5AIV A;  2OT3 A;  3ZRD A;  3IC8 A;  1R4W A;  4H86 A;  2QA2 A;  1Q4J A;  4MNN A;  1GSY A;  2L5L A;  4V2M A;  1FHE A;  3SWL A;  3P8W A;  1GUH A;  3TU3 B;  3IR4 A;  2HSN B;  4MPF A;  1C72 A;  4G10 A;  1R5A A;  4EIQ A;  3WT2 A;  1TXU A;  4ZL7 A;  3PIN A;  3S9F A;  1GUM A;  4CY6 A;  5BMU B;  12GS A;  3QDN A;  1Z5Y E;  3LYK A;  5J41 A;  4LA1 A;  2I9H A;  2FHE A;  4WBJ A;  5ECN B;  4TR3 A;  3EC3 A;  2YWM A;  3FMW A;  4ID0 A;  4OCE A;  5JCG A;  4ZB7 A;  4QL7 A;  3PGT A;  4YQV A;  1EP7 A;  5J4Y A;  3DEX A;  4HU9 A;  4MP4 A;  3HVV A;  3P90 A;  3QR6 A;  5A4W A;  3HXS A;  3TB2 A;  2V41 A;  4K7I A;  2JZT A;  4KW6 A;  4WBR D;  5IPH A;  3TJG A;  18GS A;  1T8E B;  5G5E A;  4EDY A;  2AHE A;  1JZW A;  5ECP B;  5B8B A;  1YDK A;  5DCH A;  1X5E A;  10GS A;  1GSF A;  2FA4 A;  4FQU A;  3GX0 A;  2O89 A;  4DSR A;  2B1L A;  1KNG A;  2JAD A;  1ZGN A;  3F8U A;  5D8I A;  2BMX A;  4IN0 A;  3LQ7 A;  3DD3 A;  4LL4 B;  4A5P A;  7GSS A;  4TR1 B;  4TXV A;  5ENU A;  5DAK A;  3UEM A;  4GQF A; 
#chains in the Genus database with same CATH homology
 5INY A;  2IMK A;  1OC3 A;  2H75 A;  1B48 A;  2YN1 A;  4MMM A;  4FYC A;  1YVL A;  2PBJ A;  1B9Y C;  2J9H A;  2K18 A;  3O3T A;  2F8A A;  2OKA A;  4MJC A;  1Z6M A;  4OFT A;  3TRX A;  2H74 A;  2HRK A;  4XIH A;  5JCU A;  5KN3 A;  1UN2 A;  5IIZ A;  2PER A;  1V9W A;  3QOU A;  1N25 A;  4IVF A;  3GIX A;  4KSM A;  6GSY A;  3FEU A;  5F0G A;  3L9U A;  4Z2U A;  4HJ2 A;  5IMA A;  4PGT A;  4TW5 A;  2L4C A;  5IMV A;  3L9V A;  4BVY B;  2OJL A;  4DEJ A;  1EGO A;  2J23 A;  5DCG A;  4IBP A;  1WMJ A;  5CRW A;  2F9S A;  3CRU A;  5ECQ B;  4EO3 A;  1K3L A;  4FO5 A;  2H6Z A;  4WF5 A;  1UC7 A;  3ZVJ D;  4J56 E;  4MCU A;  4E8E A;  2I3Y A;  3IXR A;  2VLU A;  2IMD A;  1M9B A;  4AGS A;  3F0I A;  1YF1 A;  1CQG A;  3J7Y b;  5B8A A;  4N10 A;  5G30 A;  1GSD A;  5HFG A;  4WF4 A;  4BPY A;  1A0R P;  3R2Q A;  3FKF A;  4KH7 A;  1XPV A;  2WZ9 A;  2YWN A;  2KUC A;  3F3R A;  1AW9 A;  2OAC A;  2JU5 A;  1TK0 B;  1W89 A;  4EL1 A;  2BTO T;  2PVQ A;  3IBH A;  3KXO A;  3DXB A;  3DKS A;  1O8X A;  1PL1 A;  3W6G A;  4WXT A;  3L4N A;  4PXO A;  1KTE A;  5EPF A;  1GL8 A;  1TRV A;  3RPN A;  5EY6 A;  2F3M A;  2G2Q A;  2FLS A;  2C0D A;  1U3I A;  3A3T A;  1TK5 B;  1USB A;  2VD1 A;  4DSS A;  2VL2 A;  1G7E A;  2DKI A;  2OBI A;  4POB A;  1S3A A;  1SJZ A;  1G7O A;  2N5F A;  4CDO A;  3UIW A;  2CT6 A;  2TRC P;  2HYX A;  2VL3 A;  2C0F A;  3GTU A;  3TKS C;  4YQU A;  1SVO A;  4ZB6 A;  3HJO A;  2P0G A;  3KP8 A;  3F63 A;  2VLT A;  2DJJ A;  3TDG A;  1LU4 A;  4TXO A;  5J5N A;  4J2F A;  2VKZ G;  1A23 A;  1ZZY A;  2GLR A;  4MK3 A;  3UOM A;  4EXJ A;  2V1M A;  2IN3 A;  3MYD A;  2XPE A;  1MDK A;  4ZB9 A;  4MF6 A;  4ZBB A;  3ZZX A;  3UVH A;  3FZ5 A;  3TJB A;  17GS A;  3H1N A;  1GSE A;  5H5Q A;  5ABR A;  3TKP A;  4TR0 A;  4GF0 A;  4QMK A;  2L6C A;  4LMV A;  2AYT A;  4ISD A;  1O73 A;  4EIP A;  4FIW A;  2H1G A;  5H5S A;  3VPQ A;  2DJ2 A;  1PSQ A;  4L8E A;  1U87 A;  4Z7X A;  4KSO A;  4L0U A;  2C3N A;  1AQW A;  2DC5 A;  1J9B A;  3HCZ A;  5J4V A;  3EU3 A;  4EE0 A;  5A34 B;  1AQX A;  4RQR A;  2ES7 A;  3ZRE A;  3GNJ A;  4ECB A;  5DQS A;  2PU9 C;  1A2J A;  1MEK A;  5J40 A;  4XS1 A;  2JSZ A;  1CQH A;  4NHW A;  1GP1 A;  4I6X A;  5EVO A;  2YP6 A;  1QQ2 A;  4AKI A;  2WJU A;  1SD8 A;  5DAK B;  4POM A;  5FHI A;  5D9V A;  4QQ7 A;  1DUG A;  3DML A;  3Q18 A;  2F8F A;  2LV3 A;  5FWG A;  3E9J B;  1SKR B;  4GXZ A;  2GSR A;  4I5Q A;  2HRK B;  3G7Y A;  1XOA A;  2IME A;  2DJ3 A;  3GL5 A;  4RI7 A;  2MMZ A;  5CP1 A;  3RBT A;  2YAN A;  3GMF A;  3DGQ A;  2GZZ A;  1XVQ A;  2IMF A;  2NVL A;  1X9M B;  1GRX A;  3M1G A;  2NBS A;  5J9B A;  4GLT A;  3C1R A;  2AV4 A;  1VF1 A;  4CW9 A;  4NWY A;  3KEB A;  1WE0 A;  1SK2 A;  2GS3 A;  2V32 A;  2H1L A;  1T7P B;  1EV9 A;  5ECL B;  3HY2 A;  3IK9 A;  4IKH A;  2G0F A;  4J57 E;  2N5A A;  3QAG A;  1A2L A;  5J47 A;  5G1K A;  2V6O A;  1N8J A;  2I4A A;  1PL2 A;  5HR0 A;  1FVK A;  4HEA 2;  1M99 A;  2REM A;  2GQL A;  1BYE A;  4AJ7 A;  5J4U A;  1XZO A;  1XBS A;  5ECS A;  3VWV A;  1OE8 A;  4HZ4 A;  1AUC A;  5KN0 A;  5IO0 A;  1PA3 A;  2VO4 A;  2A2P A;  1V57 A;  4EF0 A;  1UVZ A;  4O32 A;  2CAQ A;  3WYW A;  3HHV A;  3UMA A;  3QPM A;  4G0K A;  2C8U A;  2M72 A;  3ZIV A;  3CSH A;  4G01 A;  5DQY A;  5D73 A;  4BVY A;  2VIM A;  3ED3 A;  4IS0 A;  2C1Y A;  3G7I A;  3IDV A;  5JCW A;  2IPA A;  2C0E A;  2XBQ A;  2P5Q A;  5LNK e;  3HA9 A;  1JFU A;  3VI5 A;  2A2R A;  3LEF A;  1V58 A;  2CAI A;  4MF7 A;  1AAZ A;  2GGT A;  3GYK A;  3CTF A;  3M0F A;  4PQ1 A;  2VCT A;  1TOF A;  1HQO A;  5DAL A;  5HFI A;  1X9W B;  19GS A;  3BJ5 A;  2FWE A;  4Z2T A;  4FYB A;  4KCA A;  2CVK A;  1YJ6 A;  3I9V 2;  4JED A;  4ZL9 A;  1SYX A;  2XC2 A;  1QXH A;  3GTU B;  1OC9 B;  3NIV A;  3MWH A;  5IO2 A;  5G5F A;  4KDY A;  4MZB A;  4I97 A;  2LRC A;  1F2E A;  4AJ8 A;  4TXO B;  2OE0 A;  1EOH A;  3PH9 A;  2R3X A;  3IV4 A;  2B7J A;  1ZYN A;  3K8N A;  4PUA A;  5J3R A;  5IMZ A;  2CVB A;  4XS6 A;  3KMN A;  2F51 A;  1EZK A;  2HE3 A;  1IYH A;  4TOP A;  2O87 A;  3KJY A;  1OKT A;  2V6K A;  2CX4 A;  1NHY A;  4XCS A;  2AAW A;  4MA9 A;  1V98 A;  2GT5 A;  5CRD A;  3KH9 A;  3UVT A;  1J0F A;  5ID2 A;  2H8L A;  3C1S A;  4MJB A;  3HZ4 A;  4KB3 A;  3W8S A;  2HSH A;  4O5Q A;  3HVX A;  2JSY A;  2LST A;  5HR3 A;  3TKS A;  1DSB A;  5B7C A;  5CYY A;  4NHZ A;  5KEJ A;  4GTU A;  2MBT A;  2YV7 A;  3MAK A;  1U88 A;  5C00 A;  3EVI A;  4ZXG A;  3C8E A;  3IC4 A;  3TJJ A;  5H5R A;  2K9F A;  1K3O A;  4PNG A;  4Q5N A;  4HQS A;  1M2D A;  2EFH A;  1HYU A;  1J08 A;  1XWB A;  5AIS A;  4HUA A;  1XCC A;  4KCE A;  2WFC A;  3CMI A;  3MNG A;  1FAA A;  3UBL A;  2R6K A;  2VCZ A;  5LCZ A;  4WR4 A;  1EOG A;  2YZU A;  1VRS D;  2MMO A;  2DJ0 A;  1ABA A;  3UAR A;  2YPM A;  4IGJ A;  4F82 A;  1QMV A;  2ON7 A;  4BL7 A;  5A34 A;  4N3Z A;  2EIR A;  3P2A A;  1U3A A;  5CAX A;  5KN1 A;  3QMX A;  1K0O A;  3ME8 A;  3CBU A;  4F03 A;  1F3B A;  5IMF A;  2GZP A;  2X4A A;  2VD0 A;  2L6D A;  5ECM B;  2L59 A;  3EPT A;  3O6T A;  2LJR A;  3KD0 A;  4K7O A;  4PX1 A;  1B4Q A;  1M0U A;  3BD2 A;  4KX4 A;  1EEM A;  2CZ2 A;  4MLY A;  5D9W A;  4N11 A;  1Y25 A;  3TOT A;  1MDJ A;  2HRF A;  1BG1 A;  3ZML A;  5A5K A;  3A2V A;  1MDI A;  4MPG A;  3BCK A;  1TTZ A;  2KP2 A;  1ILO A;  3C7M A;  2WB9 A;  3FW2 A;  2FNO A;  2E2M A;  2HRA A;  5J9C A;  4ZBA A;  2FA8 A;  3A5I A;  5IMD A;  2I1U A;  1DBY A;  3VWU A;  1FW1 A;  4ZBD A;  3HKR A;  2H0H A;  4IJ3 A;  3A2X A;  4YKF A;  1LBK A;  1XFL A;  1RK4 A;  5GSS A;  4F0C A;  5B6N A;  2H71 A;  2K6V A;  3LJR A;  3HZ8 A;  4K5S A;  4MJE A;  4XRA A;  3ZFL A;  3VI7 A;  4BA7 A;  3ZL5 A;  4JU5 A;  4IP6 A;  3KMO A;  4JBB A;  3JCM L;  1PN0 A;  1X0R A;  5A5H A;  4G19 A;  2H30 A;  2FD3 A;  3GKK A;  3LFL A;  2MZC A;  3TGZ A;  2DKH A;  1JZR A;  1XWC A;  5D93 A;  4AF2 A;  3EE2 A;  2H1D A;  4JR6 A;  5DBQ A;  4KND A;  4XRD A;  4OD7 A;  1EEJ A;  3ZLP A;  4AKX B;  2KLX A;  4IP1 A;  4LMW A;  2H70 A;  5B6M A;  2FWG A;  2X64 A;  2WUL A;  1RW1 A;  4CY8 A;  1URM A;  5DAL B;  2L5O A;  1OC8 A;  1JZO A;  2CZ3 A;  2RUF A;  3DYR A;  5FT3 A;  2VUP A;  4AKH A;  1Z9H A;  1F3A A;  3KH7 A;  3UAP A;  1SK0 A;  2X8G A;  4NXI A;  2OA7 A;  2C80 A;  1SKW B;  3ERG A;  2O5V A;  4K6X A;  3RAZ A;  1GWC A;  3FK8 A;  22GS A;  4IQ1 A;  2EIQ A;  1TKD B;  2AUV A;  1H75 A;  5COH A;  2HNL A;  1EWX A;  2GST A;  4EUY A;  4K0N A;  3D4M A;  3IK7 A;  5CNW A;  3HD5 A;  2LUS A;  5IOX A;  2MBS A;  1TW9 A;  2ON5 A;  1WP0 A;  2VCW A;  4KA0 A;  4HU7 A;  4OO5 A;  3M9J A;  3PPU A;  4WET A;  4WKW A;  2JL4 A;  2HQT A;  4O5R A;  1SVM A;  4NV2 A;  1OC9 A;  2FUG 2;  5ID2 B;  1FG4 A;  4N0Z A;  5F8B A;  3OR5 A;  2IIY A;  3HDC A;  1Z3E A;  1M2A A;  3TKS E;  4IQA A;  3ME7 A;  2JAC A;  2CX3 A;  2H73 A;  2EFE A;  4LLR A;  4ML1 A;  2WRT A;  4FH8 A;  1KBN A;  3GH9 A;  1WRY A;  3WD6 A;  3IA1 A;  1SVL A;  4LL1 B;  5KN2 A;  3CRT A;  2ALB A;  2KHP A;  2LTK A;  2XHF A;  1JLV A;  1RQM A;  3Q6O A;  1FVJ A;  6GSU A;  2H1A A;  1TP9 A;  4PUR A;  3CTG A;  1FO5 A;  4ZL8 A;  2B5X A;  2WCI A;  5IMC A;  3EU4 A;  4GSN A;  4G2E A;  1GLP A;  3DVX A;  3GRX A;  3UBK A;  2LJK A;  1XIY A;  2KOK A;  5GAP D;  5IM9 A;  3G9B A;  2PPT A;  2H0I A;  5CRG A;  2HXK A;  3QFB C;  2VAF A;  2A4H A;  4GST A;  1BED A;  2MMN A;  1I5G A;  4L0W A;  4I8B A;  4BL7 B;  4MZW A;  3ZFB A;  3GKN A;  1SKS B;  1QUW A;  1K0N A;  2IFQ A;  1Y1U A;  1YKC A;  1GNW A;  2HFD A;  2FWF A;  1GSS A;  2NPB A;  3F3Q A;  3DRN A;  2RUE A;  3TCO A;  1GTB A;  1QGV A;  1NW2 A;  2H0G A;  3L78 A;  3TUE A;  1BG5 A;  2RM6 A;  1VF4 A;  2IJY A;  4YQM A;  1TRU A;  3KCM A;  4PQI A;  3NOF A;  4JZQ A;  3KGK A;  16GS A;  4G9H A;  1OKD A;  5C04 A;  3FY7 A;  2LJA A;  3HVS A;  2PWJ A;  5D9T A;  4G0L A;  2N5B A;  1WWJ A;  2E0Q A;  1PX6 A;  1QFN A;  2ZUP A;  3TKR A;  3C73 A;  2WGR A;  5IQY A;  3GA4 A;  1SL0 B;  4K2X A;  2M46 A;  4HQZ A;  3W8J A;  2CQ9 A;  2GVP A;  1TK8 B;  1SJ6 A;  3GV1 A;  4ULX A;  4O7H A;  4P3Y B;  4X43 A;  4KDX A;  3VWX A;  2GSS A;  4MAB A;  2HRN A;  3D21 A;  5AGY A;  1SK1 A;  3TJK A;  1I9D A;  2FWH A;  2H1B A;  3FR6 A;  5A5H B;  2MMA A;  3RHC A;  4V1A p;  3H93 A;  1TRS A;  1XW6 A;  3H4K A;  5G2Z A;  3D4T A;  1JLW A;  4N30 A;  3FR3 A;  2LNT A;  2PN8 A;  3VLN A;  3E3E A;  5GAN D;  4XHM A;  1T00 A;  3LG6 A;  2L4Q A;  1TXX A;  4NAX A;  1TDI A;  4GWR A;  3PR8 A;  4O92 A;  4HDE A;  2QKE A;  2OAD A;  4V1A g;  1TI1 A;  1AC1 A;  1XWK A;  2QC7 A;  2FY6 A;  1OYJ A;  3D22 A;  4MH2 A;  4EVM A;  1B4P A;  3FZ4 A;  2DMM A;  5LD0 A;  3QAW A;  4V2L A;  2VOC A;  3APO A;  2KP1 A;  1TU7 A;  1THO A;  3KTL A;  2VL9 A;  1WOU A;  3GST A;  5EL8 A;  3WGE A;  1GUL A;  5DJM A;  3WT1 A;  2B1K A;  3SBC A;  1TI3 A;  4E8H A;  4HI7 A;  4GDF A;  2GSQ A;  1X5C A;  4IW9 A;  2VL2 C;  2CA8 A;  3KP9 A;  1YEX A;  5E4W A;  2VCX A;  2B3S A;  1R26 A;  3F6D A;  3U6V A;  1BQ7 A;  4XS4 B;  1A0F A;  3GKM A;  4DVC A;  4KDU A;  13GS A;  4Q5F A;  4ZIJ A;  2H66 A;  2YNX A;  2XPD A;  2HZF A;  1ZOF A;  3BCI A;  1PMT A;  4JRR A;  4TVE A;  5ELG A;  6GST A;  2K8V A;  3D6I A;  2K8S A;  1PKW A;  2LRN A;  2WDU A;  1TJD A;  4IJI A;  3HMJ G;  2VCQ A;  4EC0 A;  1Z7P A;  1A2M A;  1GTI A;  3HYP A;  3MIX A;  2X8C A;  3GHA A;  4NMU A;  1EGR A;  1GSU A;  1THX A;  1O85 A;  1Z6N A;  3QFA C;  3MDK A;  4KAE A;  1SJI A;  1A8L A;  1V2A A;  2B5Y A;  2PGT A;  2H01 A;  4O5U A;  3VFI A;  3GH6 A;  2YJH A;  4OFN A;  4OCF A;  1ZYP A;  1WIK A;  5E59 A;  2IFQ B;  1T1V A;  1SEN A;  2GQK A;  3VWW A;  1OAZ A;  4HZ2 A;  4K0G A;  3DWV A;  1ERU A;  1O8W A;  1BF5 A;  4YAP A;  1EV4 A;  4AJ6 A;  3O76 A;  2GZY A;  2LQO A;  4MDC A;  3CSI A;  1PKZ A;  5F07 A;  1ZYE A;  4HS1 A;  3ZYW A;  3KZQ A;  6GSS A;  1OE7 A;  1VGL A;  5BRT A;  4Q5Q A;  4AKG A;  1GUK A;  1W4V A;  3QAV A;  1MTC A;  3TRP A;  1ERT A;  1TRW A;  3DVW A;  2H6Y A;  3RPP A;  5JWR B;  2O85 A;  1VF2 A;  3H79 A;  2X49 A;  1HNA A;  3IE3 A;  2CV4 A;  2HSM A;  1GTU A;  4ECI A;  4BVX B;  2JZS A;  2GDR A;  1PRX A;  1X5D A;  2AB6 A;  2EFC A;  1A8Y A;  1FOV A;  3VK9 A;  2OBK A;  1AIU A;  3LOR A;  4D73 A;  1YY7 A;  3A5W A;  2GTU A;  2YZH A;  5ECK B;  2C0G A;  3IRA A;  1K0B A;  3I6A A;  3EUR A;  5A1N B;  3EMP A;  3N9J A;  2IL3 A;  4GRF A;  5F05 A;  2A4V A;  4OWY A;  2I81 A;  5D9X A;  1S3D A;  2DIZ A;  1AQV A;  4PUF C;  1YEP A;  3C71 A;  2V2G A;  1ERV A;  3RHB A;  3KIJ A;  2O7K A;  1OVN A;  4KE3 A;  4QL9 A;  2DLX A;  4POK A;  4MF5 A;  4ML6 A;  4WR5 A;  2H6X A;  1U6T A;  3ISO A;  2PUK C;  2HZE B;  1JZD A;  1ML6 A;  1GNE A;  1ERW A;  3KTB A;  2DSA A;  2TRX A;  4JR4 A;  1YZX A;  1ON4 A;  4PNF A;  2H76 A;  2NTO A;  1GLQ A;  2UV8 G;  3MSZ A;  3FYG A;  2LEG A;  5GST A;  4HOJ A;  3F6F A;  3ZVJ A;  4ZB8 A;  4F9Z A;  4DSQ A;  1HNB A;  3Q19 A;  2M80 A;  3I69 A;  2D2Z A;  1R7H A;  5ELA A;  2CVD A;  1LJR A;  2QGV A;  1EP8 A;  3IAM 2;  2NDO A;  3TOU A;  5KOW A;  1GTA A;  2O8V B;  4GCI A;  4K2D A;  1FB6 A;  4PQH A;  5CO3 A;  2R2J A;  3GUR A;  5ECI B;  3U5R E;  1B9X C;  2Z9S A;  1T3B A;  4TRX A;  3F4S A;  2P31 A;  3EMX A;  3GN3 A;  5G31 A;  4ECC A;  3P7X A;  2OE3 A;  3GL3 A;  1ZMA A;  3NZN A;  2ZNM A;  4KUN A;  4POL A;  1PGT A;  4KF9 A;  1HD2 A;  2TIR A;  3V1W A;  2RM5 A;  1R5P A;  3IOS A;  4V2N A;  2B5E A;  1TU8 A;  3FHK A;  1XVW A;  4RQX A;  4L5L A;  4XS4 A;  4L5O A;  3D5J A;  1XW5 A;  1GH2 A;  3GX8 A;  3A2W A;  1ZCP A;  1M2B A;  1ST9 A;  4ACS A;  3WGD A;  1FB0 A;  1NSW A;  1XOB A;  3ZMK A;  1XWG A;  1SD9 A;  3APS A;  4EKZ A;  1K0C A;  3FZA A;  4HJM A;  1N2A A;  5GZZ B;  2R5G A;  3GSS A;  4OO4 A;  1B8X A;  2E2G A;  2RII A;  2HT9 A;  1O7U A;  2YV9 A;  2LRT A;  4W66 A;  2DJ1 A;  1G6Y A;  3LGC A;  3D0Z A;  1PQN A;  3G7J A;  4G0I A;  4TR4 A;  2OE1 A;  1H4O A;  5CRE A;  6GSW A;  2LKU A;  4IHU A;  4F2I A;  3M9K A;  3F4T A;  2VM2 A;  2R4V A;  1FOH A;  2FGX A;  3QCP A;  3ERW A;  2HSM B;  1SL2 B;  1S3C A;  3LSZ A;  4RUV A;  2HLS A;  2YWI A;  2DIY A;  3ZTL A;  2HSN A;  4YH2 A;  3VUR A;  2IWT A;  1SU9 A;  3CXG A;  3LYP A;  1PN9 A;  2RLI A;  1Q98 A;  1YKA A;  4EDZ A;  3HJP A;  2WS2 A;  1G6W A;  2C4J A;  2R0C A;  5KOX A;  2EIO A;  2VCV A;  3EWL A;  1ACV A;  5BMU A;  4TKY A;  2C3T A;  2H72 A;  2PMT A;  4JE1 A;  4ZIL A;  3F4R A;  4NV5 A;  1O6J A;  1ZL9 A;  3VPT A;  2JZR A;  2LNS A;  2XBI A;  4D73 B;  4MH3 A;  1F37 A;  5ECH B;  1MD3 A;  1MD4 A;  4GSS A;  3UL3 A;  2B7K A;  5DVB A;  3TRQ A;  14GS A;  2VLV A;  2FCH A;  11GS A;  3FRC A;  4AI6 A;  4WEY A;  3WGX A;  2IMI A;  3BOA A;  4FYU A;  2P5R A;  4Z2R A;  2VM1 A;  1A24 A;  3J7Y k;  1AXD A;  2YOI A;  4BVX A;  2PVO C;  4YKG A;  4IEL A;  1NM3 A;  4USS A;  4MJA A;  3LXZ A;  3IHQ A;  5CRH A;  5DDL A;  2R37 A;  3M3M A;  1K3Y A;  3BBY A;  6GSX A;  2QA1 A;  2YJ7 A;  4BWQ A;  3TKQ A;  3R3E A;  5A4U A;  4X0X A;  3CSJ A;  2E7P A;  2BJX A;  1KEB A;  3CWG A;  2B6M A;  3E0U A;  1JHB A;  1DE2 A;  5A4V A;  1Y6E A;  4X1U A;  1T4Y A;  3L0H A;  2C3Q A;  5AN1 A;  1BJX A;  2R0P A;  1M9A A;  5A1N A;  1SL1 B;  6GSV A;  2EC4 A;  4ECJ A;  1HNC A;  3LWA A;  5IPG A;  2GQM A;  3LXT A;  4TR1 A;  3GFK A;  2YCD A;  3UJ1 A;  1E6B A;  1YQ1 A;  4E68 A;  2ZCT A;  4X4J A;  1IYI A;  5DJL A;  5HR2 A;  3FZ9 A;  5L71 A;  3H8Q A;  4RI6 A;  4K8M A;  5HR1 A;  4ICY A;  4BWS A;  5D96 A;  2HZE A;  2HSY A;  2GT6 A;  2MYG A;  3EYT A;  2A2S A;  2AJQ B;  1K0D A;  1F9M A;  2DBC A;  3L9S A;  3FR9 A;  4F0B A;  1V40 A;  1PX7 A;  3IAS 2;  1F6M C;  2X99 A;  3IHG A;  3APQ A;  1BX9 A;  5ECO B;  1WJK A;  2QSI A;  3I43 A;  8GSS A;  2R0G A;  1K0M A;  1YF0 A;  2DML A;  3GKX A;  2UZ8 A;  1NHO A;  3ERF A;  4OFM A;  1VF3 A;  2LS5 A;  3HJM A;  1O81 A;  1ZYQ B;  3QD9 A;  9GSS A;  5JWO B;  1X9S B;  4NPB A;  3M8N A;  1WPI A;  3EIN A;  3IPZ A;  4OMV A;  2HI7 A;  3KM6 A;  3TJF A;  4MZC A;  3N5O A;  1GSQ A;  4Q5R A;  3RDW A;  2DJK A;  1SYR A;  2H19 A;  4DSS B;  1T4Z A;  1XXU A;  1PD2 1;  3CYN A;  5ECR B;  3GUS A;  3F9U A;  4GQC A;  4CHS A;  1XW9 A;  5AIX A;  5F06 A;  1K0A A;  4XTS A;  1E2Y A;  2YWO A;  3Q74 A;  4ILF A;  4YAV A;  3DIE A;  4K7N A;  4N0V A;  4TN8 A;  3ZIT A;  1DE1 A;  4I2U A;  3US3 A;  2EFD A;  5IOW A;  4PTS A;  20GS A;  3AY8 A;  3ZIJ A;  3LW9 A;  2X8H A;  4KGI A;  1BAY A;  4K5R A;  1Z7R A;  2LQQ A;  1G0T A;  2L57 A;  1XWA A;  4K9Z A;  4K1F A;  4I2T A;  1UA5 A;  5JWQ B;  5HFK A;  5HQP A;  1M7T A;  1QK8 A;  5G1L A;  5AIV A;  2OT3 A;  3ZRD A;  3IC8 A;  1R4W A;  4H86 A;  2QA2 A;  1Q4J A;  4MNN A;  1GSY A;  2L5L A;  4V2M A;  1FHE A;  3SWL A;  3P8W A;  1GUH A;  3TU3 B;  3IR4 A;  2HSN B;  4MPF A;  1C72 A;  4G10 A;  1R5A A;  4EIQ A;  3WT2 A;  1TXU A;  4ZL7 A;  3PIN A;  3S9F A;  1GUM A;  4CY6 A;  5BMU B;  12GS A;  3QDN A;  1Z5Y E;  3LYK A;  5J41 A;  4LA1 A;  2I9H A;  2FHE A;  4WBJ A;  5ECN B;  4TR3 A;  3EC3 A;  2YWM A;  3FMW A;  4ID0 A;  4OCE A;  5JCG A;  4ZB7 A;  4QL7 A;  3PGT A;  4YQV A;  1EP7 A;  5J4Y A;  3DEX A;  4HU9 A;  4MP4 A;  3HVV A;  3P90 A;  3QR6 A;  5A4W A;  3HXS A;  3TB2 A;  2V41 A;  4K7I A;  2JZT A;  4KW6 A;  4WBR D;  5IPH A;  3TJG A;  18GS A;  1T8E B;  5G5E A;  4EDY A;  2AHE A;  1JZW A;  5ECP B;  5B8B A;  1YDK A;  5DCH A;  1X5E A;  10GS A;  1GSF A;  2FA4 A;  4FQU A;  3GX0 A;  2O89 A;  4DSR A;  2B1L A;  1KNG A;  2JAD A;  1ZGN A;  3F8U A;  5D8I A;  2BMX A;  4IN0 A;  3LQ7 A;  3DD3 A;  4LL4 B;  4A5P A;  7GSS A;  4TR1 B;  4TXV A;  5ENU A;  5DAK A;  3UEM A;  4GQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...