2C3TA

Human glutathione-s-transferase t1-1, w234r mutant, apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
239
structure length
239
Chain Sequence
GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPRVLAMIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3tA01
3QD9A 1PL2A 3PGTA 2MBTA 4IJ3A 3F4SA 1VF4A 2FWEA 1TKDB 4IGJA 2RIIA 4GF0A 6GSYA 1FAAA 5IMCA 1B48A 2K6VA 2VL9A 5IMAA 1CQHA 1TU8A 5B7CA 4KUNA 4PUAA 3DMLA 2OKAA 4LL1B 5COHA 4LLRA 4TR1B 3W6GA 2N5AA 1W89A 3ZL5A 3MDKA 1XWBA 1GLQA 1E6BA 3L9SA 3GIXA 5ECQB 3F8UA 5G2ZA 3FYGA 3TUEA 4MF7A 3R2QA 17GSA 2I9HA 2GDRA 2F8AA 1EGRA 4K7IA 5IO0A 5C04A 2HT9A 4NAXA 1X5CA 5F06A 1Z3EA 3QFBC 3LYPA 2MMAA 2WULA 4XCSA 3ZLPA 4WF4A 4ZBAA 2HYXA 3U6VA 3H93A 4MLYA 1XOAA 2DJ0A 3HXSA 3EVIA 2EIRA 2JSZA 3CMIA 3KTBA 5HFGA 2IL3A 1PGTA 1XWGA 1J0FA 5IIZA 4AJ7A 4POBA 3H79A 2UZ8A 2FNOA 1GWCA 1K0MA 5GZZB 1O73A 4O7HA 4IVFA 3F9UA 2F51A 1I9DA 1JLVA 1PSQA 4G0LA 3CSJA 3P7XA 4OO4A 4GCIA 1WOUA 3IE3A 2F8FA 2YZUA 3HZ4A 3I6AA 3L9UA 4FQUA 4MA9A 1SU9A 2YJ7A 5IMZA 1K0CA 1PA3A 1S3CA 1IYIA 1KEBA 4MJBA 3D21A 5AN1A 2PWJA 1GL8A 1CQGA 5KEJA 1BG5A 1BYEA 1XFLA 2IMFA 2GQMA 5EPFA 1YZXA 3ZMKA 3I9V2 4HEA2 4I6XA 2MMOA 1PRXA 2FD3A 3TDGA 3TKSA 1X5EA 1WRYA 2B6MA 1GSYA 4IW9A 4EXJA 4OCEA 2LJAA 2QC7A 2VL2A 2LKUA 2HQTA 1J9BA 5HR3A 2IFQB 3PR8A 1O6JA 2FUG2 3FR3A 1K0BA 4KA0A 4IQ1A 4KAEA 2VCZA 1YEXA 4USSA 2L6CA 2DIYA 1M9BA 1BJXA 1FG4A 3M9KA 2DC5A 3DRNA 3J7Yk 4EVMA 1W4VA 2MMNA 1XW6A 5G1LA 3GL3A 4OFNA 1B4PA 1V57A 3EMXA 5E4WA 3N9JA 6GSUA 2VCWA 2A2RA 4ULXA 3ZFBA 4KH7A 4MMMA 4TKYA 4ML6A 3H1NA 3IXRA 1H4OA 3TKRA 4DSQA 1K3LA 4TR1A 2JZTA 2XBIA 4JU5A 4XHMA 3M1GA 4G0KA 1LU4A 4ZL9A 4GSSA 1EV9A 2P31A 1BEDA 2L4CA 1OVNA 2IMIA 5CRDA 2HRAA 4HZ4A 3IK7A 3DWVA 2C1YA 3IAM2 1TRVA 2B5XA 2YWNA 4CW9A 2CT6A 3TRQA 4I2UA 3OR5A 5FHIA 2FGXA 5DQYA 5ECHB 2JZRA 4PURA 4MJCA 1MEKA 2B5EA 4PNFA 2H70A 10GSA 2N5FA 1ZYQB 5ABRA 4JEDA 1TRSA 3LSZA 2C3QA 1OC3A 2IWTA 1Z7PA 2HSHA 2OE0A 1ML6A 2YJHA 1YDKA 3W8SA 4V1Ap 1SKWB 1F6MC 1S3DA 3F3QA 2ON7A 1G7EA 4HQZA 4MJEA 1GUKA 2LRCA 4OWYA 3C8EA 3F63A 4BL7A 2A4VA 1JLWA 4YQVA 4POKA 4HU9A 5CRHA 2H0GA 2AUVA 2GQKA 1GH2A 3C7MA 2VO4A 4WETA 1DE2A 3ISOA 2DIZA 1X9SB 1M0UA 1WWJA 1U87A 2GTUA 3GKNA 1SL0B 1JFUA 3VPTA 3GKMA 1XW9A 2L57A 2R5GA 2H73A 5CRGA 4XS1A 2FA4A 3ERFA 4MH2A 4F03A 2HRFA 4ZB6A 1XXUA 1VRSD 3VURA 3A2WA 4KE3A 2IFQA 4ML1A 1I5GA 2EIQA 1XZOA 4HUAA 1LBKA 4HJ2A 3KH7A 4OCFA 4WBRD 4DEJA 3LYKA 2ZUPA 1A2JA 1GUMA 1THXA 2PVOC 3H4KA 4KF9A 3GV1A 5HFIA 4I2TA 2CAQA 4K8MA 2LRTA 4TN8A 3Q6OA 2V32A 1XIYA 1A23A 4MZWA 3TB2A 1ERTA 4RI6A 1GLPA 4IS0A 1RW1A 2K18A 2FLSA 5HR2A 1MDKA 1T4ZA 1SENA 1BX9A 3HCZA 3TJFA 4FYCA 4PXOA 5D9XA 1A24A 5H5RA 2FWHA 4KCEA 1O8WA 1UC7A 3TKQA 3LFLA 1ZGNA 3VWXA 5EY6A 2OE1A 2H72A 4XS6A 4ZB9A 4HI7A 3QDNA 3A2XA 1YJ6A 3NIVA 1MD3A 1KTEA 3KGKA 3WGDA 3WGEA 2DJJA 1THOA 1QXHA 2GZZA 2GSRA 1ZMAA 1MDJA 3HJOA 2VIMA 7GSSA 2X64A 2WB9A 4K0GA 4IELA 2DJ3A 1B9XC 4WF5A 3DYRA 1TJDA 1ON4A 4ISDA 2VUPA 5J5NA 3QR6A 2HSMA 2H1DA 3QOUA 2IMEA 5IMFA 3NZNA 4BWSA 4EKZA 2CA8A 1GP1A 8GSSA 2GSQA 1N2AA 3K8NA 3EMPA 3VI7A 2H75A 5F0GA 1PKZA 3L9VA 5GAPD 2C3NA 4FYUA 3GTUB 3APOA 4RUVA 3E0UA 4F82A 1SJ6A 2IIYA 4MABA 3C73A 1B9YC 2YOIA 3UAPA 3GH9A 4GXZA 3EINA 5G5EA 4QQ7A 2O7KA 2CX4A 2JSYA 2PGTA 5J41A 5EL8A 2JZSA 3BCKA 2O89A 1F3AA 3IOSA 3HVSA 2JADA 3VI5A 3SBCA 3LG6A 3IBHA 1AQWA 4ECIA 4NHWA 4ID0A 4IHUA 3E3EA 3FZ4A 2R6KA 3CXGA 1YF1A 3TKPA 2VM2A 1PN9A 3LXZA 1M2DA 2TRXA 2B1KA 4MP4A 1XWCA 1R7HA 4NV5A 1GSQA 3UBLA 1TDIA 4X0XA 5EVOA 4K6XA 2R37A 3A5WA 3GL5A 3WD6A 4TR3A 3APSA 1V98A 2R4VA 2GSTA 3A2VA 6GSWA 4NV2A 3EE2A 2NDOA 2A2SA 3D4MA 6GSTA 4WKWA 4NPBA 4XS4B 1ZZYA 1ERVA 1HNAA 2O87A 1XWKA 5DCHA 6GSVA 5D8IA 4PGTA 3CRTA 5F05A 2CV4A 2YV9A 2OACA 4ECJA 4NXIA 1AXDA 5ECMB 3BBYA 3FRCA 1X5DA 2M46A 5JWOB 1M2BA 2HZEB 3ZVJD 3ZREA 1V40A 4Z7XA 3RHCA 2GSSA 3HY2A 3ZRDA 1GSDA 4MK3A 3ZVJA 4KCAA 3EU3A 3IC4A 2JACA 3M3MA 4DSRA 4TR0A 2DSAA 5A4VA 2E2MA 3UL3A 2K9FA 2H1AA 1O7UA 3KIJA 2I3YA 3LGCA 3ZITA 4Q5RA 4EL1A 4ECCA 3P90A 3JCML 4K7NA 1VF1A 5L71A 1U88A 2LSTA 1QQ2A 3TKSC 2FY6A 5ELGA 5DALB 5DBQA 4FIWA 4HS1A 3VWVA 1YQ1A 2LRNA 2VLVA 3NOFA 5DJLA 2RLIA 3KJYA 2YZHA 4L5OA 3C1SA 4ZILA 1GSUA 1NHOA 3VWWA 3VFIA 3TCOA 4KB3A 1TRUA 1GSSA 2H76A 1H75A 3QFAC 1FB0A 5ECIB 4KDXA 3I43A 1YF0A 2HLSA 2RM5A 4PUFC 3GTUA 1ERUA 2H1GA 3KP8A 4LMWA 4FO5A 2PVQA 2AJQB 19GSA 3G7IA 1K0DA 1R5PA 1SD9A 4WR4A 5B8BA 3L78A 1QMVA 3HZ8A 3KP9A 3KD0A 3WT1A 3FKFA 4OFMA 3TGZA 5DVBA 1JZOA 3D4TA 1A0RP 2AV4A 3V1WA 3BCIA 2VD0A 2LQOA 1ILOA 2C4JA 2ON5A 2PN8A 4ZB8A 2PMTA 3HYPA 1ZCPA 4GQCA 3PPUA 1K0OA 3UIWA 5ID2B 2DLXA 3C71A 2GZPA 2KLXA 5IM9A 3IAS2 1TXXA 3EU4A 3L4NA 5FWGA 1GULA 4F9ZA 1DSBA 2YP6A 3IHQA 5IMVA 1HQOA 4E8EA 4NWYA 2R3XA 5AIVA 1HD2A 2WRTA 1SJZA 4NHZA 1WIKA 4V2MA 4IBPA 1VGLA 5JWQB 1E2YA 1MTCA 1FVJA 2HZEA 1TRWA 2CX3A 3FZAA 1TW9A 1GTAA 1UA5A 4PQHA 3F4TA 3TRXA 4KDUA 4Q5FA 9GSSA 1F9MA 1T00A 2L5OA 3O76A 3O6TA 1PKWA 3GFKA 4OFTA 1Y25A 4MPGA 1FW1A 4TR4A 3U5RE 2V2GA 1EOGA 2B1LA 2HRNA 1X9WB 2YWIA 3DGQA 3QAGA 4L0UA 2OADA 2H6ZA 4OMVA 1TTZA 3GUSA 3GNJA 1RK4A 3LORA 5DALA 3BD2A 2GT5A 5GSTA 1R4WA 1OYJA 4YAPA 3DVXA 5ECRB 1SD8A 2LEGA 4XIHA 4EDYA 4K7OA 5JWRB 5J3RA 5G30A 2M72A 5JCWA 3FEUA 3IPZA 3GRXA 4PNGA 2VAFA 2FA8A 3C1RA 5D9VA 4I8BA 4DSSB 2XHFA 1T3BA 1JZRA 1EGOA 3KZQA 4BVXB 1J08A 3QAVA 3ZTLA 2Z9SA 3ED3A 4F0BA 2CZ3A 1B4QA 3VLNA 2DMMA 1XBSA 1UVZA 1R26A 3HKRA 1TK8B 2FWGA 4YQMA 4X43A 1DBYA 3RDWA 2MBSA 5ECLB 2YN1A 3FHKA 1M2AA 5ID2A 3FK8A 1OAZA 4ILFA 3MWHA 2E7PA 4FH8A 2GQLA 1BAYA 2G0FA 4JR6A 2KP1A 2V1MA 2QGVA 2VLTA 3FY7A 3E9JB 1USBA 1WPIA 2JL4A 2P5RA 2FHEA 1EV4A 4XRDA 4L0WA 2REMA 1DUGA 3UJ1A 2KP2A 2VCQA 4F2IA 1GNWA 1AAZA 1A2LA 3EYTA 4O32A 4TXVA 3KEBA 5KN0A 4RI7A 4N10A 3ME8A 2MMZA 4ACSA 4D73B 3HD5A 4ZBBA 1K0AA 2H1BA 3G9BA 1PX7A 2LS5A 5HR0A 2E0QA 5KN3A 1Y6EA 4N11A 1V58A 1SL1B 4IJIA 1SKSB 5D93A 2VOCA 1SKRB 4WBJA 4AF2A 1YKCA 2NTOA 13GSA 4CDOA 1HNBA 1Z7RA 4JBBA 2H74A 3F4RA 5IO2A 1GRXA 1EP8A 3M9JA 3CYNA 3ERGA 5AGYA 4IQAA 2GGTA 1XVQA 2X8CA 5F07A 5DDLA 1ZOFA 2B7KA 2V6OA 1GTBA 5CO3A 4K2DA 2GT6A 5H5SA 4POMA 4TW5A 3J7Yb 2L4QA 1XPVA 1K3YA 2L5LA 2MZCA 4ECBA 1OC9B 4WR5A 3EURA 1HNCA 4WEYA 2F9SA 3GX8A 3F6DA 3G7JA 1QK8A 4HOJA 4V1Ag 2TIRA 4LMVA 3GMFA 4IP6A 5D73A 2H19A 1A8YA 2X8HA 3WT2A 3MSZA 4V2LA 5ECOB 1O85A 4TVEA 3RHBA 4Q5NA 3KCMA 4DSSA 4N0VA 4G0IA 4H86A 1Q4JA 5B6NA 4X1UA 2OBIA 2CZ2A 3DD3A 3GA4A 1G6YA 3P8WA 2VCTA 1MDIA 5FT3A 2M80A 3GHAA 4BVXA 1A8LA 2O8VB 4O5RA 3TKSE 2WCIA 2GLRA 1YKAA 3VWUA 3ZIJA 20GSA 3ZIVA 3CSHA 2PPTA 5LD0A 4PTSA 2LJKA 1XCCA 5IOWA 14GSA 3FR6A 2N5BA 4HDEA 3S9FA 1XWAA 3QAWA 4V2NA 3F6FA 3GX0A 3QCPA 1TOFA 2OE3A 1WJKA 1XVWA 2HI7A 1V9WA 2LUSA 2KUCA 4YQUA 1JZDA 1SJIA 2H30A 4MDCA 2LJRA 3H8QA 3TJKA 1X9MB 4AJ6A 3EC3A 3KM6A 3ZZXA 2GZYA 5G1KA 2LQQA 2H66A 4HU7A 1FHEA 5IQYA 3D0ZA 4ZBDA 2H01A 1TU7A 2OJLA 2J23A 1XOBA 1EWXA 2LV3A 1T7PB 1AW9A 5CREA 4EO3A 1NHYA 3PH9A 5CYYA 2EC4A 1T8EB 1Z5YE 3UVTA 3HVXA 2HSYA 5IPHA 4ZXGA 1BQ7A 4JRRA 4YH2A 2OBKA 4D73A 5B8AA 1M9AA 1URMA 2YWOA 3F0IA 4GSTA 2NPBA 4ZIJA 1OKTA 3LJRA 3ERWA 1GSEA 12GSA 5J4UA 3FZ9A 4BPYA 3UEMA 5ECNB 1G0TA 2DMLA 2ALBA 1U6TA 2VCVA 1PL1A 1GUHA 5HR1A 4IKHA 3VK9A 4LL4B 2VL2C 1U3AA 4BVYB 5D9TA 4EF0A 2O85A 3TJJA 3UMAA 1OE8A 1NW2A 2E2GA 2XBQA 4ZL8A 3RPPA 1F37A 2AB6A 2WJUA 2H8LA 2C0DA 1T4YA 2VL3A 2YANA 3M8NA 1OC9A 5E59A 4GWRA 3HJMA 5C00A 5CNWA 4MJAA 2HRKB 1R5AA 3L0HA 2AHEA 2YCDA 3GKXA 1AC1A 2R2JA 2DJ2A 3FZ5A 2HXKA 2B5YA 1GNEA 4P3YB 1FO5A 4QL9A 4HJMA 4JZQA 4KSOA 3UBKA 2C80A 3KTLA 1KBNA 3M0FA 5BMUA 4BL7B 1ACVA 2V41A 4KGIA 11GSA 1PX6A 2H6YA 1MD4A 2HSNB 1M7TA 2G2QA 3LQ7A 3TRPA 2WGRA 3DXBA 2IMDA 1DE1A 5CAXA 5IPGA 5AISA 1JZWA 2GVPA 2X8GA 3ZFLA 4JE1A 5J9BA 4RQRA 18GSA 4YAVA 5G5FA 3RAZA 2BMXA 3ME7A 2WZ9A 1FVKA 3D5JA 2JU5A 6GSSA 1O8XA 1M99A 5DJMA 1F3BA 4BA7A 2DJKA 1VF2A 5A4UA 3VPQA 1ZYEA 5INYA 2H71A 1GSFA 1JHBA 6GSXA 3CBUA 4XS4A 1ERWA 1QFNA 3EWLA 3I69A 1G6WA 2WFCA 5JCGA 2CVKA 3UOMA 1ZL9A 2HZFA 1OE7A 3HDCA 2HNLA 3AY8A 3DVWA 3HA9A 2FWFA 5GSSA 4N30A 2YV7A 3US3A 2EIOA 2F3MA 2C0FA 3GSSA 4MH3A 2ZNMA 5HFKA 4L8EA 4AGSA 4G10A 3HHVA 1ABAA 2RUEA 4J56E 3GSTA 1G7OA 5H5QA 2GS3A 3GURA 5B6MA 1X0RA 3HJPA 1PMTA 5ECSA 1HYUA 2ES7A 1TK0B 2YWMA 1TI1A 3CSIA 4GTUA 2CQ9A 4TXOB 2PUKC 2VD1A 3GN3A 2C3TA 4KDYA 4HQSA 2HSMB 4BVYA 5JCUA 1NSWA 3CTGA 2L6DA 4JR4A 3GKKA 4MZBA 5DAKB 4KX4A 3CTFA 4WXTA 2QKEA 4I5QA 4G9HA 4KW6A 1U3IA 4FYBA 4EUYA 1LJRA 4AJ8A 1Q98A 1Z6NA 3IDVA 4K1FA 2NVLA 4QL7A 2IN3A 2XC2A 1K3OA 5HQPA 2HRKA 2C0GA 2P5QA 4EC0A 2VCXA 3D22A 3FR9A 1Z6MA 1SYXA 2LTKA 2BJXA 4GSNA 4LA1A 4KSMA 2V6KA 5ELAA 2FCHA 4MZCA 2C0EA 3IC8A 4PQ1A 3Q19A 2X99A 4E8HA 1SL2B 1XW5A 2B7JA 2CVDA 3F3RA 5KN2A 4J57E 3GYKA 2YNXA 4N0ZA 4XTSA 4EE0A 2D2ZA 1OC8A 2HE3A 1SYRA 4MF5A 3KXOA 1V2AA 4PX1A 3Q18A 1EOHA 22GSA 1NM3A 4L5LA 1AQVA 1K0NA 3SWLA 3IA1A 2XPEA 4Q5QA 4J2FA 4GLTA 5ECKB 2K8VA 3BJ5A 2KOKA 2K8SA 1PD21 3TOUA 4GQFA 2XPDA 1EZKA 5DQSA 1A2MA 2CAIA 2J9HA 5IMDA 2KHPA 3TJBA 3KMOA 2BTOT 3DKSA 2RUFA 2MYGA 2L59A 3WGXA 3ZMLA 5LCZA 1GTUA 3IV4A 3CRUA 1WMJA 1WE0A 2IPAA 4KNDA 5ECPB 1SK1A 5G31A 3QMXA 1IYHA 1AUCA 5A4WA 3UVHA 4TRXA 5CRWA 16GSA 3TOTA 3KMNA 3A3TA 5D96A 4EDZA 1OKDA 2B3SA 3ZYWA 5AIXA 3RBTA 4G19A 3MNGA 4XRAA 5CP1A 3LXTA 2I81A 2AYTA 3FW2A 4BWQA 4DVCA 3APQA 1O81A 4RQXA 1PQNA 2WS2A 2I4AA 4K9ZA 3RPNA 5LNKe 4MCUA 4I97A 1AQXA 4NMUA 2C8UA 5GAND 3BOAA 2NBSA 3W8JA 1QGVA 3O3TA 3R3EA 1B8XA 4TOPA 4F0CA 3PINA 3UARA 4TXOA 3HVVA 2VM1A 3QPMA 2YPMA 4G2EA 1S3AA 3WYWA 2PBJA 2I1UA 1FB6A 5DCGA 2VLUA 2P0GA 1QUWA 5ENUA 2QSIA 2IJYA 5DAKA 3D6IA 4OD7A 4IP1A 1EEMA 1AIUA 1TP9A 3GH6A 4HZ2A 1TI3A 2H0HA 1VF3A 3N5OA 1RQMA 1FOVA 1GTIA 3TJGA 2TRCP 3G7YA 3DEXA 4ZL7A 4PQIA 5D9WA 1UN2A 4POLA 1SK0A 2RM6A 1TK5B 2ZCTA 1T1VA 1Z9HA 4MPFA 4CHSA 5J9CA 2PERA 2PU9C 4MF6A 2H0IA 2H6XA 2HFDA 3IK9A 4GRFA 3LEFA 4O92A 3KH9A 1YY7A 1ST9A 1KNGA 2CVBA 2DBCA 2LNTA 2LNSA 1EEJA 3DIEA 3IR4A 1N8JA 5F8BA 2AAWA 4K0NA 3Q74A 2OA7A 3P2AA 1A0FA 2WDUA 5A5KA 1F2EA 5KN1A 1C72A 3IRAA 3LWAA 2DJ1A 1SK2A 1YEPA 1WP0A 3MAKA 1EP7A 4OO5A 4IN0A 2IMKA 5IOXA
chains in the Genus database with same CATH superfamily
3QD9A 1PL2A 3PGTA 4HSCX 2MBTA 4IJ3A 3F4SA 1VF4A 2FWEA 1TKDB 4IGJA 4N3ZA 2RIIA 4GF0A 3CWGA 6GSYA 1FAAA 5IMCA 1B48A 2K6VA 2VL9A 4YKGA 5IMAA 1CQHA 1TU8A 5B7CA 4KUNA 4PUAA 3DMLA 2OKAA 4LL1B 4YKFA 5COHA 4LLRA 4TR1B 3W6GA 2N5AA 1W89A 3ZL5A 3MDKA 1XWBA 1GLQA 1E6BA 3L9SA 3GIXA 5ECQB 3FMWA 3F8UA 5G2ZA 3FYGA 3TUEA 4MF7A 3R2QA 17GSA 2I9HA 2GDRA 2F8AA 1EGRA 4K7IA 5IO0A 5C04A 2HT9A 4NAXA 1X5CA 5F06A 1Z3EA 3QFBC 3LYPA 2MMAA 2WULA 4XCSA 3ZLPA 4WF4A 4ZBAA 2HYXA 3U6VA 4K5RA 3H93A 4MLYA 1S3RA 1XOAA 2DJ0A 3HXSA 3EVIA 2EIRA 2JSZA 3CMIA 3KTBA 5HFGA 2IL3A 1PGTA 1XWGA 1J0FA 2WW3A 5IIZA 4AJ7A 4POBA 3H79A 2UZ8A 2FNOA 5A5HB 1GWCA 1K0MA 5GZZB 3TU3B 1O73A 4O7HA 4IVFA 3F9UA 2F51A 1I9DA 1JLVA 1PSQA 4G0LA 3CSJA 3P7XA 4OO4A 4GCIA 1WOUA 3IE3A 2EFDA 2F8FA 2YZUA 3HZ4A 3I6AA 3L9UA 4FQUA 4MA9A 1SU9A 2YJ7A 5IMZA 2WZSA 1K0CA 1PA3A 1S3CA 1IYIA 1KEBA 4MJBA 3D21A 5AN1A 2PWJA 1GL8A 1CQGA 5KEJA 1BG5A 1BYEA 1XFLA 2IMFA 2GQMA 5EPFA 1YZXA 3ZMKA 1ZYNA 3I9V2 4HEA2 4I6XA 2MMOA 1PRXA 2FD3A 3TDGA 3TKSA 1X5EA 1YEWC 1WRYA 2B6MA 1GSYA 4IW9A 4EXJA 4OCEA 2LJAA 2QC7A 2VL2A 2WVXA 2LKUA 2HQTA 1J9BA 5HR3A 2IFQB 3PR8A 1O6JA 4K5SA 2FUG2 3FR3A 1K0BA 4KA0A 4IQ1A 4KAEA 2VCZA 1YEXA 3CQFA 4USSA 2L6CA 2DIYA 1M9BA 1BJXA 1FG4A 3M9KA 2DC5A 3DRNA 3J7Yk 4EVMA 1W4VA 2MMNA 1XW6A 4K2XA 5G1LA 3GL3A 4OFNA 1B4PA 1V57A 3EMXA 5E4WA 3N9JA 6GSUA 2VCWA 2A2RA 4ULXA 3ZFBA 4EIQA 4KH7A 4MMMA 4TKYA 4ML6A 3H1NA 3IXRA 1H4OA 2O36A 3RGBC 3TKRA 4DSQA 1K3LA 4TR1A 2JZTA 2XBIA 4JU5A 1Y1UA 4XHMA 3M1GA 4G0KA 1LU4A 4ZL9A 4GSSA 1EV9A 2P31A 1BEDA 2L4CA 1OVNA 2IMIA 5CRDA 2HRAA 4HZ4A 3IK7A 3DWVA 2C1YA 3IAM2 1TRVA 2B5XA 3CHXC 2YWNA 4CW9A 2CT6A 3TRQA 4I2UA 3OR5A 5FHIA 2FGXA 5DQYA 5ECHB 2JZRA 4PURA 4AKXB 4MJCA 1MEKA 2B5EA 5A5HA 4PNFA 2H70A 10GSA 2N5FA 1ZYQB 5ABRA 3MIXA 4JEDA 1TRSA 3LSZA 2C3QA 1OC3A 2IWTA 1Z7PA 2HSHA 2OE0A 1ML6A 2YJHA 1YDKA 3W8SA 4V1Ap 4PHZC 1SKWB 1F6MC 1S3DA 3F3QA 2ON7A 1G7EA 4HQZA 4MJEA 1GUKA 2LRCA 2EFCA 4OWYA 3C8EA 3F63A 4BL7A 2A4VA 1JLWA 4YQVA 4POKA 4HU9A 5CRHA 2H0GA 2AUVA 2GQKA 1GH2A 3C7MA 2VO4A 4WETA 1DE2A 4GDFA 3ISOA 2DIZA 1X9SB 1M0UA 1WWJA 1U87A 2GTUA 3GKNA 1SL0B 1JFUA 3VPTA 3GKMA 4FXYP 1XW9A 2L57A 2R5GA 2H73A 5CRGA 4XS1A 2FA4A 3ERFA 4MH2A 4F03A 4QMKA 2HRFA 4ZB6A 1XXUA 1VRSD 3VURA 3A2WA 4KE3A 2IFQA 4ML1A 1I5GA 2EIQA 1XZOA 4HUAA 1LBKA 4HJ2A 3KH7A 4OCFA 4WBRD 4DEJA 3LYKA 2ZUPA 1A2JA 1GUMA 1THXA 2PVOC 3H4KA 5BRTA 4KF9A 3GV1A 5HFIA 4I2TA 2CAQA 4K8MA 2LRTA 4TN8A 3Q6OA 2V32A 1XIYA 1A23A 4MZWA 3TB2A 1ERTA 4RI6A 1GLPA 4IS0A 1RW1A 2K18A 2FLSA 5HR2A 1MDKA 1T4ZA 1SENA 1BX9A 3HCZA 3TJFA 4FYCA 2WW2A 4PXOA 5D9XA 1A24A 5H5RA 2FWHA 4KCEA 1O8WA 1UC7A 1SVLA 3TKQA 3LFLA 1ZGNA 3VWXA 5EY6A 2OE1A 2H72A 4XS6A 4ZB9A 4HI7A 3QDNA 3A2XA 1YJ6A 3NIVA 1MD3A 1KTEA 3KGKA 2R0PA 3WGDA 3WGEA 2DJJA 1THOA 1QXHA 2GZZA 2GSRA 1ZMAA 1MDJA 3HJOA 2VIMA 7GSSA 2X64A 2WB9A 4K0GA 4IELA 4Z2RA 2DJ3A 1B9XC 4PI2C 4WF5A 3DYRA 1TJDA 1ON4A 4ISDA 2VUPA 5J5NA 3QR6A 2HSMA 2H1DA 3QOUA 2IMEA 5IMFA 3NZNA 4BWSA 4EKZA 2CA8A 1GP1A 8GSSA 2GSQA 1N2AA 3K8NA 3EMPA 3VI7A 2H75A 5F0GA 1PKZA 3L9VA 5GAPD 2C3NA 4FYUA 3GTUB 3APOA 4RUVA 3E0UA 4F82A 1SJ6A 2IIYA 4MABA 3C73A 1B9YC 2YOIA 3UAPA 3GH9A 4GXZA 3EINA 5G5EA 4QQ7A 2O7KA 2CX4A 2JSYA 2PGTA 5J41A 5EL8A 2JZSA 3BCKA 2O89A 1F3AA 3IOSA 3HVSA 2JADA 3VI5A 3SBCA 3LG6A 3IBHA 1AQWA 4ECIA 4NHWA 4ID0A 4IHUA 3E3EA 3FZ4A 2R6KA 3CXGA 1YF1A 3TKPA 2VM2A 1PN9A 3LXZA 1M2DA 2TRXA 2B1KA 4MP4A 1XWCA 1R7HA 4NV5A 1GSQA 3UBLA 1TDIA 4X0XA 5EVOA 4K6XA 2O5VA 2R37A 3A5WA 3GL5A 3WD6A 4TR3A 3APSA 1V98A 3RFRC 2R4VA 2GSTA 3A2VA 6GSWA 4NV2A 3EE2A 2NDOA 2A2SA 3D4MA 6GSTA 4WKWA 4NPBA 4XS4B 4Z2TA 1ZZYA 1ERVA 1HNAA 2O87A 1XWKA 5DCHA 6GSVA 5D8IA 4PGTA 3CRTA 5F05A 2CV4A 2YV9A 2OACA 4ECJA 4NXIA 1AXDA 5ECMB 3BBYA 3FRCA 1X5DA 2M46A 5JWOB 1M2BA 2HZEB 3ZVJD 3ZREA 1V40A 4Z7XA 3RHCA 2GSSA 3HY2A 3ZRDA 1GSDA 4MK3A 3ZVJA 4KCAA 3EU3A 3IC4A 2JACA 3M3MA 4DSRA 4TR0A 2DSAA 5A4VA 2E2MA 3UL3A 2K9FA 2H1AA 1O7UA 3KIJA 2I3YA 3LGCA 3ZITA 4Q5RA 4EL1A 4ECCA 3P90A 3JCML 4K7NA 1VF1A 5L71A 1U88A 2LSTA 1QQ2A 3TKSC 2FY6A 5ELGA 5DALB 5DBQA 4FIWA 4HS1A 3VWVA 1YQ1A 2LRNA 2VLVA 3NOFA 5DJLA 2RLIA 3KJYA 2YZHA 4L5OA 3C1SA 4ZILA 1GSUA 1NHOA 3HVNA 3VWWA 3VFIA 3TCOA 4KB3A 1TRUA 1GSSA 2H76A 1H75A 3QFAC 1FB0A 5ECIB 4KDXA 3I43A 1YF0A 2HLSA 2RM5A 4PUFC 3GTUA 1ERUA 2H1GA 3KP8A 4LMWA 2H1LA 4FO5A 2PVQA 2AJQB 19GSA 3G7IA 1K0DA 1R5PA 1SD9A 4WR4A 5B8BA 3L78A 1QMVA 3HZ8A 3KP9A 3KD0A 3WT1A 3FKFA 4OFMA 3TGZA 5DVBA 1JZOA 3D4TA 1A0RP 2AV4A 3V1WA 3BCIA 2VD0A 2LQOA 1ILOA 2C4JA 2ON5A 2PN8A 4ZB8A 2PMTA 3HYPA 1ZCPA 4GQCA 3PPUA 1K0OA 3UIWA 5ID2B 2DLXA 3C71A 2GZPA 2KLXA 5IM9A 3IAS2 1TXXA 3EU4A 3L4NA 5FWGA 1GULA 1M3IA 4F9ZA 1DSBA 2YP6A 3IHQA 5IMVA 4E68A 1HQOA 4E8EA 4NWYA 2R3XA 5AIVA 1HD2A 2WRTA 1SJZA 4NHZA 1WIKA 4V2MA 4IBPA 1VGLA 5JWQB 1E2YA 1MTCA 1FVJA 2HZEA 1TRWA 2CX3A 5J47A 3FZAA 1SVMA 1TW9A 1GTAA 1UA5A 4PQHA 3F4TA 3TRXA 4KDUA 4Q5FA 9GSSA 1F9MA 1T00A 2L5OA 3O76A 3O6TA 1PKWA 3GFKA 4OFTA 1Y25A 1FOHA 4MPGA 1FW1A 4TR4A 3U5RE 2V2GA 1EOGA 2B1LA 2HRNA 1X9WB 2QA2A 2YWIA 3DGQA 3QAGA 4L0UA 2OADA 2H6ZA 4OMVA 5A1NB 1TTZA 3GUSA 3GNJA 1RK4A 3LORA 5DALA 2QA1A 3BD2A 2GT5A 5GSTA 1R4WA 1OYJA 4YAPA 3DVXA 5ECRB 1SD8A 2LEGA 4XIHA 4EDYA 4K7OA 5JWRB 5J3RA 5G30A 4AI6A 2UV8G 2M72A 5JCWA 3FEUA 3IPZA 3GRXA 4PNGA 2VAFA 2FA8A 3C1RA 5D9VA 4I8BA 4DSSB 2XHFA 1T3BA 1JZRA 1EGOA 3KZQA 4BVXB 1J08A 3QAVA 4X4JA 3ZTLA 2Z9SA 3ED3A 4F0BA 2CZ3A 1B4QA 3VLNA 2DMMA 1XBSA 1UVZA 1R26A 3HKRA 1TK8B 2FWGA 4YQMA 4X43A 1DBYA 3RDWA 2MBSA 5ECLB 2YN1A 3FHKA 1M2AA 5ID2A 3FK8A 1OAZA 4ILFA 3MWHA 2E7PA 4AKGA 4FH8A 2GQLA 1BAYA 2G0FA 4JR6A 2WVYA 2KP1A 2V1MA 2QGVA 2VLTA 3FY7A 5KOWA 3E9JB 1USBA 1WPIA 2JL4A 2P5RA 2FHEA 1EV4A 4XRDA 4L0WA 2REMA 1DUGA 3UJ1A 2KP2A 2VCQA 4F2IA 1GNWA 1AAZA 1A2LA 3A5IA 3EYTA 4O32A 3MYDA 4TXVA 3KEBA 5KN0A 4RI7A 4N10A 3ME8A 2MMZA 4ACSA 4D73B 3HD5A 4ZBBA 1K0AA 2H1BA 3G9BA 1PX7A 3IHGA 2LS5A 5HR0A 2E0QA 5KN3A 1Y6EA 4N11A 1V58A 1SL1B 4IJIA 1SKSB 5D93A 2VOCA 1SKRB 4WBJA 4AF2A 1YKCA 2NTOA 13GSA 4CDOA 1HNBA 1Z7RA 4JBBA 2H74A 3F4RA 5IO2A 1GRXA 1EP8A 3M9JA 3CYNA 3ERGA 5AGYA 4IQAA 2EFHA 2GGTA 1XVQA 5A1NA 2X8CA 5F07A 5DDLA 1ZOFA 1BG1A 2B7KA 2V6OA 1GTBA 5CO3A 4K2DA 2GT6A 5H5SA 4POMA 4ICYA 4TW5A 3J7Yb 2L4QA 1XPVA 1K3YA 2L5LA 2MZCA 4ECBA 1OC9B 2X49A 4WR5A 4EIPA 3EURA 1HNCA 4WEYA 2F9SA 3GX8A 3F6DA 3G7JA 1QK8A 4HOJA 4V1Ag 2TIRA 4LMVA 3GMFA 4IP6A 5D73A 2H19A 1A8YA 2X8HA 3WT2A 3MSZA 4V2LA 5ECOB 1O85A 4TVEA 3RHBA 4Q5NA 3KCMA 2R0CA 4DSSA 4N0VA 4G0IA 4H86A 1Q4JA 5BMUB 5B6NA 4X1UA 2OBIA 2CZ2A 3DD3A 3GA4A 1G6YA 3P8WA 2VCTA 1MDIA 5FT3A 2M80A 3GHAA 4BVXA 1A8LA 2O8VB 4O5RA 3TKSE 2WCIA 2GLRA 1YKAA 3VWUA 3ZIJA 20GSA 5A34B 3ZIVA 3CSHA 1M3JA 2PPTA 5LD0A 4PTSA 2LJKA 1XCCA 5IOWA 14GSA 3FR6A 2N5BA 4HDEA 3S9FA 1XWAA 3QAWA 4V2NA 3F6FA 3GX0A 3QCPA 1TOFA 2OE3A 1WJKA 1YVLA 1XVWA 2HI7A 1V9WA 2LUSA 2KUCA 4YQUA 4ZB7A 1JZDA 1SJIA 2H30A 4MDCA 2LJRA 3H8QA 3TJKA 1X9MB 4AJ6A 3EC3A 3KM6A 3ZZXA 2GZYA 5G1KA 2LQQA 2H66A 4HU7A 1FHEA 1BF5A 5IQYA 3D0ZA 4ZBDA 2H01A 1TU7A 2OJLA 2J23A 1I1IP 1XOBA 1EWXA 2LV3A 1T7PB 1AW9A 5CREA 4EO3A 1NHYA 3PH9A 5CYYA 2EC4A 1T8EB 1Z5YE 3UVTA 3HVXA 2HSYA 5IPHA 4ZXGA 1BQ7A 4JRRA 4YH2A 2OBKA 4D73A 5B8AA 4A5PA 1M9AA 1URMA 2YWOA 3F0IA 4GSTA 2NPBA 4ZIJA 1OKTA 3LJRA 3ERWA 1GSEA 12GSA 3EPTA 5J4UA 3FZ9A 1TXUA 4BPYA 3UEMA 1XG8A 5ECNB 1G0TA 3LW9A 2DMLA 2ALBA 1U6TA 2VCVA 1PL1A 1GUHA 5HR1A 4IKHA 3VK9A 4LL4B 2VL2C 1U3AA 4BVYB 5D9TA 4EF0A 2O85A 3TJJA 3UMAA 1OE8A 1NW2A 2E2GA 2XBQA 4ZL8A 3RPPA 1F37A 2AB6A 2WJUA 2H8LA 2C0DA 1T4YA 2VL3A 2YANA 3M8NA 1OC9A 5E59A 4GWRA 3HJMA 5C00A 5CNWA 4MJAA 2HRKB 1R5AA 3L0HA 2OT3A 2AHEA 2YCDA 3GKXA 1AC1A 2R2JA 2DJ2A 2WVZA 3FZ5A 2HXKA 2B5YA 1GNEA 4P3YB 1FO5A 4QL9A 2A4HA 4HJMA 4JZQA 4W66A 4KSOA 3UBKA 2C80A 3KTLA 1KBNA 3M0FA 5BMUA 4CY6A 5J4YA 4BL7B 1ACVA 2V41A 4KGIA 11GSA 1PX6A 2H6YA 1MD4A 2HSNB 1M7TA 2G2QA 3LQ7A 3TRPA 5A34A 2WGRA 3DXBA 2IMDA 1DE1A 5CAXA 5IPGA 5AISA 1JZWA 2GVPA 2X8GA 3ZFLA 4JE1A 5J9BA 4RQRA 18GSA 4YAVA 5G5FA 3RAZA 2BMXA 3ME7A 2WZ9A 1FVKA 3D5JA 2JU5A 6GSSA 1O8XA 1M99A 5DJMA 4O5UA 3HMJG 1F3BA 4BA7A 2DJKA 1VF2A 5A4UA 3VPQA 1ZYEA 5INYA 2H71A 1GSFA 1JHBA 6GSXA 3CBUA 4XS4A 1ERWA 1QFNA 3EWLA 3I69A 1G6WA 2WFCA 5JCGA 2CVKA 1PFOA 3UOMA 1ZL9A 1S4BP 2HZFA 1OE7A 3HDCA 2HNLA 3AY8A 3DVWA 4AKIA 3HA9A 2FWFA 5GSSA 4N30A 2VKZG 2YV7A 3US3A 2EIOA 2F3MA 2C0FA 3GSSA 4MH3A 2ZNMA 5HFKA 4L8EA 4AGSA 4G10A 3HHVA 1ABAA 2RUEA 4J56E 3GSTA 1G7OA 5H5QA 2GS3A 4O5QA 3GURA 5B6MA 1X0RA 3HJPA 1PMTA 5ECSA 1HYUA 2ES7A 1TK0B 2YWMA 1TI1A 3CSIA 4GTUA 2CQ9A 4TXOB 2PUKC 2VD1A 3GN3A 2C3TA 4KDYA 4HQSA 2HSMB 1SVOA 4BVYA 5JCUA 1NSWA 3CTGA 2L6DA 4JR4A 3GKKA 4MZBA 5DAKB 4KX4A 3CTFA 4WXTA 2QKEA 4I5QA 4G9HA 4G01A 1U3IA 4KW6A 4FYBA 4EUYA 1LJRA 4AJ8A 1Q98A 1Z6NA 3IDVA 4K1FA 2NVLA 4QL7A 2IN3A 2XC2A 1K3OA 5HQPA 2EFEA 1N25A 2HRKA 2C0GA 2P5QA 4EC0A 2VCXA 3D22A 3FR9A 1Z6MA 1SYXA 2LTKA 2BJXA 4GSNA 4LA1A 4KSMA 4PI0C 2V6KA 5ELAA 2FCHA 4MZCA 2C0EA 3IC8A 4PQ1A 3Q19A 2X99A 4E8HA 1SL2B 1XW5A 2B7JA 2CVDA 3F3RA 5KN2A 2HSNA 4J57E 3GYKA 2YNXA 2WW0A 2X4AA 4N0ZA 4XTSA 4EE0A 2D2ZA 1OC8A 2HE3A 1SYRA 4MF5A 3KXOA 1V2AA 4PX1A 3Q18A 4MNNA 1EOHA 22GSA 1NM3A 4L5LA 1AQVA 1K0NA 3SWLA 2R0GA 3IA1A 2XPEA 4Q5QA 4J2FA 4GLTA 5ECKB 2K8VA 3BJ5A 2KOKA 2K8SA 1PD21 3TOUA 2DKIA 4GQFA 2XPDA 1EZKA 5DQSA 5KOXA 1A2MA 2CAIA 2J9HA 2O3EA 5IMDA 2KHPA 3TJBA 3KMOA 2BTOT 3DKSA 2RUFA 2MYGA 2L59A 3WGXA 3ZMLA 5LCZA 1GTUA 3IV4A 3CRUA 1WMJA 1WE0A 2IPAA 4KNDA 5ECPB 1SK1A 5G31A 3QMXA 1IYHA 1AUCA 5A4WA 3UVHA 4AKHA 4TRXA 5CRWA 16GSA 3TOTA 3KMNA 3A3TA 5D96A 4EDZA 1OKDA 2B3SA 3ZYWA 5AIXA 3RBTA 4G19A 3MNGA 4XRAA 5CP1A 3LXTA 2I81A 2AYTA 3FW2A 4BIKA 4BWQA 4DVCA 5J40A 3APQA 1O81A 4RQXA 1PQNA 2WS2A 2I4AA 4K9ZA 3RPNA 5LNKe 4MCUA 4I97A 1AQXA 4NMUA 1ZYPA 2C8UA 5GAND 3BOAA 2NBSA 3W8JA 4CY8A 1QGVA 3O3TA 3R3EA 1B8XA 4TOPA 4F0CA 3PINA 3UARA 4TXOA 3HVVA 2VM1A 3QPMA 2YPMA 4G2EA 1S3AA 3WYWA 2PBJA 2I1UA 1FB6A 5DCGA 2VLUA 2P0GA 1QUWA 5ENUA 2QSIA 2IJYA 5DAKA 3D6IA 4OD7A 4IP1A 1EEMA 1AIUA 1TP9A 3GH6A 4HZ2A 1TI3A 2H0HA 1VF3A 2A2PA 3N5OA 1RQMA 1FOVA 1GTIA 3TJGA 2DKHA 2TRCP 1PN0A 3G7YA 3DEXA 4ZL7A 4PQIA 5D9WA 1UN2A 4POLA 1SK0A 2RM6A 1TK5B 2ZCTA 1T1VA 1Z9HA 4MPFA 4CHSA 5J9CA 4Z2UA 2PERA 2PU9C 4MF6A 2WW1A 2H0IA 2H6XA 2HFDA 3IK9A 4GRFA 3LEFA 4O92A 3KH9A 1YY7A 1ST9A 1KNGA 2CVBA 2DBCA 2WVXB 2LNTA 2LNSA 1EEJA 3DIEA 3IR4A 1N8JA 5F8BA 2AAWA 4K0NA 3Q74A 2OA7A 3P2AA 1A0FA 2WDUA 5J4VA 5A5KA 1F2EA 5KN1A 1C72A 3IRAA 3LWAA 2DJ1A 1SK2A 1YEPA 1WP0A 3MAKA 1EP7A 4OO5A 4IN0A 2IMKA 5IOXA
chains in the Genus database with same CATH topology
3QD9A 1PL2A 3PGTA 2MBTA 4IJ3A 3F4SA 1VF4A 2FWEA 1TKDB 4IGJA 4N3ZA 2RIIA 4GF0A 3CWGA 6GSYA 1FAAA 5IMCA 1B48A 2K6VA 2VL9A 4YKGA 5IMAA 1CQHA 1TU8A 5B7CA 4KUNA 4PUAA 3DMLA 2OKAA 4LL1B 4YKFA 5COHA 4LLRA 4TR1B 3W6GA 2N5AA 1W89A 3ZL5A 3MDKA 1XWBA 1GLQA 1E6BA 3L9SA 3GIXA 5ECQB 3FMWA 3F8UA 5G2ZA 3FYGA 3TUEA 4MF7A 3R2QA 17GSA 2I9HA 2GDRA 2F8AA 1EGRA 4K7IA 5IO0A 5C04A 2HT9A 4NAXA 1X5CA 5F06A 1Z3EA 3QFBC 3LYPA 2MMAA 2WULA 4XCSA 3ZLPA 4WF4A 4ZBAA 2HYXA 3U6VA 4K5RA 3H93A 4MLYA 1XOAA 2DJ0A 3HXSA 3EVIA 2EIRA 2JSZA 3CMIA 3KTBA 5HFGA 2IL3A 1PGTA 1XWGA 1J0FA 5IIZA 4AJ7A 4POBA 3H79A 2UZ8A 2FNOA 5A5HB 1GWCA 1K0MA 5GZZB 3TU3B 1O73A 4O7HA 4IVFA 3F9UA 2F51A 1I9DA 1JLVA 1PSQA 4G0LA 3CSJA 3P7XA 4OO4A 4GCIA 1WOUA 3IE3A 2EFDA 2F8FA 2YZUA 3HZ4A 3I6AA 3L9UA 4FQUA 4MA9A 1SU9A 2YJ7A 5IMZA 1K0CA 1PA3A 1S3CA 1IYIA 1KEBA 4MJBA 3D21A 5AN1A 2PWJA 1GL8A 1CQGA 5KEJA 1BG5A 1BYEA 1XFLA 2IMFA 2GQMA 5EPFA 1YZXA 3ZMKA 1ZYNA 3I9V2 4HEA2 4I6XA 2MMOA 1PRXA 2FD3A 3TDGA 3TKSA 1X5EA 1WRYA 2B6MA 1GSYA 4IW9A 4EXJA 4OCEA 2LJAA 2QC7A 2VL2A 2LKUA 2HQTA 1J9BA 5HR3A 2IFQB 3PR8A 1O6JA 4K5SA 2FUG2 3FR3A 1K0BA 4KA0A 4IQ1A 4KAEA 2VCZA 1YEXA 4USSA 2L6CA 2DIYA 1M9BA 1BJXA 1FG4A 3M9KA 2DC5A 3DRNA 3J7Yk 4EVMA 1W4VA 2MMNA 1XW6A 4K2XA 5G1LA 3GL3A 4OFNA 1B4PA 1V57A 3EMXA 5E4WA 3N9JA 6GSUA 2VCWA 2A2RA 4ULXA 3ZFBA 4EIQA 4KH7A 4MMMA 4TKYA 4ML6A 3H1NA 3IXRA 1H4OA 3TKRA 4DSQA 1K3LA 4TR1A 2JZTA 2XBIA 4JU5A 1Y1UA 4XHMA 3M1GA 4G0KA 1LU4A 4ZL9A 4GSSA 1EV9A 2P31A 1BEDA 2L4CA 1OVNA 2IMIA 5CRDA 2HRAA 4HZ4A 3IK7A 3DWVA 2C1YA 3IAM2 1TRVA 2B5XA 2YWNA 4CW9A 2CT6A 3TRQA 4I2UA 3OR5A 5FHIA 2FGXA 5DQYA 5ECHB 2JZRA 4PURA 4AKXB 4MJCA 1MEKA 2B5EA 5A5HA 4PNFA 2H70A 10GSA 2N5FA 1ZYQB 5ABRA 3MIXA 4JEDA 1TRSA 3LSZA 2C3QA 1OC3A 2IWTA 1Z7PA 2HSHA 2OE0A 1ML6A 2YJHA 1YDKA 3W8SA 4V1Ap 1SKWB 1F6MC 1S3DA 3F3QA 2ON7A 1G7EA 4HQZA 4MJEA 1GUKA 2LRCA 2EFCA 4OWYA 3C8EA 3F63A 4BL7A 2A4VA 1JLWA 4YQVA 4POKA 4HU9A 5CRHA 2H0GA 2AUVA 2GQKA 1GH2A 3C7MA 2VO4A 4WETA 1DE2A 4GDFA 3ISOA 2DIZA 1X9SB 1M0UA 1WWJA 1U87A 2GTUA 3GKNA 1SL0B 1JFUA 3VPTA 3GKMA 1XW9A 2L57A 2R5GA 2H73A 5CRGA 4XS1A 2FA4A 3ERFA 4MH2A 4F03A 4QMKA 2HRFA 4ZB6A 1XXUA 1VRSD 3VURA 3A2WA 4KE3A 2IFQA 4ML1A 1I5GA 2EIQA 1XZOA 4HUAA 1LBKA 4HJ2A 3KH7A 4OCFA 4WBRD 4DEJA 3LYKA 2ZUPA 1A2JA 1GUMA 1THXA 2PVOC 3H4KA 5BRTA 4KF9A 3GV1A 5HFIA 4I2TA 2CAQA 4K8MA 2LRTA 4TN8A 3Q6OA 2V32A 1XIYA 1A23A 4MZWA 3TB2A 1ERTA 4RI6A 1GLPA 4IS0A 1RW1A 2K18A 2FLSA 5HR2A 1MDKA 1T4ZA 1SENA 1BX9A 3HCZA 3TJFA 4FYCA 4PXOA 5D9XA 1A24A 5H5RA 2FWHA 4KCEA 1O8WA 1UC7A 1SVLA 3TKQA 3LFLA 1ZGNA 3VWXA 5EY6A 2OE1A 2H72A 4XS6A 4ZB9A 4HI7A 3QDNA 3A2XA 1YJ6A 3NIVA 1MD3A 1KTEA 3KGKA 2R0PA 3WGDA 3WGEA 2DJJA 1THOA 1QXHA 2GZZA 2GSRA 1ZMAA 1MDJA 3HJOA 2VIMA 7GSSA 2X64A 2WB9A 4K0GA 4IELA 4Z2RA 2DJ3A 1B9XC 4WF5A 3DYRA 1TJDA 1ON4A 4ISDA 2VUPA 5J5NA 3QR6A 2HSMA 2H1DA 3QOUA 2IMEA 5IMFA 3NZNA 4BWSA 4EKZA 2CA8A 1GP1A 8GSSA 2GSQA 1N2AA 3K8NA 3EMPA 3VI7A 2H75A 5F0GA 1PKZA 3L9VA 5GAPD 2C3NA 4FYUA 3GTUB 3APOA 4RUVA 3E0UA 4F82A 1SJ6A 2IIYA 4MABA 3C73A 1B9YC 2YOIA 3UAPA 3GH9A 4GXZA 3EINA 5G5EA 4QQ7A 2O7KA 2CX4A 2JSYA 2PGTA 5J41A 5EL8A 2JZSA 3BCKA 2O89A 1F3AA 3IOSA 3HVSA 2JADA 3VI5A 3SBCA 3LG6A 3IBHA 1AQWA 4ECIA 4NHWA 4ID0A 4IHUA 3E3EA 3FZ4A 2R6KA 3CXGA 1YF1A 3TKPA 2VM2A 1PN9A 3LXZA 1M2DA 2TRXA 2B1KA 4MP4A 1XWCA 1R7HA 4NV5A 1GSQA 3UBLA 1TDIA 4X0XA 5EVOA 4K6XA 2O5VA 2R37A 3A5WA 3GL5A 3WD6A 4TR3A 3APSA 1V98A 2R4VA 2GSTA 3A2VA 6GSWA 4NV2A 3EE2A 2NDOA 2A2SA 3D4MA 6GSTA 4WKWA 4NPBA 4XS4B 4Z2TA 1ZZYA 1ERVA 1HNAA 2O87A 1XWKA 5DCHA 6GSVA 5D8IA 4PGTA 3CRTA 5F05A 2CV4A 2YV9A 2OACA 4ECJA 4NXIA 1AXDA 5ECMB 3BBYA 3FRCA 1X5DA 2M46A 5JWOB 1M2BA 2HZEB 3ZVJD 3ZREA 1V40A 4Z7XA 3RHCA 2GSSA 3HY2A 3ZRDA 1GSDA 4MK3A 3ZVJA 4KCAA 3EU3A 3IC4A 2JACA 3M3MA 4DSRA 4TR0A 2DSAA 5A4VA 2E2MA 3UL3A 2K9FA 2H1AA 1O7UA 3KIJA 2I3YA 3LGCA 3ZITA 4Q5RA 4EL1A 4ECCA 3P90A 3JCML 4K7NA 1VF1A 5L71A 1U88A 2LSTA 1QQ2A 3TKSC 2FY6A 5ELGA 5DALB 5DBQA 4FIWA 4HS1A 3VWVA 1YQ1A 2LRNA 2VLVA 3NOFA 5DJLA 2RLIA 3KJYA 2YZHA 4L5OA 3C1SA 4ZILA 1GSUA 1NHOA 3VWWA 3VFIA 3TCOA 4KB3A 1TRUA 1GSSA 2H76A 1H75A 3QFAC 1FB0A 5ECIB 4KDXA 3I43A 1YF0A 2HLSA 2RM5A 4PUFC 3GTUA 1ERUA 2H1GA 3KP8A 4LMWA 2H1LA 4FO5A 2PVQA 2AJQB 19GSA 3G7IA 1K0DA 1R5PA 1SD9A 4WR4A 5B8BA 3L78A 1QMVA 3HZ8A 3KP9A 3KD0A 3WT1A 3FKFA 4OFMA 3TGZA 5DVBA 1JZOA 3D4TA 1A0RP 2AV4A 3V1WA 3BCIA 2VD0A 2LQOA 1ILOA 2C4JA 2ON5A 2PN8A 4ZB8A 2PMTA 3HYPA 1ZCPA 4GQCA 3PPUA 1K0OA 3UIWA 5ID2B 2DLXA 3C71A 2GZPA 2KLXA 5IM9A 3IAS2 1TXXA 3EU4A 3L4NA 5FWGA 1GULA 4F9ZA 1DSBA 2YP6A 3IHQA 5IMVA 4E68A 1HQOA 4E8EA 4NWYA 2R3XA 5AIVA 1HD2A 2WRTA 1SJZA 4NHZA 1WIKA 4V2MA 4IBPA 1VGLA 5JWQB 1E2YA 1MTCA 1FVJA 2HZEA 1TRWA 2CX3A 5J47A 3FZAA 1SVMA 1TW9A 1GTAA 1UA5A 4PQHA 3F4TA 3TRXA 4KDUA 4Q5FA 9GSSA 1F9MA 1T00A 2L5OA 3O76A 3O6TA 1PKWA 3GFKA 4OFTA 1Y25A 1FOHA 4MPGA 1FW1A 4TR4A 3U5RE 2V2GA 1EOGA 2B1LA 2HRNA 1X9WB 2QA2A 2YWIA 3DGQA 3QAGA 4L0UA 2OADA 2H6ZA 4OMVA 5A1NB 1TTZA 3GUSA 3GNJA 1RK4A 3LORA 5DALA 2QA1A 3BD2A 2GT5A 5GSTA 1R4WA 1OYJA 4YAPA 3DVXA 5ECRB 1SD8A 2LEGA 4XIHA 4EDYA 4K7OA 5JWRB 5J3RA 5G30A 4AI6A 2UV8G 2M72A 5JCWA 3FEUA 3IPZA 3GRXA 4PNGA 2VAFA 2FA8A 3C1RA 5D9VA 4I8BA 4DSSB 2XHFA 1T3BA 1JZRA 1EGOA 3KZQA 4BVXB 1J08A 3QAVA 4X4JA 3ZTLA 2Z9SA 3ED3A 4F0BA 2CZ3A 1B4QA 3VLNA 2DMMA 1XBSA 1UVZA 1R26A 3HKRA 1TK8B 2FWGA 4YQMA 4X43A 1DBYA 3RDWA 2MBSA 5ECLB 2YN1A 3FHKA 1M2AA 5ID2A 3FK8A 1OAZA 4ILFA 3MWHA 2E7PA 4AKGA 4FH8A 2GQLA 1BAYA 2G0FA 4JR6A 2KP1A 2V1MA 2QGVA 2VLTA 3FY7A 5KOWA 3E9JB 1USBA 1WPIA 2JL4A 2P5RA 2FHEA 1EV4A 4XRDA 4L0WA 2REMA 1DUGA 3UJ1A 2KP2A 2VCQA 4F2IA 1GNWA 1AAZA 1A2LA 3A5IA 3EYTA 4O32A 3MYDA 4TXVA 3KEBA 5KN0A 4RI7A 4N10A 3ME8A 2MMZA 4ACSA 4D73B 3HD5A 4ZBBA 1K0AA 2H1BA 3G9BA 1PX7A 3IHGA 2LS5A 5HR0A 2E0QA 5KN3A 1Y6EA 4N11A 1V58A 1SL1B 4IJIA 1SKSB 5D93A 2VOCA 1SKRB 4WBJA 4AF2A 1YKCA 2NTOA 13GSA 4CDOA 1HNBA 1Z7RA 4JBBA 2H74A 3F4RA 5IO2A 1GRXA 1EP8A 3M9JA 3CYNA 3ERGA 5AGYA 4IQAA 2EFHA 2GGTA 1XVQA 5A1NA 2X8CA 5F07A 5DDLA 1ZOFA 1BG1A 2B7KA 2V6OA 1GTBA 5CO3A 4K2DA 2GT6A 5H5SA 4POMA 4ICYA 4TW5A 3J7Yb 2L4QA 1XPVA 1K3YA 2L5LA 2MZCA 4ECBA 1OC9B 2X49A 4WR5A 4EIPA 3EURA 1HNCA 4WEYA 2F9SA 3GX8A 3F6DA 3G7JA 1QK8A 4HOJA 4V1Ag 2TIRA 4LMVA 3GMFA 4IP6A 5D73A 2H19A 1A8YA 2X8HA 3WT2A 3MSZA 4V2LA 5ECOB 1O85A 4TVEA 3RHBA 4Q5NA 3KCMA 2R0CA 4DSSA 4N0VA 4G0IA 4H86A 1Q4JA 5BMUB 5B6NA 4X1UA 2OBIA 2CZ2A 3DD3A 3GA4A 1G6YA 3P8WA 2VCTA 1MDIA 5FT3A 2M80A 3GHAA 4BVXA 1A8LA 2O8VB 4O5RA 3TKSE 2WCIA 2GLRA 1YKAA 3VWUA 3ZIJA 20GSA 5A34B 3ZIVA 3CSHA 2PPTA 5LD0A 4PTSA 2LJKA 1XCCA 5IOWA 14GSA 3FR6A 2N5BA 4HDEA 3S9FA 1XWAA 3QAWA 4V2NA 3F6FA 3GX0A 3QCPA 1TOFA 2OE3A 1WJKA 1YVLA 1XVWA 2HI7A 1V9WA 2LUSA 2KUCA 4YQUA 4ZB7A 1JZDA 1SJIA 2H30A 4MDCA 2LJRA 3H8QA 3TJKA 1X9MB 4AJ6A 3EC3A 3KM6A 3ZZXA 2GZYA 5G1KA 2LQQA 2H66A 4HU7A 1FHEA 1BF5A 5IQYA 3D0ZA 4ZBDA 2H01A 1TU7A 2OJLA 2J23A 1XOBA 1EWXA 2LV3A 1T7PB 1AW9A 5CREA 4EO3A 1NHYA 3PH9A 5CYYA 2EC4A 1T8EB 1Z5YE 3UVTA 3HVXA 2HSYA 5IPHA 4ZXGA 1BQ7A 4JRRA 4YH2A 2OBKA 4D73A 5B8AA 4A5PA 1M9AA 1URMA 2YWOA 3F0IA 4GSTA 2NPBA 4ZIJA 1OKTA 3LJRA 3ERWA 1GSEA 12GSA 3EPTA 5J4UA 3FZ9A 1TXUA 4BPYA 3UEMA 5ECNB 1G0TA 3LW9A 2DMLA 2ALBA 1U6TA 2VCVA 1PL1A 1GUHA 5HR1A 4IKHA 3VK9A 4LL4B 2VL2C 1U3AA 4BVYB 5D9TA 4EF0A 2O85A 3TJJA 3UMAA 1OE8A 1NW2A 2E2GA 2XBQA 4ZL8A 3RPPA 1F37A 2AB6A 2WJUA 2H8LA 2C0DA 1T4YA 2VL3A 2YANA 3M8NA 1OC9A 5E59A 4GWRA 3HJMA 5C00A 5CNWA 4MJAA 2HRKB 1R5AA 3L0HA 2OT3A 2AHEA 2YCDA 3GKXA 1AC1A 2R2JA 2DJ2A 3FZ5A 2HXKA 2B5YA 1GNEA 4P3YB 1FO5A 4QL9A 2A4HA 4HJMA 4JZQA 4W66A 4KSOA 3UBKA 2C80A 3KTLA 1KBNA 3M0FA 5BMUA 4CY6A 5J4YA 4BL7B 1ACVA 2V41A 4KGIA 11GSA 1PX6A 2H6YA 1MD4A 2HSNB 1M7TA 2G2QA 3LQ7A 3TRPA 5A34A 2WGRA 3DXBA 2IMDA 1DE1A 5CAXA 5IPGA 5AISA 1JZWA 2GVPA 2X8GA 3ZFLA 4JE1A 5J9BA 4RQRA 18GSA 4YAVA 5G5FA 3RAZA 2BMXA 3ME7A 2WZ9A 1FVKA 3D5JA 2JU5A 6GSSA 1O8XA 1M99A 5DJMA 4O5UA 3HMJG 1F3BA 4BA7A 2DJKA 1VF2A 5A4UA 3VPQA 1ZYEA 5INYA 2H71A 1GSFA 1JHBA 6GSXA 3CBUA 4XS4A 1ERWA 1QFNA 3EWLA 3I69A 1G6WA 2WFCA 5JCGA 2CVKA 3UOMA 1ZL9A 2HZFA 1OE7A 3HDCA 2HNLA 3AY8A 3DVWA 4AKIA 3HA9A 2FWFA 5GSSA 4N30A 2VKZG 2YV7A 3US3A 2EIOA 2F3MA 2C0FA 3GSSA 4MH3A 2ZNMA 5HFKA 4L8EA 4AGSA 4G10A 3HHVA 1ABAA 2RUEA 4J56E 3GSTA 1G7OA 5H5QA 2GS3A 4O5QA 3GURA 5B6MA 1X0RA 3HJPA 1PMTA 5ECSA 1HYUA 2ES7A 1TK0B 2YWMA 1TI1A 3CSIA 4GTUA 2CQ9A 4TXOB 2PUKC 2VD1A 3GN3A 2C3TA 4KDYA 4HQSA 2HSMB 1SVOA 4BVYA 5JCUA 1NSWA 3CTGA 2L6DA 4JR4A 3GKKA 4MZBA 5DAKB 4KX4A 3CTFA 4WXTA 2QKEA 4I5QA 4G9HA 4G01A 1U3IA 4KW6A 4FYBA 4EUYA 1LJRA 4AJ8A 1Q98A 1Z6NA 3IDVA 4K1FA 2NVLA 4QL7A 2IN3A 2XC2A 1K3OA 5HQPA 2EFEA 1N25A 2HRKA 2C0GA 2P5QA 4EC0A 2VCXA 3D22A 3FR9A 1Z6MA 1SYXA 2LTKA 2BJXA 4GSNA 4LA1A 4KSMA 2V6KA 5ELAA 2FCHA 4MZCA 2C0EA 3IC8A 4PQ1A 3Q19A 2X99A 4E8HA 1SL2B 1XW5A 2B7JA 2CVDA 3F3RA 5KN2A 2HSNA 4J57E 3GYKA 2YNXA 2X4AA 4N0ZA 4XTSA 4EE0A 2D2ZA 1OC8A 2HE3A 1SYRA 4MF5A 3KXOA 1V2AA 4PX1A 3Q18A 4MNNA 1EOHA 22GSA 1NM3A 4L5LA 1AQVA 1K0NA 3SWLA 2R0GA 3IA1A 2XPEA 4Q5QA 4J2FA 4GLTA 5ECKB 2K8VA 3BJ5A 2KOKA 2K8SA 1PD21 3TOUA 2DKIA 4GQFA 2XPDA 1EZKA 5DQSA 5KOXA 1A2MA 2CAIA 2J9HA 5IMDA 2KHPA 3TJBA 3KMOA 2BTOT 3DKSA 2RUFA 2MYGA 2L59A 3WGXA 3ZMLA 5LCZA 1GTUA 3IV4A 3CRUA 1WMJA 1WE0A 2IPAA 4KNDA 5ECPB 1SK1A 5G31A 3QMXA 1IYHA 1AUCA 5A4WA 3UVHA 4AKHA 4TRXA 5CRWA 16GSA 3TOTA 3KMNA 3A3TA 5D96A 4EDZA 1OKDA 2B3SA 3ZYWA 5AIXA 3RBTA 4G19A 3MNGA 4XRAA 5CP1A 3LXTA 2I81A 2AYTA 3FW2A 4BWQA 4DVCA 5J40A 3APQA 1O81A 4RQXA 1PQNA 2WS2A 2I4AA 4K9ZA 3RPNA 5LNKe 4MCUA 4I97A 1AQXA 4NMUA 1ZYPA 2C8UA 5GAND 3BOAA 2NBSA 3W8JA 4CY8A 1QGVA 3O3TA 3R3EA 1B8XA 4TOPA 4F0CA 3PINA 3UARA 4TXOA 3HVVA 2VM1A 3QPMA 2YPMA 4G2EA 1S3AA 3WYWA 2PBJA 2I1UA 1FB6A 5DCGA 2VLUA 2P0GA 1QUWA 5ENUA 2QSIA 2IJYA 5DAKA 3D6IA 4OD7A 4IP1A 1EEMA 1AIUA 1TP9A 3GH6A 4HZ2A 1TI3A 2H0HA 1VF3A 2A2PA 3N5OA 1RQMA 1FOVA 1GTIA 3TJGA 2DKHA 2TRCP 1PN0A 3G7YA 3DEXA 4ZL7A 4PQIA 5D9WA 1UN2A 4POLA 1SK0A 2RM6A 1TK5B 2ZCTA 1T1VA 1Z9HA 4MPFA 4CHSA 5J9CA 4Z2UA 2PERA 2PU9C 4MF6A 2H0IA 2H6XA 2HFDA 3IK9A 4GRFA 3LEFA 4O92A 3KH9A 1YY7A 1ST9A 1KNGA 2CVBA 2DBCA 2LNTA 2LNSA 1EEJA 3DIEA 3IR4A 1N8JA 5F8BA 2AAWA 4K0NA 3Q74A 2OA7A 3P2AA 1A0FA 2WDUA 5J4VA 5A5KA 1F2EA 5KN1A 1C72A 3IRAA 3LWAA 2DJ1A 1SK2A 1YEPA 1WP0A 3MAKA 1EP7A 4OO5A 4IN0A 2IMKA 5IOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QD9 A;  1PL2 A;  3PGT A;  2MBT A;  4IJ3 A;  3F4S A;  1VF4 A;  2FWE A;  1TKD B;  4IGJ A;  2RII A;  4GF0 A;  6GSY A;  1FAA A;  5IMC A;  1B48 A;  2K6V A;  2VL9 A;  5IMA A;  1CQH A;  1TU8 A;  5B7C A;  4KUN A;  4PUA A;  3DML A;  2OKA A;  4LL1 B;  5COH A;  4LLR A;  4TR1 B;  3W6G A;  2N5A A;  1W89 A;  3ZL5 A;  3MDK A;  1XWB A;  1GLQ A;  1E6B A;  3L9S A;  3GIX A;  5ECQ B;  3F8U A;  5G2Z A;  3FYG A;  3TUE A;  4MF7 A;  3R2Q A;  17GS A;  2I9H A;  2GDR A;  2F8A A;  1EGR A;  4K7I A;  5IO0 A;  5C04 A;  2HT9 A;  4NAX A;  1X5C A;  5F06 A;  1Z3E A;  3QFB C;  3LYP A;  2MMA A;  2WUL A;  4XCS A;  3ZLP A;  4WF4 A;  4ZBA A;  2HYX A;  3U6V A;  3H93 A;  4MLY A;  1XOA A;  2DJ0 A;  3HXS A;  3EVI A;  2EIR A;  2JSZ A;  3CMI A;  3KTB A;  5HFG A;  2IL3 A;  1PGT A;  1XWG A;  1J0F A;  5IIZ A;  4AJ7 A;  4POB A;  3H79 A;  2UZ8 A;  2FNO A;  1GWC A;  1K0M A;  5GZZ B;  1O73 A;  4O7H A;  4IVF A;  3F9U A;  2F51 A;  1I9D A;  1JLV A;  1PSQ A;  4G0L A;  3CSJ A;  3P7X A;  4OO4 A;  4GCI A;  1WOU A;  3IE3 A;  2F8F A;  2YZU A;  3HZ4 A;  3I6A A;  3L9U A;  4FQU A;  4MA9 A;  1SU9 A;  2YJ7 A;  5IMZ A;  1K0C A;  1PA3 A;  1S3C A;  1IYI A;  1KEB A;  4MJB A;  3D21 A;  5AN1 A;  2PWJ A;  1GL8 A;  1CQG A;  5KEJ A;  1BG5 A;  1BYE A;  1XFL A;  2IMF A;  2GQM A;  5EPF A;  1YZX A;  3ZMK A;  3I9V 2;  4HEA 2;  4I6X A;  2MMO A;  1PRX A;  2FD3 A;  3TDG A;  3TKS A;  1X5E A;  1WRY A;  2B6M A;  1GSY A;  4IW9 A;  4EXJ A;  4OCE A;  2LJA A;  2QC7 A;  2VL2 A;  2LKU A;  2HQT A;  1J9B A;  5HR3 A;  2IFQ B;  3PR8 A;  1O6J A;  2FUG 2;  3FR3 A;  1K0B A;  4KA0 A;  4IQ1 A;  4KAE A;  2VCZ A;  1YEX A;  4USS A;  2L6C A;  2DIY A;  1M9B A;  1BJX A;  1FG4 A;  3M9K A;  2DC5 A;  3DRN A;  3J7Y k;  4EVM A;  1W4V A;  2MMN A;  1XW6 A;  5G1L A;  3GL3 A;  4OFN A;  1B4P A;  1V57 A;  3EMX A;  5E4W A;  3N9J A;  6GSU A;  2VCW A;  2A2R A;  4ULX A;  3ZFB A;  4KH7 A;  4MMM A;  4TKY A;  4ML6 A;  3H1N A;  3IXR A;  1H4O A;  3TKR A;  4DSQ A;  1K3L A;  4TR1 A;  2JZT A;  2XBI A;  4JU5 A;  4XHM A;  3M1G A;  4G0K A;  1LU4 A;  4ZL9 A;  4GSS A;  1EV9 A;  2P31 A;  1BED A;  2L4C A;  1OVN A;  2IMI A;  5CRD A;  2HRA A;  4HZ4 A;  3IK7 A;  3DWV A;  2C1Y A;  3IAM 2;  1TRV A;  2B5X A;  2YWN A;  4CW9 A;  2CT6 A;  3TRQ A;  4I2U A;  3OR5 A;  5FHI A;  2FGX A;  5DQY A;  5ECH B;  2JZR A;  4PUR A;  4MJC A;  1MEK A;  2B5E A;  4PNF A;  2H70 A;  10GS A;  2N5F A;  1ZYQ B;  5ABR A;  4JED A;  1TRS A;  3LSZ A;  2C3Q A;  1OC3 A;  2IWT A;  1Z7P A;  2HSH A;  2OE0 A;  1ML6 A;  2YJH A;  1YDK A;  3W8S A;  4V1A p;  1SKW B;  1F6M C;  1S3D A;  3F3Q A;  2ON7 A;  1G7E A;  4HQZ A;  4MJE A;  1GUK A;  2LRC A;  4OWY A;  3C8E A;  3F63 A;  4BL7 A;  2A4V A;  1JLW A;  4YQV A;  4POK A;  4HU9 A;  5CRH A;  2H0G A;  2AUV A;  2GQK A;  1GH2 A;  3C7M A;  2VO4 A;  4WET A;  1DE2 A;  3ISO A;  2DIZ A;  1X9S B;  1M0U A;  1WWJ A;  1U87 A;  2GTU A;  3GKN A;  1SL0 B;  1JFU A;  3VPT A;  3GKM A;  1XW9 A;  2L57 A;  2R5G A;  2H73 A;  5CRG A;  4XS1 A;  2FA4 A;  3ERF A;  4MH2 A;  4F03 A;  2HRF A;  4ZB6 A;  1XXU A;  1VRS D;  3VUR A;  3A2W A;  4KE3 A;  2IFQ A;  4ML1 A;  1I5G A;  2EIQ A;  1XZO A;  4HUA A;  1LBK A;  4HJ2 A;  3KH7 A;  4OCF A;  4WBR D;  4DEJ A;  3LYK A;  2ZUP A;  1A2J A;  1GUM A;  1THX A;  2PVO C;  3H4K A;  4KF9 A;  3GV1 A;  5HFI A;  4I2T A;  2CAQ A;  4K8M A;  2LRT A;  4TN8 A;  3Q6O A;  2V32 A;  1XIY A;  1A23 A;  4MZW A;  3TB2 A;  1ERT A;  4RI6 A;  1GLP A;  4IS0 A;  1RW1 A;  2K18 A;  2FLS A;  5HR2 A;  1MDK A;  1T4Z A;  1SEN A;  1BX9 A;  3HCZ A;  3TJF A;  4FYC A;  4PXO A;  5D9X A;  1A24 A;  5H5R A;  2FWH A;  4KCE A;  1O8W A;  1UC7 A;  3TKQ A;  3LFL A;  1ZGN A;  3VWX A;  5EY6 A;  2OE1 A;  2H72 A;  4XS6 A;  4ZB9 A;  4HI7 A;  3QDN A;  3A2X A;  1YJ6 A;  3NIV A;  1MD3 A;  1KTE A;  3KGK A;  3WGD A;  3WGE A;  2DJJ A;  1THO A;  1QXH A;  2GZZ A;  2GSR A;  1ZMA A;  1MDJ A;  3HJO A;  2VIM A;  7GSS A;  2X64 A;  2WB9 A;  4K0G A;  4IEL A;  2DJ3 A;  1B9X C;  4WF5 A;  3DYR A;  1TJD A;  1ON4 A;  4ISD A;  2VUP A;  5J5N A;  3QR6 A;  2HSM A;  2H1D A;  3QOU A;  2IME A;  5IMF A;  3NZN A;  4BWS A;  4EKZ A;  2CA8 A;  1GP1 A;  8GSS A;  2GSQ A;  1N2A A;  3K8N A;  3EMP A;  3VI7 A;  2H75 A;  5F0G A;  1PKZ A;  3L9V A;  5GAP D;  2C3N A;  4FYU A;  3GTU B;  3APO A;  4RUV A;  3E0U A;  4F82 A;  1SJ6 A;  2IIY A;  4MAB A;  3C73 A;  1B9Y C;  2YOI A;  3UAP A;  3GH9 A;  4GXZ A;  3EIN A;  5G5E A;  4QQ7 A;  2O7K A;  2CX4 A;  2JSY A;  2PGT A;  5J41 A;  5EL8 A;  2JZS A;  3BCK A;  2O89 A;  1F3A A;  3IOS A;  3HVS A;  2JAD A;  3VI5 A;  3SBC A;  3LG6 A;  3IBH A;  1AQW A;  4ECI A;  4NHW A;  4ID0 A;  4IHU A;  3E3E A;  3FZ4 A;  2R6K A;  3CXG A;  1YF1 A;  3TKP A;  2VM2 A;  1PN9 A;  3LXZ A;  1M2D A;  2TRX A;  2B1K A;  4MP4 A;  1XWC A;  1R7H A;  4NV5 A;  1GSQ A;  3UBL A;  1TDI A;  4X0X A;  5EVO A;  4K6X A;  2R37 A;  3A5W A;  3GL5 A;  3WD6 A;  4TR3 A;  3APS A;  1V98 A;  2R4V A;  2GST A;  3A2V A;  6GSW A;  4NV2 A;  3EE2 A;  2NDO A;  2A2S A;  3D4M A;  6GST A;  4WKW A;  4NPB A;  4XS4 B;  1ZZY A;  1ERV A;  1HNA A;  2O87 A;  1XWK A;  5DCH A;  6GSV A;  5D8I A;  4PGT A;  3CRT A;  5F05 A;  2CV4 A;  2YV9 A;  2OAC A;  4ECJ A;  4NXI A;  1AXD A;  5ECM B;  3BBY A;  3FRC A;  1X5D A;  2M46 A;  5JWO B;  1M2B A;  2HZE B;  3ZVJ D;  3ZRE A;  1V40 A;  4Z7X A;  3RHC A;  2GSS A;  3HY2 A;  3ZRD A;  1GSD A;  4MK3 A;  3ZVJ A;  4KCA A;  3EU3 A;  3IC4 A;  2JAC A;  3M3M A;  4DSR A;  4TR0 A;  2DSA A;  5A4V A;  2E2M A;  3UL3 A;  2K9F A;  2H1A A;  1O7U A;  3KIJ A;  2I3Y A;  3LGC A;  3ZIT A;  4Q5R A;  4EL1 A;  4ECC A;  3P90 A;  3JCM L;  4K7N A;  1VF1 A;  5L71 A;  1U88 A;  2LST A;  1QQ2 A;  3TKS C;  2FY6 A;  5ELG A;  5DAL B;  5DBQ A;  4FIW A;  4HS1 A;  3VWV A;  1YQ1 A;  2LRN A;  2VLV A;  3NOF A;  5DJL A;  2RLI A;  3KJY A;  2YZH A;  4L5O A;  3C1S A;  4ZIL A;  1GSU A;  1NHO A;  3VWW A;  3VFI A;  3TCO A;  4KB3 A;  1TRU A;  1GSS A;  2H76 A;  1H75 A;  3QFA C;  1FB0 A;  5ECI B;  4KDX A;  3I43 A;  1YF0 A;  2HLS A;  2RM5 A;  4PUF C;  3GTU A;  1ERU A;  2H1G A;  3KP8 A;  4LMW A;  4FO5 A;  2PVQ A;  2AJQ B;  19GS A;  3G7I A;  1K0D A;  1R5P A;  1SD9 A;  4WR4 A;  5B8B A;  3L78 A;  1QMV A;  3HZ8 A;  3KP9 A;  3KD0 A;  3WT1 A;  3FKF A;  4OFM A;  3TGZ A;  5DVB A;  1JZO A;  3D4T A;  1A0R P;  2AV4 A;  3V1W A;  3BCI A;  2VD0 A;  2LQO A;  1ILO A;  2C4J A;  2ON5 A;  2PN8 A;  4ZB8 A;  2PMT A;  3HYP A;  1ZCP A;  4GQC A;  3PPU A;  1K0O A;  3UIW A;  5ID2 B;  2DLX A;  3C71 A;  2GZP A;  2KLX A;  5IM9 A;  3IAS 2;  1TXX A;  3EU4 A;  3L4N A;  5FWG A;  1GUL A;  4F9Z A;  1DSB A;  2YP6 A;  3IHQ A;  5IMV A;  1HQO A;  4E8E A;  4NWY A;  2R3X A;  5AIV A;  1HD2 A;  2WRT A;  1SJZ A;  4NHZ A;  1WIK A;  4V2M A;  4IBP A;  1VGL A;  5JWQ B;  1E2Y A;  1MTC A;  1FVJ A;  2HZE A;  1TRW A;  2CX3 A;  3FZA A;  1TW9 A;  1GTA A;  1UA5 A;  4PQH A;  3F4T A;  3TRX A;  4KDU A;  4Q5F A;  9GSS A;  1F9M A;  1T00 A;  2L5O A;  3O76 A;  3O6T A;  1PKW A;  3GFK A;  4OFT A;  1Y25 A;  4MPG A;  1FW1 A;  4TR4 A;  3U5R E;  2V2G A;  1EOG A;  2B1L A;  2HRN A;  1X9W B;  2YWI A;  3DGQ A;  3QAG A;  4L0U A;  2OAD A;  2H6Z A;  4OMV A;  1TTZ A;  3GUS A;  3GNJ A;  1RK4 A;  3LOR A;  5DAL A;  3BD2 A;  2GT5 A;  5GST A;  1R4W A;  1OYJ A;  4YAP A;  3DVX A;  5ECR B;  1SD8 A;  2LEG A;  4XIH A;  4EDY A;  4K7O A;  5JWR B;  5J3R A;  5G30 A;  2M72 A;  5JCW A;  3FEU A;  3IPZ A;  3GRX A;  4PNG A;  2VAF A;  2FA8 A;  3C1R A;  5D9V A;  4I8B A;  4DSS B;  2XHF A;  1T3B A;  1JZR A;  1EGO A;  3KZQ A;  4BVX B;  1J08 A;  3QAV A;  3ZTL A;  2Z9S A;  3ED3 A;  4F0B A;  2CZ3 A;  1B4Q A;  3VLN A;  2DMM A;  1XBS A;  1UVZ A;  1R26 A;  3HKR A;  1TK8 B;  2FWG A;  4YQM A;  4X43 A;  1DBY A;  3RDW A;  2MBS A;  5ECL B;  2YN1 A;  3FHK A;  1M2A A;  5ID2 A;  3FK8 A;  1OAZ A;  4ILF A;  3MWH A;  2E7P A;  4FH8 A;  2GQL A;  1BAY A;  2G0F A;  4JR6 A;  2KP1 A;  2V1M A;  2QGV A;  2VLT A;  3FY7 A;  3E9J B;  1USB A;  1WPI A;  2JL4 A;  2P5R A;  2FHE A;  1EV4 A;  4XRD A;  4L0W A;  2REM A;  1DUG A;  3UJ1 A;  2KP2 A;  2VCQ A;  4F2I A;  1GNW A;  1AAZ A;  1A2L A;  3EYT A;  4O32 A;  4TXV A;  3KEB A;  5KN0 A;  4RI7 A;  4N10 A;  3ME8 A;  2MMZ A;  4ACS A;  4D73 B;  3HD5 A;  4ZBB A;  1K0A A;  2H1B A;  3G9B A;  1PX7 A;  2LS5 A;  5HR0 A;  2E0Q A;  5KN3 A;  1Y6E A;  4N11 A;  1V58 A;  1SL1 B;  4IJI A;  1SKS B;  5D93 A;  2VOC A;  1SKR B;  4WBJ A;  4AF2 A;  1YKC A;  2NTO A;  13GS A;  4CDO A;  1HNB A;  1Z7R A;  4JBB A;  2H74 A;  3F4R A;  5IO2 A;  1GRX A;  1EP8 A;  3M9J A;  3CYN A;  3ERG A;  5AGY A;  4IQA A;  2GGT A;  1XVQ A;  2X8C A;  5F07 A;  5DDL A;  1ZOF A;  2B7K A;  2V6O A;  1GTB A;  5CO3 A;  4K2D A;  2GT6 A;  5H5S A;  4POM A;  4TW5 A;  3J7Y b;  2L4Q A;  1XPV A;  1K3Y A;  2L5L A;  2MZC A;  4ECB A;  1OC9 B;  4WR5 A;  3EUR A;  1HNC A;  4WEY A;  2F9S A;  3GX8 A;  3F6D A;  3G7J A;  1QK8 A;  4HOJ A;  4V1A g;  2TIR A;  4LMV A;  3GMF A;  4IP6 A;  5D73 A;  2H19 A;  1A8Y A;  2X8H A;  3WT2 A;  3MSZ A;  4V2L A;  5ECO B;  1O85 A;  4TVE A;  3RHB A;  4Q5N A;  3KCM A;  4DSS A;  4N0V A;  4G0I A;  4H86 A;  1Q4J A;  5B6N A;  4X1U A;  2OBI A;  2CZ2 A;  3DD3 A;  3GA4 A;  1G6Y A;  3P8W A;  2VCT A;  1MDI A;  5FT3 A;  2M80 A;  3GHA A;  4BVX A;  1A8L A;  2O8V B;  4O5R A;  3TKS E;  2WCI A;  2GLR A;  1YKA A;  3VWU A;  3ZIJ A;  20GS A;  3ZIV A;  3CSH A;  2PPT A;  5LD0 A;  4PTS A;  2LJK A;  1XCC A;  5IOW A;  14GS A;  3FR6 A;  2N5B A;  4HDE A;  3S9F A;  1XWA A;  3QAW A;  4V2N A;  3F6F A;  3GX0 A;  3QCP A;  1TOF A;  2OE3 A;  1WJK A;  1XVW A;  2HI7 A;  1V9W A;  2LUS A;  2KUC A;  4YQU A;  1JZD A;  1SJI A;  2H30 A;  4MDC A;  2LJR A;  3H8Q A;  3TJK A;  1X9M B;  4AJ6 A;  3EC3 A;  3KM6 A;  3ZZX A;  2GZY A;  5G1K A;  2LQQ A;  2H66 A;  4HU7 A;  1FHE A;  5IQY A;  3D0Z A;  4ZBD A;  2H01 A;  1TU7 A;  2OJL A;  2J23 A;  1XOB A;  1EWX A;  2LV3 A;  1T7P B;  1AW9 A;  5CRE A;  4EO3 A;  1NHY A;  3PH9 A;  5CYY A;  2EC4 A;  1T8E B;  1Z5Y E;  3UVT A;  3HVX A;  2HSY A;  5IPH A;  4ZXG A;  1BQ7 A;  4JRR A;  4YH2 A;  2OBK A;  4D73 A;  5B8A A;  1M9A A;  1URM A;  2YWO A;  3F0I A;  4GST A;  2NPB A;  4ZIJ A;  1OKT A;  3LJR A;  3ERW A;  1GSE A;  12GS A;  5J4U A;  3FZ9 A;  4BPY A;  3UEM A;  5ECN B;  1G0T A;  2DML A;  2ALB A;  1U6T A;  2VCV A;  1PL1 A;  1GUH A;  5HR1 A;  4IKH A;  3VK9 A;  4LL4 B;  2VL2 C;  1U3A A;  4BVY B;  5D9T A;  4EF0 A;  2O85 A;  3TJJ A;  3UMA A;  1OE8 A;  1NW2 A;  2E2G A;  2XBQ A;  4ZL8 A;  3RPP A;  1F37 A;  2AB6 A;  2WJU A;  2H8L A;  2C0D A;  1T4Y A;  2VL3 A;  2YAN A;  3M8N A;  1OC9 A;  5E59 A;  4GWR A;  3HJM A;  5C00 A;  5CNW A;  4MJA A;  2HRK B;  1R5A A;  3L0H A;  2AHE A;  2YCD A;  3GKX A;  1AC1 A;  2R2J A;  2DJ2 A;  3FZ5 A;  2HXK A;  2B5Y A;  1GNE A;  4P3Y B;  1FO5 A;  4QL9 A;  4HJM A;  4JZQ A;  4KSO A;  3UBK A;  2C80 A;  3KTL A;  1KBN A;  3M0F A;  5BMU A;  4BL7 B;  1ACV A;  2V41 A;  4KGI A;  11GS A;  1PX6 A;  2H6Y A;  1MD4 A;  2HSN B;  1M7T A;  2G2Q A;  3LQ7 A;  3TRP A;  2WGR A;  3DXB A;  2IMD A;  1DE1 A;  5CAX A;  5IPG A;  5AIS A;  1JZW A;  2GVP A;  2X8G A;  3ZFL A;  4JE1 A;  5J9B A;  4RQR A;  18GS A;  4YAV A;  5G5F A;  3RAZ A;  2BMX A;  3ME7 A;  2WZ9 A;  1FVK A;  3D5J A;  2JU5 A;  6GSS A;  1O8X A;  1M99 A;  5DJM A;  1F3B A;  4BA7 A;  2DJK A;  1VF2 A;  5A4U A;  3VPQ A;  1ZYE A;  5INY A;  2H71 A;  1GSF A;  1JHB A;  6GSX A;  3CBU A;  4XS4 A;  1ERW A;  1QFN A;  3EWL A;  3I69 A;  1G6W A;  2WFC A;  5JCG A;  2CVK A;  3UOM A;  1ZL9 A;  2HZF A;  1OE7 A;  3HDC A;  2HNL A;  3AY8 A;  3DVW A;  3HA9 A;  2FWF A;  5GSS A;  4N30 A;  2YV7 A;  3US3 A;  2EIO A;  2F3M A;  2C0F A;  3GSS A;  4MH3 A;  2ZNM A;  5HFK A;  4L8E A;  4AGS A;  4G10 A;  3HHV A;  1ABA A;  2RUE A;  4J56 E;  3GST A;  1G7O A;  5H5Q A;  2GS3 A;  3GUR A;  5B6M A;  1X0R A;  3HJP A;  1PMT A;  5ECS A;  1HYU A;  2ES7 A;  1TK0 B;  2YWM A;  1TI1 A;  3CSI A;  4GTU A;  2CQ9 A;  4TXO B;  2PUK C;  2VD1 A;  3GN3 A;  2C3T A;  4KDY A;  4HQS A;  2HSM B;  4BVY A;  5JCU A;  1NSW A;  3CTG A;  2L6D A;  4JR4 A;  3GKK A;  4MZB A;  5DAK B;  4KX4 A;  3CTF A;  4WXT A;  2QKE A;  4I5Q A;  4G9H A;  4KW6 A;  1U3I A;  4FYB A;  4EUY A;  1LJR A;  4AJ8 A;  1Q98 A;  1Z6N A;  3IDV A;  4K1F A;  2NVL A;  4QL7 A;  2IN3 A;  2XC2 A;  1K3O A;  5HQP A;  2HRK A;  2C0G A;  2P5Q A;  4EC0 A;  2VCX A;  3D22 A;  3FR9 A;  1Z6M A;  1SYX A;  2LTK A;  2BJX A;  4GSN A;  4LA1 A;  4KSM A;  2V6K A;  5ELA A;  2FCH A;  4MZC A;  2C0E A;  3IC8 A;  4PQ1 A;  3Q19 A;  2X99 A;  4E8H A;  1SL2 B;  1XW5 A;  2B7J A;  2CVD A;  3F3R A;  5KN2 A;  4J57 E;  3GYK A;  2YNX A;  4N0Z A;  4XTS A;  4EE0 A;  2D2Z A;  1OC8 A;  2HE3 A;  1SYR A;  4MF5 A;  3KXO A;  1V2A A;  4PX1 A;  3Q18 A;  1EOH A;  22GS A;  1NM3 A;  4L5L A;  1AQV A;  1K0N A;  3SWL A;  3IA1 A;  2XPE A;  4Q5Q A;  4J2F A;  4GLT A;  5ECK B;  2K8V A;  3BJ5 A;  2KOK A;  2K8S A;  1PD2 1;  3TOU A;  4GQF A;  2XPD A;  1EZK A;  5DQS A;  1A2M A;  2CAI A;  2J9H A;  5IMD A;  2KHP A;  3TJB A;  3KMO A;  2BTO T;  3DKS A;  2RUF A;  2MYG A;  2L59 A;  3WGX A;  3ZML A;  5LCZ A;  1GTU A;  3IV4 A;  3CRU A;  1WMJ A;  1WE0 A;  2IPA A;  4KND A;  5ECP B;  1SK1 A;  5G31 A;  3QMX A;  1IYH A;  1AUC A;  5A4W A;  3UVH A;  4TRX A;  5CRW A;  16GS A;  3TOT A;  3KMN A;  3A3T A;  5D96 A;  4EDZ A;  1OKD A;  2B3S A;  3ZYW A;  5AIX A;  3RBT A;  4G19 A;  3MNG A;  4XRA A;  5CP1 A;  3LXT A;  2I81 A;  2AYT A;  3FW2 A;  4BWQ A;  4DVC A;  3APQ A;  1O81 A;  4RQX A;  1PQN A;  2WS2 A;  2I4A A;  4K9Z A;  3RPN A;  5LNK e;  4MCU A;  4I97 A;  1AQX A;  4NMU A;  2C8U A;  5GAN D;  3BOA A;  2NBS A;  3W8J A;  1QGV A;  3O3T A;  3R3E A;  1B8X A;  4TOP A;  4F0C A;  3PIN A;  3UAR A;  4TXO A;  3HVV A;  2VM1 A;  3QPM A;  2YPM A;  4G2E A;  1S3A A;  3WYW A;  2PBJ A;  2I1U A;  1FB6 A;  5DCG A;  2VLU A;  2P0G A;  1QUW A;  5ENU A;  2QSI A;  2IJY A;  5DAK A;  3D6I A;  4OD7 A;  4IP1 A;  1EEM A;  1AIU A;  1TP9 A;  3GH6 A;  4HZ2 A;  1TI3 A;  2H0H A;  1VF3 A;  3N5O A;  1RQM A;  1FOV A;  1GTI A;  3TJG A;  2TRC P;  3G7Y A;  3DEX A;  4ZL7 A;  4PQI A;  5D9W A;  1UN2 A;  4POL A;  1SK0 A;  2RM6 A;  1TK5 B;  2ZCT A;  1T1V A;  1Z9H A;  4MPF A;  4CHS A;  5J9C A;  2PER A;  2PU9 C;  4MF6 A;  2H0I A;  2H6X A;  2HFD A;  3IK9 A;  4GRF A;  3LEF A;  4O92 A;  3KH9 A;  1YY7 A;  1ST9 A;  1KNG A;  2CVB A;  2DBC A;  2LNT A;  2LNS A;  1EEJ A;  3DIE A;  3IR4 A;  1N8J A;  5F8B A;  2AAW A;  4K0N A;  3Q74 A;  2OA7 A;  3P2A A;  1A0F A;  2WDU A;  5A5K A;  1F2E A;  5KN1 A;  1C72 A;  3IRA A;  3LWA A;  2DJ1 A;  1SK2 A;  1YEP A;  1WP0 A;  3MAK A;  1EP7 A;  4OO5 A;  4IN0 A;  2IMK A;  5IOX A; 
#chains in the Genus database with same CATH topology
 3QD9 A;  1PL2 A;  3PGT A;  4HSC X;  2MBT A;  4IJ3 A;  3F4S A;  1VF4 A;  2FWE A;  1TKD B;  4IGJ A;  4N3Z A;  2RII A;  4GF0 A;  3CWG A;  6GSY A;  1FAA A;  5IMC A;  1B48 A;  2K6V A;  2VL9 A;  4YKG A;  5IMA A;  1CQH A;  1TU8 A;  5B7C A;  4KUN A;  4PUA A;  3DML A;  2OKA A;  4LL1 B;  4YKF A;  5COH A;  4LLR A;  4TR1 B;  3W6G A;  2N5A A;  1W89 A;  3ZL5 A;  3MDK A;  1XWB A;  1GLQ A;  1E6B A;  3L9S A;  3GIX A;  5ECQ B;  3FMW A;  3F8U A;  5G2Z A;  3FYG A;  3TUE A;  4MF7 A;  3R2Q A;  17GS A;  2I9H A;  2GDR A;  2F8A A;  1EGR A;  4K7I A;  5IO0 A;  5C04 A;  2HT9 A;  4NAX A;  1X5C A;  5F06 A;  1Z3E A;  3QFB C;  3LYP A;  2MMA A;  2WUL A;  4XCS A;  3ZLP A;  4WF4 A;  4ZBA A;  2HYX A;  3U6V A;  4K5R A;  3H93 A;  4MLY A;  1S3R A;  1XOA A;  2DJ0 A;  3HXS A;  3EVI A;  2EIR A;  2JSZ A;  3CMI A;  3KTB A;  5HFG A;  2IL3 A;  1PGT A;  1XWG A;  1J0F A;  2WW3 A;  5IIZ A;  4AJ7 A;  4POB A;  3H79 A;  2UZ8 A;  2FNO A;  5A5H B;  1GWC A;  1K0M A;  5GZZ B;  3TU3 B;  1O73 A;  4O7H A;  4IVF A;  3F9U A;  2F51 A;  1I9D A;  1JLV A;  1PSQ A;  4G0L A;  3CSJ A;  3P7X A;  4OO4 A;  4GCI A;  1WOU A;  3IE3 A;  2EFD A;  2F8F A;  2YZU A;  3HZ4 A;  3I6A A;  3L9U A;  4FQU A;  4MA9 A;  1SU9 A;  2YJ7 A;  5IMZ A;  2WZS A;  1K0C A;  1PA3 A;  1S3C A;  1IYI A;  1KEB A;  4MJB A;  3D21 A;  5AN1 A;  2PWJ A;  1GL8 A;  1CQG A;  5KEJ A;  1BG5 A;  1BYE A;  1XFL A;  2IMF A;  2GQM A;  5EPF A;  1YZX A;  3ZMK A;  1ZYN A;  3I9V 2;  4HEA 2;  4I6X A;  2MMO A;  1PRX A;  2FD3 A;  3TDG A;  3TKS A;  1X5E A;  1YEW C;  1WRY A;  2B6M A;  1GSY A;  4IW9 A;  4EXJ A;  4OCE A;  2LJA A;  2QC7 A;  2VL2 A;  2WVX A;  2LKU A;  2HQT A;  1J9B A;  5HR3 A;  2IFQ B;  3PR8 A;  1O6J A;  4K5S A;  2FUG 2;  3FR3 A;  1K0B A;  4KA0 A;  4IQ1 A;  4KAE A;  2VCZ A;  1YEX A;  3CQF A;  4USS A;  2L6C A;  2DIY A;  1M9B A;  1BJX A;  1FG4 A;  3M9K A;  2DC5 A;  3DRN A;  3J7Y k;  4EVM A;  1W4V A;  2MMN A;  1XW6 A;  4K2X A;  5G1L A;  3GL3 A;  4OFN A;  1B4P A;  1V57 A;  3EMX A;  5E4W A;  3N9J A;  6GSU A;  2VCW A;  2A2R A;  4ULX A;  3ZFB A;  4EIQ A;  4KH7 A;  4MMM A;  4TKY A;  4ML6 A;  3H1N A;  3IXR A;  1H4O A;  2O36 A;  3RGB C;  3TKR A;  4DSQ A;  1K3L A;  4TR1 A;  2JZT A;  2XBI A;  4JU5 A;  1Y1U A;  4XHM A;  3M1G A;  4G0K A;  1LU4 A;  4ZL9 A;  4GSS A;  1EV9 A;  2P31 A;  1BED A;  2L4C A;  1OVN A;  2IMI A;  5CRD A;  2HRA A;  4HZ4 A;  3IK7 A;  3DWV A;  2C1Y A;  3IAM 2;  1TRV A;  2B5X A;  3CHX C;  2YWN A;  4CW9 A;  2CT6 A;  3TRQ A;  4I2U A;  3OR5 A;  5FHI A;  2FGX A;  5DQY A;  5ECH B;  2JZR A;  4PUR A;  4AKX B;  4MJC A;  1MEK A;  2B5E A;  5A5H A;  4PNF A;  2H70 A;  10GS A;  2N5F A;  1ZYQ B;  5ABR A;  3MIX A;  4JED A;  1TRS A;  3LSZ A;  2C3Q A;  1OC3 A;  2IWT A;  1Z7P A;  2HSH A;  2OE0 A;  1ML6 A;  2YJH A;  1YDK A;  3W8S A;  4V1A p;  4PHZ C;  1SKW B;  1F6M C;  1S3D A;  3F3Q A;  2ON7 A;  1G7E A;  4HQZ A;  4MJE A;  1GUK A;  2LRC A;  2EFC A;  4OWY A;  3C8E A;  3F63 A;  4BL7 A;  2A4V A;  1JLW A;  4YQV A;  4POK A;  4HU9 A;  5CRH A;  2H0G A;  2AUV A;  2GQK A;  1GH2 A;  3C7M A;  2VO4 A;  4WET A;  1DE2 A;  4GDF A;  3ISO A;  2DIZ A;  1X9S B;  1M0U A;  1WWJ A;  1U87 A;  2GTU A;  3GKN A;  1SL0 B;  1JFU A;  3VPT A;  3GKM A;  4FXY P;  1XW9 A;  2L57 A;  2R5G A;  2H73 A;  5CRG A;  4XS1 A;  2FA4 A;  3ERF A;  4MH2 A;  4F03 A;  4QMK A;  2HRF A;  4ZB6 A;  1XXU A;  1VRS D;  3VUR A;  3A2W A;  4KE3 A;  2IFQ A;  4ML1 A;  1I5G A;  2EIQ A;  1XZO A;  4HUA A;  1LBK A;  4HJ2 A;  3KH7 A;  4OCF A;  4WBR D;  4DEJ A;  3LYK A;  2ZUP A;  1A2J A;  1GUM A;  1THX A;  2PVO C;  3H4K A;  5BRT A;  4KF9 A;  3GV1 A;  5HFI A;  4I2T A;  2CAQ A;  4K8M A;  2LRT A;  4TN8 A;  3Q6O A;  2V32 A;  1XIY A;  1A23 A;  4MZW A;  3TB2 A;  1ERT A;  4RI6 A;  1GLP A;  4IS0 A;  1RW1 A;  2K18 A;  2FLS A;  5HR2 A;  1MDK A;  1T4Z A;  1SEN A;  1BX9 A;  3HCZ A;  3TJF A;  4FYC A;  2WW2 A;  4PXO A;  5D9X A;  1A24 A;  5H5R A;  2FWH A;  4KCE A;  1O8W A;  1UC7 A;  1SVL A;  3TKQ A;  3LFL A;  1ZGN A;  3VWX A;  5EY6 A;  2OE1 A;  2H72 A;  4XS6 A;  4ZB9 A;  4HI7 A;  3QDN A;  3A2X A;  1YJ6 A;  3NIV A;  1MD3 A;  1KTE A;  3KGK A;  2R0P A;  3WGD A;  3WGE A;  2DJJ A;  1THO A;  1QXH A;  2GZZ A;  2GSR A;  1ZMA A;  1MDJ A;  3HJO A;  2VIM A;  7GSS A;  2X64 A;  2WB9 A;  4K0G A;  4IEL A;  4Z2R A;  2DJ3 A;  1B9X C;  4PI2 C;  4WF5 A;  3DYR A;  1TJD A;  1ON4 A;  4ISD A;  2VUP A;  5J5N A;  3QR6 A;  2HSM A;  2H1D A;  3QOU A;  2IME A;  5IMF A;  3NZN A;  4BWS A;  4EKZ A;  2CA8 A;  1GP1 A;  8GSS A;  2GSQ A;  1N2A A;  3K8N A;  3EMP A;  3VI7 A;  2H75 A;  5F0G A;  1PKZ A;  3L9V A;  5GAP D;  2C3N A;  4FYU A;  3GTU B;  3APO A;  4RUV A;  3E0U A;  4F82 A;  1SJ6 A;  2IIY A;  4MAB A;  3C73 A;  1B9Y C;  2YOI A;  3UAP A;  3GH9 A;  4GXZ A;  3EIN A;  5G5E A;  4QQ7 A;  2O7K A;  2CX4 A;  2JSY A;  2PGT A;  5J41 A;  5EL8 A;  2JZS A;  3BCK A;  2O89 A;  1F3A A;  3IOS A;  3HVS A;  2JAD A;  3VI5 A;  3SBC A;  3LG6 A;  3IBH A;  1AQW A;  4ECI A;  4NHW A;  4ID0 A;  4IHU A;  3E3E A;  3FZ4 A;  2R6K A;  3CXG A;  1YF1 A;  3TKP A;  2VM2 A;  1PN9 A;  3LXZ A;  1M2D A;  2TRX A;  2B1K A;  4MP4 A;  1XWC A;  1R7H A;  4NV5 A;  1GSQ A;  3UBL A;  1TDI A;  4X0X A;  5EVO A;  4K6X A;  2O5V A;  2R37 A;  3A5W A;  3GL5 A;  3WD6 A;  4TR3 A;  3APS A;  1V98 A;  3RFR C;  2R4V A;  2GST A;  3A2V A;  6GSW A;  4NV2 A;  3EE2 A;  2NDO A;  2A2S A;  3D4M A;  6GST A;  4WKW A;  4NPB A;  4XS4 B;  4Z2T A;  1ZZY A;  1ERV A;  1HNA A;  2O87 A;  1XWK A;  5DCH A;  6GSV A;  5D8I A;  4PGT A;  3CRT A;  5F05 A;  2CV4 A;  2YV9 A;  2OAC A;  4ECJ A;  4NXI A;  1AXD A;  5ECM B;  3BBY A;  3FRC A;  1X5D A;  2M46 A;  5JWO B;  1M2B A;  2HZE B;  3ZVJ D;  3ZRE A;  1V40 A;  4Z7X A;  3RHC A;  2GSS A;  3HY2 A;  3ZRD A;  1GSD A;  4MK3 A;  3ZVJ A;  4KCA A;  3EU3 A;  3IC4 A;  2JAC A;  3M3M A;  4DSR A;  4TR0 A;  2DSA A;  5A4V A;  2E2M A;  3UL3 A;  2K9F A;  2H1A A;  1O7U A;  3KIJ A;  2I3Y A;  3LGC A;  3ZIT A;  4Q5R A;  4EL1 A;  4ECC A;  3P90 A;  3JCM L;  4K7N A;  1VF1 A;  5L71 A;  1U88 A;  2LST A;  1QQ2 A;  3TKS C;  2FY6 A;  5ELG A;  5DAL B;  5DBQ A;  4FIW A;  4HS1 A;  3VWV A;  1YQ1 A;  2LRN A;  2VLV A;  3NOF A;  5DJL A;  2RLI A;  3KJY A;  2YZH A;  4L5O A;  3C1S A;  4ZIL A;  1GSU A;  1NHO A;  3HVN A;  3VWW A;  3VFI A;  3TCO A;  4KB3 A;  1TRU A;  1GSS A;  2H76 A;  1H75 A;  3QFA C;  1FB0 A;  5ECI B;  4KDX A;  3I43 A;  1YF0 A;  2HLS A;  2RM5 A;  4PUF C;  3GTU A;  1ERU A;  2H1G A;  3KP8 A;  4LMW A;  2H1L A;  4FO5 A;  2PVQ A;  2AJQ B;  19GS A;  3G7I A;  1K0D A;  1R5P A;  1SD9 A;  4WR4 A;  5B8B A;  3L78 A;  1QMV A;  3HZ8 A;  3KP9 A;  3KD0 A;  3WT1 A;  3FKF A;  4OFM A;  3TGZ A;  5DVB A;  1JZO A;  3D4T A;  1A0R P;  2AV4 A;  3V1W A;  3BCI A;  2VD0 A;  2LQO A;  1ILO A;  2C4J A;  2ON5 A;  2PN8 A;  4ZB8 A;  2PMT A;  3HYP A;  1ZCP A;  4GQC A;  3PPU A;  1K0O A;  3UIW A;  5ID2 B;  2DLX A;  3C71 A;  2GZP A;  2KLX A;  5IM9 A;  3IAS 2;  1TXX A;  3EU4 A;  3L4N A;  5FWG A;  1GUL A;  1M3I A;  4F9Z A;  1DSB A;  2YP6 A;  3IHQ A;  5IMV A;  4E68 A;  1HQO A;  4E8E A;  4NWY A;  2R3X A;  5AIV A;  1HD2 A;  2WRT A;  1SJZ A;  4NHZ A;  1WIK A;  4V2M A;  4IBP A;  1VGL A;  5JWQ B;  1E2Y A;  1MTC A;  1FVJ A;  2HZE A;  1TRW A;  2CX3 A;  5J47 A;  3FZA A;  1SVM A;  1TW9 A;  1GTA A;  1UA5 A;  4PQH A;  3F4T A;  3TRX A;  4KDU A;  4Q5F A;  9GSS A;  1F9M A;  1T00 A;  2L5O A;  3O76 A;  3O6T A;  1PKW A;  3GFK A;  4OFT A;  1Y25 A;  1FOH A;  4MPG A;  1FW1 A;  4TR4 A;  3U5R E;  2V2G A;  1EOG A;  2B1L A;  2HRN A;  1X9W B;  2QA2 A;  2YWI A;  3DGQ A;  3QAG A;  4L0U A;  2OAD A;  2H6Z A;  4OMV A;  5A1N B;  1TTZ A;  3GUS A;  3GNJ A;  1RK4 A;  3LOR A;  5DAL A;  2QA1 A;  3BD2 A;  2GT5 A;  5GST A;  1R4W A;  1OYJ A;  4YAP A;  3DVX A;  5ECR B;  1SD8 A;  2LEG A;  4XIH A;  4EDY A;  4K7O A;  5JWR B;  5J3R A;  5G30 A;  4AI6 A;  2UV8 G;  2M72 A;  5JCW A;  3FEU A;  3IPZ A;  3GRX A;  4PNG A;  2VAF A;  2FA8 A;  3C1R A;  5D9V A;  4I8B A;  4DSS B;  2XHF A;  1T3B A;  1JZR A;  1EGO A;  3KZQ A;  4BVX B;  1J08 A;  3QAV A;  4X4J A;  3ZTL A;  2Z9S A;  3ED3 A;  4F0B A;  2CZ3 A;  1B4Q A;  3VLN A;  2DMM A;  1XBS A;  1UVZ A;  1R26 A;  3HKR A;  1TK8 B;  2FWG A;  4YQM A;  4X43 A;  1DBY A;  3RDW A;  2MBS A;  5ECL B;  2YN1 A;  3FHK A;  1M2A A;  5ID2 A;  3FK8 A;  1OAZ A;  4ILF A;  3MWH A;  2E7P A;  4AKG A;  4FH8 A;  2GQL A;  1BAY A;  2G0F A;  4JR6 A;  2WVY A;  2KP1 A;  2V1M A;  2QGV A;  2VLT A;  3FY7 A;  5KOW A;  3E9J B;  1USB A;  1WPI A;  2JL4 A;  2P5R A;  2FHE A;  1EV4 A;  4XRD A;  4L0W A;  2REM A;  1DUG A;  3UJ1 A;  2KP2 A;  2VCQ A;  4F2I A;  1GNW A;  1AAZ A;  1A2L A;  3A5I A;  3EYT A;  4O32 A;  3MYD A;  4TXV A;  3KEB A;  5KN0 A;  4RI7 A;  4N10 A;  3ME8 A;  2MMZ A;  4ACS A;  4D73 B;  3HD5 A;  4ZBB A;  1K0A A;  2H1B A;  3G9B A;  1PX7 A;  3IHG A;  2LS5 A;  5HR0 A;  2E0Q A;  5KN3 A;  1Y6E A;  4N11 A;  1V58 A;  1SL1 B;  4IJI A;  1SKS B;  5D93 A;  2VOC A;  1SKR B;  4WBJ A;  4AF2 A;  1YKC A;  2NTO A;  13GS A;  4CDO A;  1HNB A;  1Z7R A;  4JBB A;  2H74 A;  3F4R A;  5IO2 A;  1GRX A;  1EP8 A;  3M9J A;  3CYN A;  3ERG A;  5AGY A;  4IQA A;  2EFH A;  2GGT A;  1XVQ A;  5A1N A;  2X8C A;  5F07 A;  5DDL A;  1ZOF A;  1BG1 A;  2B7K A;  2V6O A;  1GTB A;  5CO3 A;  4K2D A;  2GT6 A;  5H5S A;  4POM A;  4ICY A;  4TW5 A;  3J7Y b;  2L4Q A;  1XPV A;  1K3Y A;  2L5L A;  2MZC A;  4ECB A;  1OC9 B;  2X49 A;  4WR5 A;  4EIP A;  3EUR A;  1HNC A;  4WEY A;  2F9S A;  3GX8 A;  3F6D A;  3G7J A;  1QK8 A;  4HOJ A;  4V1A g;  2TIR A;  4LMV A;  3GMF A;  4IP6 A;  5D73 A;  2H19 A;  1A8Y A;  2X8H A;  3WT2 A;  3MSZ A;  4V2L A;  5ECO B;  1O85 A;  4TVE A;  3RHB A;  4Q5N A;  3KCM A;  2R0C A;  4DSS A;  4N0V A;  4G0I A;  4H86 A;  1Q4J A;  5BMU B;  5B6N A;  4X1U A;  2OBI A;  2CZ2 A;  3DD3 A;  3GA4 A;  1G6Y A;  3P8W A;  2VCT A;  1MDI A;  5FT3 A;  2M80 A;  3GHA A;  4BVX A;  1A8L A;  2O8V B;  4O5R A;  3TKS E;  2WCI A;  2GLR A;  1YKA A;  3VWU A;  3ZIJ A;  20GS A;  5A34 B;  3ZIV A;  3CSH A;  1M3J A;  2PPT A;  5LD0 A;  4PTS A;  2LJK A;  1XCC A;  5IOW A;  14GS A;  3FR6 A;  2N5B A;  4HDE A;  3S9F A;  1XWA A;  3QAW A;  4V2N A;  3F6F A;  3GX0 A;  3QCP A;  1TOF A;  2OE3 A;  1WJK A;  1YVL A;  1XVW A;  2HI7 A;  1V9W A;  2LUS A;  2KUC A;  4YQU A;  4ZB7 A;  1JZD A;  1SJI A;  2H30 A;  4MDC A;  2LJR A;  3H8Q A;  3TJK A;  1X9M B;  4AJ6 A;  3EC3 A;  3KM6 A;  3ZZX A;  2GZY A;  5G1K A;  2LQQ A;  2H66 A;  4HU7 A;  1FHE A;  1BF5 A;  5IQY A;  3D0Z A;  4ZBD A;  2H01 A;  1TU7 A;  2OJL A;  2J23 A;  1I1I P;  1XOB A;  1EWX A;  2LV3 A;  1T7P B;  1AW9 A;  5CRE A;  4EO3 A;  1NHY A;  3PH9 A;  5CYY A;  2EC4 A;  1T8E B;  1Z5Y E;  3UVT A;  3HVX A;  2HSY A;  5IPH A;  4ZXG A;  1BQ7 A;  4JRR A;  4YH2 A;  2OBK A;  4D73 A;  5B8A A;  4A5P A;  1M9A A;  1URM A;  2YWO A;  3F0I A;  4GST A;  2NPB A;  4ZIJ A;  1OKT A;  3LJR A;  3ERW A;  1GSE A;  12GS A;  3EPT A;  5J4U A;  3FZ9 A;  1TXU A;  4BPY A;  3UEM A;  1XG8 A;  5ECN B;  1G0T A;  3LW9 A;  2DML A;  2ALB A;  1U6T A;  2VCV A;  1PL1 A;  1GUH A;  5HR1 A;  4IKH A;  3VK9 A;  4LL4 B;  2VL2 C;  1U3A A;  4BVY B;  5D9T A;  4EF0 A;  2O85 A;  3TJJ A;  3UMA A;  1OE8 A;  1NW2 A;  2E2G A;  2XBQ A;  4ZL8 A;  3RPP A;  1F37 A;  2AB6 A;  2WJU A;  2H8L A;  2C0D A;  1T4Y A;  2VL3 A;  2YAN A;  3M8N A;  1OC9 A;  5E59 A;  4GWR A;  3HJM A;  5C00 A;  5CNW A;  4MJA A;  2HRK B;  1R5A A;  3L0H A;  2OT3 A;  2AHE A;  2YCD A;  3GKX A;  1AC1 A;  2R2J A;  2DJ2 A;  2WVZ A;  3FZ5 A;  2HXK A;  2B5Y A;  1GNE A;  4P3Y B;  1FO5 A;  4QL9 A;  2A4H A;  4HJM A;  4JZQ A;  4W66 A;  4KSO A;  3UBK A;  2C80 A;  3KTL A;  1KBN A;  3M0F A;  5BMU A;  4CY6 A;  5J4Y A;  4BL7 B;  1ACV A;  2V41 A;  4KGI A;  11GS A;  1PX6 A;  2H6Y A;  1MD4 A;  2HSN B;  1M7T A;  2G2Q A;  3LQ7 A;  3TRP A;  5A34 A;  2WGR A;  3DXB A;  2IMD A;  1DE1 A;  5CAX A;  5IPG A;  5AIS A;  1JZW A;  2GVP A;  2X8G A;  3ZFL A;  4JE1 A;  5J9B A;  4RQR A;  18GS A;  4YAV A;  5G5F A;  3RAZ A;  2BMX A;  3ME7 A;  2WZ9 A;  1FVK A;  3D5J A;  2JU5 A;  6GSS A;  1O8X A;  1M99 A;  5DJM A;  4O5U A;  3HMJ G;  1F3B A;  4BA7 A;  2DJK A;  1VF2 A;  5A4U A;  3VPQ A;  1ZYE A;  5INY A;  2H71 A;  1GSF A;  1JHB A;  6GSX A;  3CBU A;  4XS4 A;  1ERW A;  1QFN A;  3EWL A;  3I69 A;  1G6W A;  2WFC A;  5JCG A;  2CVK A;  1PFO A;  3UOM A;  1ZL9 A;  1S4B P;  2HZF A;  1OE7 A;  3HDC A;  2HNL A;  3AY8 A;  3DVW A;  4AKI A;  3HA9 A;  2FWF A;  5GSS A;  4N30 A;  2VKZ G;  2YV7 A;  3US3 A;  2EIO A;  2F3M A;  2C0F A;  3GSS A;  4MH3 A;  2ZNM A;  5HFK A;  4L8E A;  4AGS A;  4G10 A;  3HHV A;  1ABA A;  2RUE A;  4J56 E;  3GST A;  1G7O A;  5H5Q A;  2GS3 A;  4O5Q A;  3GUR A;  5B6M A;  1X0R A;  3HJP A;  1PMT A;  5ECS A;  1HYU A;  2ES7 A;  1TK0 B;  2YWM A;  1TI1 A;  3CSI A;  4GTU A;  2CQ9 A;  4TXO B;  2PUK C;  2VD1 A;  3GN3 A;  2C3T A;  4KDY A;  4HQS A;  2HSM B;  1SVO A;  4BVY A;  5JCU A;  1NSW A;  3CTG A;  2L6D A;  4JR4 A;  3GKK A;  4MZB A;  5DAK B;  4KX4 A;  3CTF A;  4WXT A;  2QKE A;  4I5Q A;  4G9H A;  4G01 A;  1U3I A;  4KW6 A;  4FYB A;  4EUY A;  1LJR A;  4AJ8 A;  1Q98 A;  1Z6N A;  3IDV A;  4K1F A;  2NVL A;  4QL7 A;  2IN3 A;  2XC2 A;  1K3O A;  5HQP A;  2EFE A;  1N25 A;  2HRK A;  2C0G A;  2P5Q A;  4EC0 A;  2VCX A;  3D22 A;  3FR9 A;  1Z6M A;  1SYX A;  2LTK A;  2BJX A;  4GSN A;  4LA1 A;  4KSM A;  4PI0 C;  2V6K A;  5ELA A;  2FCH A;  4MZC A;  2C0E A;  3IC8 A;  4PQ1 A;  3Q19 A;  2X99 A;  4E8H A;  1SL2 B;  1XW5 A;  2B7J A;  2CVD A;  3F3R A;  5KN2 A;  2HSN A;  4J57 E;  3GYK A;  2YNX A;  2WW0 A;  2X4A A;  4N0Z A;  4XTS A;  4EE0 A;  2D2Z A;  1OC8 A;  2HE3 A;  1SYR A;  4MF5 A;  3KXO A;  1V2A A;  4PX1 A;  3Q18 A;  4MNN A;  1EOH A;  22GS A;  1NM3 A;  4L5L A;  1AQV A;  1K0N A;  3SWL A;  2R0G A;  3IA1 A;  2XPE A;  4Q5Q A;  4J2F A;  4GLT A;  5ECK B;  2K8V A;  3BJ5 A;  2KOK A;  2K8S A;  1PD2 1;  3TOU A;  2DKI A;  4GQF A;  2XPD A;  1EZK A;  5DQS A;  5KOX A;  1A2M A;  2CAI A;  2J9H A;  2O3E A;  5IMD A;  2KHP A;  3TJB A;  3KMO A;  2BTO T;  3DKS A;  2RUF A;  2MYG A;  2L59 A;  3WGX A;  3ZML A;  5LCZ A;  1GTU A;  3IV4 A;  3CRU A;  1WMJ A;  1WE0 A;  2IPA A;  4KND A;  5ECP B;  1SK1 A;  5G31 A;  3QMX A;  1IYH A;  1AUC A;  5A4W A;  3UVH A;  4AKH A;  4TRX A;  5CRW A;  16GS A;  3TOT A;  3KMN A;  3A3T A;  5D96 A;  4EDZ A;  1OKD A;  2B3S A;  3ZYW A;  5AIX A;  3RBT A;  4G19 A;  3MNG A;  4XRA A;  5CP1 A;  3LXT A;  2I81 A;  2AYT A;  3FW2 A;  4BIK A;  4BWQ A;  4DVC A;  5J40 A;  3APQ A;  1O81 A;  4RQX A;  1PQN A;  2WS2 A;  2I4A A;  4K9Z A;  3RPN A;  5LNK e;  4MCU A;  4I97 A;  1AQX A;  4NMU A;  1ZYP A;  2C8U A;  5GAN D;  3BOA A;  2NBS A;  3W8J A;  4CY8 A;  1QGV A;  3O3T A;  3R3E A;  1B8X A;  4TOP A;  4F0C A;  3PIN A;  3UAR A;  4TXO A;  3HVV A;  2VM1 A;  3QPM A;  2YPM A;  4G2E A;  1S3A A;  3WYW A;  2PBJ A;  2I1U A;  1FB6 A;  5DCG A;  2VLU A;  2P0G A;  1QUW A;  5ENU A;  2QSI A;  2IJY A;  5DAK A;  3D6I A;  4OD7 A;  4IP1 A;  1EEM A;  1AIU A;  1TP9 A;  3GH6 A;  4HZ2 A;  1TI3 A;  2H0H A;  1VF3 A;  2A2P A;  3N5O A;  1RQM A;  1FOV A;  1GTI A;  3TJG A;  2DKH A;  2TRC P;  1PN0 A;  3G7Y A;  3DEX A;  4ZL7 A;  4PQI A;  5D9W A;  1UN2 A;  4POL A;  1SK0 A;  2RM6 A;  1TK5 B;  2ZCT A;  1T1V A;  1Z9H A;  4MPF A;  4CHS A;  5J9C A;  4Z2U A;  2PER A;  2PU9 C;  4MF6 A;  2WW1 A;  2H0I A;  2H6X A;  2HFD A;  3IK9 A;  4GRF A;  3LEF A;  4O92 A;  3KH9 A;  1YY7 A;  1ST9 A;  1KNG A;  2CVB A;  2DBC A;  2WVX B;  2LNT A;  2LNS A;  1EEJ A;  3DIE A;  3IR4 A;  1N8J A;  5F8B A;  2AAW A;  4K0N A;  3Q74 A;  2OA7 A;  3P2A A;  1A0F A;  2WDU A;  5J4V A;  5A5K A;  1F2E A;  5KN1 A;  1C72 A;  3IRA A;  3LWA A;  2DJ1 A;  1SK2 A;  1YEP A;  1WP0 A;  3MAK A;  1EP7 A;  4OO5 A;  4IN0 A;  2IMK A;  5IOX A; 
#chains in the Genus database with same CATH homology
 3QD9 A;  1PL2 A;  3PGT A;  2MBT A;  4IJ3 A;  3F4S A;  1VF4 A;  2FWE A;  1TKD B;  4IGJ A;  4N3Z A;  2RII A;  4GF0 A;  3CWG A;  6GSY A;  1FAA A;  5IMC A;  1B48 A;  2K6V A;  2VL9 A;  4YKG A;  5IMA A;  1CQH A;  1TU8 A;  5B7C A;  4KUN A;  4PUA A;  3DML A;  2OKA A;  4LL1 B;  4YKF A;  5COH A;  4LLR A;  4TR1 B;  3W6G A;  2N5A A;  1W89 A;  3ZL5 A;  3MDK A;  1XWB A;  1GLQ A;  1E6B A;  3L9S A;  3GIX A;  5ECQ B;  3FMW A;  3F8U A;  5G2Z A;  3FYG A;  3TUE A;  4MF7 A;  3R2Q A;  17GS A;  2I9H A;  2GDR A;  2F8A A;  1EGR A;  4K7I A;  5IO0 A;  5C04 A;  2HT9 A;  4NAX A;  1X5C A;  5F06 A;  1Z3E A;  3QFB C;  3LYP A;  2MMA A;  2WUL A;  4XCS A;  3ZLP A;  4WF4 A;  4ZBA A;  2HYX A;  3U6V A;  4K5R A;  3H93 A;  4MLY A;  1XOA A;  2DJ0 A;  3HXS A;  3EVI A;  2EIR A;  2JSZ A;  3CMI A;  3KTB A;  5HFG A;  2IL3 A;  1PGT A;  1XWG A;  1J0F A;  5IIZ A;  4AJ7 A;  4POB A;  3H79 A;  2UZ8 A;  2FNO A;  5A5H B;  1GWC A;  1K0M A;  5GZZ B;  3TU3 B;  1O73 A;  4O7H A;  4IVF A;  3F9U A;  2F51 A;  1I9D A;  1JLV A;  1PSQ A;  4G0L A;  3CSJ A;  3P7X A;  4OO4 A;  4GCI A;  1WOU A;  3IE3 A;  2EFD A;  2F8F A;  2YZU A;  3HZ4 A;  3I6A A;  3L9U A;  4FQU A;  4MA9 A;  1SU9 A;  2YJ7 A;  5IMZ A;  1K0C A;  1PA3 A;  1S3C A;  1IYI A;  1KEB A;  4MJB A;  3D21 A;  5AN1 A;  2PWJ A;  1GL8 A;  1CQG A;  5KEJ A;  1BG5 A;  1BYE A;  1XFL A;  2IMF A;  2GQM A;  5EPF A;  1YZX A;  3ZMK A;  1ZYN A;  3I9V 2;  4HEA 2;  4I6X A;  2MMO A;  1PRX A;  2FD3 A;  3TDG A;  3TKS A;  1X5E A;  1WRY A;  2B6M A;  1GSY A;  4IW9 A;  4EXJ A;  4OCE A;  2LJA A;  2QC7 A;  2VL2 A;  2LKU A;  2HQT A;  1J9B A;  5HR3 A;  2IFQ B;  3PR8 A;  1O6J A;  4K5S A;  2FUG 2;  3FR3 A;  1K0B A;  4KA0 A;  4IQ1 A;  4KAE A;  2VCZ A;  1YEX A;  4USS A;  2L6C A;  2DIY A;  1M9B A;  1BJX A;  1FG4 A;  3M9K A;  2DC5 A;  3DRN A;  3J7Y k;  4EVM A;  1W4V A;  2MMN A;  1XW6 A;  4K2X A;  5G1L A;  3GL3 A;  4OFN A;  1B4P A;  1V57 A;  3EMX A;  5E4W A;  3N9J A;  6GSU A;  2VCW A;  2A2R A;  4ULX A;  3ZFB A;  4EIQ A;  4KH7 A;  4MMM A;  4TKY A;  4ML6 A;  3H1N A;  3IXR A;  1H4O A;  3TKR A;  4DSQ A;  1K3L A;  4TR1 A;  2JZT A;  2XBI A;  4JU5 A;  1Y1U A;  4XHM A;  3M1G A;  4G0K A;  1LU4 A;  4ZL9 A;  4GSS A;  1EV9 A;  2P31 A;  1BED A;  2L4C A;  1OVN A;  2IMI A;  5CRD A;  2HRA A;  4HZ4 A;  3IK7 A;  3DWV A;  2C1Y A;  3IAM 2;  1TRV A;  2B5X A;  2YWN A;  4CW9 A;  2CT6 A;  3TRQ A;  4I2U A;  3OR5 A;  5FHI A;  2FGX A;  5DQY A;  5ECH B;  2JZR A;  4PUR A;  4AKX B;  4MJC A;  1MEK A;  2B5E A;  5A5H A;  4PNF A;  2H70 A;  10GS A;  2N5F A;  1ZYQ B;  5ABR A;  3MIX A;  4JED A;  1TRS A;  3LSZ A;  2C3Q A;  1OC3 A;  2IWT A;  1Z7P A;  2HSH A;  2OE0 A;  1ML6 A;  2YJH A;  1YDK A;  3W8S A;  4V1A p;  1SKW B;  1F6M C;  1S3D A;  3F3Q A;  2ON7 A;  1G7E A;  4HQZ A;  4MJE A;  1GUK A;  2LRC A;  2EFC A;  4OWY A;  3C8E A;  3F63 A;  4BL7 A;  2A4V A;  1JLW A;  4YQV A;  4POK A;  4HU9 A;  5CRH A;  2H0G A;  2AUV A;  2GQK A;  1GH2 A;  3C7M A;  2VO4 A;  4WET A;  1DE2 A;  4GDF A;  3ISO A;  2DIZ A;  1X9S B;  1M0U A;  1WWJ A;  1U87 A;  2GTU A;  3GKN A;  1SL0 B;  1JFU A;  3VPT A;  3GKM A;  1XW9 A;  2L57 A;  2R5G A;  2H73 A;  5CRG A;  4XS1 A;  2FA4 A;  3ERF A;  4MH2 A;  4F03 A;  4QMK A;  2HRF A;  4ZB6 A;  1XXU A;  1VRS D;  3VUR A;  3A2W A;  4KE3 A;  2IFQ A;  4ML1 A;  1I5G A;  2EIQ A;  1XZO A;  4HUA A;  1LBK A;  4HJ2 A;  3KH7 A;  4OCF A;  4WBR D;  4DEJ A;  3LYK A;  2ZUP A;  1A2J A;  1GUM A;  1THX A;  2PVO C;  3H4K A;  5BRT A;  4KF9 A;  3GV1 A;  5HFI A;  4I2T A;  2CAQ A;  4K8M A;  2LRT A;  4TN8 A;  3Q6O A;  2V32 A;  1XIY A;  1A23 A;  4MZW A;  3TB2 A;  1ERT A;  4RI6 A;  1GLP A;  4IS0 A;  1RW1 A;  2K18 A;  2FLS A;  5HR2 A;  1MDK A;  1T4Z A;  1SEN A;  1BX9 A;  3HCZ A;  3TJF A;  4FYC A;  4PXO A;  5D9X A;  1A24 A;  5H5R A;  2FWH A;  4KCE A;  1O8W A;  1UC7 A;  1SVL A;  3TKQ A;  3LFL A;  1ZGN A;  3VWX A;  5EY6 A;  2OE1 A;  2H72 A;  4XS6 A;  4ZB9 A;  4HI7 A;  3QDN A;  3A2X A;  1YJ6 A;  3NIV A;  1MD3 A;  1KTE A;  3KGK A;  2R0P A;  3WGD A;  3WGE A;  2DJJ A;  1THO A;  1QXH A;  2GZZ A;  2GSR A;  1ZMA A;  1MDJ A;  3HJO A;  2VIM A;  7GSS A;  2X64 A;  2WB9 A;  4K0G A;  4IEL A;  4Z2R A;  2DJ3 A;  1B9X C;  4WF5 A;  3DYR A;  1TJD A;  1ON4 A;  4ISD A;  2VUP A;  5J5N A;  3QR6 A;  2HSM A;  2H1D A;  3QOU A;  2IME A;  5IMF A;  3NZN A;  4BWS A;  4EKZ A;  2CA8 A;  1GP1 A;  8GSS A;  2GSQ A;  1N2A A;  3K8N A;  3EMP A;  3VI7 A;  2H75 A;  5F0G A;  1PKZ A;  3L9V A;  5GAP D;  2C3N A;  4FYU A;  3GTU B;  3APO A;  4RUV A;  3E0U A;  4F82 A;  1SJ6 A;  2IIY A;  4MAB A;  3C73 A;  1B9Y C;  2YOI A;  3UAP A;  3GH9 A;  4GXZ A;  3EIN A;  5G5E A;  4QQ7 A;  2O7K A;  2CX4 A;  2JSY A;  2PGT A;  5J41 A;  5EL8 A;  2JZS A;  3BCK A;  2O89 A;  1F3A A;  3IOS A;  3HVS A;  2JAD A;  3VI5 A;  3SBC A;  3LG6 A;  3IBH A;  1AQW A;  4ECI A;  4NHW A;  4ID0 A;  4IHU A;  3E3E A;  3FZ4 A;  2R6K A;  3CXG A;  1YF1 A;  3TKP A;  2VM2 A;  1PN9 A;  3LXZ A;  1M2D A;  2TRX A;  2B1K A;  4MP4 A;  1XWC A;  1R7H A;  4NV5 A;  1GSQ A;  3UBL A;  1TDI A;  4X0X A;  5EVO A;  4K6X A;  2O5V A;  2R37 A;  3A5W A;  3GL5 A;  3WD6 A;  4TR3 A;  3APS A;  1V98 A;  2R4V A;  2GST A;  3A2V A;  6GSW A;  4NV2 A;  3EE2 A;  2NDO A;  2A2S A;  3D4M A;  6GST A;  4WKW A;  4NPB A;  4XS4 B;  4Z2T A;  1ZZY A;  1ERV A;  1HNA A;  2O87 A;  1XWK A;  5DCH A;  6GSV A;  5D8I A;  4PGT A;  3CRT A;  5F05 A;  2CV4 A;  2YV9 A;  2OAC A;  4ECJ A;  4NXI A;  1AXD A;  5ECM B;  3BBY A;  3FRC A;  1X5D A;  2M46 A;  5JWO B;  1M2B A;  2HZE B;  3ZVJ D;  3ZRE A;  1V40 A;  4Z7X A;  3RHC A;  2GSS A;  3HY2 A;  3ZRD A;  1GSD A;  4MK3 A;  3ZVJ A;  4KCA A;  3EU3 A;  3IC4 A;  2JAC A;  3M3M A;  4DSR A;  4TR0 A;  2DSA A;  5A4V A;  2E2M A;  3UL3 A;  2K9F A;  2H1A A;  1O7U A;  3KIJ A;  2I3Y A;  3LGC A;  3ZIT A;  4Q5R A;  4EL1 A;  4ECC A;  3P90 A;  3JCM L;  4K7N A;  1VF1 A;  5L71 A;  1U88 A;  2LST A;  1QQ2 A;  3TKS C;  2FY6 A;  5ELG A;  5DAL B;  5DBQ A;  4FIW A;  4HS1 A;  3VWV A;  1YQ1 A;  2LRN A;  2VLV A;  3NOF A;  5DJL A;  2RLI A;  3KJY A;  2YZH A;  4L5O A;  3C1S A;  4ZIL A;  1GSU A;  1NHO A;  3VWW A;  3VFI A;  3TCO A;  4KB3 A;  1TRU A;  1GSS A;  2H76 A;  1H75 A;  3QFA C;  1FB0 A;  5ECI B;  4KDX A;  3I43 A;  1YF0 A;  2HLS A;  2RM5 A;  4PUF C;  3GTU A;  1ERU A;  2H1G A;  3KP8 A;  4LMW A;  2H1L A;  4FO5 A;  2PVQ A;  2AJQ B;  19GS A;  3G7I A;  1K0D A;  1R5P A;  1SD9 A;  4WR4 A;  5B8B A;  3L78 A;  1QMV A;  3HZ8 A;  3KP9 A;  3KD0 A;  3WT1 A;  3FKF A;  4OFM A;  3TGZ A;  5DVB A;  1JZO A;  3D4T A;  1A0R P;  2AV4 A;  3V1W A;  3BCI A;  2VD0 A;  2LQO A;  1ILO A;  2C4J A;  2ON5 A;  2PN8 A;  4ZB8 A;  2PMT A;  3HYP A;  1ZCP A;  4GQC A;  3PPU A;  1K0O A;  3UIW A;  5ID2 B;  2DLX A;  3C71 A;  2GZP A;  2KLX A;  5IM9 A;  3IAS 2;  1TXX A;  3EU4 A;  3L4N A;  5FWG A;  1GUL A;  4F9Z A;  1DSB A;  2YP6 A;  3IHQ A;  5IMV A;  4E68 A;  1HQO A;  4E8E A;  4NWY A;  2R3X A;  5AIV A;  1HD2 A;  2WRT A;  1SJZ A;  4NHZ A;  1WIK A;  4V2M A;  4IBP A;  1VGL A;  5JWQ B;  1E2Y A;  1MTC A;  1FVJ A;  2HZE A;  1TRW A;  2CX3 A;  5J47 A;  3FZA A;  1SVM A;  1TW9 A;  1GTA A;  1UA5 A;  4PQH A;  3F4T A;  3TRX A;  4KDU A;  4Q5F A;  9GSS A;  1F9M A;  1T00 A;  2L5O A;  3O76 A;  3O6T A;  1PKW A;  3GFK A;  4OFT A;  1Y25 A;  1FOH A;  4MPG A;  1FW1 A;  4TR4 A;  3U5R E;  2V2G A;  1EOG A;  2B1L A;  2HRN A;  1X9W B;  2QA2 A;  2YWI A;  3DGQ A;  3QAG A;  4L0U A;  2OAD A;  2H6Z A;  4OMV A;  5A1N B;  1TTZ A;  3GUS A;  3GNJ A;  1RK4 A;  3LOR A;  5DAL A;  2QA1 A;  3BD2 A;  2GT5 A;  5GST A;  1R4W A;  1OYJ A;  4YAP A;  3DVX A;  5ECR B;  1SD8 A;  2LEG A;  4XIH A;  4EDY A;  4K7O A;  5JWR B;  5J3R A;  5G30 A;  4AI6 A;  2UV8 G;  2M72 A;  5JCW A;  3FEU A;  3IPZ A;  3GRX A;  4PNG A;  2VAF A;  2FA8 A;  3C1R A;  5D9V A;  4I8B A;  4DSS B;  2XHF A;  1T3B A;  1JZR A;  1EGO A;  3KZQ A;  4BVX B;  1J08 A;  3QAV A;  4X4J A;  3ZTL A;  2Z9S A;  3ED3 A;  4F0B A;  2CZ3 A;  1B4Q A;  3VLN A;  2DMM A;  1XBS A;  1UVZ A;  1R26 A;  3HKR A;  1TK8 B;  2FWG A;  4YQM A;  4X43 A;  1DBY A;  3RDW A;  2MBS A;  5ECL B;  2YN1 A;  3FHK A;  1M2A A;  5ID2 A;  3FK8 A;  1OAZ A;  4ILF A;  3MWH A;  2E7P A;  4AKG A;  4FH8 A;  2GQL A;  1BAY A;  2G0F A;  4JR6 A;  2KP1 A;  2V1M A;  2QGV A;  2VLT A;  3FY7 A;  5KOW A;  3E9J B;  1USB A;  1WPI A;  2JL4 A;  2P5R A;  2FHE A;  1EV4 A;  4XRD A;  4L0W A;  2REM A;  1DUG A;  3UJ1 A;  2KP2 A;  2VCQ A;  4F2I A;  1GNW A;  1AAZ A;  1A2L A;  3A5I A;  3EYT A;  4O32 A;  3MYD A;  4TXV A;  3KEB A;  5KN0 A;  4RI7 A;  4N10 A;  3ME8 A;  2MMZ A;  4ACS A;  4D73 B;  3HD5 A;  4ZBB A;  1K0A A;  2H1B A;  3G9B A;  1PX7 A;  3IHG A;  2LS5 A;  5HR0 A;  2E0Q A;  5KN3 A;  1Y6E A;  4N11 A;  1V58 A;  1SL1 B;  4IJI A;  1SKS B;  5D93 A;  2VOC A;  1SKR B;  4WBJ A;  4AF2 A;  1YKC A;  2NTO A;  13GS A;  4CDO A;  1HNB A;  1Z7R A;  4JBB A;  2H74 A;  3F4R A;  5IO2 A;  1GRX A;  1EP8 A;  3M9J A;  3CYN A;  3ERG A;  5AGY A;  4IQA A;  2EFH A;  2GGT A;  1XVQ A;  5A1N A;  2X8C A;  5F07 A;  5DDL A;  1ZOF A;  1BG1 A;  2B7K A;  2V6O A;  1GTB A;  5CO3 A;  4K2D A;  2GT6 A;  5H5S A;  4POM A;  4ICY A;  4TW5 A;  3J7Y b;  2L4Q A;  1XPV A;  1K3Y A;  2L5L A;  2MZC A;  4ECB A;  1OC9 B;  2X49 A;  4WR5 A;  4EIP A;  3EUR A;  1HNC A;  4WEY A;  2F9S A;  3GX8 A;  3F6D A;  3G7J A;  1QK8 A;  4HOJ A;  4V1A g;  2TIR A;  4LMV A;  3GMF A;  4IP6 A;  5D73 A;  2H19 A;  1A8Y A;  2X8H A;  3WT2 A;  3MSZ A;  4V2L A;  5ECO B;  1O85 A;  4TVE A;  3RHB A;  4Q5N A;  3KCM A;  2R0C A;  4DSS A;  4N0V A;  4G0I A;  4H86 A;  1Q4J A;  5BMU B;  5B6N A;  4X1U A;  2OBI A;  2CZ2 A;  3DD3 A;  3GA4 A;  1G6Y A;  3P8W A;  2VCT A;  1MDI A;  5FT3 A;  2M80 A;  3GHA A;  4BVX A;  1A8L A;  2O8V B;  4O5R A;  3TKS E;  2WCI A;  2GLR A;  1YKA A;  3VWU A;  3ZIJ A;  20GS A;  5A34 B;  3ZIV A;  3CSH A;  2PPT A;  5LD0 A;  4PTS A;  2LJK A;  1XCC A;  5IOW A;  14GS A;  3FR6 A;  2N5B A;  4HDE A;  3S9F A;  1XWA A;  3QAW A;  4V2N A;  3F6F A;  3GX0 A;  3QCP A;  1TOF A;  2OE3 A;  1WJK A;  1YVL A;  1XVW A;  2HI7 A;  1V9W A;  2LUS A;  2KUC A;  4YQU A;  4ZB7 A;  1JZD A;  1SJI A;  2H30 A;  4MDC A;  2LJR A;  3H8Q A;  3TJK A;  1X9M B;  4AJ6 A;  3EC3 A;  3KM6 A;  3ZZX A;  2GZY A;  5G1K A;  2LQQ A;  2H66 A;  4HU7 A;  1FHE A;  1BF5 A;  5IQY A;  3D0Z A;  4ZBD A;  2H01 A;  1TU7 A;  2OJL A;  2J23 A;  1XOB A;  1EWX A;  2LV3 A;  1T7P B;  1AW9 A;  5CRE A;  4EO3 A;  1NHY A;  3PH9 A;  5CYY A;  2EC4 A;  1T8E B;  1Z5Y E;  3UVT A;  3HVX A;  2HSY A;  5IPH A;  4ZXG A;  1BQ7 A;  4JRR A;  4YH2 A;  2OBK A;  4D73 A;  5B8A A;  4A5P A;  1M9A A;  1URM A;  2YWO A;  3F0I A;  4GST A;  2NPB A;  4ZIJ A;  1OKT A;  3LJR A;  3ERW A;  1GSE A;  12GS A;  3EPT A;  5J4U A;  3FZ9 A;  1TXU A;  4BPY A;  3UEM A;  5ECN B;  1G0T A;  3LW9 A;  2DML A;  2ALB A;  1U6T A;  2VCV A;  1PL1 A;  1GUH A;  5HR1 A;  4IKH A;  3VK9 A;  4LL4 B;  2VL2 C;  1U3A A;  4BVY B;  5D9T A;  4EF0 A;  2O85 A;  3TJJ A;  3UMA A;  1OE8 A;  1NW2 A;  2E2G A;  2XBQ A;  4ZL8 A;  3RPP A;  1F37 A;  2AB6 A;  2WJU A;  2H8L A;  2C0D A;  1T4Y A;  2VL3 A;  2YAN A;  3M8N A;  1OC9 A;  5E59 A;  4GWR A;  3HJM A;  5C00 A;  5CNW A;  4MJA A;  2HRK B;  1R5A A;  3L0H A;  2OT3 A;  2AHE A;  2YCD A;  3GKX A;  1AC1 A;  2R2J A;  2DJ2 A;  3FZ5 A;  2HXK A;  2B5Y A;  1GNE A;  4P3Y B;  1FO5 A;  4QL9 A;  2A4H A;  4HJM A;  4JZQ A;  4W66 A;  4KSO A;  3UBK A;  2C80 A;  3KTL A;  1KBN A;  3M0F A;  5BMU A;  4CY6 A;  5J4Y A;  4BL7 B;  1ACV A;  2V41 A;  4KGI A;  11GS A;  1PX6 A;  2H6Y A;  1MD4 A;  2HSN B;  1M7T A;  2G2Q A;  3LQ7 A;  3TRP A;  5A34 A;  2WGR A;  3DXB A;  2IMD A;  1DE1 A;  5CAX A;  5IPG A;  5AIS A;  1JZW A;  2GVP A;  2X8G A;  3ZFL A;  4JE1 A;  5J9B A;  4RQR A;  18GS A;  4YAV A;  5G5F A;  3RAZ A;  2BMX A;  3ME7 A;  2WZ9 A;  1FVK A;  3D5J A;  2JU5 A;  6GSS A;  1O8X A;  1M99 A;  5DJM A;  4O5U A;  3HMJ G;  1F3B A;  4BA7 A;  2DJK A;  1VF2 A;  5A4U A;  3VPQ A;  1ZYE A;  5INY A;  2H71 A;  1GSF A;  1JHB A;  6GSX A;  3CBU A;  4XS4 A;  1ERW A;  1QFN A;  3EWL A;  3I69 A;  1G6W A;  2WFC A;  5JCG A;  2CVK A;  3UOM A;  1ZL9 A;  2HZF A;  1OE7 A;  3HDC A;  2HNL A;  3AY8 A;  3DVW A;  4AKI A;  3HA9 A;  2FWF A;  5GSS A;  4N30 A;  2VKZ G;  2YV7 A;  3US3 A;  2EIO A;  2F3M A;  2C0F A;  3GSS A;  4MH3 A;  2ZNM A;  5HFK A;  4L8E A;  4AGS A;  4G10 A;  3HHV A;  1ABA A;  2RUE A;  4J56 E;  3GST A;  1G7O A;  5H5Q A;  2GS3 A;  4O5Q A;  3GUR A;  5B6M A;  1X0R A;  3HJP A;  1PMT A;  5ECS A;  1HYU A;  2ES7 A;  1TK0 B;  2YWM A;  1TI1 A;  3CSI A;  4GTU A;  2CQ9 A;  4TXO B;  2PUK C;  2VD1 A;  3GN3 A;  2C3T A;  4KDY A;  4HQS A;  2HSM B;  1SVO A;  4BVY A;  5JCU A;  1NSW A;  3CTG A;  2L6D A;  4JR4 A;  3GKK A;  4MZB A;  5DAK B;  4KX4 A;  3CTF A;  4WXT A;  2QKE A;  4I5Q A;  4G9H A;  4G01 A;  1U3I A;  4KW6 A;  4FYB A;  4EUY A;  1LJR A;  4AJ8 A;  1Q98 A;  1Z6N A;  3IDV A;  4K1F A;  2NVL A;  4QL7 A;  2IN3 A;  2XC2 A;  1K3O A;  5HQP A;  2EFE A;  1N25 A;  2HRK A;  2C0G A;  2P5Q A;  4EC0 A;  2VCX A;  3D22 A;  3FR9 A;  1Z6M A;  1SYX A;  2LTK A;  2BJX A;  4GSN A;  4LA1 A;  4KSM A;  2V6K A;  5ELA A;  2FCH A;  4MZC A;  2C0E A;  3IC8 A;  4PQ1 A;  3Q19 A;  2X99 A;  4E8H A;  1SL2 B;  1XW5 A;  2B7J A;  2CVD A;  3F3R A;  5KN2 A;  2HSN A;  4J57 E;  3GYK A;  2YNX A;  2X4A A;  4N0Z A;  4XTS A;  4EE0 A;  2D2Z A;  1OC8 A;  2HE3 A;  1SYR A;  4MF5 A;  3KXO A;  1V2A A;  4PX1 A;  3Q18 A;  4MNN A;  1EOH A;  22GS A;  1NM3 A;  4L5L A;  1AQV A;  1K0N A;  3SWL A;  2R0G A;  3IA1 A;  2XPE A;  4Q5Q A;  4J2F A;  4GLT A;  5ECK B;  2K8V A;  3BJ5 A;  2KOK A;  2K8S A;  1PD2 1;  3TOU A;  2DKI A;  4GQF A;  2XPD A;  1EZK A;  5DQS A;  5KOX A;  1A2M A;  2CAI A;  2J9H A;  5IMD A;  2KHP A;  3TJB A;  3KMO A;  2BTO T;  3DKS A;  2RUF A;  2MYG A;  2L59 A;  3WGX A;  3ZML A;  5LCZ A;  1GTU A;  3IV4 A;  3CRU A;  1WMJ A;  1WE0 A;  2IPA A;  4KND A;  5ECP B;  1SK1 A;  5G31 A;  3QMX A;  1IYH A;  1AUC A;  5A4W A;  3UVH A;  4AKH A;  4TRX A;  5CRW A;  16GS A;  3TOT A;  3KMN A;  3A3T A;  5D96 A;  4EDZ A;  1OKD A;  2B3S A;  3ZYW A;  5AIX A;  3RBT A;  4G19 A;  3MNG A;  4XRA A;  5CP1 A;  3LXT A;  2I81 A;  2AYT A;  3FW2 A;  4BWQ A;  4DVC A;  5J40 A;  3APQ A;  1O81 A;  4RQX A;  1PQN A;  2WS2 A;  2I4A A;  4K9Z A;  3RPN A;  5LNK e;  4MCU A;  4I97 A;  1AQX A;  4NMU A;  1ZYP A;  2C8U A;  5GAN D;  3BOA A;  2NBS A;  3W8J A;  4CY8 A;  1QGV A;  3O3T A;  3R3E A;  1B8X A;  4TOP A;  4F0C A;  3PIN A;  3UAR A;  4TXO A;  3HVV A;  2VM1 A;  3QPM A;  2YPM A;  4G2E A;  1S3A A;  3WYW A;  2PBJ A;  2I1U A;  1FB6 A;  5DCG A;  2VLU A;  2P0G A;  1QUW A;  5ENU A;  2QSI A;  2IJY A;  5DAK A;  3D6I A;  4OD7 A;  4IP1 A;  1EEM A;  1AIU A;  1TP9 A;  3GH6 A;  4HZ2 A;  1TI3 A;  2H0H A;  1VF3 A;  2A2P A;  3N5O A;  1RQM A;  1FOV A;  1GTI A;  3TJG A;  2DKH A;  2TRC P;  1PN0 A;  3G7Y A;  3DEX A;  4ZL7 A;  4PQI A;  5D9W A;  1UN2 A;  4POL A;  1SK0 A;  2RM6 A;  1TK5 B;  2ZCT A;  1T1V A;  1Z9H A;  4MPF A;  4CHS A;  5J9C A;  4Z2U A;  2PER A;  2PU9 C;  4MF6 A;  2H0I A;  2H6X A;  2HFD A;  3IK9 A;  4GRF A;  3LEF A;  4O92 A;  3KH9 A;  1YY7 A;  1ST9 A;  1KNG A;  2CVB A;  2DBC A;  2LNT A;  2LNS A;  1EEJ A;  3DIE A;  3IR4 A;  1N8J A;  5F8B A;  2AAW A;  4K0N A;  3Q74 A;  2OA7 A;  3P2A A;  1A0F A;  2WDU A;  5J4V A;  5A5K A;  1F2E A;  5KN1 A;  1C72 A;  3IRA A;  3LWA A;  2DJ1 A;  1SK2 A;  1YEP A;  1WP0 A;  3MAK A;  1EP7 A;  4OO5 A;  4IN0 A;  2IMK A;  5IOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...