2C3TA

Human glutathione-s-transferase t1-1, w234r mutant, apo form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
239
structure length
239
Chain Sequence
b'GLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPRVLAMIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE THETA 1
publication title Structural Basis of the Suppressed Catalytic Activity of Wild-Type Human Glutathione Transferase T1-1 Compared to its W234R Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 239
sequence length 239
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c3tA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c3tA01
2BMXA 4KSOA 4ULXA 5DCHA 5IMFA 2OJLA 5HR2A 1GSDA 5ECRB 2FWEA 4LMWA 2XPEA 3VWUA 1XW9A 1I5GA 2WJUA 4KX4A 4J57E 2CAQA 5DCGA 2B5XA 3KP8A 4HU9A 3CBUA 4ECBA 3SBCA 2H6ZA 2DMLA 2HZFA 4HQZA 4TKYA 5KN0A 1PN9A 5DAKA 2VAFA 4PQ1A 1A0RP 4MZCA 1RW1A 1U88A 3F8UA 4JZQA 1MTCA 2CAIA 2VIMA 4L0WA 3LWAA 1PD21 1F3BA 2C4JA 3P8WA 3ZLPA 1EWXA 1DE1A 2YNXA 1A8LA 4IVFA 3EVIA 5ECSA 3L4NA 2LRNA 3GX8A 4HZ2A 4GCIA 1TK8B 2IFQA 4XRAA 1YKCA 3GRXA 4EKZA 2IMKA 4BVYB 1AAZA 2G0FA 2JACA 4WF4A 3FR3A 3HKRA 2P5QA 5IO2A 4WR5A 5EVOA 1K3YA 3IHQA 2C0FA 3HJOA 4TR0A 5J9CA 5AGYA 3L9UA 1A24A 1E6BA 3HVSA 1XFLA 2MMOA 3LXTA 3HD5A 1EP7A 3GL5A 5CO3A 3LYPA 2FD3A 2LNTA 1G0TA 2HNLA 4GSSA 3GHAA 1XW5A 1T4YA 4YAPA 3LEFA 2HRAA 2C0GA 1M9AA 4K0GA 4DSSB 1J0FA 5CRHA 1IYIA 4G0IA 3VLNA 3CXGA 4IJ3A 1Z5YE 2VD0A 2F9SA 3TJFA 1PRXA 1GL8A 5B8BA 2K8SA 2LKUA 4V2LA 3PR8A 1JLWA 1S3DA 5CRWA 2CVDA 4EO3A 3RHBA 4GSNA 3IAM2 3WGDA 20GSA 2PU9C 4IP1A 4TRXA 3W8SA 4IJIA 1LU4A 3TRQA 2VCZA 2FWGA 1TI1A 1TI3A 4XIHA 1YEXA 2CT6A 5DALB 2JZSA 4KUNA 3TKPA 4ZB9A 5IQYA 2PPTA 1AXDA 11GSA 2CX3A 4Q5NA 4BVYA 3D4MA 1W4VA 8GSSA 1SD9A 3EC3A 3MWHA 2AYTA 1IYHA 2YV9A 1SKRB 4K1FA 3A2VA 4XRDA 2IMIA 4KSMA 5E59A 1M7TA 2H74A 3DKSA 3V1WA 1ZZYA 3I43A 1XWAA 5B7CA 2H76A 3ZVJD 1U3IA 4PUFC 2LQQA 3H79A 4D73A 1VF4A 3EURA 1Z6MA 2F8FA 1K3LA 3WT1A 2GZPA 1XWGA 3SWLA 2NDOA 2R4VA 3M1GA 2LNSA 4TXOB 4OCFA 2DC5A 2LRTA 4MF7A 1BG5A 1OE8A 4FQUA 2HZEB 1HYUA 4O5RA 4OO4A 1NSWA 3FY7A 5CNWA 1XWKA 4LL1B 1JHBA 4PURA 2H6XA 4WBRD 5F8BA 3UMAA 4TN8A 3VPTA 19GSA 3ZVJA 4I8BA 3P90A 2LRCA 3TJKA 2N5AA 4AGSA 4LMVA 5DALA 1G6YA 3W6GA 1V58A 4XS4A 3ZIVA 3GA4A 3OR5A 1EV4A 1Y6EA 4WR4A 4MJEA 3TKSC 2B5EA 1O81A 3W8JA 4ECCA 3A2WA 3HY2A 5ECNB 4KGIA 4ZBBA 4JR4A 4POKA 3D0ZA 1T7PB 1OC9A 2WFCA 1DSBA 3H4KA 3J7Yb 2YV7A 1YJ6A 2L4QA 3WGXA 3IBHA 3TGZA 5KN3A 1A2JA 2IN3A 1VF3A 2OBIA 1TRSA 5ECPB 1Q4JA 3FZ9A 3M9JA 1PA3A 3I9V2 1F37A 4MF5A 1B4PA 3O3TA 2K6VA 5L71A 1B9XC 2B1KA 1FG4A 1GH2A 1V9WA 4TR1B 5J3RA 2HZEA 4XS6A 2WRTA 4GQCA 1XCCA 2WGRA 1GLPA 1GSSA 2OE1A 1VRSD 2NVLA 4JBBA 1GP1A 2B7KA 1GNEA 4E8EA 4OFTA 2YOIA 3D22A 4FO5A 2XBIA 2QKEA 3F6DA 4F0BA 5H5SA 3FKFA 1URMA 2HSYA 1SKWB 4TVEA 4RQRA 4MCUA 1MD3A 2HXKA 3C73A 3M0FA 2DJ1A 4NHZA 4PNGA 1MDKA 3LYKA 1WOUA 4AJ8A 2I81A 4F03A 3VWWA 3QAGA 4DSQA 5A4WA 4OCEA 5IMVA 2H1DA 4L8EA 1YDKA 5ECKB 3RBTA 5INYA 4WETA 3TKQA 1FO5A 1G6WA 3DYRA 4GWRA 2M80A 1XWBA 5ELAA 5F07A 5EY6A 1X9WB 4MK3A 1KBNA 1YKAA 2B7JA 4ZILA 2X8GA 4V2NA 3PGTA 4JU5A 5ID2A 1K0CA 1YZXA 2FLSA 4FH8A 1XVWA 1UN2A 4IW9A 4CDOA 3F4RA 3HZ8A 4HI7A 1CQHA 3R3EA 4TR1A 4YH2A 2FY6A 2H6YA 1A2MA 5CAXA 3ME8A 4K2DA 5IO0A 2HQTA 4IHUA 5LD0A 4EUYA 3VURA 13GSA 4MF6A 4MP4A 3Q74A 5GSSA 2XPDA 1WPIA 1PL1A 4K7OA 2CQ9A 1HNAA 1U3AA 4I2UA 1TK0B 4CHSA 1F9MA 1ABAA 1XOBA 2EIRA 3MAKA 2GDRA 1PL2A 1BAYA 4EE0A 2M72A 2DMMA 2VL3A 4RI7A 3UARA 2GSQA 4WF5A 2TIRA 5D9XA 1PSQA 2DSAA 1JZDA 3DIEA 3KZQA 6GSXA 6GSVA 2Z9SA 2GSRA 3IOSA 3DMLA 5G5EA 2PVQA 3VI7A 3IR4A 2JSZA 4HEA2 4POMA 1TW9A 3F0IA 1VF1A 1T1VA 4EL1A 3QDNA 2AV4A 3APOA 1CQGA 4NPBA 1M0UA 4OMVA 5EPFA 4AJ7A 4MABA 3UAPA 1UVZA 4NHWA 1ZYQB 4KDXA 4EC0A 3MNGA 4ML6A 3FR6A 3RPNA 2YWNA 1M99A 3GUSA 2TRCP 1EOGA 3HCZA 4CW9A 2FUG2 1SKSB 3U5RE 3QFAC 3FK8A 3KXOA 2LJKA 2OADA 5DQSA 2DIYA 3FW2A 2O8VB 2NPBA 5BMUA 5ENUA 2HSMB 4K0NA 1FW1A 1NHYA 3G7YA 4YQUA 3KH7A 1KTEA 5ECIB 1SJIA 2CVBA 22GSA 1JZOA 1R5PA 3WD6A 2MBTA 2FA8A 4PGTA 3APSA 2YPMA 2A2RA 2HRKA 4IQ1A 2YZUA 4J2FA 4RI6A 4MMMA 5C00A 3E9JB 5D96A 3O6TA 2QC7A 3J7Yk 3TUEA 2WDUA 2P0GA 1W89A 1YQ1A 4NWYA 1SYRA 1XWCA 2GLRA 2FA4A 3IPZA 4WXTA 3ZZXA 3Q19A 1UC7A 2WS2A 5DVBA 3ERWA 1HQOA 2AUVA 4ZL7A 4JR6A 5IMCA 3VFIA 5JWOB 4OD7A 3IK9A 1XW6A 2B6MA 4XTSA 3GKMA 3F3QA 2DJ2A 3GURA 3QPMA 3ZL5A 5IMZA 3TOUA 3UBKA 4I97A 3NIVA 2JZTA 3DRNA 3TCOA 3GNJA 4TW5A 1VGLA 2RUFA 4N0ZA 2LS5A 1F2EA 3QD9A 2X99A 3M3MA 3PINA 1HD2A 3BOAA 3QAVA 1EP8A 3GTUB 2UZ8A 2H1AA 1PKWA 1TRWA 2CVKA 5G1KA 3D21A 1JFUA 2FNOA 5HR1A 4X43A 1O85A 3A2XA 3NZNA 6GSSA 2RLIA 1G7EA 2LJAA 1U6TA 1AIUA 4N10A 3EMXA 5JCUA 3UL3A 1EGRA 2OBKA 1TRVA 3LFLA 3HA9A 4PNFA 1SK0A 3LGCA 1BQ7A 2I4AA 2O7KA 1ERVA 4ML1A 3G7JA 4RUVA 3ZYWA 1GUKA 3ME7A 1T3BA 3FZ4A 3BJ5A 4HDEA 5HQPA 4WEYA 1F6MC 3P7XA 3WYWA 2RM6A 2MBSA 2DJKA 2GZZA 4DVCA 3TRPA 4MLYA 4PQIA 2YZHA 3TKRA 3UOMA 2L57A 2VCVA 3E3EA 3HHVA 4Q5RA 1OC3A 3IE3A 6GSYA 3F3RA 4IBPA 3UVHA 1TJDA 6GSTA 1PMTA 3GH6A 1PKZA 4G0KA 3ZRDA 1M2DA 3GH9A 2DJ0A 5KN1A 5HR3A 1NM3A 3IC4A 3GTUA 1YF0A 2NBSA 4P3YB 4V1Ag 1SYXA 5ECQB 2GVPA 2REMA 1ACVA 2BJXA 3QCPA 3KD0A 5GZZB 4GSTA 3P2AA 2C80A 4DSSA 4EVMA 4ISDA 2ALBA 4MZBA 1SU9A 3DXBA 4GXZA 3EU3A 2VLTA 1S3AA 2GQKA 2H30A 3I6AA 4KAEA 1FHEA 1USBA 5G2ZA 7GSSA 2OA7A 5CP1A 2VCWA 2E2GA 2JSYA 2VUPA 1GUMA 1XXUA 1O6JA 3EE2A 2O89A 3C1SA 1GTBA 4KW6A 2MMZA 5G30A 2RUEA 4HUAA 2C3TA 3G9BA 3C7MA 3ZITA 1TKDB 3IC8A 2HI7A 4DSRA 4MH3A 5DQYA 5B6MA 1WIKA 3VWVA 4LLRA 1O73A 2YCDA 2K18A 2ZNMA 3G7IA 2YJ7A 3QOUA 1M9BA 2HSNB 4IQAA 3NOFA 2VD1A 1XPVA 3F63A 4MJAA 1K3OA 4TXOA 2KHPA 2X8CA 4XCSA 2R2JA 4MDCA 3KTLA 3GSSA 5GAND 1A8YA 1QQ2A 2B1LA 2L4CA 2N5BA 3C8EA 4PUAA 4KNDA 4OFNA 1SD8A 1ST9A 4Q5FA 2B5YA 1XOAA 1WE0A 3N9JA 2F51A 3UBLA 4WKWA 3GKNA 5COHA 3IXRA 2HE3A 1MEKA 2R5GA 3K8NA 1SJ6A 1ZCPA 2IPAA 3BD2A 2DIZA 2RIIA 6GSUA 4POLA 5LCZA 1BX9A 2F3MA 1V40A 3DVXA 1PGTA 2MMNA 2FGXA 4L5LA 3L9VA 5CYYA 1A2LA 3KMNA 3TDGA 2HSHA 10GSA 4ID0A 3HYPA 2VLVA 3WGEA 1TDIA 2WB9A 1K0BA 1GRXA 2MZCA 5C04A 2N5FA 1SK1A 1R7HA 3H93A 1B48A 1NHOA 1FOVA 3F9UA 4HOJA 5D8IA 2GQMA 1JZRA 5ECOB 2R3XA 1GSEA 3CSIA 4G9HA 4MPGA 4HQSA 1T8EB 2GTUA 1B8XA 1ZL9A 2FWHA 3A3TA 1THOA 2X8HA 3EYTA 2E0QA 4ZIJA 4J56E 1GTUA 1TP9A 3TKSE 3GYKA 3U6VA 5B6NA 3GKKA 2FHEA 4I6XA 3ZMKA 3F6FA 1V98A 2VM1A 2VLUA 4O7HA 3CSHA 4PTSA 2XC2A 1XZOA 3TJBA 3QR6A 2CA8A 3VPQA 3GN3A 3GV1A 1M2AA 4HJ2A 17GSA 1R4WA 3JCML 5EL8A 5FT3A 1KEBA 2V32A 2H0GA 4X1UA 2H72A 1SJZA 4KDYA 5IOXA 2DBCA 5DJLA 3KEBA 18GSA 2WZ9A 4MPFA 1GUHA 3HZ4A 3C71A 4MH2A 4G10A 2HRFA 3BCIA 2GQLA 1Z9HA 2MMAA 3EU4A 4TXVA 1J08A 1DBYA 4DEJA 1GLQA 4GTUA 5A4VA 5CRGA 3KH9A 2M46A 5ECLB 3FR9A 2C3NA 2VOCA 2VL9A 2OKAA 2L59A 1GSUA 1FVKA 3IAS2 1ERUA 4YAVA 4V1Ap 3H1NA 1JLVA 4YQVA 1AQWA 2L6DA 3GKXA 5HFKA 4ILFA 4KH7A 4ZB8A 2PGTA 2HRNA 4FIWA 4FYUA 2I9HA 3I69A 4IN0A 4IP6A 3US3A 5IMAA 4EDYA 2YWIA 3KP9A 1O8XA 4OO5A 5JWQB 4MA9A 5KN2A 2IFQB 3A5WA 2X64A 2FCHA 5LNKe 2XHFA 1EEJA 4GF0A 4AF2A 1I9DA 5B8AA 3FZAA 1RK4A 5A4UA 5G1LA 2E7PA 3ZFBA 4PX1A 3UJ1A 1WP0A 2GZYA 3N5OA 3IDVA 4K6XA 3TRXA 2EC4A 3F4TA 3PPUA 3FEUA 2H71A 1JZWA 1TRUA 3UEMA 4JRRA 5GAPD 4IKHA 2A4VA 6GSWA 4KCAA 3BCKA 1TU7A 3IK7A 2GS3A 5H5RA 3HVVA 3ZREA 4Z7XA 5FWGA 4FYCA 5FHIA 4BPYA 4G2EA 4ZL9A 1ERWA 4ZL8A 3CRTA 1FAAA 3ZFLA 3VK9A 1LJRA 5G5FA 4POBA 1DUGA 2LTKA 1THXA 2LV3A 1A0FA 1X5EA 2PN8A 3KCMA 4NXIA 2PBJA 1K0AA 3EINA 2YWMA 3KM6A 1AW9A 2LQOA 2OE3A 1KNGA 1PQNA 4TR3A 4HS1A 4GLTA 5DBQA 4K7IA 5CREA 1EGOA 4G19A 1EV9A 2HSMA 4K9ZA 3TKSA 16GSA 5HFIA 3M8NA 1QUWA 2YWOA 4F2IA 3R2QA 2R37A 3KJYA 4BA7A 1AUCA 2PUKC 3QFBC 1Z3EA 1FVJA 4NMUA 3GSTA 4FYBA 1EZKA 1ZOFA 3DD3A 1AQXA 4K8MA 2V41A 5IIZA 4GQFA 2C3QA 3CTGA 1OKTA 1TK5B 4TR4A 5J41A 4D73B 1GWCA 2ON5A 2CZ2A 1QGVA 1GNWA 3RDWA 4BVXB 2IJYA 1YF1A 4KA0A 2JL4A 2HT9A 5H5QA 3UIWA 3Q6OA 3S9FA 1EOHA 3ISOA 5ECHB 5F0GA 1OAZA 1QMVA 2DJ3A 3HJPA 2B3SA 2H70A 4L0UA 2J23A 2VCQA 3RHCA 2GSSA 3ERFA 3QMXA 4OFMA 2C0DA 4EDZA 2C8UA 1FB0A 1T00A 2H75A 1K0DA 4L5OA 3KMOA 4TOPA 4JEDA 1B9YC 3ED3A 3CYNA 1Z7PA 4USSA 2KUCA 2QSIA 3DVWA 1BYEA 2GGTA 1GULA 3E0UA 4XS4B 2YJHA 1Z7RA 3ZIJA 1M2BA 4EF0A 2H73A 4G0LA 4PQHA 5F05A 3ERGA 5D9TA 3GX0A 1OC9B 3O76A 2O87A 3GFKA 5DDLA 1A23A 2K9FA 2EIOA 4PXOA 4GRFA 1V2AA 1Y25A 1UA5A 1GSFA 1NW2A 3TJJA 2JU5A 1ON4A 1O8WA 1XIYA 5D73A 4BVXA 2C0EA 3CTFA 3M9KA 2H8LA 5ELGA 2C1YA 2QGVA 5IPGA 2AB6A 3CSJA 1ZGNA 2PMTA 2PERA 1MDIA 2VCXA 1X5CA 2L5LA 3DWVA 2F8AA 1GSQA 2WCIA 1AC1A 5DJMA 14GSA 1ILOA 1QXHA 2H66A 2KOKA 1YEPA 3FHKA 9GSSA 1ZYEA 2IMDA 2H0IA 1RQMA 3IV4A 2JADA 1EEMA 3EWLA 4BL7B 1B4QA 5IMDA 4O92A 5JCGA 4WBJA 4XHMA 1OC8A 3QAWA 2AHEA 3HJMA 1ERTA 1MDJA 3CMIA 4O32A 1PX7A 3LG6A 4N11A 1HNCA 1TU8A 1S3CA 1X0RA 3TOTA 4IGJA 3BBYA 3LQ7A 4F82A 1C72A 2GSTA 5ABRA 2DLXA 1BEDA 4H86A 5IM9A 3KGKA 3TB2A 1WWJA 2VO4A 2P31A 2YP6A 1Z6NA 4E8HA 2FWFA 1GTAA 5G31A 3VI5A 5HFGA 4KF9A 1J9BA 2KLXA 3HVXA 1N2AA 4ECJA 5J4UA 5GSTA 5ECMB 1O7UA 2KP1A 3LORA 4RQXA 5ID2B 3GMFA 3IA1A 3CRUA 1MD4A 3RAZA 1AQVA 2XBQA 1PX6A 1SL1B 1ZMAA 4OWYA 2JZRA 5IOWA 1OKDA 2D2ZA 2IIYA 3L78A 2CZ3A 3LXZA 2VL2A 2K8VA 1SENA 3L0HA 1N8JA 2PWJA 1HNBA 4KE3A 4KDUA 1TTZA 2R6KA 5D9VA 4BWSA 2HLSA 2IMFA 5AN1A 4ACSA 5KEJA 2H0HA 2IL3A 4BL7A 2YN1A 4MJCA 5AISA 5AIVA 3D6IA 1X9SB 2H19A 4ECIA 3KTBA 1OE7A 4IELA 3HDCA 1Q98A 4IS0A 2VCTA 4ZXGA 2PVOC 3TJGA 4HZ4A 2I1UA 4YQMA 4HU7A 1K0MA 4Q5QA 1H75A 3FYGA 4ZBDA 3MDKA 5J9BA 4N0VA 4I5QA 4MZWA 5D93A 1X5DA 2HFDA 2O85A 1WMJA 3APQA 2EIQA 4QL9A 1OYJA 1SK2A 2L5OA 4K7NA 3D4TA 3Q18A 12GSA 5F06A 1R26A 1WJKA 1OVNA 2H01A 1YY7A 2A2SA 3PH9A 4X0XA 3AY8A 2ZCTA 1SL0B 4JE1A 1R5AA 2I3YA 4KB3A 1SL2B 4F0CA 5A5KA 2L6CA 3UVTA 4QQ7A 1QK8A 2AAWA 4EXJA 1X9MB 2V1MA 4LL4B 2WULA 1E2YA 2ES7A 5JCWA 4KCEA 5E4WA 3DEXA 3GIXA 3MSZA 4HJMA 3LJRA 1LBKA 2LUSA 2V2GA 2G2QA 4XS1A 2LEGA 1V57A 4NV2A 3H8QA 2GT5A 1U87A 3ZMLA 3RPPA 2IMEA 3GL3A 2E2MA 2YANA 2H1GA 2NTOA 4V2MA 2VM2A 4QL7A 3FZ5A 4I2TA 3FRCA 3ZTLA 1WRYA 2HRKB 5D9WA 2ON7A 2CV4A 5CRDA 2J9HA 4F9ZA 2HYXA 2CX4A 2DJJA 4NV5A 2IWTA 1TOFA 4MJBA 4BWQA 3KIJA 5J5NA 1K0OA 5DAKB 2ZUPA 1DE2A 4AJ6A 3EMPA 3C1RA 1VF2A 5JWRB 4NAXA 2OACA 3HXSA 2H1BA 2AJQB 1T4ZA 1G7OA 2V6OA 1K0NA 2GT6A 1FB6A 2OE0A 1GSYA 5IPHA 2RM5A 1F3AA 2LSTA 1XBSA 4ZBAA 3F4SA 3WT2A 2KP2A 3IRAA 2P5RA 1XVQA 5HR0A 1H4OA 4ZB6A 2MYGA 4LA1A 2VL2C 1BJXA 2TRXA 2LJRA 2BTOT 3LSZA 1QFNA 2V6KA 3VWXA 5AIXA 3DGQA 3L9SA 3D5JA 1ML6A 4N30A 1TXXA 1GTIA
chains in the Genus database with same CATH superfamily
2BMXA 4KSOA 4ULXA 5DCHA 5IMFA 2OJLA 5HR2A 1GSDA 5ECRB 2FWEA 4LMWA 2XPEA 3VWUA 1XW9A 1I5GA 2WJUA 1FOHA 4KX4A 4J57E 2CAQA 5DCGA 2B5XA 3KP8A 4HU9A 3CBUA 4ECBA 3SBCA 2H6ZA 2DMLA 2HZFA 4HQZA 4TKYA 5KN0A 1PN9A 4O5QA 5DAKA 2VAFA 4PQ1A 1A0RP 4MZCA 1RW1A 1U88A 3F8UA 4JZQA 1MTCA 2CAIA 2VIMA 4L0WA 3LWAA 1PD21 5A34B 1F3BA 2C4JA 3P8WA 3ZLPA 1EWXA 1DE1A 2YNXA 1A8LA 2O36A 4IVFA 3EVIA 5ECSA 3L4NA 2LRNA 2O3EA 4GDFA 3GX8A 4HZ2A 4GCIA 2WW0A 1TK8B 2IFQA 4XRAA 1YKCA 3GRXA 4EKZA 2IMKA 4BVYB 1AAZA 2G0FA 2JACA 4WF4A 3FR3A 3CHXC 3HKRA 2P5QA 5IO2A 4WR5A 5EVOA 1K3YA 3IHQA 2C0FA 3HJOA 4TR0A 5J9CA 5AGYA 3L9UA 1A24A 1E6BA 3HVSA 1XFLA 2MMOA 3LXTA 3HD5A 1EP7A 3GL5A 5CO3A 3LYPA 2FD3A 2LNTA 1G0TA 2HNLA 4GSSA 3GHAA 1XW5A 1T4YA 4YAPA 3LEFA 4K2XA 2HRAA 2C0GA 1M9AA 4K0GA 4DSSB 1J0FA 3HVNA 4N3ZA 5CRHA 1IYIA 4G0IA 3VLNA 3CXGA 4IJ3A 2EFCA 1Z5YE 2VD0A 2F9SA 4AKXB 3TJFA 1PRXA 1GL8A 5B8BA 2K8SA 2LKUA 4V2LA 3PR8A 1JLWA 1S3DA 5CRWA 2CVDA 4EO3A 3RHBA 4GSNA 3IAM2 3WGDA 20GSA 2PU9C 4IP1A 4TRXA 3W8SA 4IJIA 1LU4A 3TRQA 2VCZA 2FWGA 1TI1A 1TI3A 4XIHA 1YEXA 2CT6A 5DALB 2JZSA 4QMKA 4KUNA 3TKPA 4ZB9A 5IQYA 2PPTA 1AXDA 11GSA 2CX3A 4Q5NA 4BVYA 3D4MA 1PN0A 1W4VA 5J4YA 8GSSA 1SD9A 3EC3A 3MWHA 2AYTA 1IYHA 2YV9A 1SKRB 4K1FA 3A2VA 4XRDA 2IMIA 4KSMA 5E59A 1M7TA 2H74A 3DKSA 3V1WA 1ZZYA 3I43A 1XWAA 5B7CA 2H76A 3ZVJD 1U3IA 4PUFC 2LQQA 3H79A 4D73A 1VF4A 3EURA 2EFHA 1Z6MA 2F8FA 1K3LA 3WT1A 2GZPA 1XWGA 3SWLA 2NDOA 2R4VA 3M1GA 2LNSA 4TXOB 3HMJG 4OCFA 2DC5A 2LRTA 4MF7A 1BG5A 1OE8A 4FQUA 2HZEB 1HYUA 4O5RA 4OO4A 1NSWA 3FY7A 1N25A 5CNWA 1XWKA 4LL1B 1JHBA 4PURA 2H6XA 4WBRD 5F8BA 3UMAA 4TN8A 3VPTA 19GSA 3ZVJA 4I8BA 3P90A 2LRCA 3TJKA 2N5AA 4FXYP 4AGSA 4LMVA 2O5VA 5DALA 1G6YA 3W6GA 1V58A 4XS4A 3ZIVA 3GA4A 3OR5A 4CY6A 1EV4A 1Y6EA 4WR4A 4MJEA 3TKSC 2B5EA 1O81A 3W8JA 4ECCA 3A2WA 3HY2A 5ECNB 4KGIA 4ZBBA 4JR4A 4POKA 3D0ZA 1T7PB 4W66A 1OC9A 2WFCA 1DSBA 3H4KA 3J7Yb 2YV7A 1YJ6A 2L4QA 3WGXA 3IBHA 3TGZA 5KN3A 1A2JA 2IN3A 1VF3A 2OBIA 1TRSA 5ECPB 1Q4JA 3FZ9A 3M9JA 1PA3A 3I9V2 1F37A 4MF5A 1B4PA 3O3TA 2K6VA 5L71A 1B9XC 2B1KA 2R0PA 1FG4A 1GH2A 1V9WA 4TR1B 5J3RA 2HZEA 4XS6A 2WRTA 4GQCA 1XCCA 2WGRA 1GLPA 1GSSA 2OE1A 1VRSD 2NVLA 4MNNA 4JBBA 1GP1A 2B7KA 1GNEA 4G01A 4E8EA 4AKGA 1SVOA 4OFTA 2YOIA 3D22A 4FO5A 2XBIA 4O5UA 2QKEA 3F6DA 4F0BA 5H5SA 3FKFA 1URMA 2HSYA 1SKWB 4TVEA 4RQRA 4ZB7A 4MCUA 1MD3A 2X49A 2WVYA 2HXKA 3C73A 3M0FA 2DJ1A 4NHZA 4PNGA 1MDKA 3LYKA 1WOUA 4AJ8A 2I81A 4F03A 3VWWA 3QAGA 4DSQA 5A4WA 4OCEA 5IMVA 2H1DA 4L8EA 1YDKA 5ECKB 3RBTA 5INYA 4WETA 3TKQA 1FO5A 1G6WA 3DYRA 4GWRA 2M80A 1XWBA 5ELAA 5F07A 5EY6A 1X9WB 4MK3A 1KBNA 1YKAA 2B7JA 4ZILA 2X8GA 4V2NA 3PGTA 4JU5A 5ID2A 1K0CA 1YZXA 2FLSA 4FH8A 1XVWA 1UN2A 4IW9A 4CDOA 3F4RA 3HZ8A 4HI7A 1CQHA 3R3EA 4TR1A 4YH2A 2FY6A 2H6YA 1A2MA 5CAXA 3ME8A 4AKIA 4K2DA 5IO0A 2HQTA 4IHUA 5LD0A 4EUYA 3VURA 13GSA 4MF6A 4MP4A 5J4VA 3Q74A 5GSSA 2XPDA 1WPIA 1PL1A 4K7OA 2CQ9A 1HNAA 1U3AA 4I2UA 5BMUB 1TK0B 4CHSA 1F9MA 2A4HA 5J47A 1ABAA 1XOBA 2EIRA 3MAKA 2GDRA 1PL2A 1BAYA 4CY8A 4EE0A 2M72A 2DMMA 2VL3A 4RI7A 3UARA 2GSQA 4WF5A 2TIRA 5D9XA 1PSQA 2DSAA 1JZDA 3DIEA 3KZQA 6GSXA 6GSVA 2Z9SA 2GSRA 3IOSA 4EIPA 3DMLA 5G5EA 2PVQA 2EFEA 3VI7A 3IR4A 2JSZA 4HEA2 4POMA 1TW9A 3F0IA 1VF1A 1T1VA 4EL1A 3QDNA 2AV4A 3APOA 1CQGA 4NPBA 1M0UA 4OMVA 5EPFA 4AJ7A 4MABA 3UAPA 1UVZA 4NHWA 1ZYQB 4KDXA 4EC0A 3MNGA 4ML6A 3FR6A 3RPNA 2YWNA 1M99A 3GUSA 2TRCP 1EOGA 3HCZA 4CW9A 2FUG2 1SKSB 3U5RE 3QFAC 3FK8A 3KXOA 2LJKA 2OADA 5DQSA 2DIYA 3FW2A 2O8VB 2NPBA 5BMUA 3CWGA 5ENUA 2HSMB 4K0NA 1FW1A 1NHYA 3G7YA 4YQUA 3KH7A 1KTEA 5ECIB 1SJIA 2CVBA 22GSA 1JZOA 1R5PA 3WD6A 2MBTA 2FA8A 4PGTA 3APSA 2YPMA 2A2RA 2HRKA 4E68A 4IQ1A 2YZUA 4J2FA 4RI6A 4MMMA 5C00A 3E9JB 5D96A 3O6TA 2QC7A 3J7Yk 5J40A 3TUEA 2WDUA 2P0GA 2WW1A 1W89A 1YQ1A 2WVXB 4NWYA 1SYRA 1XWCA 2GLRA 2FA4A 3IPZA 3IHGA 4WXTA 3ZZXA 3Q19A 1UC7A 2WS2A 5DVBA 3ERWA 1HQOA 2AUVA 4ZL7A 4JR6A 5IMCA 1ZYNA 3VFIA 5JWOB 4OD7A 3IK9A 1XW6A 2B6MA 4XTSA 3GKMA 3F3QA 2DJ2A 3GURA 3QPMA 3ZL5A 5IMZA 3TOUA 3UBKA 4ICYA 4I97A 3NIVA 2JZTA 3DRNA 3A5IA 1M3IA 3TCOA 3GNJA 4TW5A 1VGLA 2RUFA 4Z2UA 4N0ZA 2LS5A 1F2EA 3QD9A 2X99A 3M3MA 3PINA 1HD2A 3BOAA 3QAVA 1EP8A 3GTUB 2UZ8A 2H1AA 1PKWA 1TRWA 2CVKA 5G1KA 5KOWA 3D21A 1JFUA 2FNOA 5HR1A 4X43A 1O85A 3A2XA 3NZNA 6GSSA 2RLIA 3RFRC 1G7EA 2LJAA 1U6TA 1AIUA 4N10A 3EMXA 5JCUA 3UL3A 5A34A 1EGRA 2OBKA 1TRVA 3LFLA 3HA9A 4PNFA 1SK0A 3LGCA 1BQ7A 2I4AA 2O7KA 1ERVA 4ML1A 3G7JA 4RUVA 3ZYWA 1GUKA 3ME7A 1T3BA 3FZ4A 2R0GA 3BJ5A 4HDEA 4HSCX 5HQPA 4WEYA 1F6MC 3P7XA 3WYWA 2RM6A 2MBSA 2DJKA 2GZZA 4DVCA 3TRPA 4MLYA 4PQIA 2YZHA 3TKRA 3UOMA 2L57A 2VCVA 3E3EA 3HHVA 4Q5RA 1OC3A 3IE3A 6GSYA 3F3RA 4IBPA 3UVHA 1TJDA 6GSTA 1PMTA 3GH6A 1PKZA 4G0KA 3ZRDA 1M2DA 3GH9A 2DJ0A 5KN1A 5HR3A 1NM3A 3IC4A 2NBSA 3GTUA 1YF0A 4P3YB 4V1Ag 1SYXA 5ECQB 2GVPA 2REMA 1ACVA 2BJXA 3QCPA 3KD0A 5GZZB 4GSTA 3P2AA 2C80A 4DSSA 4EVMA 4ISDA 5A5HB 2ALBA 4MZBA 1SU9A 3DXBA 4GXZA 3EU3A 2VLTA 1S3AA 2GQKA 2H30A 3I6AA 4KAEA 1FHEA 1USBA 5G2ZA 7GSSA 2OA7A 5CP1A 2VCWA 2E2GA 2JSYA 2VUPA 1GUMA 1XXUA 1O6JA 4YKGA 3EE2A 2O89A 3C1SA 1GTBA 4KW6A 2MMZA 5G30A 2RUEA 4HUAA 2C3TA 3G9BA 3C7MA 3ZITA 1TKDB 3IC8A 2HI7A 4DSRA 4MH3A 2WZSA 5DQYA 5B6MA 1WIKA 3VWVA 4LLRA 1O73A 1BG1A 2YCDA 2K18A 1I1IP 2ZNMA 2DKHA 3G7IA 2YJ7A 3QOUA 1M9BA 2HSNB 4IQAA 3NOFA 2VD1A 1XPVA 3F63A 4MJAA 1K3OA 4TXOA 2KHPA 2X8CA 4XCSA 2R2JA 4MDCA 3KTLA 3GSSA 5GAND 1A8YA 1QQ2A 2B1LA 2L4CA 2N5BA 1SVLA 3C8EA 4A5PA 4PUAA 4KNDA 4OFNA 1SD8A 1ST9A 4Q5FA 2B5YA 1XOAA 1WE0A 3N9JA 2F51A 3UBLA 4WKWA 3GKNA 5COHA 3IXRA 2HE3A 1MEKA 2R5GA 3RGBC 3K8NA 1SJ6A 1ZCPA 2IPAA 2WW3A 3BD2A 2DIZA 4PI2C 5A1NB 2RIIA 6GSUA 4POLA 5LCZA 1BX9A 2F3MA 1V40A 3DVXA 1PGTA 4PHZC 4YKFA 2MMNA 2FGXA 1YEWC 4L5LA 1ZYPA 3L9VA 5CYYA 1A2LA 3KMNA 3TDGA 1XG8A 2HSHA 10GSA 4ID0A 3HYPA 2VLVA 3WGEA 1TDIA 2WB9A 1K0BA 1GRXA 2MZCA 5C04A 2N5FA 1SK1A 1R7HA 3H93A 1B48A 1NHOA 1FOVA 3F9UA 4HOJA 5D8IA 2GQMA 1JZRA 5ECOB 2R3XA 1GSEA 3CSIA 4G9HA 4MPGA 4AI6A 4HQSA 2GTUA 1T8EB 1B8XA 1ZL9A 2FWHA 3A3TA 1THOA 2X8HA 3EYTA 2E0QA 4ZIJA 4J56E 1GTUA 1TP9A 3TKSE 3GYKA 3U6VA 5B6NA 3GKKA 2FHEA 4I6XA 3ZMKA 3F6FA 1V98A 2VM1A 2VLUA 4O7HA 3CSHA 4PTSA 2XC2A 1XZOA 3TJBA 3LW9A 3QR6A 2CA8A 3VPQA 3MYDA 3GN3A 3GV1A 1M2AA 4HJ2A 17GSA 1R4WA 3JCML 5EL8A 5FT3A 1KEBA 2V32A 2H0GA 4X1UA 1PFOA 2H72A 1SJZA 4KDYA 2VKZG 5IOXA 2DBCA 5DJLA 3KEBA 18GSA 2WZ9A 4MPFA 1GUHA 3HZ4A 3C71A 4MH2A 4G10A 2HRFA 3BCIA 2GQLA 1Z9HA 2MMAA 3EU4A 4TXVA 1J08A 1DBYA 4DEJA 1GLQA 4GTUA 5A4VA 5CRGA 3KH9A 2M46A 5ECLB 3FR9A 2C3NA 2VOCA 2VL9A 2OKAA 2L59A 1GSUA 1FVKA 3IAS2 1ERUA 4YAVA 4V1Ap 3H1NA 1JLVA 4YQVA 1AQWA 2L6DA 3GKXA 5HFKA 4ILFA 4KH7A 4ZB8A 2PGTA 2HRNA 4FIWA 4FYUA 2I9HA 2WVZA 3EPTA 3I69A 4IN0A 4IP6A 3US3A 5IMAA 4EDYA 2YWIA 3KP9A 1O8XA 4OO5A 2OT3A 5JWQB 4MA9A 5KN2A 2IFQB 3A5WA 2X64A 4K5SA 2FCHA 5LNKe 2XHFA 1EEJA 4GF0A 4AF2A 1I9DA 5B8AA 3FZAA 1RK4A 5A4UA 5G1LA 2E7PA 3ZFBA 4PX1A 3UJ1A 1WP0A 2GZYA 3N5OA 3IDVA 4K6XA 3TRXA 2EC4A 3F4TA 3PPUA 3FEUA 2H71A 1BF5A 1JZWA 1TRUA 3UEMA 4JRRA 5GAPD 4IKHA 2A4VA 6GSWA 4KCAA 3BCKA 1TU7A 3IK7A 2GS3A 5H5RA 3HVVA 3ZREA 4Z7XA 5FWGA 4FYCA 5FHIA 4BPYA 4G2EA 4ZL9A 1ERWA 4ZL8A 3CRTA 3FMWA 1FAAA 3ZFLA 3VK9A 1LJRA 5G5FA 4POBA 1DUGA 2LTKA 1THXA 2LV3A 1A0FA 1X5EA 2PN8A 3KCMA 4NXIA 2PBJA 1K0AA 3EINA 2YWMA 3KM6A 1AW9A 4K5RA 2LQOA 2OE3A 1KNGA 2H1LA 1PQNA 4TR3A 4HS1A 4GLTA 5DBQA 4K7IA 5CREA 1EGOA 4G19A 1EV9A 2HSMA 4Z2TA 4K9ZA 3TKSA 16GSA 5HFIA 3M8NA 1QUWA 2YWOA 2EFDA 4F2IA 3R2QA 2R37A 3KJYA 4BA7A 1AUCA 2PUKC 3QFBC 1Z3EA 1FVJA 4NMUA 3GSTA 4FYBA 1EZKA 1ZOFA 3DD3A 1AQXA 4K8MA 4BIKA 2V41A 5IIZA 4GQFA 2C3QA 3CTGA 2WVXA 1OKTA 1TK5B 4TR4A 5J41A 4D73B 1GWCA 2ON5A 2CZ2A 1QGVA 1GNWA 3RDWA 4BVXB 2IJYA 1YF1A 4KA0A 2JL4A 2HT9A 5H5QA 3UIWA 3Q6OA 3S9FA 3TU3B 1EOHA 2DKIA 3ISOA 5ECHB 5F0GA 1OAZA 1QMVA 2DJ3A 3HJPA 2B3SA 2H70A 4L0UA 2J23A 2VCQA 3RHCA 2GSSA 3ERFA 3QMXA 4OFMA 2C0DA 4EDZA 2C8UA 1FB0A 1T00A 2H75A 1K0DA 4L5OA 3KMOA 4TOPA 4JEDA 1B9YC 3ED3A 3CYNA 1Z7PA 4USSA 2KUCA 2QSIA 3DVWA 1BYEA 2GGTA 1GULA 3E0UA 4XS4B 2YJHA 1Z7RA 5BRTA 3ZIJA 1M2BA 4EF0A 2H73A 4G0LA 4PQHA 5F05A 3ERGA 5D9TA 3GX0A 1OC9B 3O76A 5KOXA 2O87A 3GFKA 5DDLA 1A23A 2K9FA 2EIOA 1Y1UA 4PXOA 4GRFA 1V2AA 1Y25A 1UA5A 1GSFA 1NW2A 3TJJA 2JU5A 1ON4A 1O8WA 1XIYA 1TXUA 5D73A 4BVXA 2C0EA 3CTFA 3M9KA 2H8LA 5ELGA 2C1YA 2QGVA 5IPGA 2AB6A 3CSJA 1ZGNA 2PMTA 2PERA 1MDIA 2VCXA 1X5CA 2L5LA 3DWVA 1S3RA 2F8AA 1GSQA 2WCIA 1AC1A 5DJMA 14GSA 1ILOA 1QXHA 2H66A 2KOKA 2X4AA 1YEPA 3FHKA 9GSSA 1ZYEA 2IMDA 2H0IA 1RQMA 3IV4A 2JADA 1EEMA 3EWLA 4BL7B 1B4QA 5IMDA 4O92A 5JCGA 4WBJA 4XHMA 1OC8A 3QAWA 2AHEA 3HJMA 1ERTA 1MDJA 3CMIA 4O32A 1PX7A 3LG6A 4N11A 1HNCA 1TU8A 1S3CA 1X0RA 3TOTA 4IGJA 3BBYA 3LQ7A 4F82A 1C72A 2GSTA 5ABRA 2DLXA 1BEDA 4H86A 5IM9A 3KGKA 3TB2A 1WWJA 2VO4A 2P31A 2A2PA 2YP6A 1Z6NA 4E8HA 2FWFA 1GTAA 5A5HA 5G31A 3VI5A 5HFGA 4KF9A 1J9BA 2KLXA 3HVXA 1N2AA 4ECJA 5J4UA 5GSTA 5ECMB 1O7UA 2KP1A 3LORA 2R0CA 4RQXA 4EIQA 4AKHA 5ID2B 3GMFA 3IA1A 3CRUA 1MD4A 3RAZA 1AQVA 2XBQA 1PX6A 1SL1B 2QA2A 1ZMAA 4OWYA 2JZRA 5IOWA 1OKDA 2D2ZA 2IIYA 3L78A 2CZ3A 3LXZA 2VL2A 2K8VA 1SENA 3L0HA 1N8JA 2PWJA 1HNBA 4KE3A 4KDUA 1TTZA 2R6KA 5D9VA 4BWSA 2HLSA 2IMFA 5AN1A 4ACSA 5KEJA 2H0HA 2IL3A 4BL7A 2YN1A 4MJCA 5AISA 5AIVA 3D6IA 1X9SB 2H19A 4ECIA 3KTBA 1OE7A 4IELA 3HDCA 1Q98A 4IS0A 2VCTA 4ZXGA 2PVOC 3TJGA 4HZ4A 2I1UA 4YQMA 4HU7A 1S4BP 1K0MA 4Q5QA 1H75A 3FYGA 4ZBDA 2HSNA 3MDKA 5J9BA 4N0VA 4I5QA 4MZWA 5D93A 1X5DA 2HFDA 2O85A 1WMJA 1SVMA 3APQA 1M3JA 3MIXA 2EIQA 4QL9A 1OYJA 1SK2A 2L5OA 4K7NA 3D4TA 3Q18A 12GSA 5F06A 1R26A 1YVLA 1WJKA 1OVNA 2H01A 1YY7A 2WW2A 2A2SA 3PH9A 4X0XA 3AY8A 2ZCTA 1SL0B 4JE1A 1R5AA 2I3YA 4KB3A 2UV8G 1SL2B 4F0CA 5A5KA 2L6CA 3UVTA 4QQ7A 1QK8A 2AAWA 4EXJA 1X9MB 2V1MA 4LL4B 2WULA 4Z2RA 1E2YA 2ES7A 5JCWA 4KCEA 5E4WA 3DEXA 5A1NA 3GIXA 3MSZA 4HJMA 3LJRA 1LBKA 2LUSA 2V2GA 2G2QA 4XS1A 2LEGA 1V57A 4NV2A 3H8QA 2GT5A 1U87A 3ZMLA 3RPPA 2IMEA 3GL3A 2E2MA 2YANA 2H1GA 2NTOA 4V2MA 2VM2A 4QL7A 3FZ5A 4I2TA 3FRCA 3ZTLA 1WRYA 2HRKB 5D9WA 2ON7A 2CV4A 5CRDA 2J9HA 4F9ZA 2HYXA 4PI0C 2CX4A 2DJJA 4NV5A 2IWTA 1TOFA 4MJBA 4BWQA 3KIJA 5J5NA 1K0OA 5DAKB 2ZUPA 1DE2A 4AJ6A 3EMPA 3C1RA 1VF2A 5JWRB 4NAXA 2OACA 3HXSA 2H1BA 2AJQB 1T4ZA 1G7OA 2V6OA 1K0NA 2GT6A 1FB6A 2OE0A 1GSYA 5IPHA 2RM5A 4X4JA 1F3AA 2LSTA 1XBSA 4ZBAA 3F4SA 3WT2A 2KP2A 3IRAA 2P5RA 1XVQA 3CQFA 5HR0A 1H4OA 4ZB6A 2MYGA 2QA1A 4LA1A 2VL2C 1BJXA 2TRXA 2LJRA 2BTOT 3LSZA 1QFNA 2V6KA 3VWXA 5AIXA 3DGQA 3L9SA 3D5JA 1ML6A 4N30A 1TXXA 1GTIA
chains in the Genus database with same CATH topology
2BMXA 4KSOA 4ULXA 5DCHA 5IMFA 2OJLA 5HR2A 1GSDA 5ECRB 2FWEA 4LMWA 2XPEA 3VWUA 1XW9A 1I5GA 2WJUA 1FOHA 4KX4A 4J57E 2CAQA 5DCGA 2B5XA 3KP8A 4HU9A 3CBUA 4ECBA 3SBCA 2H6ZA 2DMLA 2HZFA 4HQZA 4TKYA 5KN0A 1PN9A 4O5QA 5DAKA 2VAFA 4PQ1A 1A0RP 4MZCA 1RW1A 1U88A 3F8UA 4JZQA 1MTCA 2CAIA 2VIMA 4L0WA 3LWAA 1PD21 5A34B 1F3BA 2C4JA 3P8WA 3ZLPA 1EWXA 1DE1A 2YNXA 1A8LA 4IVFA 3EVIA 5ECSA 3L4NA 2LRNA 4GDFA 3GX8A 4HZ2A 4GCIA 1TK8B 2IFQA 4XRAA 1YKCA 3GRXA 4EKZA 2IMKA 4BVYB 1AAZA 2G0FA 2JACA 4WF4A 3FR3A 3HKRA 2P5QA 5IO2A 4WR5A 5EVOA 1K3YA 3IHQA 2C0FA 3HJOA 4TR0A 5J9CA 5AGYA 3L9UA 1A24A 1E6BA 3HVSA 1XFLA 2MMOA 3LXTA 3HD5A 1EP7A 3GL5A 5CO3A 3LYPA 2FD3A 2LNTA 1G0TA 2HNLA 4GSSA 3GHAA 1XW5A 1T4YA 4YAPA 3LEFA 4K2XA 2HRAA 2C0GA 1M9AA 4K0GA 4DSSB 1J0FA 4N3ZA 5CRHA 1IYIA 4G0IA 3VLNA 3CXGA 4IJ3A 2EFCA 1Z5YE 2VD0A 2F9SA 4AKXB 3TJFA 1PRXA 1GL8A 5B8BA 2K8SA 2LKUA 4V2LA 3PR8A 1JLWA 1S3DA 5CRWA 2CVDA 4EO3A 3RHBA 4GSNA 3IAM2 3WGDA 20GSA 2PU9C 4IP1A 4TRXA 3W8SA 4IJIA 1LU4A 3TRQA 2VCZA 2FWGA 1TI1A 1TI3A 4XIHA 1YEXA 2CT6A 5DALB 2JZSA 4QMKA 4KUNA 3TKPA 4ZB9A 5IQYA 2PPTA 1AXDA 11GSA 2CX3A 4Q5NA 4BVYA 3D4MA 1PN0A 1W4VA 5J4YA 8GSSA 1SD9A 3EC3A 3MWHA 2AYTA 1IYHA 2YV9A 1SKRB 4K1FA 3A2VA 4XRDA 2IMIA 4KSMA 5E59A 1M7TA 2H74A 3DKSA 3V1WA 1ZZYA 3I43A 1XWAA 5B7CA 2H76A 3ZVJD 1U3IA 4PUFC 2LQQA 3H79A 4D73A 1VF4A 3EURA 2EFHA 1Z6MA 2F8FA 1K3LA 3WT1A 2GZPA 1XWGA 3SWLA 2NDOA 2R4VA 3M1GA 2LNSA 4TXOB 3HMJG 4OCFA 2DC5A 2LRTA 4MF7A 1BG5A 1OE8A 4FQUA 2HZEB 1HYUA 4O5RA 4OO4A 1NSWA 3FY7A 1N25A 5CNWA 1XWKA 4LL1B 1JHBA 4PURA 2H6XA 4WBRD 5F8BA 3UMAA 4TN8A 3VPTA 19GSA 3ZVJA 4I8BA 3P90A 2LRCA 3TJKA 2N5AA 4AGSA 4LMVA 2O5VA 5DALA 1G6YA 3W6GA 1V58A 4XS4A 3ZIVA 3GA4A 3OR5A 4CY6A 1EV4A 1Y6EA 4WR4A 4MJEA 3TKSC 2B5EA 1O81A 3W8JA 4ECCA 3A2WA 3HY2A 5ECNB 4KGIA 4ZBBA 4JR4A 4POKA 3D0ZA 1T7PB 4W66A 1OC9A 2WFCA 1DSBA 3H4KA 3J7Yb 2YV7A 1YJ6A 2L4QA 3WGXA 3IBHA 3TGZA 5KN3A 1A2JA 2IN3A 1VF3A 2OBIA 1TRSA 5ECPB 1Q4JA 3FZ9A 3M9JA 1PA3A 3I9V2 1F37A 4MF5A 1B4PA 3O3TA 2K6VA 5L71A 1B9XC 2B1KA 2R0PA 1FG4A 1GH2A 1V9WA 4TR1B 5J3RA 2HZEA 4XS6A 2WRTA 4GQCA 1XCCA 2WGRA 1GLPA 1GSSA 2OE1A 1VRSD 2NVLA 4MNNA 4JBBA 1GP1A 2B7KA 1GNEA 4G01A 4E8EA 4AKGA 1SVOA 4OFTA 2YOIA 3D22A 4FO5A 2XBIA 4O5UA 2QKEA 3F6DA 4F0BA 5H5SA 3FKFA 1URMA 2HSYA 1SKWB 4TVEA 4RQRA 4ZB7A 4MCUA 1MD3A 2X49A 2HXKA 3C73A 3M0FA 2DJ1A 4NHZA 4PNGA 1MDKA 3LYKA 1WOUA 4AJ8A 2I81A 4F03A 3VWWA 3QAGA 4DSQA 5A4WA 4OCEA 5IMVA 2H1DA 4L8EA 1YDKA 5ECKB 3RBTA 5INYA 4WETA 3TKQA 1FO5A 1G6WA 3DYRA 4GWRA 2M80A 1XWBA 5ELAA 5F07A 5EY6A 1X9WB 4MK3A 1KBNA 1YKAA 2B7JA 4ZILA 2X8GA 4V2NA 3PGTA 4JU5A 5ID2A 1K0CA 1YZXA 2FLSA 4FH8A 1XVWA 1UN2A 4IW9A 4CDOA 3F4RA 3HZ8A 4HI7A 1CQHA 3R3EA 4TR1A 4YH2A 2FY6A 2H6YA 1A2MA 5CAXA 3ME8A 4AKIA 4K2DA 5IO0A 2HQTA 4IHUA 5LD0A 4EUYA 3VURA 13GSA 4MF6A 4MP4A 5J4VA 3Q74A 5GSSA 2XPDA 1WPIA 1PL1A 4K7OA 2CQ9A 1HNAA 1U3AA 4I2UA 5BMUB 1TK0B 4CHSA 1F9MA 2A4HA 5J47A 1ABAA 1XOBA 2EIRA 3MAKA 2GDRA 1PL2A 1BAYA 4CY8A 4EE0A 2M72A 2DMMA 2VL3A 4RI7A 3UARA 2GSQA 4WF5A 2TIRA 5D9XA 1PSQA 2DSAA 1JZDA 3DIEA 3KZQA 6GSXA 6GSVA 2Z9SA 2GSRA 3IOSA 4EIPA 3DMLA 5G5EA 2PVQA 2EFEA 3VI7A 3IR4A 2JSZA 4HEA2 4POMA 1TW9A 3F0IA 1VF1A 1T1VA 4EL1A 3QDNA 2AV4A 3APOA 1CQGA 4NPBA 1M0UA 4OMVA 5EPFA 4AJ7A 4MABA 3UAPA 1UVZA 4NHWA 1ZYQB 4KDXA 4EC0A 3MNGA 4ML6A 3FR6A 3RPNA 2YWNA 1M99A 3GUSA 2TRCP 1EOGA 3HCZA 4CW9A 2FUG2 1SKSB 3U5RE 3QFAC 3FK8A 3KXOA 2LJKA 2OADA 5DQSA 2DIYA 3FW2A 2O8VB 2NPBA 5BMUA 3CWGA 5ENUA 2HSMB 4K0NA 1FW1A 1NHYA 3G7YA 4YQUA 3KH7A 1KTEA 5ECIB 1SJIA 2CVBA 22GSA 1JZOA 1R5PA 3WD6A 2MBTA 2FA8A 4PGTA 3APSA 2YPMA 2A2RA 2HRKA 4E68A 4IQ1A 2YZUA 4J2FA 4RI6A 4MMMA 5C00A 3E9JB 5D96A 3O6TA 2QC7A 3J7Yk 5J40A 3TUEA 2WDUA 2P0GA 1W89A 1YQ1A 4NWYA 1SYRA 1XWCA 2GLRA 2FA4A 3IPZA 3IHGA 4WXTA 3ZZXA 3Q19A 1UC7A 2WS2A 5DVBA 3ERWA 1HQOA 2AUVA 4ZL7A 4JR6A 5IMCA 1ZYNA 3VFIA 5JWOB 4OD7A 3IK9A 1XW6A 2B6MA 4XTSA 3GKMA 3F3QA 2DJ2A 3GURA 3QPMA 3ZL5A 5IMZA 3TOUA 3UBKA 4ICYA 4I97A 3NIVA 2JZTA 3DRNA 3A5IA 3TCOA 3GNJA 4TW5A 1VGLA 2RUFA 4Z2UA 4N0ZA 2LS5A 1F2EA 3QD9A 2X99A 3M3MA 3PINA 1HD2A 3BOAA 3QAVA 1EP8A 3GTUB 2UZ8A 2H1AA 1PKWA 1TRWA 2CVKA 5G1KA 5KOWA 3D21A 1JFUA 2FNOA 5HR1A 4X43A 1O85A 3A2XA 3NZNA 6GSSA 2RLIA 1G7EA 2LJAA 1U6TA 1AIUA 4N10A 3EMXA 5JCUA 3UL3A 5A34A 1EGRA 2OBKA 1TRVA 3LFLA 3HA9A 4PNFA 1SK0A 3LGCA 1BQ7A 2I4AA 2O7KA 1ERVA 4ML1A 3G7JA 4RUVA 3ZYWA 1GUKA 3ME7A 1T3BA 3FZ4A 2R0GA 3BJ5A 4HDEA 5HQPA 4WEYA 1F6MC 3P7XA 3WYWA 2RM6A 2MBSA 2DJKA 2GZZA 4DVCA 3TRPA 4MLYA 4PQIA 2YZHA 3TKRA 3UOMA 2L57A 2VCVA 3E3EA 3HHVA 4Q5RA 1OC3A 3IE3A 6GSYA 3F3RA 4IBPA 3UVHA 1TJDA 6GSTA 1PMTA 3GH6A 1PKZA 4G0KA 3ZRDA 1M2DA 3GH9A 2DJ0A 5KN1A 5HR3A 1NM3A 3IC4A 2NBSA 3GTUA 1YF0A 4P3YB 4V1Ag 1SYXA 5ECQB 2GVPA 2REMA 1ACVA 2BJXA 3QCPA 3KD0A 5GZZB 4GSTA 3P2AA 2C80A 4DSSA 4EVMA 4ISDA 5A5HB 2ALBA 4MZBA 1SU9A 3DXBA 4GXZA 3EU3A 2VLTA 1S3AA 2GQKA 2H30A 3I6AA 4KAEA 1FHEA 1USBA 5G2ZA 7GSSA 2OA7A 5CP1A 2VCWA 2E2GA 2JSYA 2VUPA 1GUMA 1XXUA 1O6JA 4YKGA 3EE2A 2O89A 3C1SA 1GTBA 4KW6A 2MMZA 5G30A 2RUEA 4HUAA 2C3TA 3G9BA 3C7MA 3ZITA 1TKDB 3IC8A 2HI7A 4DSRA 4MH3A 5DQYA 5B6MA 1WIKA 3VWVA 4LLRA 1O73A 1BG1A 2YCDA 2K18A 2ZNMA 2DKHA 3G7IA 2YJ7A 3QOUA 1M9BA 2HSNB 4IQAA 3NOFA 2VD1A 1XPVA 3F63A 4MJAA 1K3OA 4TXOA 2KHPA 2X8CA 4XCSA 2R2JA 4MDCA 3KTLA 3GSSA 5GAND 1A8YA 1QQ2A 2B1LA 2L4CA 2N5BA 1SVLA 3C8EA 4A5PA 4PUAA 4KNDA 4OFNA 1SD8A 1ST9A 4Q5FA 2B5YA 1XOAA 1WE0A 3N9JA 2F51A 3UBLA 4WKWA 3GKNA 5COHA 3IXRA 2HE3A 1MEKA 2R5GA 3K8NA 1SJ6A 1ZCPA 2IPAA 3BD2A 2DIZA 5A1NB 2RIIA 6GSUA 4POLA 5LCZA 1BX9A 2F3MA 1V40A 3DVXA 1PGTA 4YKFA 2MMNA 2FGXA 4L5LA 1ZYPA 3L9VA 5CYYA 1A2LA 3KMNA 3TDGA 2HSHA 10GSA 4ID0A 3HYPA 2VLVA 3WGEA 1TDIA 2WB9A 1K0BA 1GRXA 2MZCA 5C04A 2N5FA 1SK1A 1R7HA 3H93A 1B48A 1NHOA 1FOVA 3F9UA 4HOJA 5D8IA 2GQMA 1JZRA 5ECOB 2R3XA 1GSEA 3CSIA 4G9HA 4MPGA 4AI6A 4HQSA 2GTUA 1T8EB 1B8XA 1ZL9A 2FWHA 3A3TA 1THOA 2X8HA 3EYTA 2E0QA 4ZIJA 4J56E 1GTUA 1TP9A 3TKSE 3GYKA 3U6VA 5B6NA 3GKKA 2FHEA 4I6XA 3ZMKA 3F6FA 1V98A 2VM1A 2VLUA 4O7HA 3CSHA 4PTSA 2XC2A 1XZOA 3TJBA 3LW9A 3QR6A 2CA8A 3VPQA 3MYDA 3GN3A 3GV1A 1M2AA 4HJ2A 17GSA 1R4WA 3JCML 5EL8A 5FT3A 1KEBA 2V32A 2H0GA 4X1UA 2H72A 1SJZA 4KDYA 2VKZG 5IOXA 2DBCA 5DJLA 3KEBA 18GSA 2WZ9A 4MPFA 1GUHA 3HZ4A 3C71A 4MH2A 4G10A 2HRFA 3BCIA 2GQLA 1Z9HA 2MMAA 3EU4A 4TXVA 1J08A 1DBYA 4DEJA 1GLQA 4GTUA 5A4VA 5CRGA 3KH9A 2M46A 5ECLB 3FR9A 2C3NA 2VOCA 2VL9A 2OKAA 2L59A 1GSUA 1FVKA 3IAS2 1ERUA 4YAVA 4V1Ap 3H1NA 1JLVA 4YQVA 1AQWA 2L6DA 3GKXA 5HFKA 4ILFA 4KH7A 4ZB8A 2PGTA 2HRNA 4FIWA 4FYUA 2I9HA 3EPTA 3I69A 4IN0A 4IP6A 3US3A 5IMAA 4EDYA 2YWIA 3KP9A 1O8XA 4OO5A 2OT3A 5JWQB 4MA9A 5KN2A 2IFQB 3A5WA 2X64A 4K5SA 2FCHA 5LNKe 2XHFA 1EEJA 4GF0A 4AF2A 1I9DA 5B8AA 3FZAA 1RK4A 5A4UA 5G1LA 2E7PA 3ZFBA 4PX1A 3UJ1A 1WP0A 2GZYA 3N5OA 3IDVA 4K6XA 3TRXA 2EC4A 3F4TA 3PPUA 3FEUA 2H71A 1BF5A 1JZWA 1TRUA 3UEMA 4JRRA 5GAPD 4IKHA 2A4VA 6GSWA 4KCAA 3BCKA 1TU7A 3IK7A 2GS3A 5H5RA 3HVVA 3ZREA 4Z7XA 5FWGA 4FYCA 5FHIA 4BPYA 4G2EA 4ZL9A 1ERWA 4ZL8A 3CRTA 3FMWA 1FAAA 3ZFLA 3VK9A 1LJRA 5G5FA 4POBA 1DUGA 2LTKA 1THXA 2LV3A 1A0FA 1X5EA 2PN8A 3KCMA 4NXIA 2PBJA 1K0AA 3EINA 2YWMA 3KM6A 1AW9A 4K5RA 2LQOA 2OE3A 1KNGA 2H1LA 1PQNA 4TR3A 4HS1A 4GLTA 5DBQA 4K7IA 5CREA 1EGOA 4G19A 1EV9A 2HSMA 4Z2TA 4K9ZA 3TKSA 16GSA 5HFIA 3M8NA 1QUWA 2YWOA 2EFDA 4F2IA 3R2QA 2R37A 3KJYA 4BA7A 1AUCA 2PUKC 3QFBC 1Z3EA 1FVJA 4NMUA 3GSTA 4FYBA 1EZKA 1ZOFA 3DD3A 1AQXA 4K8MA 2V41A 5IIZA 4GQFA 2C3QA 3CTGA 1OKTA 1TK5B 4TR4A 5J41A 4D73B 1GWCA 2ON5A 2CZ2A 1QGVA 1GNWA 3RDWA 4BVXB 2IJYA 1YF1A 4KA0A 2JL4A 2HT9A 5H5QA 3UIWA 3Q6OA 3S9FA 3TU3B 1EOHA 2DKIA 3ISOA 5ECHB 5F0GA 1OAZA 1QMVA 2DJ3A 3HJPA 2B3SA 2H70A 4L0UA 2J23A 2VCQA 3RHCA 2GSSA 3ERFA 3QMXA 4OFMA 2C0DA 4EDZA 2C8UA 1FB0A 1T00A 2H75A 1K0DA 4L5OA 3KMOA 4TOPA 4JEDA 1B9YC 3ED3A 3CYNA 1Z7PA 4USSA 2KUCA 2QSIA 3DVWA 1BYEA 2GGTA 1GULA 3E0UA 4XS4B 2YJHA 1Z7RA 5BRTA 3ZIJA 1M2BA 4EF0A 2H73A 4G0LA 4PQHA 5F05A 3ERGA 5D9TA 3GX0A 1OC9B 3O76A 5KOXA 2O87A 3GFKA 5DDLA 1A23A 2K9FA 2EIOA 1Y1UA 4PXOA 4GRFA 1V2AA 1Y25A 1UA5A 1GSFA 1NW2A 3TJJA 2JU5A 1ON4A 1O8WA 1XIYA 1TXUA 5D73A 4BVXA 2C0EA 3CTFA 3M9KA 2H8LA 5ELGA 2C1YA 2QGVA 5IPGA 2AB6A 3CSJA 1ZGNA 2PMTA 2PERA 1MDIA 2VCXA 1X5CA 2L5LA 3DWVA 2F8AA 1GSQA 2WCIA 1AC1A 5DJMA 14GSA 1ILOA 1QXHA 2H66A 2KOKA 2X4AA 1YEPA 3FHKA 9GSSA 1ZYEA 2IMDA 2H0IA 1RQMA 3IV4A 2JADA 1EEMA 3EWLA 4BL7B 1B4QA 5IMDA 4O92A 5JCGA 4WBJA 4XHMA 1OC8A 3QAWA 2AHEA 3HJMA 1ERTA 1MDJA 3CMIA 4O32A 1PX7A 3LG6A 4N11A 1HNCA 1TU8A 1S3CA 1X0RA 3TOTA 4IGJA 3BBYA 3LQ7A 4F82A 1C72A 2GSTA 5ABRA 2DLXA 1BEDA 4H86A 5IM9A 3KGKA 3TB2A 1WWJA 2VO4A 2P31A 2A2PA 2YP6A 1Z6NA 4E8HA 2FWFA 1GTAA 5A5HA 5G31A 3VI5A 5HFGA 4KF9A 1J9BA 2KLXA 3HVXA 1N2AA 4ECJA 5J4UA 5GSTA 5ECMB 1O7UA 2KP1A 3LORA 2R0CA 4RQXA 4EIQA 4AKHA 5ID2B 3GMFA 3IA1A 3CRUA 1MD4A 3RAZA 1AQVA 2XBQA 1PX6A 1SL1B 2QA2A 1ZMAA 4OWYA 2JZRA 5IOWA 1OKDA 2D2ZA 2IIYA 3L78A 2CZ3A 3LXZA 2VL2A 2K8VA 1SENA 3L0HA 1N8JA 2PWJA 1HNBA 4KE3A 4KDUA 1TTZA 2R6KA 5D9VA 4BWSA 2HLSA 2IMFA 5AN1A 4ACSA 5KEJA 2H0HA 2IL3A 4BL7A 2YN1A 4MJCA 5AISA 5AIVA 3D6IA 1X9SB 2H19A 4ECIA 3KTBA 1OE7A 4IELA 3HDCA 1Q98A 4IS0A 2VCTA 4ZXGA 2PVOC 3TJGA 4HZ4A 2I1UA 4YQMA 4HU7A 1K0MA 4Q5QA 1H75A 3FYGA 4ZBDA 2HSNA 3MDKA 5J9BA 4N0VA 4I5QA 4MZWA 5D93A 1X5DA 2HFDA 2O85A 1WMJA 1SVMA 3APQA 3MIXA 2EIQA 4QL9A 1OYJA 1SK2A 2L5OA 4K7NA 3D4TA 3Q18A 12GSA 5F06A 1R26A 1YVLA 1WJKA 1OVNA 2H01A 1YY7A 2A2SA 3PH9A 4X0XA 3AY8A 2ZCTA 1SL0B 4JE1A 1R5AA 2I3YA 4KB3A 2UV8G 1SL2B 4F0CA 5A5KA 2L6CA 3UVTA 4QQ7A 1QK8A 2AAWA 4EXJA 1X9MB 2V1MA 4LL4B 2WULA 4Z2RA 1E2YA 2ES7A 5JCWA 4KCEA 5E4WA 3DEXA 5A1NA 3GIXA 3MSZA 4HJMA 3LJRA 1LBKA 2LUSA 2V2GA 2G2QA 4XS1A 2LEGA 1V57A 4NV2A 3H8QA 2GT5A 1U87A 3ZMLA 3RPPA 2IMEA 3GL3A 2E2MA 2YANA 2H1GA 2NTOA 4V2MA 2VM2A 4QL7A 3FZ5A 4I2TA 3FRCA 3ZTLA 1WRYA 2HRKB 5D9WA 2ON7A 2CV4A 5CRDA 2J9HA 4F9ZA 2HYXA 2CX4A 2DJJA 4NV5A 2IWTA 1TOFA 4MJBA 4BWQA 3KIJA 5J5NA 1K0OA 5DAKB 2ZUPA 1DE2A 4AJ6A 3EMPA 3C1RA 1VF2A 5JWRB 4NAXA 2OACA 3HXSA 2H1BA 2AJQB 1T4ZA 1G7OA 2V6OA 1K0NA 2GT6A 1FB6A 2OE0A 1GSYA 5IPHA 2RM5A 4X4JA 1F3AA 2LSTA 1XBSA 4ZBAA 3F4SA 3WT2A 2KP2A 3IRAA 2P5RA 1XVQA 5HR0A 1H4OA 4ZB6A 2MYGA 2QA1A 4LA1A 2VL2C 1BJXA 2TRXA 2LJRA 2BTOT 3LSZA 1QFNA 2V6KA 3VWXA 5AIXA 3DGQA 3L9SA 3D5JA 1ML6A 4N30A 1TXXA 1GTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMX A;  4KSO A;  4ULX A;  5DCH A;  5IMF A;  2OJL A;  5HR2 A;  1GSD A;  5ECR B;  2FWE A;  4LMW A;  2XPE A;  3VWU A;  1XW9 A;  1I5G A;  2WJU A;  4KX4 A;  4J57 E;  2CAQ A;  5DCG A;  2B5X A;  3KP8 A;  4HU9 A;  3CBU A;  4ECB A;  3SBC A;  2H6Z A;  2DML A;  2HZF A;  4HQZ A;  4TKY A;  5KN0 A;  1PN9 A;  5DAK A;  2VAF A;  4PQ1 A;  1A0R P;  4MZC A;  1RW1 A;  1U88 A;  3F8U A;  4JZQ A;  1MTC A;  2CAI A;  2VIM A;  4L0W A;  3LWA A;  1PD2 1;  1F3B A;  2C4J A;  3P8W A;  3ZLP A;  1EWX A;  1DE1 A;  2YNX A;  1A8L A;  4IVF A;  3EVI A;  5ECS A;  3L4N A;  2LRN A;  3GX8 A;  4HZ2 A;  4GCI A;  1TK8 B;  2IFQ A;  4XRA A;  1YKC A;  3GRX A;  4EKZ A;  2IMK A;  4BVY B;  1AAZ A;  2G0F A;  2JAC A;  4WF4 A;  3FR3 A;  3HKR A;  2P5Q A;  5IO2 A;  4WR5 A;  5EVO A;  1K3Y A;  3IHQ A;  2C0F A;  3HJO A;  4TR0 A;  5J9C A;  5AGY A;  3L9U A;  1A24 A;  1E6B A;  3HVS A;  1XFL A;  2MMO A;  3LXT A;  3HD5 A;  1EP7 A;  3GL5 A;  5CO3 A;  3LYP A;  2FD3 A;  2LNT A;  1G0T A;  2HNL A;  4GSS A;  3GHA A;  1XW5 A;  1T4Y A;  4YAP A;  3LEF A;  2HRA A;  2C0G A;  1M9A A;  4K0G A;  4DSS B;  1J0F A;  5CRH A;  1IYI A;  4G0I A;  3VLN A;  3CXG A;  4IJ3 A;  1Z5Y E;  2VD0 A;  2F9S A;  3TJF A;  1PRX A;  1GL8 A;  5B8B A;  2K8S A;  2LKU A;  4V2L A;  3PR8 A;  1JLW A;  1S3D A;  5CRW A;  2CVD A;  4EO3 A;  3RHB A;  4GSN A;  3IAM 2;  3WGD A;  20GS A;  2PU9 C;  4IP1 A;  4TRX A;  3W8S A;  4IJI A;  1LU4 A;  3TRQ A;  2VCZ A;  2FWG A;  1TI1 A;  1TI3 A;  4XIH A;  1YEX A;  2CT6 A;  5DAL B;  2JZS A;  4KUN A;  3TKP A;  4ZB9 A;  5IQY A;  2PPT A;  1AXD A;  11GS A;  2CX3 A;  4Q5N A;  4BVY A;  3D4M A;  1W4V A;  8GSS A;  1SD9 A;  3EC3 A;  3MWH A;  2AYT A;  1IYH A;  2YV9 A;  1SKR B;  4K1F A;  3A2V A;  4XRD A;  2IMI A;  4KSM A;  5E59 A;  1M7T A;  2H74 A;  3DKS A;  3V1W A;  1ZZY A;  3I43 A;  1XWA A;  5B7C A;  2H76 A;  3ZVJ D;  1U3I A;  4PUF C;  2LQQ A;  3H79 A;  4D73 A;  1VF4 A;  3EUR A;  1Z6M A;  2F8F A;  1K3L A;  3WT1 A;  2GZP A;  1XWG A;  3SWL A;  2NDO A;  2R4V A;  3M1G A;  2LNS A;  4TXO B;  4OCF A;  2DC5 A;  2LRT A;  4MF7 A;  1BG5 A;  1OE8 A;  4FQU A;  2HZE B;  1HYU A;  4O5R A;  4OO4 A;  1NSW A;  3FY7 A;  5CNW A;  1XWK A;  4LL1 B;  1JHB A;  4PUR A;  2H6X A;  4WBR D;  5F8B A;  3UMA A;  4TN8 A;  3VPT A;  19GS A;  3ZVJ A;  4I8B A;  3P90 A;  2LRC A;  3TJK A;  2N5A A;  4AGS A;  4LMV A;  5DAL A;  1G6Y A;  3W6G A;  1V58 A;  4XS4 A;  3ZIV A;  3GA4 A;  3OR5 A;  1EV4 A;  1Y6E A;  4WR4 A;  4MJE A;  3TKS C;  2B5E A;  1O81 A;  3W8J A;  4ECC A;  3A2W A;  3HY2 A;  5ECN B;  4KGI A;  4ZBB A;  4JR4 A;  4POK A;  3D0Z A;  1T7P B;  1OC9 A;  2WFC A;  1DSB A;  3H4K A;  3J7Y b;  2YV7 A;  1YJ6 A;  2L4Q A;  3WGX A;  3IBH A;  3TGZ A;  5KN3 A;  1A2J A;  2IN3 A;  1VF3 A;  2OBI A;  1TRS A;  5ECP B;  1Q4J A;  3FZ9 A;  3M9J A;  1PA3 A;  3I9V 2;  1F37 A;  4MF5 A;  1B4P A;  3O3T A;  2K6V A;  5L71 A;  1B9X C;  2B1K A;  1FG4 A;  1GH2 A;  1V9W A;  4TR1 B;  5J3R A;  2HZE A;  4XS6 A;  2WRT A;  4GQC A;  1XCC A;  2WGR A;  1GLP A;  1GSS A;  2OE1 A;  1VRS D;  2NVL A;  4JBB A;  1GP1 A;  2B7K A;  1GNE A;  4E8E A;  4OFT A;  2YOI A;  3D22 A;  4FO5 A;  2XBI A;  2QKE A;  3F6D A;  4F0B A;  5H5S A;  3FKF A;  1URM A;  2HSY A;  1SKW B;  4TVE A;  4RQR A;  4MCU A;  1MD3 A;  2HXK A;  3C73 A;  3M0F A;  2DJ1 A;  4NHZ A;  4PNG A;  1MDK A;  3LYK A;  1WOU A;  4AJ8 A;  2I81 A;  4F03 A;  3VWW A;  3QAG A;  4DSQ A;  5A4W A;  4OCE A;  5IMV A;  2H1D A;  4L8E A;  1YDK A;  5ECK B;  3RBT A;  5INY A;  4WET A;  3TKQ A;  1FO5 A;  1G6W A;  3DYR A;  4GWR A;  2M80 A;  1XWB A;  5ELA A;  5F07 A;  5EY6 A;  1X9W B;  4MK3 A;  1KBN A;  1YKA A;  2B7J A;  4ZIL A;  2X8G A;  4V2N A;  3PGT A;  4JU5 A;  5ID2 A;  1K0C A;  1YZX A;  2FLS A;  4FH8 A;  1XVW A;  1UN2 A;  4IW9 A;  4CDO A;  3F4R A;  3HZ8 A;  4HI7 A;  1CQH A;  3R3E A;  4TR1 A;  4YH2 A;  2FY6 A;  2H6Y A;  1A2M A;  5CAX A;  3ME8 A;  4K2D A;  5IO0 A;  2HQT A;  4IHU A;  5LD0 A;  4EUY A;  3VUR A;  13GS A;  4MF6 A;  4MP4 A;  3Q74 A;  5GSS A;  2XPD A;  1WPI A;  1PL1 A;  4K7O A;  2CQ9 A;  1HNA A;  1U3A A;  4I2U A;  1TK0 B;  4CHS A;  1F9M A;  1ABA A;  1XOB A;  2EIR A;  3MAK A;  2GDR A;  1PL2 A;  1BAY A;  4EE0 A;  2M72 A;  2DMM A;  2VL3 A;  4RI7 A;  3UAR A;  2GSQ A;  4WF5 A;  2TIR A;  5D9X A;  1PSQ A;  2DSA A;  1JZD A;  3DIE A;  3KZQ A;  6GSX A;  6GSV A;  2Z9S A;  2GSR A;  3IOS A;  3DML A;  5G5E A;  2PVQ A;  3VI7 A;  3IR4 A;  2JSZ A;  4HEA 2;  4POM A;  1TW9 A;  3F0I A;  1VF1 A;  1T1V A;  4EL1 A;  3QDN A;  2AV4 A;  3APO A;  1CQG A;  4NPB A;  1M0U A;  4OMV A;  5EPF A;  4AJ7 A;  4MAB A;  3UAP A;  1UVZ A;  4NHW A;  1ZYQ B;  4KDX A;  4EC0 A;  3MNG A;  4ML6 A;  3FR6 A;  3RPN A;  2YWN A;  1M99 A;  3GUS A;  2TRC P;  1EOG A;  3HCZ A;  4CW9 A;  2FUG 2;  1SKS B;  3U5R E;  3QFA C;  3FK8 A;  3KXO A;  2LJK A;  2OAD A;  5DQS A;  2DIY A;  3FW2 A;  2O8V B;  2NPB A;  5BMU A;  5ENU A;  2HSM B;  4K0N A;  1FW1 A;  1NHY A;  3G7Y A;  4YQU A;  3KH7 A;  1KTE A;  5ECI B;  1SJI A;  2CVB A;  22GS A;  1JZO A;  1R5P A;  3WD6 A;  2MBT A;  2FA8 A;  4PGT A;  3APS A;  2YPM A;  2A2R A;  2HRK A;  4IQ1 A;  2YZU A;  4J2F A;  4RI6 A;  4MMM A;  5C00 A;  3E9J B;  5D96 A;  3O6T A;  2QC7 A;  3J7Y k;  3TUE A;  2WDU A;  2P0G A;  1W89 A;  1YQ1 A;  4NWY A;  1SYR A;  1XWC A;  2GLR A;  2FA4 A;  3IPZ A;  4WXT A;  3ZZX A;  3Q19 A;  1UC7 A;  2WS2 A;  5DVB A;  3ERW A;  1HQO A;  2AUV A;  4ZL7 A;  4JR6 A;  5IMC A;  3VFI A;  5JWO B;  4OD7 A;  3IK9 A;  1XW6 A;  2B6M A;  4XTS A;  3GKM A;  3F3Q A;  2DJ2 A;  3GUR A;  3QPM A;  3ZL5 A;  5IMZ A;  3TOU A;  3UBK A;  4I97 A;  3NIV A;  2JZT A;  3DRN A;  3TCO A;  3GNJ A;  4TW5 A;  1VGL A;  2RUF A;  4N0Z A;  2LS5 A;  1F2E A;  3QD9 A;  2X99 A;  3M3M A;  3PIN A;  1HD2 A;  3BOA A;  3QAV A;  1EP8 A;  3GTU B;  2UZ8 A;  2H1A A;  1PKW A;  1TRW A;  2CVK A;  5G1K A;  3D21 A;  1JFU A;  2FNO A;  5HR1 A;  4X43 A;  1O85 A;  3A2X A;  3NZN A;  6GSS A;  2RLI A;  1G7E A;  2LJA A;  1U6T A;  1AIU A;  4N10 A;  3EMX A;  5JCU A;  3UL3 A;  1EGR A;  2OBK A;  1TRV A;  3LFL A;  3HA9 A;  4PNF A;  1SK0 A;  3LGC A;  1BQ7 A;  2I4A A;  2O7K A;  1ERV A;  4ML1 A;  3G7J A;  4RUV A;  3ZYW A;  1GUK A;  3ME7 A;  1T3B A;  3FZ4 A;  3BJ5 A;  4HDE A;  5HQP A;  4WEY A;  1F6M C;  3P7X A;  3WYW A;  2RM6 A;  2MBS A;  2DJK A;  2GZZ A;  4DVC A;  3TRP A;  4MLY A;  4PQI A;  2YZH A;  3TKR A;  3UOM A;  2L57 A;  2VCV A;  3E3E A;  3HHV A;  4Q5R A;  1OC3 A;  3IE3 A;  6GSY A;  3F3R A;  4IBP A;  3UVH A;  1TJD A;  6GST A;  1PMT A;  3GH6 A;  1PKZ A;  4G0K A;  3ZRD A;  1M2D A;  3GH9 A;  2DJ0 A;  5KN1 A;  5HR3 A;  1NM3 A;  3IC4 A;  3GTU A;  1YF0 A;  2NBS A;  4P3Y B;  4V1A g;  1SYX A;  5ECQ B;  2GVP A;  2REM A;  1ACV A;  2BJX A;  3QCP A;  3KD0 A;  5GZZ B;  4GST A;  3P2A A;  2C80 A;  4DSS A;  4EVM A;  4ISD A;  2ALB A;  4MZB A;  1SU9 A;  3DXB A;  4GXZ A;  3EU3 A;  2VLT A;  1S3A A;  2GQK A;  2H30 A;  3I6A A;  4KAE A;  1FHE A;  1USB A;  5G2Z A;  7GSS A;  2OA7 A;  5CP1 A;  2VCW A;  2E2G A;  2JSY A;  2VUP A;  1GUM A;  1XXU A;  1O6J A;  3EE2 A;  2O89 A;  3C1S A;  1GTB A;  4KW6 A;  2MMZ A;  5G30 A;  2RUE A;  4HUA A;  2C3T A;  3G9B A;  3C7M A;  3ZIT A;  1TKD B;  3IC8 A;  2HI7 A;  4DSR A;  4MH3 A;  5DQY A;  5B6M A;  1WIK A;  3VWV A;  4LLR A;  1O73 A;  2YCD A;  2K18 A;  2ZNM A;  3G7I A;  2YJ7 A;  3QOU A;  1M9B A;  2HSN B;  4IQA A;  3NOF A;  2VD1 A;  1XPV A;  3F63 A;  4MJA A;  1K3O A;  4TXO A;  2KHP A;  2X8C A;  4XCS A;  2R2J A;  4MDC A;  3KTL A;  3GSS A;  5GAN D;  1A8Y A;  1QQ2 A;  2B1L A;  2L4C A;  2N5B A;  3C8E A;  4PUA A;  4KND A;  4OFN A;  1SD8 A;  1ST9 A;  4Q5F A;  2B5Y A;  1XOA A;  1WE0 A;  3N9J A;  2F51 A;  3UBL A;  4WKW A;  3GKN A;  5COH A;  3IXR A;  2HE3 A;  1MEK A;  2R5G A;  3K8N A;  1SJ6 A;  1ZCP A;  2IPA A;  3BD2 A;  2DIZ A;  2RII A;  6GSU A;  4POL A;  5LCZ A;  1BX9 A;  2F3M A;  1V40 A;  3DVX A;  1PGT A;  2MMN A;  2FGX A;  4L5L A;  3L9V A;  5CYY A;  1A2L A;  3KMN A;  3TDG A;  2HSH A;  10GS A;  4ID0 A;  3HYP A;  2VLV A;  3WGE A;  1TDI A;  2WB9 A;  1K0B A;  1GRX A;  2MZC A;  5C04 A;  2N5F A;  1SK1 A;  1R7H A;  3H93 A;  1B48 A;  1NHO A;  1FOV A;  3F9U A;  4HOJ A;  5D8I A;  2GQM A;  1JZR A;  5ECO B;  2R3X A;  1GSE A;  3CSI A;  4G9H A;  4MPG A;  4HQS A;  1T8E B;  2GTU A;  1B8X A;  1ZL9 A;  2FWH A;  3A3T A;  1THO A;  2X8H A;  3EYT A;  2E0Q A;  4ZIJ A;  4J56 E;  1GTU A;  1TP9 A;  3TKS E;  3GYK A;  3U6V A;  5B6N A;  3GKK A;  2FHE A;  4I6X A;  3ZMK A;  3F6F A;  1V98 A;  2VM1 A;  2VLU A;  4O7H A;  3CSH A;  4PTS A;  2XC2 A;  1XZO A;  3TJB A;  3QR6 A;  2CA8 A;  3VPQ A;  3GN3 A;  3GV1 A;  1M2A A;  4HJ2 A;  17GS A;  1R4W A;  3JCM L;  5EL8 A;  5FT3 A;  1KEB A;  2V32 A;  2H0G A;  4X1U A;  2H72 A;  1SJZ A;  4KDY A;  5IOX A;  2DBC A;  5DJL A;  3KEB A;  18GS A;  2WZ9 A;  4MPF A;  1GUH A;  3HZ4 A;  3C71 A;  4MH2 A;  4G10 A;  2HRF A;  3BCI A;  2GQL A;  1Z9H A;  2MMA A;  3EU4 A;  4TXV A;  1J08 A;  1DBY A;  4DEJ A;  1GLQ A;  4GTU A;  5A4V A;  5CRG A;  3KH9 A;  2M46 A;  5ECL B;  3FR9 A;  2C3N A;  2VOC A;  2VL9 A;  2OKA A;  2L59 A;  1GSU A;  1FVK A;  3IAS 2;  1ERU A;  4YAV A;  4V1A p;  3H1N A;  1JLV A;  4YQV A;  1AQW A;  2L6D A;  3GKX A;  5HFK A;  4ILF A;  4KH7 A;  4ZB8 A;  2PGT A;  2HRN A;  4FIW A;  4FYU A;  2I9H A;  3I69 A;  4IN0 A;  4IP6 A;  3US3 A;  5IMA A;  4EDY A;  2YWI A;  3KP9 A;  1O8X A;  4OO5 A;  5JWQ B;  4MA9 A;  5KN2 A;  2IFQ B;  3A5W A;  2X64 A;  2FCH A;  5LNK e;  2XHF A;  1EEJ A;  4GF0 A;  4AF2 A;  1I9D A;  5B8A A;  3FZA A;  1RK4 A;  5A4U A;  5G1L A;  2E7P A;  3ZFB A;  4PX1 A;  3UJ1 A;  1WP0 A;  2GZY A;  3N5O A;  3IDV A;  4K6X A;  3TRX A;  2EC4 A;  3F4T A;  3PPU A;  3FEU A;  2H71 A;  1JZW A;  1TRU A;  3UEM A;  4JRR A;  5GAP D;  4IKH A;  2A4V A;  6GSW A;  4KCA A;  3BCK A;  1TU7 A;  3IK7 A;  2GS3 A;  5H5R A;  3HVV A;  3ZRE A;  4Z7X A;  5FWG A;  4FYC A;  5FHI A;  4BPY A;  4G2E A;  4ZL9 A;  1ERW A;  4ZL8 A;  3CRT A;  1FAA A;  3ZFL A;  3VK9 A;  1LJR A;  5G5F A;  4POB A;  1DUG A;  2LTK A;  1THX A;  2LV3 A;  1A0F A;  1X5E A;  2PN8 A;  3KCM A;  4NXI A;  2PBJ A;  1K0A A;  3EIN A;  2YWM A;  3KM6 A;  1AW9 A;  2LQO A;  2OE3 A;  1KNG A;  1PQN A;  4TR3 A;  4HS1 A;  4GLT A;  5DBQ A;  4K7I A;  5CRE A;  1EGO A;  4G19 A;  1EV9 A;  2HSM A;  4K9Z A;  3TKS A;  16GS A;  5HFI A;  3M8N A;  1QUW A;  2YWO A;  4F2I A;  3R2Q A;  2R37 A;  3KJY A;  4BA7 A;  1AUC A;  2PUK C;  3QFB C;  1Z3E A;  1FVJ A;  4NMU A;  3GST A;  4FYB A;  1EZK A;  1ZOF A;  3DD3 A;  1AQX A;  4K8M A;  2V41 A;  5IIZ A;  4GQF A;  2C3Q A;  3CTG A;  1OKT A;  1TK5 B;  4TR4 A;  5J41 A;  4D73 B;  1GWC A;  2ON5 A;  2CZ2 A;  1QGV A;  1GNW A;  3RDW A;  4BVX B;  2IJY A;  1YF1 A;  4KA0 A;  2JL4 A;  2HT9 A;  5H5Q A;  3UIW A;  3Q6O A;  3S9F A;  1EOH A;  3ISO A;  5ECH B;  5F0G A;  1OAZ A;  1QMV A;  2DJ3 A;  3HJP A;  2B3S A;  2H70 A;  4L0U A;  2J23 A;  2VCQ A;  3RHC A;  2GSS A;  3ERF A;  3QMX A;  4OFM A;  2C0D A;  4EDZ A;  2C8U A;  1FB0 A;  1T00 A;  2H75 A;  1K0D A;  4L5O A;  3KMO A;  4TOP A;  4JED A;  1B9Y C;  3ED3 A;  3CYN A;  1Z7P A;  4USS A;  2KUC A;  2QSI A;  3DVW A;  1BYE A;  2GGT A;  1GUL A;  3E0U A;  4XS4 B;  2YJH A;  1Z7R A;  3ZIJ A;  1M2B A;  4EF0 A;  2H73 A;  4G0L A;  4PQH A;  5F05 A;  3ERG A;  5D9T A;  3GX0 A;  1OC9 B;  3O76 A;  2O87 A;  3GFK A;  5DDL A;  1A23 A;  2K9F A;  2EIO A;  4PXO A;  4GRF A;  1V2A A;  1Y25 A;  1UA5 A;  1GSF A;  1NW2 A;  3TJJ A;  2JU5 A;  1ON4 A;  1O8W A;  1XIY A;  5D73 A;  4BVX A;  2C0E A;  3CTF A;  3M9K A;  2H8L A;  5ELG A;  2C1Y A;  2QGV A;  5IPG A;  2AB6 A;  3CSJ A;  1ZGN A;  2PMT A;  2PER A;  1MDI A;  2VCX A;  1X5C A;  2L5L A;  3DWV A;  2F8A A;  1GSQ A;  2WCI A;  1AC1 A;  5DJM A;  14GS A;  1ILO A;  1QXH A;  2H66 A;  2KOK A;  1YEP A;  3FHK A;  9GSS A;  1ZYE A;  2IMD A;  2H0I A;  1RQM A;  3IV4 A;  2JAD A;  1EEM A;  3EWL A;  4BL7 B;  1B4Q A;  5IMD A;  4O92 A;  5JCG A;  4WBJ A;  4XHM A;  1OC8 A;  3QAW A;  2AHE A;  3HJM A;  1ERT A;  1MDJ A;  3CMI A;  4O32 A;  1PX7 A;  3LG6 A;  4N11 A;  1HNC A;  1TU8 A;  1S3C A;  1X0R A;  3TOT A;  4IGJ A;  3BBY A;  3LQ7 A;  4F82 A;  1C72 A;  2GST A;  5ABR A;  2DLX A;  1BED A;  4H86 A;  5IM9 A;  3KGK A;  3TB2 A;  1WWJ A;  2VO4 A;  2P31 A;  2YP6 A;  1Z6N A;  4E8H A;  2FWF A;  1GTA A;  5G31 A;  3VI5 A;  5HFG A;  4KF9 A;  1J9B A;  2KLX A;  3HVX A;  1N2A A;  4ECJ A;  5J4U A;  5GST A;  5ECM B;  1O7U A;  2KP1 A;  3LOR A;  4RQX A;  5ID2 B;  3GMF A;  3IA1 A;  3CRU A;  1MD4 A;  3RAZ A;  1AQV A;  2XBQ A;  1PX6 A;  1SL1 B;  1ZMA A;  4OWY A;  2JZR A;  5IOW A;  1OKD A;  2D2Z A;  2IIY A;  3L78 A;  2CZ3 A;  3LXZ A;  2VL2 A;  2K8V A;  1SEN A;  3L0H A;  1N8J A;  2PWJ A;  1HNB A;  4KE3 A;  4KDU A;  1TTZ A;  2R6K A;  5D9V A;  4BWS A;  2HLS A;  2IMF A;  5AN1 A;  4ACS A;  5KEJ A;  2H0H A;  2IL3 A;  4BL7 A;  2YN1 A;  4MJC A;  5AIS A;  5AIV A;  3D6I A;  1X9S B;  2H19 A;  4ECI A;  3KTB A;  1OE7 A;  4IEL A;  3HDC A;  1Q98 A;  4IS0 A;  2VCT A;  4ZXG A;  2PVO C;  3TJG A;  4HZ4 A;  2I1U A;  4YQM A;  4HU7 A;  1K0M A;  4Q5Q A;  1H75 A;  3FYG A;  4ZBD A;  3MDK A;  5J9B A;  4N0V A;  4I5Q A;  4MZW A;  5D93 A;  1X5D A;  2HFD A;  2O85 A;  1WMJ A;  3APQ A;  2EIQ A;  4QL9 A;  1OYJ A;  1SK2 A;  2L5O A;  4K7N A;  3D4T A;  3Q18 A;  12GS A;  5F06 A;  1R26 A;  1WJK A;  1OVN A;  2H01 A;  1YY7 A;  2A2S A;  3PH9 A;  4X0X A;  3AY8 A;  2ZCT A;  1SL0 B;  4JE1 A;  1R5A A;  2I3Y A;  4KB3 A;  1SL2 B;  4F0C A;  5A5K A;  2L6C A;  3UVT A;  4QQ7 A;  1QK8 A;  2AAW A;  4EXJ A;  1X9M B;  2V1M A;  4LL4 B;  2WUL A;  1E2Y A;  2ES7 A;  5JCW A;  4KCE A;  5E4W A;  3DEX A;  3GIX A;  3MSZ A;  4HJM A;  3LJR A;  1LBK A;  2LUS A;  2V2G A;  2G2Q A;  4XS1 A;  2LEG A;  1V57 A;  4NV2 A;  3H8Q A;  2GT5 A;  1U87 A;  3ZML A;  3RPP A;  2IME A;  3GL3 A;  2E2M A;  2YAN A;  2H1G A;  2NTO A;  4V2M A;  2VM2 A;  4QL7 A;  3FZ5 A;  4I2T A;  3FRC A;  3ZTL A;  1WRY A;  2HRK B;  5D9W A;  2ON7 A;  2CV4 A;  5CRD A;  2J9H A;  4F9Z A;  2HYX A;  2CX4 A;  2DJJ A;  4NV5 A;  2IWT A;  1TOF A;  4MJB A;  4BWQ A;  3KIJ A;  5J5N A;  1K0O A;  5DAK B;  2ZUP A;  1DE2 A;  4AJ6 A;  3EMP A;  3C1R A;  1VF2 A;  5JWR B;  4NAX A;  2OAC A;  3HXS A;  2H1B A;  2AJQ B;  1T4Z A;  1G7O A;  2V6O A;  1K0N A;  2GT6 A;  1FB6 A;  2OE0 A;  1GSY A;  5IPH A;  2RM5 A;  1F3A A;  2LST A;  1XBS A;  4ZBA A;  3F4S A;  3WT2 A;  2KP2 A;  3IRA A;  2P5R A;  1XVQ A;  5HR0 A;  1H4O A;  4ZB6 A;  2MYG A;  4LA1 A;  2VL2 C;  1BJX A;  2TRX A;  2LJR A;  2BTO T;  3LSZ A;  1QFN A;  2V6K A;  3VWX A;  5AIX A;  3DGQ A;  3L9S A;  3D5J A;  1ML6 A;  4N30 A;  1TXX A;  1GTI A; 
#chains in the Genus database with same CATH topology
 2BMX A;  4KSO A;  4ULX A;  5DCH A;  5IMF A;  2OJL A;  5HR2 A;  1GSD A;  5ECR B;  2FWE A;  4LMW A;  2XPE A;  3VWU A;  1XW9 A;  1I5G A;  2WJU A;  1FOH A;  4KX4 A;  4J57 E;  2CAQ A;  5DCG A;  2B5X A;  3KP8 A;  4HU9 A;  3CBU A;  4ECB A;  3SBC A;  2H6Z A;  2DML A;  2HZF A;  4HQZ A;  4TKY A;  5KN0 A;  1PN9 A;  4O5Q A;  5DAK A;  2VAF A;  4PQ1 A;  1A0R P;  4MZC A;  1RW1 A;  1U88 A;  3F8U A;  4JZQ A;  1MTC A;  2CAI A;  2VIM A;  4L0W A;  3LWA A;  1PD2 1;  5A34 B;  1F3B A;  2C4J A;  3P8W A;  3ZLP A;  1EWX A;  1DE1 A;  2YNX A;  1A8L A;  2O36 A;  4IVF A;  3EVI A;  5ECS A;  3L4N A;  2LRN A;  2O3E A;  4GDF A;  3GX8 A;  4HZ2 A;  4GCI A;  2WW0 A;  1TK8 B;  2IFQ A;  4XRA A;  1YKC A;  3GRX A;  4EKZ A;  2IMK A;  4BVY B;  1AAZ A;  2G0F A;  2JAC A;  4WF4 A;  3FR3 A;  3CHX C;  3HKR A;  2P5Q A;  5IO2 A;  4WR5 A;  5EVO A;  1K3Y A;  3IHQ A;  2C0F A;  3HJO A;  4TR0 A;  5J9C A;  5AGY A;  3L9U A;  1A24 A;  1E6B A;  3HVS A;  1XFL A;  2MMO A;  3LXT A;  3HD5 A;  1EP7 A;  3GL5 A;  5CO3 A;  3LYP A;  2FD3 A;  2LNT A;  1G0T A;  2HNL A;  4GSS A;  3GHA A;  1XW5 A;  1T4Y A;  4YAP A;  3LEF A;  4K2X A;  2HRA A;  2C0G A;  1M9A A;  4K0G A;  4DSS B;  1J0F A;  3HVN A;  4N3Z A;  5CRH A;  1IYI A;  4G0I A;  3VLN A;  3CXG A;  4IJ3 A;  2EFC A;  1Z5Y E;  2VD0 A;  2F9S A;  4AKX B;  3TJF A;  1PRX A;  1GL8 A;  5B8B A;  2K8S A;  2LKU A;  4V2L A;  3PR8 A;  1JLW A;  1S3D A;  5CRW A;  2CVD A;  4EO3 A;  3RHB A;  4GSN A;  3IAM 2;  3WGD A;  20GS A;  2PU9 C;  4IP1 A;  4TRX A;  3W8S A;  4IJI A;  1LU4 A;  3TRQ A;  2VCZ A;  2FWG A;  1TI1 A;  1TI3 A;  4XIH A;  1YEX A;  2CT6 A;  5DAL B;  2JZS A;  4QMK A;  4KUN A;  3TKP A;  4ZB9 A;  5IQY A;  2PPT A;  1AXD A;  11GS A;  2CX3 A;  4Q5N A;  4BVY A;  3D4M A;  1PN0 A;  1W4V A;  5J4Y A;  8GSS A;  1SD9 A;  3EC3 A;  3MWH A;  2AYT A;  1IYH A;  2YV9 A;  1SKR B;  4K1F A;  3A2V A;  4XRD A;  2IMI A;  4KSM A;  5E59 A;  1M7T A;  2H74 A;  3DKS A;  3V1W A;  1ZZY A;  3I43 A;  1XWA A;  5B7C A;  2H76 A;  3ZVJ D;  1U3I A;  4PUF C;  2LQQ A;  3H79 A;  4D73 A;  1VF4 A;  3EUR A;  2EFH A;  1Z6M A;  2F8F A;  1K3L A;  3WT1 A;  2GZP A;  1XWG A;  3SWL A;  2NDO A;  2R4V A;  3M1G A;  2LNS A;  4TXO B;  3HMJ G;  4OCF A;  2DC5 A;  2LRT A;  4MF7 A;  1BG5 A;  1OE8 A;  4FQU A;  2HZE B;  1HYU A;  4O5R A;  4OO4 A;  1NSW A;  3FY7 A;  1N25 A;  5CNW A;  1XWK A;  4LL1 B;  1JHB A;  4PUR A;  2H6X A;  4WBR D;  5F8B A;  3UMA A;  4TN8 A;  3VPT A;  19GS A;  3ZVJ A;  4I8B A;  3P90 A;  2LRC A;  3TJK A;  2N5A A;  4FXY P;  4AGS A;  4LMV A;  2O5V A;  5DAL A;  1G6Y A;  3W6G A;  1V58 A;  4XS4 A;  3ZIV A;  3GA4 A;  3OR5 A;  4CY6 A;  1EV4 A;  1Y6E A;  4WR4 A;  4MJE A;  3TKS C;  2B5E A;  1O81 A;  3W8J A;  4ECC A;  3A2W A;  3HY2 A;  5ECN B;  4KGI A;  4ZBB A;  4JR4 A;  4POK A;  3D0Z A;  1T7P B;  4W66 A;  1OC9 A;  2WFC A;  1DSB A;  3H4K A;  3J7Y b;  2YV7 A;  1YJ6 A;  2L4Q A;  3WGX A;  3IBH A;  3TGZ A;  5KN3 A;  1A2J A;  2IN3 A;  1VF3 A;  2OBI A;  1TRS A;  5ECP B;  1Q4J A;  3FZ9 A;  3M9J A;  1PA3 A;  3I9V 2;  1F37 A;  4MF5 A;  1B4P A;  3O3T A;  2K6V A;  5L71 A;  1B9X C;  2B1K A;  2R0P A;  1FG4 A;  1GH2 A;  1V9W A;  4TR1 B;  5J3R A;  2HZE A;  4XS6 A;  2WRT A;  4GQC A;  1XCC A;  2WGR A;  1GLP A;  1GSS A;  2OE1 A;  1VRS D;  2NVL A;  4MNN A;  4JBB A;  1GP1 A;  2B7K A;  1GNE A;  4G01 A;  4E8E A;  4AKG A;  1SVO A;  4OFT A;  2YOI A;  3D22 A;  4FO5 A;  2XBI A;  4O5U A;  2QKE A;  3F6D A;  4F0B A;  5H5S A;  3FKF A;  1URM A;  2HSY A;  1SKW B;  4TVE A;  4RQR A;  4ZB7 A;  4MCU A;  1MD3 A;  2X49 A;  2WVY A;  2HXK A;  3C73 A;  3M0F A;  2DJ1 A;  4NHZ A;  4PNG A;  1MDK A;  3LYK A;  1WOU A;  4AJ8 A;  2I81 A;  4F03 A;  3VWW A;  3QAG A;  4DSQ A;  5A4W A;  4OCE A;  5IMV A;  2H1D A;  4L8E A;  1YDK A;  5ECK B;  3RBT A;  5INY A;  4WET A;  3TKQ A;  1FO5 A;  1G6W A;  3DYR A;  4GWR A;  2M80 A;  1XWB A;  5ELA A;  5F07 A;  5EY6 A;  1X9W B;  4MK3 A;  1KBN A;  1YKA A;  2B7J A;  4ZIL A;  2X8G A;  4V2N A;  3PGT A;  4JU5 A;  5ID2 A;  1K0C A;  1YZX A;  2FLS A;  4FH8 A;  1XVW A;  1UN2 A;  4IW9 A;  4CDO A;  3F4R A;  3HZ8 A;  4HI7 A;  1CQH A;  3R3E A;  4TR1 A;  4YH2 A;  2FY6 A;  2H6Y A;  1A2M A;  5CAX A;  3ME8 A;  4AKI A;  4K2D A;  5IO0 A;  2HQT A;  4IHU A;  5LD0 A;  4EUY A;  3VUR A;  13GS A;  4MF6 A;  4MP4 A;  5J4V A;  3Q74 A;  5GSS A;  2XPD A;  1WPI A;  1PL1 A;  4K7O A;  2CQ9 A;  1HNA A;  1U3A A;  4I2U A;  5BMU B;  1TK0 B;  4CHS A;  1F9M A;  2A4H A;  5J47 A;  1ABA A;  1XOB A;  2EIR A;  3MAK A;  2GDR A;  1PL2 A;  1BAY A;  4CY8 A;  4EE0 A;  2M72 A;  2DMM A;  2VL3 A;  4RI7 A;  3UAR A;  2GSQ A;  4WF5 A;  2TIR A;  5D9X A;  1PSQ A;  2DSA A;  1JZD A;  3DIE A;  3KZQ A;  6GSX A;  6GSV A;  2Z9S A;  2GSR A;  3IOS A;  4EIP A;  3DML A;  5G5E A;  2PVQ A;  2EFE A;  3VI7 A;  3IR4 A;  2JSZ A;  4HEA 2;  4POM A;  1TW9 A;  3F0I A;  1VF1 A;  1T1V A;  4EL1 A;  3QDN A;  2AV4 A;  3APO A;  1CQG A;  4NPB A;  1M0U A;  4OMV A;  5EPF A;  4AJ7 A;  4MAB A;  3UAP A;  1UVZ A;  4NHW A;  1ZYQ B;  4KDX A;  4EC0 A;  3MNG A;  4ML6 A;  3FR6 A;  3RPN A;  2YWN A;  1M99 A;  3GUS A;  2TRC P;  1EOG A;  3HCZ A;  4CW9 A;  2FUG 2;  1SKS B;  3U5R E;  3QFA C;  3FK8 A;  3KXO A;  2LJK A;  2OAD A;  5DQS A;  2DIY A;  3FW2 A;  2O8V B;  2NPB A;  5BMU A;  3CWG A;  5ENU A;  2HSM B;  4K0N A;  1FW1 A;  1NHY A;  3G7Y A;  4YQU A;  3KH7 A;  1KTE A;  5ECI B;  1SJI A;  2CVB A;  22GS A;  1JZO A;  1R5P A;  3WD6 A;  2MBT A;  2FA8 A;  4PGT A;  3APS A;  2YPM A;  2A2R A;  2HRK A;  4E68 A;  4IQ1 A;  2YZU A;  4J2F A;  4RI6 A;  4MMM A;  5C00 A;  3E9J B;  5D96 A;  3O6T A;  2QC7 A;  3J7Y k;  5J40 A;  3TUE A;  2WDU A;  2P0G A;  2WW1 A;  1W89 A;  1YQ1 A;  2WVX B;  4NWY A;  1SYR A;  1XWC A;  2GLR A;  2FA4 A;  3IPZ A;  3IHG A;  4WXT A;  3ZZX A;  3Q19 A;  1UC7 A;  2WS2 A;  5DVB A;  3ERW A;  1HQO A;  2AUV A;  4ZL7 A;  4JR6 A;  5IMC A;  1ZYN A;  3VFI A;  5JWO B;  4OD7 A;  3IK9 A;  1XW6 A;  2B6M A;  4XTS A;  3GKM A;  3F3Q A;  2DJ2 A;  3GUR A;  3QPM A;  3ZL5 A;  5IMZ A;  3TOU A;  3UBK A;  4ICY A;  4I97 A;  3NIV A;  2JZT A;  3DRN A;  3A5I A;  1M3I A;  3TCO A;  3GNJ A;  4TW5 A;  1VGL A;  2RUF A;  4Z2U A;  4N0Z A;  2LS5 A;  1F2E A;  3QD9 A;  2X99 A;  3M3M A;  3PIN A;  1HD2 A;  3BOA A;  3QAV A;  1EP8 A;  3GTU B;  2UZ8 A;  2H1A A;  1PKW A;  1TRW A;  2CVK A;  5G1K A;  5KOW A;  3D21 A;  1JFU A;  2FNO A;  5HR1 A;  4X43 A;  1O85 A;  3A2X A;  3NZN A;  6GSS A;  2RLI A;  3RFR C;  1G7E A;  2LJA A;  1U6T A;  1AIU A;  4N10 A;  3EMX A;  5JCU A;  3UL3 A;  5A34 A;  1EGR A;  2OBK A;  1TRV A;  3LFL A;  3HA9 A;  4PNF A;  1SK0 A;  3LGC A;  1BQ7 A;  2I4A A;  2O7K A;  1ERV A;  4ML1 A;  3G7J A;  4RUV A;  3ZYW A;  1GUK A;  3ME7 A;  1T3B A;  3FZ4 A;  2R0G A;  3BJ5 A;  4HDE A;  4HSC X;  5HQP A;  4WEY A;  1F6M C;  3P7X A;  3WYW A;  2RM6 A;  2MBS A;  2DJK A;  2GZZ A;  4DVC A;  3TRP A;  4MLY A;  4PQI A;  2YZH A;  3TKR A;  3UOM A;  2L57 A;  2VCV A;  3E3E A;  3HHV A;  4Q5R A;  1OC3 A;  3IE3 A;  6GSY A;  3F3R A;  4IBP A;  3UVH A;  1TJD A;  6GST A;  1PMT A;  3GH6 A;  1PKZ A;  4G0K A;  3ZRD A;  1M2D A;  3GH9 A;  2DJ0 A;  5KN1 A;  5HR3 A;  1NM3 A;  3IC4 A;  2NBS A;  3GTU A;  1YF0 A;  4P3Y B;  4V1A g;  1SYX A;  5ECQ B;  2GVP A;  2REM A;  1ACV A;  2BJX A;  3QCP A;  3KD0 A;  5GZZ B;  4GST A;  3P2A A;  2C80 A;  4DSS A;  4EVM A;  4ISD A;  5A5H B;  2ALB A;  4MZB A;  1SU9 A;  3DXB A;  4GXZ A;  3EU3 A;  2VLT A;  1S3A A;  2GQK A;  2H30 A;  3I6A A;  4KAE A;  1FHE A;  1USB A;  5G2Z A;  7GSS A;  2OA7 A;  5CP1 A;  2VCW A;  2E2G A;  2JSY A;  2VUP A;  1GUM A;  1XXU A;  1O6J A;  4YKG A;  3EE2 A;  2O89 A;  3C1S A;  1GTB A;  4KW6 A;  2MMZ A;  5G30 A;  2RUE A;  4HUA A;  2C3T A;  3G9B A;  3C7M A;  3ZIT A;  1TKD B;  3IC8 A;  2HI7 A;  4DSR A;  4MH3 A;  2WZS A;  5DQY A;  5B6M A;  1WIK A;  3VWV A;  4LLR A;  1O73 A;  1BG1 A;  2YCD A;  2K18 A;  1I1I P;  2ZNM A;  2DKH A;  3G7I A;  2YJ7 A;  3QOU A;  1M9B A;  2HSN B;  4IQA A;  3NOF A;  2VD1 A;  1XPV A;  3F63 A;  4MJA A;  1K3O A;  4TXO A;  2KHP A;  2X8C A;  4XCS A;  2R2J A;  4MDC A;  3KTL A;  3GSS A;  5GAN D;  1A8Y A;  1QQ2 A;  2B1L A;  2L4C A;  2N5B A;  1SVL A;  3C8E A;  4A5P A;  4PUA A;  4KND A;  4OFN A;  1SD8 A;  1ST9 A;  4Q5F A;  2B5Y A;  1XOA A;  1WE0 A;  3N9J A;  2F51 A;  3UBL A;  4WKW A;  3GKN A;  5COH A;  3IXR A;  2HE3 A;  1MEK A;  2R5G A;  3RGB C;  3K8N A;  1SJ6 A;  1ZCP A;  2IPA A;  2WW3 A;  3BD2 A;  2DIZ A;  4PI2 C;  5A1N B;  2RII A;  6GSU A;  4POL A;  5LCZ A;  1BX9 A;  2F3M A;  1V40 A;  3DVX A;  1PGT A;  4PHZ C;  4YKF A;  2MMN A;  2FGX A;  1YEW C;  4L5L A;  1ZYP A;  3L9V A;  5CYY A;  1A2L A;  3KMN A;  3TDG A;  1XG8 A;  2HSH A;  10GS A;  4ID0 A;  3HYP A;  2VLV A;  3WGE A;  1TDI A;  2WB9 A;  1K0B A;  1GRX A;  2MZC A;  5C04 A;  2N5F A;  1SK1 A;  1R7H A;  3H93 A;  1B48 A;  1NHO A;  1FOV A;  3F9U A;  4HOJ A;  5D8I A;  2GQM A;  1JZR A;  5ECO B;  2R3X A;  1GSE A;  3CSI A;  4G9H A;  4MPG A;  4AI6 A;  4HQS A;  2GTU A;  1T8E B;  1B8X A;  1ZL9 A;  2FWH A;  3A3T A;  1THO A;  2X8H A;  3EYT A;  2E0Q A;  4ZIJ A;  4J56 E;  1GTU A;  1TP9 A;  3TKS E;  3GYK A;  3U6V A;  5B6N A;  3GKK A;  2FHE A;  4I6X A;  3ZMK A;  3F6F A;  1V98 A;  2VM1 A;  2VLU A;  4O7H A;  3CSH A;  4PTS A;  2XC2 A;  1XZO A;  3TJB A;  3LW9 A;  3QR6 A;  2CA8 A;  3VPQ A;  3MYD A;  3GN3 A;  3GV1 A;  1M2A A;  4HJ2 A;  17GS A;  1R4W A;  3JCM L;  5EL8 A;  5FT3 A;  1KEB A;  2V32 A;  2H0G A;  4X1U A;  1PFO A;  2H72 A;  1SJZ A;  4KDY A;  2VKZ G;  5IOX A;  2DBC A;  5DJL A;  3KEB A;  18GS A;  2WZ9 A;  4MPF A;  1GUH A;  3HZ4 A;  3C71 A;  4MH2 A;  4G10 A;  2HRF A;  3BCI A;  2GQL A;  1Z9H A;  2MMA A;  3EU4 A;  4TXV A;  1J08 A;  1DBY A;  4DEJ A;  1GLQ A;  4GTU A;  5A4V A;  5CRG A;  3KH9 A;  2M46 A;  5ECL B;  3FR9 A;  2C3N A;  2VOC A;  2VL9 A;  2OKA A;  2L59 A;  1GSU A;  1FVK A;  3IAS 2;  1ERU A;  4YAV A;  4V1A p;  3H1N A;  1JLV A;  4YQV A;  1AQW A;  2L6D A;  3GKX A;  5HFK A;  4ILF A;  4KH7 A;  4ZB8 A;  2PGT A;  2HRN A;  4FIW A;  4FYU A;  2I9H A;  2WVZ A;  3EPT A;  3I69 A;  4IN0 A;  4IP6 A;  3US3 A;  5IMA A;  4EDY A;  2YWI A;  3KP9 A;  1O8X A;  4OO5 A;  2OT3 A;  5JWQ B;  4MA9 A;  5KN2 A;  2IFQ B;  3A5W A;  2X64 A;  4K5S A;  2FCH A;  5LNK e;  2XHF A;  1EEJ A;  4GF0 A;  4AF2 A;  1I9D A;  5B8A A;  3FZA A;  1RK4 A;  5A4U A;  5G1L A;  2E7P A;  3ZFB A;  4PX1 A;  3UJ1 A;  1WP0 A;  2GZY A;  3N5O A;  3IDV A;  4K6X A;  3TRX A;  2EC4 A;  3F4T A;  3PPU A;  3FEU A;  2H71 A;  1BF5 A;  1JZW A;  1TRU A;  3UEM A;  4JRR A;  5GAP D;  4IKH A;  2A4V A;  6GSW A;  4KCA A;  3BCK A;  1TU7 A;  3IK7 A;  2GS3 A;  5H5R A;  3HVV A;  3ZRE A;  4Z7X A;  5FWG A;  4FYC A;  5FHI A;  4BPY A;  4G2E A;  4ZL9 A;  1ERW A;  4ZL8 A;  3CRT A;  3FMW A;  1FAA A;  3ZFL A;  3VK9 A;  1LJR A;  5G5F A;  4POB A;  1DUG A;  2LTK A;  1THX A;  2LV3 A;  1A0F A;  1X5E A;  2PN8 A;  3KCM A;  4NXI A;  2PBJ A;  1K0A A;  3EIN A;  2YWM A;  3KM6 A;  1AW9 A;  4K5R A;  2LQO A;  2OE3 A;  1KNG A;  2H1L A;  1PQN A;  4TR3 A;  4HS1 A;  4GLT A;  5DBQ A;  4K7I A;  5CRE A;  1EGO A;  4G19 A;  1EV9 A;  2HSM A;  4Z2T A;  4K9Z A;  3TKS A;  16GS A;  5HFI A;  3M8N A;  1QUW A;  2YWO A;  2EFD A;  4F2I A;  3R2Q A;  2R37 A;  3KJY A;  4BA7 A;  1AUC A;  2PUK C;  3QFB C;  1Z3E A;  1FVJ A;  4NMU A;  3GST A;  4FYB A;  1EZK A;  1ZOF A;  3DD3 A;  1AQX A;  4K8M A;  4BIK A;  2V41 A;  5IIZ A;  4GQF A;  2C3Q A;  3CTG A;  2WVX A;  1OKT A;  1TK5 B;  4TR4 A;  5J41 A;  4D73 B;  1GWC A;  2ON5 A;  2CZ2 A;  1QGV A;  1GNW A;  3RDW A;  4BVX B;  2IJY A;  1YF1 A;  4KA0 A;  2JL4 A;  2HT9 A;  5H5Q A;  3UIW A;  3Q6O A;  3S9F A;  3TU3 B;  1EOH A;  2DKI A;  3ISO A;  5ECH B;  5F0G A;  1OAZ A;  1QMV A;  2DJ3 A;  3HJP A;  2B3S A;  2H70 A;  4L0U A;  2J23 A;  2VCQ A;  3RHC A;  2GSS A;  3ERF A;  3QMX A;  4OFM A;  2C0D A;  4EDZ A;  2C8U A;  1FB0 A;  1T00 A;  2H75 A;  1K0D A;  4L5O A;  3KMO A;  4TOP A;  4JED A;  1B9Y C;  3ED3 A;  3CYN A;  1Z7P A;  4USS A;  2KUC A;  2QSI A;  3DVW A;  1BYE A;  2GGT A;  1GUL A;  3E0U A;  4XS4 B;  2YJH A;  1Z7R A;  5BRT A;  3ZIJ A;  1M2B A;  4EF0 A;  2H73 A;  4G0L A;  4PQH A;  5F05 A;  3ERG A;  5D9T A;  3GX0 A;  1OC9 B;  3O76 A;  5KOX A;  2O87 A;  3GFK A;  5DDL A;  1A23 A;  2K9F A;  2EIO A;  1Y1U A;  4PXO A;  4GRF A;  1V2A A;  1Y25 A;  1UA5 A;  1GSF A;  1NW2 A;  3TJJ A;  2JU5 A;  1ON4 A;  1O8W A;  1XIY A;  1TXU A;  5D73 A;  4BVX A;  2C0E A;  3CTF A;  3M9K A;  2H8L A;  5ELG A;  2C1Y A;  2QGV A;  5IPG A;  2AB6 A;  3CSJ A;  1ZGN A;  2PMT A;  2PER A;  1MDI A;  2VCX A;  1X5C A;  2L5L A;  3DWV A;  1S3R A;  2F8A A;  1GSQ A;  2WCI A;  1AC1 A;  5DJM A;  14GS A;  1ILO A;  1QXH A;  2H66 A;  2KOK A;  2X4A A;  1YEP A;  3FHK A;  9GSS A;  1ZYE A;  2IMD A;  2H0I A;  1RQM A;  3IV4 A;  2JAD A;  1EEM A;  3EWL A;  4BL7 B;  1B4Q A;  5IMD A;  4O92 A;  5JCG A;  4WBJ A;  4XHM A;  1OC8 A;  3QAW A;  2AHE A;  3HJM A;  1ERT A;  1MDJ A;  3CMI A;  4O32 A;  1PX7 A;  3LG6 A;  4N11 A;  1HNC A;  1TU8 A;  1S3C A;  1X0R A;  3TOT A;  4IGJ A;  3BBY A;  3LQ7 A;  4F82 A;  1C72 A;  2GST A;  5ABR A;  2DLX A;  1BED A;  4H86 A;  5IM9 A;  3KGK A;  3TB2 A;  1WWJ A;  2VO4 A;  2P31 A;  2A2P A;  2YP6 A;  1Z6N A;  4E8H A;  2FWF A;  1GTA A;  5A5H A;  5G31 A;  3VI5 A;  5HFG A;  4KF9 A;  1J9B A;  2KLX A;  3HVX A;  1N2A A;  4ECJ A;  5J4U A;  5GST A;  5ECM B;  1O7U A;  2KP1 A;  3LOR A;  2R0C A;  4RQX A;  4EIQ A;  4AKH A;  5ID2 B;  3GMF A;  3IA1 A;  3CRU A;  1MD4 A;  3RAZ A;  1AQV A;  2XBQ A;  1PX6 A;  1SL1 B;  2QA2 A;  1ZMA A;  4OWY A;  2JZR A;  5IOW A;  1OKD A;  2D2Z A;  2IIY A;  3L78 A;  2CZ3 A;  3LXZ A;  2VL2 A;  2K8V A;  1SEN A;  3L0H A;  1N8J A;  2PWJ A;  1HNB A;  4KE3 A;  4KDU A;  1TTZ A;  2R6K A;  5D9V A;  4BWS A;  2HLS A;  2IMF A;  5AN1 A;  4ACS A;  5KEJ A;  2H0H A;  2IL3 A;  4BL7 A;  2YN1 A;  4MJC A;  5AIS A;  5AIV A;  3D6I A;  1X9S B;  2H19 A;  4ECI A;  3KTB A;  1OE7 A;  4IEL A;  3HDC A;  1Q98 A;  4IS0 A;  2VCT A;  4ZXG A;  2PVO C;  3TJG A;  4HZ4 A;  2I1U A;  4YQM A;  4HU7 A;  1S4B P;  1K0M A;  4Q5Q A;  1H75 A;  3FYG A;  4ZBD A;  2HSN A;  3MDK A;  5J9B A;  4N0V A;  4I5Q A;  4MZW A;  5D93 A;  1X5D A;  2HFD A;  2O85 A;  1WMJ A;  1SVM A;  3APQ A;  1M3J A;  3MIX A;  2EIQ A;  4QL9 A;  1OYJ A;  1SK2 A;  2L5O A;  4K7N A;  3D4T A;  3Q18 A;  12GS A;  5F06 A;  1R26 A;  1YVL A;  1WJK A;  1OVN A;  2H01 A;  1YY7 A;  2WW2 A;  2A2S A;  3PH9 A;  4X0X A;  3AY8 A;  2ZCT A;  1SL0 B;  4JE1 A;  1R5A A;  2I3Y A;  4KB3 A;  2UV8 G;  1SL2 B;  4F0C A;  5A5K A;  2L6C A;  3UVT A;  4QQ7 A;  1QK8 A;  2AAW A;  4EXJ A;  1X9M B;  2V1M A;  4LL4 B;  2WUL A;  4Z2R A;  1E2Y A;  2ES7 A;  5JCW A;  4KCE A;  5E4W A;  3DEX A;  5A1N A;  3GIX A;  3MSZ A;  4HJM A;  3LJR A;  1LBK A;  2LUS A;  2V2G A;  2G2Q A;  4XS1 A;  2LEG A;  1V57 A;  4NV2 A;  3H8Q A;  2GT5 A;  1U87 A;  3ZML A;  3RPP A;  2IME A;  3GL3 A;  2E2M A;  2YAN A;  2H1G A;  2NTO A;  4V2M A;  2VM2 A;  4QL7 A;  3FZ5 A;  4I2T A;  3FRC A;  3ZTL A;  1WRY A;  2HRK B;  5D9W A;  2ON7 A;  2CV4 A;  5CRD A;  2J9H A;  4F9Z A;  2HYX A;  4PI0 C;  2CX4 A;  2DJJ A;  4NV5 A;  2IWT A;  1TOF A;  4MJB A;  4BWQ A;  3KIJ A;  5J5N A;  1K0O A;  5DAK B;  2ZUP A;  1DE2 A;  4AJ6 A;  3EMP A;  3C1R A;  1VF2 A;  5JWR B;  4NAX A;  2OAC A;  3HXS A;  2H1B A;  2AJQ B;  1T4Z A;  1G7O A;  2V6O A;  1K0N A;  2GT6 A;  1FB6 A;  2OE0 A;  1GSY A;  5IPH A;  2RM5 A;  4X4J A;  1F3A A;  2LST A;  1XBS A;  4ZBA A;  3F4S A;  3WT2 A;  2KP2 A;  3IRA A;  2P5R A;  1XVQ A;  3CQF A;  5HR0 A;  1H4O A;  4ZB6 A;  2MYG A;  2QA1 A;  4LA1 A;  2VL2 C;  1BJX A;  2TRX A;  2LJR A;  2BTO T;  3LSZ A;  1QFN A;  2V6K A;  3VWX A;  5AIX A;  3DGQ A;  3L9S A;  3D5J A;  1ML6 A;  4N30 A;  1TXX A;  1GTI A; 
#chains in the Genus database with same CATH homology
 2BMX A;  4KSO A;  4ULX A;  5DCH A;  5IMF A;  2OJL A;  5HR2 A;  1GSD A;  5ECR B;  2FWE A;  4LMW A;  2XPE A;  3VWU A;  1XW9 A;  1I5G A;  2WJU A;  1FOH A;  4KX4 A;  4J57 E;  2CAQ A;  5DCG A;  2B5X A;  3KP8 A;  4HU9 A;  3CBU A;  4ECB A;  3SBC A;  2H6Z A;  2DML A;  2HZF A;  4HQZ A;  4TKY A;  5KN0 A;  1PN9 A;  4O5Q A;  5DAK A;  2VAF A;  4PQ1 A;  1A0R P;  4MZC A;  1RW1 A;  1U88 A;  3F8U A;  4JZQ A;  1MTC A;  2CAI A;  2VIM A;  4L0W A;  3LWA A;  1PD2 1;  5A34 B;  1F3B A;  2C4J A;  3P8W A;  3ZLP A;  1EWX A;  1DE1 A;  2YNX A;  1A8L A;  4IVF A;  3EVI A;  5ECS A;  3L4N A;  2LRN A;  4GDF A;  3GX8 A;  4HZ2 A;  4GCI A;  1TK8 B;  2IFQ A;  4XRA A;  1YKC A;  3GRX A;  4EKZ A;  2IMK A;  4BVY B;  1AAZ A;  2G0F A;  2JAC A;  4WF4 A;  3FR3 A;  3HKR A;  2P5Q A;  5IO2 A;  4WR5 A;  5EVO A;  1K3Y A;  3IHQ A;  2C0F A;  3HJO A;  4TR0 A;  5J9C A;  5AGY A;  3L9U A;  1A24 A;  1E6B A;  3HVS A;  1XFL A;  2MMO A;  3LXT A;  3HD5 A;  1EP7 A;  3GL5 A;  5CO3 A;  3LYP A;  2FD3 A;  2LNT A;  1G0T A;  2HNL A;  4GSS A;  3GHA A;  1XW5 A;  1T4Y A;  4YAP A;  3LEF A;  4K2X A;  2HRA A;  2C0G A;  1M9A A;  4K0G A;  4DSS B;  1J0F A;  4N3Z A;  5CRH A;  1IYI A;  4G0I A;  3VLN A;  3CXG A;  4IJ3 A;  2EFC A;  1Z5Y E;  2VD0 A;  2F9S A;  4AKX B;  3TJF A;  1PRX A;  1GL8 A;  5B8B A;  2K8S A;  2LKU A;  4V2L A;  3PR8 A;  1JLW A;  1S3D A;  5CRW A;  2CVD A;  4EO3 A;  3RHB A;  4GSN A;  3IAM 2;  3WGD A;  20GS A;  2PU9 C;  4IP1 A;  4TRX A;  3W8S A;  4IJI A;  1LU4 A;  3TRQ A;  2VCZ A;  2FWG A;  1TI1 A;  1TI3 A;  4XIH A;  1YEX A;  2CT6 A;  5DAL B;  2JZS A;  4QMK A;  4KUN A;  3TKP A;  4ZB9 A;  5IQY A;  2PPT A;  1AXD A;  11GS A;  2CX3 A;  4Q5N A;  4BVY A;  3D4M A;  1PN0 A;  1W4V A;  5J4Y A;  8GSS A;  1SD9 A;  3EC3 A;  3MWH A;  2AYT A;  1IYH A;  2YV9 A;  1SKR B;  4K1F A;  3A2V A;  4XRD A;  2IMI A;  4KSM A;  5E59 A;  1M7T A;  2H74 A;  3DKS A;  3V1W A;  1ZZY A;  3I43 A;  1XWA A;  5B7C A;  2H76 A;  3ZVJ D;  1U3I A;  4PUF C;  2LQQ A;  3H79 A;  4D73 A;  1VF4 A;  3EUR A;  2EFH A;  1Z6M A;  2F8F A;  1K3L A;  3WT1 A;  2GZP A;  1XWG A;  3SWL A;  2NDO A;  2R4V A;  3M1G A;  2LNS A;  4TXO B;  3HMJ G;  4OCF A;  2DC5 A;  2LRT A;  4MF7 A;  1BG5 A;  1OE8 A;  4FQU A;  2HZE B;  1HYU A;  4O5R A;  4OO4 A;  1NSW A;  3FY7 A;  1N25 A;  5CNW A;  1XWK A;  4LL1 B;  1JHB A;  4PUR A;  2H6X A;  4WBR D;  5F8B A;  3UMA A;  4TN8 A;  3VPT A;  19GS A;  3ZVJ A;  4I8B A;  3P90 A;  2LRC A;  3TJK A;  2N5A A;  4AGS A;  4LMV A;  2O5V A;  5DAL A;  1G6Y A;  3W6G A;  1V58 A;  4XS4 A;  3ZIV A;  3GA4 A;  3OR5 A;  4CY6 A;  1EV4 A;  1Y6E A;  4WR4 A;  4MJE A;  3TKS C;  2B5E A;  1O81 A;  3W8J A;  4ECC A;  3A2W A;  3HY2 A;  5ECN B;  4KGI A;  4ZBB A;  4JR4 A;  4POK A;  3D0Z A;  1T7P B;  4W66 A;  1OC9 A;  2WFC A;  1DSB A;  3H4K A;  3J7Y b;  2YV7 A;  1YJ6 A;  2L4Q A;  3WGX A;  3IBH A;  3TGZ A;  5KN3 A;  1A2J A;  2IN3 A;  1VF3 A;  2OBI A;  1TRS A;  5ECP B;  1Q4J A;  3FZ9 A;  3M9J A;  1PA3 A;  3I9V 2;  1F37 A;  4MF5 A;  1B4P A;  3O3T A;  2K6V A;  5L71 A;  1B9X C;  2B1K A;  2R0P A;  1FG4 A;  1GH2 A;  1V9W A;  4TR1 B;  5J3R A;  2HZE A;  4XS6 A;  2WRT A;  4GQC A;  1XCC A;  2WGR A;  1GLP A;  1GSS A;  2OE1 A;  1VRS D;  2NVL A;  4MNN A;  4JBB A;  1GP1 A;  2B7K A;  1GNE A;  4G01 A;  4E8E A;  4AKG A;  1SVO A;  4OFT A;  2YOI A;  3D22 A;  4FO5 A;  2XBI A;  4O5U A;  2QKE A;  3F6D A;  4F0B A;  5H5S A;  3FKF A;  1URM A;  2HSY A;  1SKW B;  4TVE A;  4RQR A;  4ZB7 A;  4MCU A;  1MD3 A;  2X49 A;  2HXK A;  3C73 A;  3M0F A;  2DJ1 A;  4NHZ A;  4PNG A;  1MDK A;  3LYK A;  1WOU A;  4AJ8 A;  2I81 A;  4F03 A;  3VWW A;  3QAG A;  4DSQ A;  5A4W A;  4OCE A;  5IMV A;  2H1D A;  4L8E A;  1YDK A;  5ECK B;  3RBT A;  5INY A;  4WET A;  3TKQ A;  1FO5 A;  1G6W A;  3DYR A;  4GWR A;  2M80 A;  1XWB A;  5ELA A;  5F07 A;  5EY6 A;  1X9W B;  4MK3 A;  1KBN A;  1YKA A;  2B7J A;  4ZIL A;  2X8G A;  4V2N A;  3PGT A;  4JU5 A;  5ID2 A;  1K0C A;  1YZX A;  2FLS A;  4FH8 A;  1XVW A;  1UN2 A;  4IW9 A;  4CDO A;  3F4R A;  3HZ8 A;  4HI7 A;  1CQH A;  3R3E A;  4TR1 A;  4YH2 A;  2FY6 A;  2H6Y A;  1A2M A;  5CAX A;  3ME8 A;  4AKI A;  4K2D A;  5IO0 A;  2HQT A;  4IHU A;  5LD0 A;  4EUY A;  3VUR A;  13GS A;  4MF6 A;  4MP4 A;  5J4V A;  3Q74 A;  5GSS A;  2XPD A;  1WPI A;  1PL1 A;  4K7O A;  2CQ9 A;  1HNA A;  1U3A A;  4I2U A;  5BMU B;  1TK0 B;  4CHS A;  1F9M A;  2A4H A;  5J47 A;  1ABA A;  1XOB A;  2EIR A;  3MAK A;  2GDR A;  1PL2 A;  1BAY A;  4CY8 A;  4EE0 A;  2M72 A;  2DMM A;  2VL3 A;  4RI7 A;  3UAR A;  2GSQ A;  4WF5 A;  2TIR A;  5D9X A;  1PSQ A;  2DSA A;  1JZD A;  3DIE A;  3KZQ A;  6GSX A;  6GSV A;  2Z9S A;  2GSR A;  3IOS A;  4EIP A;  3DML A;  5G5E A;  2PVQ A;  2EFE A;  3VI7 A;  3IR4 A;  2JSZ A;  4HEA 2;  4POM A;  1TW9 A;  3F0I A;  1VF1 A;  1T1V A;  4EL1 A;  3QDN A;  2AV4 A;  3APO A;  1CQG A;  4NPB A;  1M0U A;  4OMV A;  5EPF A;  4AJ7 A;  4MAB A;  3UAP A;  1UVZ A;  4NHW A;  1ZYQ B;  4KDX A;  4EC0 A;  3MNG A;  4ML6 A;  3FR6 A;  3RPN A;  2YWN A;  1M99 A;  3GUS A;  2TRC P;  1EOG A;  3HCZ A;  4CW9 A;  2FUG 2;  1SKS B;  3U5R E;  3QFA C;  3FK8 A;  3KXO A;  2LJK A;  2OAD A;  5DQS A;  2DIY A;  3FW2 A;  2O8V B;  2NPB A;  5BMU A;  3CWG A;  5ENU A;  2HSM B;  4K0N A;  1FW1 A;  1NHY A;  3G7Y A;  4YQU A;  3KH7 A;  1KTE A;  5ECI B;  1SJI A;  2CVB A;  22GS A;  1JZO A;  1R5P A;  3WD6 A;  2MBT A;  2FA8 A;  4PGT A;  3APS A;  2YPM A;  2A2R A;  2HRK A;  4E68 A;  4IQ1 A;  2YZU A;  4J2F A;  4RI6 A;  4MMM A;  5C00 A;  3E9J B;  5D96 A;  3O6T A;  2QC7 A;  3J7Y k;  5J40 A;  3TUE A;  2WDU A;  2P0G A;  1W89 A;  1YQ1 A;  4NWY A;  1SYR A;  1XWC A;  2GLR A;  2FA4 A;  3IPZ A;  3IHG A;  4WXT A;  3ZZX A;  3Q19 A;  1UC7 A;  2WS2 A;  5DVB A;  3ERW A;  1HQO A;  2AUV A;  4ZL7 A;  4JR6 A;  5IMC A;  1ZYN A;  3VFI A;  5JWO B;  4OD7 A;  3IK9 A;  1XW6 A;  2B6M A;  4XTS A;  3GKM A;  3F3Q A;  2DJ2 A;  3GUR A;  3QPM A;  3ZL5 A;  5IMZ A;  3TOU A;  3UBK A;  4ICY A;  4I97 A;  3NIV A;  2JZT A;  3DRN A;  3A5I A;  3TCO A;  3GNJ A;  4TW5 A;  1VGL A;  2RUF A;  4Z2U A;  4N0Z A;  2LS5 A;  1F2E A;  3QD9 A;  2X99 A;  3M3M A;  3PIN A;  1HD2 A;  3BOA A;  3QAV A;  1EP8 A;  3GTU B;  2UZ8 A;  2H1A A;  1PKW A;  1TRW A;  2CVK A;  5G1K A;  5KOW A;  3D21 A;  1JFU A;  2FNO A;  5HR1 A;  4X43 A;  1O85 A;  3A2X A;  3NZN A;  6GSS A;  2RLI A;  1G7E A;  2LJA A;  1U6T A;  1AIU A;  4N10 A;  3EMX A;  5JCU A;  3UL3 A;  5A34 A;  1EGR A;  2OBK A;  1TRV A;  3LFL A;  3HA9 A;  4PNF A;  1SK0 A;  3LGC A;  1BQ7 A;  2I4A A;  2O7K A;  1ERV A;  4ML1 A;  3G7J A;  4RUV A;  3ZYW A;  1GUK A;  3ME7 A;  1T3B A;  3FZ4 A;  2R0G A;  3BJ5 A;  4HDE A;  5HQP A;  4WEY A;  1F6M C;  3P7X A;  3WYW A;  2RM6 A;  2MBS A;  2DJK A;  2GZZ A;  4DVC A;  3TRP A;  4MLY A;  4PQI A;  2YZH A;  3TKR A;  3UOM A;  2L57 A;  2VCV A;  3E3E A;  3HHV A;  4Q5R A;  1OC3 A;  3IE3 A;  6GSY A;  3F3R A;  4IBP A;  3UVH A;  1TJD A;  6GST A;  1PMT A;  3GH6 A;  1PKZ A;  4G0K A;  3ZRD A;  1M2D A;  3GH9 A;  2DJ0 A;  5KN1 A;  5HR3 A;  1NM3 A;  3IC4 A;  2NBS A;  3GTU A;  1YF0 A;  4P3Y B;  4V1A g;  1SYX A;  5ECQ B;  2GVP A;  2REM A;  1ACV A;  2BJX A;  3QCP A;  3KD0 A;  5GZZ B;  4GST A;  3P2A A;  2C80 A;  4DSS A;  4EVM A;  4ISD A;  5A5H B;  2ALB A;  4MZB A;  1SU9 A;  3DXB A;  4GXZ A;  3EU3 A;  2VLT A;  1S3A A;  2GQK A;  2H30 A;  3I6A A;  4KAE A;  1FHE A;  1USB A;  5G2Z A;  7GSS A;  2OA7 A;  5CP1 A;  2VCW A;  2E2G A;  2JSY A;  2VUP A;  1GUM A;  1XXU A;  1O6J A;  4YKG A;  3EE2 A;  2O89 A;  3C1S A;  1GTB A;  4KW6 A;  2MMZ A;  5G30 A;  2RUE A;  4HUA A;  2C3T A;  3G9B A;  3C7M A;  3ZIT A;  1TKD B;  3IC8 A;  2HI7 A;  4DSR A;  4MH3 A;  5DQY A;  5B6M A;  1WIK A;  3VWV A;  4LLR A;  1O73 A;  1BG1 A;  2YCD A;  2K18 A;  2ZNM A;  2DKH A;  3G7I A;  2YJ7 A;  3QOU A;  1M9B A;  2HSN B;  4IQA A;  3NOF A;  2VD1 A;  1XPV A;  3F63 A;  4MJA A;  1K3O A;  4TXO A;  2KHP A;  2X8C A;  4XCS A;  2R2J A;  4MDC A;  3KTL A;  3GSS A;  5GAN D;  1A8Y A;  1QQ2 A;  2B1L A;  2L4C A;  2N5B A;  1SVL A;  3C8E A;  4A5P A;  4PUA A;  4KND A;  4OFN A;  1SD8 A;  1ST9 A;  4Q5F A;  2B5Y A;  1XOA A;  1WE0 A;  3N9J A;  2F51 A;  3UBL A;  4WKW A;  3GKN A;  5COH A;  3IXR A;  2HE3 A;  1MEK A;  2R5G A;  3K8N A;  1SJ6 A;  1ZCP A;  2IPA A;  3BD2 A;  2DIZ A;  5A1N B;  2RII A;  6GSU A;  4POL A;  5LCZ A;  1BX9 A;  2F3M A;  1V40 A;  3DVX A;  1PGT A;  4YKF A;  2MMN A;  2FGX A;  4L5L A;  1ZYP A;  3L9V A;  5CYY A;  1A2L A;  3KMN A;  3TDG A;  2HSH A;  10GS A;  4ID0 A;  3HYP A;  2VLV A;  3WGE A;  1TDI A;  2WB9 A;  1K0B A;  1GRX A;  2MZC A;  5C04 A;  2N5F A;  1SK1 A;  1R7H A;  3H93 A;  1B48 A;  1NHO A;  1FOV A;  3F9U A;  4HOJ A;  5D8I A;  2GQM A;  1JZR A;  5ECO B;  2R3X A;  1GSE A;  3CSI A;  4G9H A;  4MPG A;  4AI6 A;  4HQS A;  2GTU A;  1T8E B;  1B8X A;  1ZL9 A;  2FWH A;  3A3T A;  1THO A;  2X8H A;  3EYT A;  2E0Q A;  4ZIJ A;  4J56 E;  1GTU A;  1TP9 A;  3TKS E;  3GYK A;  3U6V A;  5B6N A;  3GKK A;  2FHE A;  4I6X A;  3ZMK A;  3F6F A;  1V98 A;  2VM1 A;  2VLU A;  4O7H A;  3CSH A;  4PTS A;  2XC2 A;  1XZO A;  3TJB A;  3LW9 A;  3QR6 A;  2CA8 A;  3VPQ A;  3MYD A;  3GN3 A;  3GV1 A;  1M2A A;  4HJ2 A;  17GS A;  1R4W A;  3JCM L;  5EL8 A;  5FT3 A;  1KEB A;  2V32 A;  2H0G A;  4X1U A;  2H72 A;  1SJZ A;  4KDY A;  2VKZ G;  5IOX A;  2DBC A;  5DJL A;  3KEB A;  18GS A;  2WZ9 A;  4MPF A;  1GUH A;  3HZ4 A;  3C71 A;  4MH2 A;  4G10 A;  2HRF A;  3BCI A;  2GQL A;  1Z9H A;  2MMA A;  3EU4 A;  4TXV A;  1J08 A;  1DBY A;  4DEJ A;  1GLQ A;  4GTU A;  5A4V A;  5CRG A;  3KH9 A;  2M46 A;  5ECL B;  3FR9 A;  2C3N A;  2VOC A;  2VL9 A;  2OKA A;  2L59 A;  1GSU A;  1FVK A;  3IAS 2;  1ERU A;  4YAV A;  4V1A p;  3H1N A;  1JLV A;  4YQV A;  1AQW A;  2L6D A;  3GKX A;  5HFK A;  4ILF A;  4KH7 A;  4ZB8 A;  2PGT A;  2HRN A;  4FIW A;  4FYU A;  2I9H A;  3EPT A;  3I69 A;  4IN0 A;  4IP6 A;  3US3 A;  5IMA A;  4EDY A;  2YWI A;  3KP9 A;  1O8X A;  4OO5 A;  2OT3 A;  5JWQ B;  4MA9 A;  5KN2 A;  2IFQ B;  3A5W A;  2X64 A;  4K5S A;  2FCH A;  5LNK e;  2XHF A;  1EEJ A;  4GF0 A;  4AF2 A;  1I9D A;  5B8A A;  3FZA A;  1RK4 A;  5A4U A;  5G1L A;  2E7P A;  3ZFB A;  4PX1 A;  3UJ1 A;  1WP0 A;  2GZY A;  3N5O A;  3IDV A;  4K6X A;  3TRX A;  2EC4 A;  3F4T A;  3PPU A;  3FEU A;  2H71 A;  1BF5 A;  1JZW A;  1TRU A;  3UEM A;  4JRR A;  5GAP D;  4IKH A;  2A4V A;  6GSW A;  4KCA A;  3BCK A;  1TU7 A;  3IK7 A;  2GS3 A;  5H5R A;  3HVV A;  3ZRE A;  4Z7X A;  5FWG A;  4FYC A;  5FHI A;  4BPY A;  4G2E A;  4ZL9 A;  1ERW A;  4ZL8 A;  3CRT A;  3FMW A;  1FAA A;  3ZFL A;  3VK9 A;  1LJR A;  5G5F A;  4POB A;  1DUG A;  2LTK A;  1THX A;  2LV3 A;  1A0F A;  1X5E A;  2PN8 A;  3KCM A;  4NXI A;  2PBJ A;  1K0A A;  3EIN A;  2YWM A;  3KM6 A;  1AW9 A;  4K5R A;  2LQO A;  2OE3 A;  1KNG A;  2H1L A;  1PQN A;  4TR3 A;  4HS1 A;  4GLT A;  5DBQ A;  4K7I A;  5CRE A;  1EGO A;  4G19 A;  1EV9 A;  2HSM A;  4Z2T A;  4K9Z A;  3TKS A;  16GS A;  5HFI A;  3M8N A;  1QUW A;  2YWO A;  2EFD A;  4F2I A;  3R2Q A;  2R37 A;  3KJY A;  4BA7 A;  1AUC A;  2PUK C;  3QFB C;  1Z3E A;  1FVJ A;  4NMU A;  3GST A;  4FYB A;  1EZK A;  1ZOF A;  3DD3 A;  1AQX A;  4K8M A;  2V41 A;  5IIZ A;  4GQF A;  2C3Q A;  3CTG A;  1OKT A;  1TK5 B;  4TR4 A;  5J41 A;  4D73 B;  1GWC A;  2ON5 A;  2CZ2 A;  1QGV A;  1GNW A;  3RDW A;  4BVX B;  2IJY A;  1YF1 A;  4KA0 A;  2JL4 A;  2HT9 A;  5H5Q A;  3UIW A;  3Q6O A;  3S9F A;  3TU3 B;  1EOH A;  2DKI A;  3ISO A;  5ECH B;  5F0G A;  1OAZ A;  1QMV A;  2DJ3 A;  3HJP A;  2B3S A;  2H70 A;  4L0U A;  2J23 A;  2VCQ A;  3RHC A;  2GSS A;  3ERF A;  3QMX A;  4OFM A;  2C0D A;  4EDZ A;  2C8U A;  1FB0 A;  1T00 A;  2H75 A;  1K0D A;  4L5O A;  3KMO A;  4TOP A;  4JED A;  1B9Y C;  3ED3 A;  3CYN A;  1Z7P A;  4USS A;  2KUC A;  2QSI A;  3DVW A;  1BYE A;  2GGT A;  1GUL A;  3E0U A;  4XS4 B;  2YJH A;  1Z7R A;  5BRT A;  3ZIJ A;  1M2B A;  4EF0 A;  2H73 A;  4G0L A;  4PQH A;  5F05 A;  3ERG A;  5D9T A;  3GX0 A;  1OC9 B;  3O76 A;  5KOX A;  2O87 A;  3GFK A;  5DDL A;  1A23 A;  2K9F A;  2EIO A;  1Y1U A;  4PXO A;  4GRF A;  1V2A A;  1Y25 A;  1UA5 A;  1GSF A;  1NW2 A;  3TJJ A;  2JU5 A;  1ON4 A;  1O8W A;  1XIY A;  1TXU A;  5D73 A;  4BVX A;  2C0E A;  3CTF A;  3M9K A;  2H8L A;  5ELG A;  2C1Y A;  2QGV A;  5IPG A;  2AB6 A;  3CSJ A;  1ZGN A;  2PMT A;  2PER A;  1MDI A;  2VCX A;  1X5C A;  2L5L A;  3DWV A;  2F8A A;  1GSQ A;  2WCI A;  1AC1 A;  5DJM A;  14GS A;  1ILO A;  1QXH A;  2H66 A;  2KOK A;  2X4A A;  1YEP A;  3FHK A;  9GSS A;  1ZYE A;  2IMD A;  2H0I A;  1RQM A;  3IV4 A;  2JAD A;  1EEM A;  3EWL A;  4BL7 B;  1B4Q A;  5IMD A;  4O92 A;  5JCG A;  4WBJ A;  4XHM A;  1OC8 A;  3QAW A;  2AHE A;  3HJM A;  1ERT A;  1MDJ A;  3CMI A;  4O32 A;  1PX7 A;  3LG6 A;  4N11 A;  1HNC A;  1TU8 A;  1S3C A;  1X0R A;  3TOT A;  4IGJ A;  3BBY A;  3LQ7 A;  4F82 A;  1C72 A;  2GST A;  5ABR A;  2DLX A;  1BED A;  4H86 A;  5IM9 A;  3KGK A;  3TB2 A;  1WWJ A;  2VO4 A;  2P31 A;  2A2P A;  2YP6 A;  1Z6N A;  4E8H A;  2FWF A;  1GTA A;  5A5H A;  5G31 A;  3VI5 A;  5HFG A;  4KF9 A;  1J9B A;  2KLX A;  3HVX A;  1N2A A;  4ECJ A;  5J4U A;  5GST A;  5ECM B;  1O7U A;  2KP1 A;  3LOR A;  2R0C A;  4RQX A;  4EIQ A;  4AKH A;  5ID2 B;  3GMF A;  3IA1 A;  3CRU A;  1MD4 A;  3RAZ A;  1AQV A;  2XBQ A;  1PX6 A;  1SL1 B;  2QA2 A;  1ZMA A;  4OWY A;  2JZR A;  5IOW A;  1OKD A;  2D2Z A;  2IIY A;  3L78 A;  2CZ3 A;  3LXZ A;  2VL2 A;  2K8V A;  1SEN A;  3L0H A;  1N8J A;  2PWJ A;  1HNB A;  4KE3 A;  4KDU A;  1TTZ A;  2R6K A;  5D9V A;  4BWS A;  2HLS A;  2IMF A;  5AN1 A;  4ACS A;  5KEJ A;  2H0H A;  2IL3 A;  4BL7 A;  2YN1 A;  4MJC A;  5AIS A;  5AIV A;  3D6I A;  1X9S B;  2H19 A;  4ECI A;  3KTB A;  1OE7 A;  4IEL A;  3HDC A;  1Q98 A;  4IS0 A;  2VCT A;  4ZXG A;  2PVO C;  3TJG A;  4HZ4 A;  2I1U A;  4YQM A;  4HU7 A;  1K0M A;  4Q5Q A;  1H75 A;  3FYG A;  4ZBD A;  2HSN A;  3MDK A;  5J9B A;  4N0V A;  4I5Q A;  4MZW A;  5D93 A;  1X5D A;  2HFD A;  2O85 A;  1WMJ A;  1SVM A;  3APQ A;  3MIX A;  2EIQ A;  4QL9 A;  1OYJ A;  1SK2 A;  2L5O A;  4K7N A;  3D4T A;  3Q18 A;  12GS A;  5F06 A;  1R26 A;  1YVL A;  1WJK A;  1OVN A;  2H01 A;  1YY7 A;  2A2S A;  3PH9 A;  4X0X A;  3AY8 A;  2ZCT A;  1SL0 B;  4JE1 A;  1R5A A;  2I3Y A;  4KB3 A;  2UV8 G;  1SL2 B;  4F0C A;  5A5K A;  2L6C A;  3UVT A;  4QQ7 A;  1QK8 A;  2AAW A;  4EXJ A;  1X9M B;  2V1M A;  4LL4 B;  2WUL A;  4Z2R A;  1E2Y A;  2ES7 A;  5JCW A;  4KCE A;  5E4W A;  3DEX A;  5A1N A;  3GIX A;  3MSZ A;  4HJM A;  3LJR A;  1LBK A;  2LUS A;  2V2G A;  2G2Q A;  4XS1 A;  2LEG A;  1V57 A;  4NV2 A;  3H8Q A;  2GT5 A;  1U87 A;  3ZML A;  3RPP A;  2IME A;  3GL3 A;  2E2M A;  2YAN A;  2H1G A;  2NTO A;  4V2M A;  2VM2 A;  4QL7 A;  3FZ5 A;  4I2T A;  3FRC A;  3ZTL A;  1WRY A;  2HRK B;  5D9W A;  2ON7 A;  2CV4 A;  5CRD A;  2J9H A;  4F9Z A;  2HYX A;  2CX4 A;  2DJJ A;  4NV5 A;  2IWT A;  1TOF A;  4MJB A;  4BWQ A;  3KIJ A;  5J5N A;  1K0O A;  5DAK B;  2ZUP A;  1DE2 A;  4AJ6 A;  3EMP A;  3C1R A;  1VF2 A;  5JWR B;  4NAX A;  2OAC A;  3HXS A;  2H1B A;  2AJQ B;  1T4Z A;  1G7O A;  2V6O A;  1K0N A;  2GT6 A;  1FB6 A;  2OE0 A;  1GSY A;  5IPH A;  2RM5 A;  4X4J A;  1F3A A;  2LST A;  1XBS A;  4ZBA A;  3F4S A;  3WT2 A;  2KP2 A;  3IRA A;  2P5R A;  1XVQ A;  5HR0 A;  1H4O A;  4ZB6 A;  2MYG A;  2QA1 A;  4LA1 A;  2VL2 C;  1BJX A;  2TRX A;  2LJR A;  2BTO T;  3LSZ A;  1QFN A;  2V6K A;  3VWX A;  5AIX A;  3DGQ A;  3L9S A;  3D5J A;  1ML6 A;  4N30 A;  1TXX A;  1GTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...