2C3VB

Structure of iodinated cbm25 from bacillus halodurans amylase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
94
Chain Sequence
MASGDATDITIYYKTGWTHPHIHYSLNQGAWTTLPGVPLTKSYVKVTIEAEEGSQLRAAFNNGSGQWDNNQGRDYDFSSGVHTLADGRILSGTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Carbohydrate-binding module
molecule keywords ALPHA-AMYLASE G-6
publication title A Structural and Functional Analysis of Alpha-Glucan Recognition by Family 25 and 26 Carbohydrate-Binding Modules Reveals a Conserved Mode of Starch Recognition
pubmed doi rcsb
source organism Bacillus halodurans
total genus 15
structure length 94
sequence length 98
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03423 CBM_25 Carbohydrate binding domain (family 25)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2c3vB00
3IDIB 1F2XK 4M7LH 3K2UL 1S7XB 1W0VA 5CP7A 1BBJB 1JFQL 4FFVC 3FRUA 3WFHA 3HZKA 2EDDA 2WQ8A 3C09C 1FG2A 1KCSH 2R39A 5CJBA 3P73A 2FEEI 3F12B 1HXYA 3F62A 3EFDH 1KIRA 5GGSA 4RGMB 1FAKT 1WJ3A 2IGFL 4IRZH 4RISH 4FMFA 1E27B 1I7TB 5DS8A 2ZCHL 5D9SA 4Y8AA 2DYPA 1X5YA 4L8SB 3VWKD 4TSCL 3QDJD 4PBVC 5E2WL 2PYEB 4JG0L 4NKQB 1RZIB 1E6OL 3LHPL 3VCLA 1OGAB 4CN6A 1ZVHA 2AEQL 3INUH 1IM3A 8CGTA 15C8H 4R96B 4Y1AE 1LWRA 2B20A 4GW5A 3MNWB 4NZUL 4KK9D 4YHLL 3T09A 4BZ2L 4P49A 4DK3A 3KNBB 2V2WA 3L3HA 2IAMC 2YPKB 1KJ2B 2P47B 2F58L 1U91A 1EO8H 2X4RA 4RRPG 2VZ1A 4XGZB 2AK1H 5DK0B 2ZUXA 2W0FA 2EO1A 2OJEA 5E6YA 1QSEA 1PFCA 1DQMH 2F19L 3TESA 1K4DB 5TDOB 4Z7WF 1JZ4A 4I18C 3SO5A 1BJ8A 1U3JA 1ZVSA 1B0RA 5J89A 3BX7C 2BJMH 3IXTB 4R7NB 1MHCB 4MNHB 1EV2E 1X4ZA 1SHMA 4HIJA 4HH9A 1UXWB 4P9MH 3L1OL 4OLEA 5IF0A 4NM4H 4PJHE 1KG0B 1JE6A 4RGMC 2BNQB 4GRLB 5HHOB 2QSCH 3NCEB 4XP1H 4N90D 1P1ZB 4NQDE 4PLKC 4NQCE 4XVUD 3MX0A 5HTSA 1IILE 2AJYH 4L8SC 5D1ZD 2JELH 2V2XA 3FCTA 3RGVD 3QEHA 5EIVA 2ILLA 2ZSVB 1WUNT 5F7NC 4UBDD 4X7FC 4KJWD 1C08A 3X12A 4HXBH 4L29B 3O6FB 4X5LA 1LO4H 5SWSB 2AK4A 4ZO6A 2R23B 4R0LA 5GGVL 5EBMB 4FQCL 3FKUS 5EUOE 4DVRH 3QG7L 4I2XB 2P5EA 5D1QA 1HNFA 3R4DA 4MD0B 4W81A 3MO1B 3VXTB 3WIIL 3DETD 3HRZB 1UEYA 3DVNB 1XH3B 4V1DD 1U8IB 4DKFL 5DUML 3QZWB 1QYGL 5GSVA 2CD0A 1JGEB 4NZDA 1IJ9A 3PHOB 2ADGA 1KXQE 4TNWF 4GRLC 4XVJL 3ARGD 4JRYE 4YHIB 1KT2B 1LO2L 4ONHB 2XZQL 3V52H 4D94A 2FJGA 3DV4A 4MVBC 1ZEAH 5DRWB 5DURB 4PJGE 2ZCKH 5TDNA 3GIVA 3AY4A 1FGVL 1M7DB 4Y1AA 1CD1B 3SDAB 4BH7B 3IDGB 4M93B 5BXFA 1NDGB 2RFXA 4MX7B 4WFGD 2Y06L 3QI9A 1AGEA 4QHNA 3BP6A 3RJQB 5CJQL 5CIPB 2Y1VA 3PHSA 1CTOA 4K8RH 3O3AA 3EO1B 2FGWL 3DMMA 1SVCP 1FH5L 1MRCH 1HNGA 1FE8L 1GGTA 3D3VD 4HUWA 4U1LA 2XZCH 1EHAA 1EXUA 1CLYH 3TBTA 1LD9B 1QRNB 3GI9L 3FO0H 1SBBA 3QUYD 3CLFH 3QWQB 1QKZL 3BKCH 1G7QB 4H26B 4PJHA 2ADIA 4U6TA 3ZDYE 5ID0B 3GSQA 4PJAB 4EN3A 3BH9B 1P4IH 1U8OA 1H3PH 4NQDA 4UB0H 4WI9A 3WUZA 2CXGA 2O5YL 2GITB 5IBUG 1IAKA 4HSQA 4ODHH 5J1TC 4NCC1 5AZ2H 3EJJX 1J0JA 3DOSA 1A0QL 2VLLB 1NBYA 2HG5A 1CLOH 2XN9D 4XPTH 5EU6B 4BH8B 4YE4H 2VE6B 1BJMA 4MCYA 3HR5B 8FABB 3PUCA 4FFWC 2B4CL 4F37K 3SDAC 4Y88A 4U1NA 1U3HA 2Q20A 3FB5B 5FHBL 3TM6A 5EUOA 3T77A 2WW8A 4EIZC 1I9JH 4HIHA 3PDOA 4CNIA 2DLHA 4LPVA 3RI5F 3ARDC 4MA7H 4BFIB 1QA9A 4QHLB 4ENEC 5T3ZL 2EDLA 3S5LB 2P48B 3MROA 1XF4A 4UIMB 3O2VH 5ENWB 3EKCA 1WTLA 3GMLA 4FQ2H 5JXAH 2F5BL 2PR4H 1EA9C 4JKWA 2PW1A 3L3JB 2CR6A 1KTLB 3PWPB 3MUGB 5FDYA 2CGRH 4LASL 3ZKXB 5CWSA 5KSAA 4D0CB 4YC2C 3RKPA 1NEZA 3SE8H 5EFIB 4JRYA 4NKOA 3BWAB 4MS8C 1F4WL 5DEFA 5TH2A 4PJ7E 3ZTNL 2DWEA 3VA2C 4DTGH 2BSSA 1RIUH 4OFKA 3MRNA 3ARFA 1CYGA 1Y0LA 4LGSB 5DRNB 3G6DL 5D7IE 2FHCA 4P23A 4PGCA 1R3HB 4LVNC 3GM0A 1MPAL 3QCTH 3TZVD 3B8SA 3QJHB 4JO3H 5HGBA 4AM0B 5FK9A 4D8PB 5FUOL 3ZKSD 1S78C 4HS3B 4TUKL 2EYSB 4LARL 2X1PA 3C60A 3LMJL 1F4HA 5FYJH 3ZSSA 1MFNA 2ZUSA 4L8BB 3MA7A 2X4UA 1RFDH 1NL0H 3Q1SH 3QEQD 5GQBA 5KSBE 5IEHA 3MJ9H 3VFPA 3N0PB 1AD0B 1FL5A 1LVEA 3PWUB 1UYWL 4HXAH 4N1EA 3QQ3A 3PWJB 4NQUA 2VDOH 3NFNB 3P4OB 3MV8A 4HMDA 3DPBA 5IT2L 5F7FA 3NCYS 4P59H 1KCLA 4FQPA 1JF1B 4XNYL 5B8CB 3GMQA 1I8IA 3UTTB 3VFWA 2HP4A 3RWJA 1AJ7H 2MKWA 5KVEL 1PX3A 4NO2A 4NRXB 4AJ0A 1LEKA 5I16A 4N8VA 1MCQA 2EZ0C 2R4SH 4JZOA 3GJEA 4YDIL 3G5VA 1CR9H 5B38B 2D4FA 3IU4L 4WFED 4ZSOE 3UTSE 1V7MH 5JMRA 2A6JB 1FNAA 3GO1L 1NEZG 1O5DT 3GI8L 1TJGL 5DJ8B 4QGYA 1QFWH 2JJSC 2VL5B 4O2CA 2UWEA 5F7WC 1MAJA 3I2CH 4Q9QH 3I6KA 5LXGL 3VWKB 5IMLB 3RNQB 2NZ9D 5HYJE 5DJZB 4PJEB 5D7JA 2X4TB 3B4NA 2X41A 1N3NB 4LCCA 2X4PA 4YHML 4XCCL 1I8MA 4BKLA 4PRPA 1MCEA 5CBAA 5GGRA 1XGTB 4EI6A 3HG1D 2X89A 1A7NL 1H3UA 4YX2L 2NY5C 5FCUH 1A14H 4PJAF 4NC1E 3EJYC 5HVWA 1DE4A 5D7IA 4QRTA 5B8CC 1UH4A 3FQXA 3T2PA 1C12A 4OCRH 5JZ7D 1NPUA 3BZ4B 3RL2B 4KRLB 5IMOA 1TZGH 3PGCA 4FQLL 3FRPG 3ILPB 2PTUA 3T0ED 1HSAB 4LGPB 2DI9A 1G7JA 1RUPL 2DB8A 2C4XA 1TNNA 1AFVL 5D4QA 1ADQH 1OTUC 3WEXA 3VRIB 5EG6C 4M1GH 2AK4D 3EOBA 3ME0A 4JZNB 4MLIA 4KHXL 4WWID 1Z3GL 2JCCB 2LVEA 5T1MA 2L4OA 4ODUA 4WHYH 2R0WH 3QDME 2ZUVA 5KSBA 1KELH 3WNMA 5EPMA 2P5ED 3VW3H 5I66A 4C58B 3SKJH 5D1QD 1LK3L 4ZAKD 3PGFL 4HKXA 1N59A 5J3HC 5LGHH 2IPUG 3CX2A 4N8VG 1T7WA 4CDHA 1MWAA 4NNXB 3D18A 4I3GA 3CVHB 1U8PB 2C4FT 4Y19A 5HY9A 5DVNA 4NSKA 4Y4FA 4MWFB 4HJ0D 2CKBL 5CSGA 3NZ8B 2MFNA 2ZSWA 2OZ4H 3HMWL 4K3HA 3ULVH 5EZLB 5GS0C 1YC7A 4L4VB 4RFOL 4KZEH 2ICES 1V7NL 4UUJB 3AB0B 3UTSA 4ZSOA 3VDBA 5LQBL 5F3HA 4W4OC 1FQ9C 2FZ3B 5IQ7L 1FO0A 4ZTPL 3MJGX 3KPSE 4J3XA 5MEQB 2HT2C 2VWEE 4YNYB 2DBJA 1OW0A 5IVZA 4E42B 5GZOD 1WCQA 1HHHB 5CMAA 4FZEH 4OLXH 5HHMD 5IOPB 3QEGH 3C08H 5GZNC 3T65B 5CJ5A 3PIQB 5T33L 1N4XL 1JPSH 3BWUC 5FYKU 4WO4A 1A6VH 4NWUH 5DZLA 3QO0A 1BGXH 3HMXH 3QDGD 5JPMB 1KEMH 3QEUB 3LKQB 1R3IL 3U1SL 3EOTL 3PXJA 3B8YA 2IBZX 4S0TD 5C0CE 5ADOL 1VESA 1EBPA 2B1AH 1HZHL 3DV6B 3QB7C 2P8PA 1UA6H 5D7SH 2R8SH 5HHQB 1UG9A 3ALPA 5AAWA 3CMOH 3X14B 1K6QH 5F9WB 2VJXA 1RK1B 2BY2A 3LEYL 5D7LE 3VMPA 2WNGA 1A1MB 5DT1H 4HWBH 3QUYB 4OCSL 3Q6FA 4OLWL 5JORA 2PO6A 4DKEH 2NX5D 5AWNL 4N9GA 3EIFA 3O3BB 5H37H 3QDMA 2A9MH 1R5WA 3RWFA 4F9LA 2YPVH 4U31A 2AJSL 2G75B 5K9OA 1OWRM 4JGJA 4GKZA 1FL3A 2VXUL 3GJFB 5F1NB 1ACZA 3L7FA 5L88H 3TCLB 1MI5D 2ESVE 1J11A 4O58L 4Z0XA 4P2QD 3U46A 4R4FL 3JTTA 3KVQA 5GIRA 4PJEF 4HH8A 4X80H 4PP2B 5TFSH 2PXYC 4XWOC 4I0KA 2EYRA 3DUUA 4P2RE 4XI5D 3QIWC 4HZAA 1TJIL 1EUUA 4YHOH 4M7LT 1T6VN 1GZQA 2YMXL 4M7JH 1CQYA 3FOMB 5F9WC 1UXSB 4R4ND 3B9KB 4TPRH 1ZV5A 1X5KA 3UYRH 2DQCH 1U8JB 3VG0H 5DJYB 1LE9A 1A6WL 3X13B 2MCPH 4Z7NE 4F80A 3QQ9D 4ZQKB 5T1LB 3KPSA 3VXPB 2NMSA 1A5FH 2HJLB 5T1KB 1JNJA 4P23D 3NN8A 1DQDL 1DLFL 3QUML 2R1XB 3WLBB 2B1HL 2YK1L 1S7VB 2Z8VC 1G9EA 3R1GL 2NPLX 1OD9A 1FORL 1XIWD 5F7LB 1VKXA 1Z5LB 3BD3A 3MYJA 4QRQA 3NPSB 1JGDB 4HAFA 2RAMA 1C8PA 3PWNA 4FABH 4Z7QE 2JCCF 3Q6GL 4Z7VE 1HHJA 1UACH 4ZNCD 3OKLB 4JZJA 1KIUA 2BDNL 2GT9B 2NY6D 4UQ2B 1KBGL 5DWUL 4ZYKB 2PCPB 5FA3A 4OT1H 5C0CA 4QXGL 3TZVB 3O41B 4WJ5A 3N1FC 4PGDA 4HC1A 1YEEL 1DQLH 3CCHB 2IWGA 1UVQB 1OAUH 2K9UA 2EIEA 3FB8B 3H7LA 2QKIA 4G43A 4NKDA 4JCLA 3MV8D 4ORGA 5D7LA 3QJFA 1QPXA 3B9KC 4LCWA 2DKUA 4RSVA 3NACH 1ODAA 4M6NL 2ZZUT 5K9KA 1OAXH 1W0VB 1CGXA 5CS7A 5CP7B 4FMKA 3VXSE 3G6JE 2H26A 3FRUB 3O6KL 3I50L 3OSKA 4OJFH 3BSZH 3HZKB 3WFHB 1F02I 1FG2B 3W0WD 1V3LA 4TVPE 3P73B 4L5FL 3BP7A 1HXYB 2JB5H 4H88H 5EWIL 1WFTA 4TNWK 3OV6A 5JIKA 1KIRB 2GK0A 3S4SA 5GGSB 3X3FH 2ESVA 3CZJA 2WBJC 3MLUH 5DS8B 5D9SB 5I1KH 2DYPB 3OX8A 3IAGC 4ZFOA 5IFHL 3QR2A 1KJMA 4P2RA 1YUHA 4KK8D 1EAPA 4DOHB 1JHLL 3QUZA 3VCLB 1EMTH 1T21A 1X4XA 4PRPD 1IM3B 3G5XA 3SE4A 4ZUSA 4GW5B 5B22A 1CK0H 1YYML 2BX5A 3LQMA 4LSPH 3MRFA 1MJ8H 4HT1H 1QP1A 4R3SA 3MLTA 3UJIL 2V2WB 3L3HB 1N64H 4Y5YA 4MGXA 4NUJA 2W91A 1G7HA 1T1YA 1U91B 2X4RB 2W92A 1EBAA 2JJVA 2W0FB 1BLNA 2OJEB 3LKOA 1QSEB 5HI5D 1KGCE 4JN1L 5C0BE 4NQED 4BFGA 4JPWL 2AXHA 2R4RH 2NNAA 2VLJD 3JWDL 1ETZA 3GNML 2WINA 4HPOL 1ZVSB 3NH7H 1B0RB 1P4BH 5JIIA 5CBEA 2X9XA 4MXVF 4HH9B 4HIJB 4XCEA 4EJ1C 4Z7VA 5IF0B 4YPGA 1JP5A 3QXDA 4NJAL 5DJCA 4XPGH 1VGEH 5GGQL 4M61A 2Q8AL 4KKLC 4LEXH 3KLDA 5L7XH 3HC4L 2V2XB 3P40A 3FCTB 2P43B 3QEHB 4K94L 2OYPA 1C08B 4UINL 3X12B 5J11B 1CDHA 3U0TA 1E4XI 2AK4B 4Y19D 4JLRA 4R0LB 2W1NA 3RI5K 1IBGH 5I8OL 3LKSA 3SO3B 4M3KB 4Y5XC 5E6IC 4AT6A 5IBUB 3L3OA 3O9WC 1LEGA 2HH0H 3S4SG 4E41A 2P5EB 1X5IA 3VXSA 3G6JA 5D1QB 1UZ6E 1RJLA 4DGIH 1UWGH 2FGZA 2VERN 1KJ2H 5IGXL 5I1GL 3ILQC 3WHXA 4P3CH 4R2GD 5L9DH 3HI5L 4NKIH 4HIXL 1MUJA 1GGBH 4GAFB 3PV6A 2YN3A 2VXQH 4MQXD 2XICA 2EDFA 5GSVB 4F7EA 2G60L 4DQOH 4TTDD 2ADGB 2NXZD 1GVIA 3HCVA 4JHAH 2ZKHH 3MNZA 3ES6A 1QRKA 2BY1A 1J1PH 4FNLH 2B39A 1J9CT 2WM0A 5ALBH 3U7WH 3J7HA 2FJGB 3DV4B 3KPTA 5TDNB 3GIVB 1FIGH 4WO4D 2HJKA 2E6JA 4Y1AB 5J11C 1Q72L 5BXFB 2DQUH 3JZ7A 1YEHH 2RFXB 3HC3H 3QI9B 4GKNA 1AGEB 4OKDA 1TTGA 1S3KH 3KGRA 5K9JL 4GW4A 4QHNB 3MFFA 4YQXL 2C4FU 1YJDL 3BP6B 5HHMB 4LSUH 3SO3C 2UZIH 3EDKA 2WBKA 4AIXA 4XP9H 3O3AB 43C9A 3DMMB 1XF2A 3GKWL 1HN1A 4LBEA 2WWMC 4XMPL 4HFWA 2ZP0T 5C0BA 2DD8L 2Z31C 3DVIA 4HUWB 1MHHA 4U1LB 4JO4L 2LQRA 1EXUB 3RY6A 2EEAA 3TBTB 4ETQA 3IYLW 5DD1L 3QUXA 2PO6D 4PJHB 2ADIB 2W9EL 4HF5L 4L4TA 4AEFA 2UUDH 5FGBC 2CO7B 5F89A 3GSQB 1YEIL 1NBZA 2MKLC 5D71H 3L5XH 4EN3B 1U8OB 4NQDB 4OGYH 5DMGD 3L5JA 3NTCL 3F7QA 3N1GC 1QFUL 1NUDA 1IAKB 5TQ2L 3B5HA 5C6TH 2J88L 5FDWA 4MAUL 1NBYB 2WIMA 2HG5B 4DAGL 1ORSA 1KTDA 2BVOA 3GMOA 1OAQL 4FXLA 5D70H 4X5XA 2E7MA 4MCYB 4F2MA 1JNLL 3AY4C 5K59F 1F42A 2YUVA 5F8QC 4Y5VA 5F21B 4PR5A 4K9EL 4U1NB 2YEZA 1U3HB 1CGWA 1WZLA 4PJ9A 1OCWH 5EUOB 3T77B 3OAUH 4RA0C 4ZS7L 4HIHB 1VEMA 3PDOB 4CNIB 2VDLH 4RGNE 5H8DA 3LN9A 3VXRE 5HGGS 1QA9B 4XPBH 4H1LA 1MH5A 2GJ6D 3L5HA 5CIPH 3S37X 1XF5A 3DMMC 3MROB 1T04A 4E0RA 2BRRH 1XF4B 2D03H 2YD4A 1A4KA 4PG2A 3GMLB 5A3IC 4M7KH 3TCXA 2R1WA 2PW1B 4KQ3H 2D9CA 4J3UA 1OM3H 5CWSB 1MCBA 5KSAB 3UAJC 2N7AA 2DI7A 4CVXA 1W0WA 3WXVH 3MBEC 1S9YA 5LG1A 1NEZB 4EN3C 4JRYB 4NKOB 2NY0D 1QPPA 1HQRA 4YXHL 5JW4N 3VXOA 4HKJA 1ZE3C 3RTQD 1MNUH 4DGVH 5SV4A 5DEFB 5TH2B 2XKNA 1GC1C 2DWEB 4X5WA 2BSSB 5J06A 2J6EA 5DRXA 5C0EA 2BVYA 3MRNB 3P11H 3ARFB 2VNCA 3V7AE 1Y0LB 1QLRA 1B2WL 4P23B 4PGCB 4JANA 12E8H 5HGBB 5FK9B 4ZFGL 1OGTA 2BFVL 1CDGA 1KJVA 2DAVA 3U9PL 3TPKA 3C60B 1CF8L 1MF2H 1C5DA 1I3GH 5FYKL 5C2UB 4FQHA 3MLWH 2DRUA 2AEPL 1NMBL 4LCWD 4NO5A 4LLWA 2VXVL 4KDVA 4QXTA 3MA7B 2X4UB 3OBAA 3MRJA 5IEHB 2W0KA 3QCVH 3O2DL 3VFPB 5JW4M 3TT1H 4BSVA 4M1DL 1NBVL 1EHLH 1FL5B 2NYYD 1X4YA 3B2UC 5I9QB 3VMOA 5I73B 5KSAC 1EX0A 3ULUL 2RBLA 1F3RB 3WUWG 1Y6NR 3LS4L 3ZE2E 1CQKA 3QQ3B 1EUTA 2EH8L 2N7BA 3MV8B 1V8HA 4HWEL 4H1LG 1AY1H 1U8LA 4M48L 1FP5A 3KDMA 4ZO9A 4OFVA 2QQNL 1AQDA 1OPGL 4MCZA 7CGTA 4FG6C 2F53E 1YYLH 3GMQB 4NZTL 4GRWE 4OZGE 3VFWB 3RWJB 3ARFC 4YHZH 4NO2B 1U6AL 1LEKB 5I16B 5I8EA 4N8VB 4KY1H 1GOGA 4JZOB 3GJEB 3VXRA 1DBBH 5JW4Q 3G5VB 3AXLA 3JBG7 4KJPD 3AS3A 5BVJA 5DDHA 4PRIA 5CILH 3C60C 4GXUN 4PJ5D 3WJLA 2AXGA 3WDHA 4O2CB 2P7TA 2UWEB 1IQWH 5DK3A 1A6TA 4Q0XH 2HT3C 3I6KB 5DD3H 5DK2A 4C4KO 4K23H 3UPRA 1KSRA 5HVHB 4OFYD 3SDDC 1QACA 4G6AC 2XZZA 4PY8J 5D7JB 1JYXA 2N4IA 1I8MB 4LCCB 2C5DC 2X4PB 4BKLB 4PRPB 4YXLH 5I9QC 2ERJB 5CBAB 1T5XA 5DUPH 5GGRB 3ZE0E 1VSCA 5GRJL 2VUOA 4EI6B 2XXCB 5C9JA 3FQWA 3MLVL 4PJHF 5I19L 1AC0A 3ELAT 2NY5H 3HI6L 1GH7A 2JTDA 1IC4H 5K33A 1DE4B 5HDQL 5D7IB 2R15A 4QRTB 2W0PA 3FQXB 1S5IL 1C12B 1D9KA 4LPYA 4NOFA 4HPYL 3DSFL 2NW3A 1IGIL 2M8XA 5IMOB 3PGCB 3F7VA 1A7QL 1G7JB 4KGJA 1L7TH 1H8OA 4WFFD 4AEHH 4M62L 4ODSH 1B0GA 3MRBA 3WEXB 5EUOF 3EOBB 2VN4A 5T3ZE 2XQBL 5T1MB 1E4KA 4ODUB 3KPLA 3GBNL 5TE6L 5FECA 1CFTA 1JK8A 5KSBB 2NZIA 1TQBB 4G6ML 4E41D 4OI8A 5EPMB 1F8TL 5I66B 4KI1A 4Q9RL 3TV3L 5HVHC 4HKXB 1N59B 5D7JC 4ODTL 3VXUE 5I18L 5ITFA 1MIMH 1MWAB 5GJSL 5HHXL 2ERJC 3D18B 5ACMA 1BWMA 2MQ0A 3QAZB 3CLEL 5B4MC 5IBLC 2FBJL 3S34L 4QGTA 4Y19B 5HY9B 4NSKB 4Y4FB 1NLDH 2QSVA 2WWKT 4GQPH 5EOQH 1OLZA 2ZSWB 1M7IA 4ZDHA 2F53A 1BREA 4OZGA 2P8MA 4LP5A 1KB9J 1S7WA 5T5FH 1BFVL 1Q9KA 1DL7L 2DBLH 4AQOA 3RX7A 3UTSB 3KAAA 1TCRA 4ZSOB 4YXKH 2FR4A 1YNKL 3BN3B 4OIIH 1AGCA 4JFHE 4R2GB 3OB0H 4YLQT 5F3HB 3F6IA 3GSNB 1FO0B 1EEYA 3ZT5A 2OL3A 4PLOB 3UC0L 1KB5L 2VZOA 4YDLB 2XQYK 5EZOL 2NXZB 5C0AD 5IVZB 1FZKA 1NCBH 2R0ZL 5CMAB 3HNSH 4XC1H 4Y8DC 1H5BA 1CDYA 5E7FA 1Y6MR 1TQBC 5L6YH 2XA3A 2IQ9L 1BAFL 2AGJL 3THMH 3U4BH 5JHLH 3U0PA 1DN0A 5AAMA 2VC2H 3OZ9L 5J8OA 4WO4B 5B39A 1KFAL 3OR6A 3QO0B 1RY7B 2APFA 4XAWL 1IL1A 4UV4L 1KENL 3EDJA 3IDYB 2FX7L 4KRNA 4Y4FC 3CVHH 4L4TD 2XTLA 2P8PB 2NTFA 5F9OH 1SJHA 2E5EA 3S98A 4S10A 3QNXA 1RZ7H 3QCUH 1IC7L 2EXWD 2DOCA 3GM8A 4ZOCA 1A7OH 4PB9L 3VD4A 4I4WA 5GGTL 3WYRA 5BS0D 1RUKH 1NDMA 3Q6FB 5IJVA 5JORB 2PO6B 3WLWC 1J1OH 5KOMC 5BV7B 4N9GB 4S1QH 5ECJE 5F7MC 3QDMB 3LD8C 1R5WB 3KLHD 3HNVH 1OW0C 4HBCH 3RWFB 5CFHA 1IGFH 3O0RL 2DL2A 5K9OB 5LGKA 4GKZB 3BZDA 3QULA 1FL3B 2UV3A 4EOWH 3VXUA 3BN9C 3R06A 3UDWA 3NPZB 3L7FB 2UWEF 5JR1L 1MREH 4PJXE 4IOSD 5IP4A 1FJ1A 5GRZA 4Z0XB 3U46B 1G0XA 5IMKA 1FC1A 3JTTB 2WUBH 4IJ3C 3RIFF 5GIRB 3I6LD 2F54E 3IDYC 5EIIA 2EYRB 1S9VA 3DUUB 1X3DA 2FD6L 2HFGH 4NC1C 4WY7H 1BWWA 3O11A 3QWRD 2UZYB 4LHUA 1JZ8A 1UC6A 3MGAA 4MLSA 4AYFA 1GZQB 2V2TA 1CU4H 3M17A 4U3CA 3ZL4L 3N85L 4WU7A 4M5ZL 3VXME 4H0GA 5M95B 1QBML 4ZUUA 3WNNA 1LE9B 1KLGA 3NABH 4HWNA 5D7IF 2D31A 5B39G 3PL6A 3KPSB 1ND0A 5E2UH 2A77L 3DJ9A 2X09A 1AXTH 3NN8B 5BV7C 4ZODA 4LPWA 5J57B 3MOBH 1ZXQA 2NY0B 3BDBA 2K3TA 1Q9WA 5E94A 5DVMA 3GDBA 3O6LH 1NGPL 3IT8D 1VKXB 2DDQL 4TSAL 3MYJB 5AEAA 4QRQB 5FYJU 2IFFH 4ZTOL 1J0HA 3PWNB 1INDL 2E27L 1HHJB 2WP3T 3EYUH 4JZJB 3GJFK 3GJFH 4XAKD 1HDMA 4RGOL 5KSBF 3W11C 4PB0L 1ZK9A 3K4AA 2EECA 5FA3B 5C0CB 4DN3H 1MFDH 1K8IA 4GJTB 4L4JA 4WJ5B 2ZCLH 3OJ2C 3TO4A 4PGDB 5D8JL 5F7YC 4OCYL 3MGTA 3HE7A 5EO9A 4NHCL 3W82A 4KRPD 2DQEH 1A4JA 3NA4A 2HA1A 5CEZL 1JWMA 2QKIB 4G43B 4XMLL 3TJHD 5I30H 4NKDB 2D7MA 4ORGB 5D7LB 3QJFB 5F9AC 1KJ3L 1KUMA 4LCWB 2P45B 3QP3A 4N5EC 3TLRA 3V4PL 5K9KB 1GRWA 3R8BB 3GSWA 4HQQH 2VLKD 3C9NA 2H26B 2K7QA 4F33A 2VWEC 1XGYL 1WIOA 2VDQL 3Q0HA 3UZQA 3RVXD 5IHBA 4LHUG 3VD9A 4D0BA 5DFWH 2VZVA 4NC2B 2LAGB 3BP7B 3NAAL 2FEDC 1YEJH 2DQHH 2JJTA 4PRID 1RULH 3UJJH 1MQ8A 3HNTL 1MAMH 3FT4A 1QBLH 2GK0B 2QSQA 3S4SB 2ESVB 4TUJA 3ZZ1A 1AR1C 3D5OF 3WFDL 1JV5A 2DM3A 4KTYA 1MJJA 3NCJL 3OX8B 2F54A 5A1AA 4ZFOB 1JF6A 1KJMB 4P2RB 1YUHB 1WFNA 4GQ9L 1EAPB 2HYMA 3QUZB 1R6VA 3V6OE 5C2BH 4XXCA 2GI7A 1T21B 3G5XB 3O3UN 4RQQA 1JYVA 4ZUSB 3L6FA 1RIVL 3BIKA 3CFDA 4PP1C 1I1AC 3VXMA 2HTLD 3MRFB 1MCPH 4R3SB 3MLTB 4V2CB 4C83A 4Y5YB 4NUJB 3T4YA 2CIKA 4OIAA 1G7HB 1T1YB 4FTVE 3MRMA 3GMNA 2Q7NA 1BLNB 3LKOB 4KTEH 4N8PA 5F7DA 1J12A 2NNAB 1ETZB 5ALCH 2WINB 2H2PD 1FYTD 1EPFA 1K5NA 5FOBA 3Q5TA 4NPYA 1OHQA 1U41A 4MDJA 4PTUA 5CINL 5CBEB 2E6PA 4XCEB 4Z7VB 5DMJB 4JHZA 4YPGB 4YFEA 1ZSDA 3QXDB 5DJCB 4PD4J 3OF6A 4YFLI 4M61B 4PJ8D 5ISZE 1BFOA 4HUMB 2BSED 1TTUA 2IG2H 3K2MC 3QUZC 1CDUA 4JFYA 3K4ZA 2CK0L 4GOSA 1PLGL 1U95A 2OR9H 3D9AL 1UM4H 4OQ1A 3U0WH 3U0TB 4M7LL 3P4NA 3SE4C 4JLRB 4LVHB 2COQA 3LKSB 1CD8A 3SY0A 4AT6B 4XBGA 4GG6E 1LEGB 4E41B 3VXSB 4MXQD 3G6JB 1KCSL 3KPNA 1RJLB 4WV1C 4HEME 5EN2A 3U30B 1YQ2A 4PJIE 4MB4A 3EFDL 3WHXB 5F6HJ 4IRZL 4RISL 4Y4HA 5BMFH 1D7FA 4BSWA 1XF3A 1MUJB 3PV6B 1F00I 4JG1H 4F7EB 3ZO0A 4LKXA 4LHQB 1E4JA 2FO4A 2AJ3A 3HCVB 1SBSH 2NY7H 3PDDA 4X6CE 5TE4H 1WICA 2YXFA 3MNZB 3ES6B 1G7MA 3INUL 4I9WE 5C08D 5CD5C 15C8L 3V6OA 1MFAH 2NCMA 4S1DC 4A6YA 4XRCA 1B0WA 4S1SH 1HSBA 4GAGH 2DWDA 4IRJD 2HJKB 4ACPA 2FCBA 2DLTA 4HCRA 2PTVA 2R56H 5F7HA 5JXEA 4GKNB 1QVOA 4KROC 1EO8L 4GW4B 2AK1L 3MFFB 4KUZH 2MQ3A 3VRJA 1DQML 5EU5A 4FTVA 2KL6A 2OI9C 1ZS8A 43C9B 1CXIA 1XF2B 4LBEB 5C0BB 3VXQA 1FLRH 4HFWB 2BJML 4F7MA 1MHHB 4B53A 3U30C 5F6IB 5C6WH 4P9ML 4NM4L 2KQMA 2WAHA 1QFHA 5I17A 2NR6C 4ETQB 2QSCL 3FT2A 4XP1L 1RZJC 5GRUH 3QUXB 2X1XR 4L4TB 2KBGA 2AJYL 5F89B 2JELL 4KK9C 1NBZB 1UCBH 3QHZH 4LGRB 4W6XB 4LPCA 1F3JA 4NRZA 5C07D 4NN7B 5GGSY 5EC1A 4R7DA 5ISZA 1X7QA 4UDTA 1H3XA 4HXBL 5FO8A 1AGBA 3FFCE 5FDWB 1LO4L 1OP5K 1OP5H 1ORSB 1KTDB 2BVOB 3C5ZD 3GMOB 3T8XA 4X5XB 5C7XH 4F2MB 4U7SA 4DVRL 4Y5VB 1OLLA 2NY2D 4PR5B 1J0YA 1MCDA 2YEZB 4C59B 5HSFA 4PJ9B 4FQXA 1W8NA 4RWYH 3QG6A 4MMXC 4OCMC 2VZTA 4XWGH 4GG6A 1IM9A 4WGVB 4H1LB 1MH5B 1T0PB 4OBRA 3RL1A 2QLVB 3DGGA 6FABH 1EEQA 2MOVA 1XF5B 1T04B 3EYQD 4PJIA 4E0RB 4G9DA 3GRWH 3QRFM 2V7HA 1IE5A 1A4KB 4Z7NF 5C0FA 3WS6A 2R1WB 3IXAA 4KJWC 3RY6C 4PY7A 5KANI 4KKCC 5FUOH 2EE6A 1EHNA 1JUFA 3G5ZA 3PL6D 4PIRF 3G04A 4YHYB 3QUXC 2O26U 1T20A 1XT5A 3IDNA 3V52L 1MHPH 4CVXB 1W0WB 2ICCA 3IRZA 4LVEA 2IF7A 1S9YB 4Z76A 1IAII 1ZEAL 3SDCD 2ZCKL 4WUUD 1HQRB 3VXOB 4HKJB 1CICA 4Z7QF 4AMKH 4Z7VF 2ITDA 2FATH 2XKNB 3BH8A 3FO9A 1U8MA 1T5WA 4X5WB 1S7RA 5KANG 5MERA 1GC1H 5DRXB 2HKHH 3F6LA 1DEEA 4U49A 4JM2A 4LAQH 3IJYA 1PAMA 5DMIH 5DC4B 1QLRB 4K8RL 4Y5VC 4PJBE 1TVHA 4JANB 1SMOA 4HLJA 4AEEA 4PJ9C 1VEOA 1Q0YH 1IQDA 1MRCL 1OGTB 3EW3B 1T7VA 1ZAGA 5MI0B 5DD6A 1KJVB 2D0HA 2XZCL 4LVOB 4IRSD 3ARGC 1CLYL 1C5DB 4WFHD 5SV3A 3FO0L 3MUZ1 3CLFL 1ORQA 4FQHB 1JTTA 3BKCL 3RA7H 3KJ4B 1OAZH 4PG2C 3TBSA 4NO5B 1MFCH 4LLWB 3G6JF 1P4IL 1N5YH 4QXTB 2H2SD 1H3PL 2VR9A 4QTHA 4UB0L 3MRJB 4RAVA 4LLUA 4BSVB 3EHBC 2A2QT 2EIDA 4ODHL 5AZ2L 4YHYC 4LOUC 4ZXBD 3GMPA 2VQ1A 4M00A 1CLOL 4XPTL 4YE4L 3JWOC 3NFSH 2QADC 1U8LB 3KDMB 4K55A 3AM8A 4MCZB 1AQDB 2PN5A 1AO7D 2ZNWA 1FGNH 1I9JL 3S3PA 3S88H 2A6KA 2FLRT 3EGSA 3JSSA 2XY1A 1S7TA 2NY4C 4MA7L 2W0LA 5I8EB 3JUYA 2FYYA 2XACC 3VXRB 4HJGA 1OARH 1NC4D 3O2VL 3AXLB 1OTTD 4NFBA 4GFTB 4HGMA 1UJ3A 4FQ2L 5JXAL 1ITBB 5BVJB 2PR4L 4LVOC 4PRIB 1ZA6A 5DDHB 1ZLWK 1ZLWH 4JKLA 4A2MA 3OGOE 2AXGB 2CGRL 4U0QB 1KPUA 2P7TB 2R2CA 5IVOA 2NY3D 5DK2B 2ATKA 2EXYD 3UPRB 3SE8L 4G7VH 3T0BA 4P2OD 1HQ4A 4ERSH 3KLSA 5D2NA 3UYOD 4BZYA 4OSUH 5CKGA 1T5XB 4DTGL 3SE9H 1RIUL 2CRIA 4F15C 5C9JB 3BDYH 3FQWB 3AREC 5HYIA 4H5SA 1QNZL 5D93B 4Q6IA 3QCTL 4X4XA 1S9XA 2V17H 2VH5H 4JO3L 1D6EA 2MHAA 1CFVH 4GUPA 4PJBA 1D9KB 3MRLA 1J7VR 3U7YH 4HUUA 2NW3B 1QZ1A 3BQUA 1DBAL 3BPOB 3QIUA 3BVNA 2EDJA 4RGNC 2IPUK 3DX6A 3F7VB 4O9HH 2KPNA 2R2HA 5FYJL 5HYSG 1FZOA 3FTGA 4Y4KD 5B21A 1D5IH 1X5AA 1B0GB 1RFDL 3MRBB 1NL0L 3Q1SL 1EGJA 3LSOA 3MJ9L 2K7PA 3KPLB 5EBLA 4XNXH 5FECB 1CFTB 1UZ6F 1JK8B 4HXAL 1LGVA 1IGYA 1RD6A 4WEMB 4QLRA 2VDOL 5F7EH 5ITFB 4GS7B 3RIFK 2D7TL 4U0RB 1HHGA 2X4QA 5FYLD 3H9SE 4P59L 4NQTA 3LKNA 3DXAD 4Y4HD 5EU3A 3DECA 3FL7A 3MRQA 4UT9H 1AJ7L 3EYFA 2VDKH 3MUJA 1UH3A 1M7IB 4ZDHB 2F53B 4Y2DC 4GRWB 4OZGB 2R4SL 1HYSD 4GMSH 2HLFD 2P8MB 1S7WB 1WF5A 2APXA 3HE6A 1CR9L 3QRGH 4NUGH 1V7ML 5JA8B 4Z95H 3L3IA 1Q9KB 1SY6A 1D9KC 1HI6A 1F4YH 2W38A 3KJ6H 3ZYZA 1TCRB 1H3WM 1C5CH 2FR4B 1AGCB 1QFWL 1DBKH 3S96A 5KS9E 1HZHH 3I2CL 4Q9QL 1EEYB 2OL3B 4ODVH 4HUVA 5DI8A 3TIEA 5FYKE 1E4KC 1FZKB 3KPRE 4M6MH 3BGFC 4WWKC 1H5BB 3PF2A 5IHLB 2Q3AA 4UQ3A 3AS1A 1XGRA 1LNUA 1SVZA 3GSUA 4JFXA 4K8RD 4OCSH 3U0PB 1DN0B 5FCUL 1CFNA 1A14L 4UV7H 5J1AA 2IPKA 4I0PA 5IW6A 5B39B 2C26A 4LQ1A 3OR6B 4U0RC 5FHAH 1PSKH 3ULUE 1IL1B 2DL9A 1MWAH 4KQ4H 3FQTA 1A7PH 2Z93A 4OCRL 2OXHA 2CK2A 2NTFB 5JDJA 1SJHB 2DI8A 3QNXB 4YBQC 4EBQH 1TZGL 4PS4H 2X9WA 1GGYA 4WHYG 4DKAA 3RY4A 1ADQL 1A8JH 4DZBA 4JREC 1M71A 4M1GL 2UVEA 1RZFH 1XGPA 4I4WB 1NDMB 3G9AB 5IJVB 2R0WL 2A0LC 4YEEA 4KKBD 1WWWX 1YN7A 1KELL 3GHEH 3KYNA 3E6HA 3VW3L 3SKJL 4FQXD 3GSNH 5D1XD 1FO0H 2BNRE 4MHHI 4YK4B 5LGHL 2VDNH 4RCAA 1H5BC 3QULB 4PG9A 3VXUB 3MJ8A 2YPLD 3R06B 3LQAH 3S6CA 3H9SA 2OZ4L 3MOQA 1BMGA 1FJ1B 5A16A 5IMKB 4JFEE 5GGRY 3ULVL 3MTRA 1BBDH 1M05A 5EIIB 5GHWH 4MHHG 1MCWM 1S9VB 3O11B 4KZEL 4LHUB 3MXWH 1ONQA 1I8LC 1MELA 4ZMAT 5GPRA 1DUZA 2V2TB 2R9HC 1CICD 4XP6H 2GJJA 3FZUC 3M17B 2B4CC 4WU7B 2VAAA 5HHVH 4ZUUB 4QXGH 2C3VA 5KS9A 1KLGB 2D31B 4GBXD 3PL6B 3HI1A 3RP1A 4FZEL 4OLXL 4JM2D 1ND0B 4NN5B 3QEGL 3C08L 3T2OA 3W39A 5I75B 4HWUA 5L2KD 3RJDA 1JPSL 2FX9H 3WCYA 1Q9WB 4YK4C 5E94B 5BV7H 5DHXB 3WDIA 1A6VL 1U8QA 2Z35A 2I07A 4NWUL 3EJZC 1BGXL 3HMXL 1KEML 4UTAH 4K3EH 1DVFD 3LDBC 5LCVH 3ARYA 1KCUL 1YEKH 3TNMA 2B1AL 1HDMB 1BEYH 5D7SL 1JNNH 2R8SL 1UA6L 2FDBP 5FYJD 4EQ3A 3CMOL 4QCIA 1LP9E 3N9GH 1K8IB 5CZXD 1MY7A 3D6GA 3RQ3A 1K6QL 3D39E 4JKMA 3TO4B 3ZE2F 4PGJA 2HWZH 3MGTB 3HE7B 5EO9B 1JWSA 5F96H 1A6ZA 1A4JB 5DT1L 1JWMB 4HWBL 5KW9H 2F15A 5HHNA 4HWZA 4DKEL 1TZHA 1X9QA 3CD4A 4GRWF 4OZGF 4PJDE 1JRHI 5C3LD 1WISA 2A9ML 3PJSA 2QQQA 1UQSA 1EFXD 2YPVL 3GSWB 3C9NB 4NN5C 3IJSA 5C0RH 4F33B 2BNRA 1UH2A 5IFAH 3KYKH 1JGLH 5I75C 5FGCE 2OR7A 5J4MA 5L88L 4D0BB 4OZ4A 1RIHH 4K3GA 2L7UA 5IJKC 4R6UA 2I25N 1G7IA 1VFUA 1ITCA 3FT4B 4X80L 5TFSL 3UMTA 4TUJB 3QHTC 4N0YH 1JV5B 4JFEA 1MJJB 4UU9A 5E03A 4X4ZA 1SJVA 5J13B 5JMOC 2F54B 4N0FA 3TF7C 1FZJA 4YHOL 5BRZD 3GNMH 4M7JL 1AD9A 4GMTH 3VE0A 4TPRL 1MLBA 3CFKA 3HE7C 4AH2A 1QFOA 3BPLB 1B3JA 1I9RH 2DQCL 2YD6A 3MCLH 4OF0A 4RQQB 4HC1H 4J3TA 3RVTD 3VG0L 3L6FB 3S35H 2MCPL 3BIKB 3CFDB 3VXMB 1A5FL 2BC4A 1U8KA 5F44A 2XTJD 2Q8BH 1X5LA 2NY3B 3BJLA 4C83B 1AXSA 5ICZA 3T4YB 1BVLA 1JI2A 2CIKB 2DQDH 4CJ1A 3MRMB 3GMNB 1LK2A 1HOCA 4DFHA 3P77A 4L3EA 5F7DB 2YZ1A 3BQUD 2IAMA 3QIUD 1CZ8H 1WWAX 4RZCA 4FABL 1A6UH 3PDGA 1RUQH 1K5NB 1UACL 5FOBB 5F9DC 4NPYB 4PTUB 4MDJB 5HI3C 2R2EA 2JJTC 3SKNA 4I18A 4BK4A 4RMQA 4OT1L 1ZSDB 1Q8MA 1LP9A 1DQLL 2A6DA 2VSCA 4D9QE 5J13C 4JQVC 3D39A 1UB5A 1OAUL 2FX8H 5D96B 1BFOB 1MCFA 2DM7A 2APTA 4JFYB 1NANI 3QIBA 1U95B 1HEZA 1E4XH 4HAGA 3BPLC 1GHFH 3P4NB 1OAXL 5DQDH 3SY0B 4CMHB 4XBGB 5DO2C 4OJFL 3BSZL 4NJ9H 3LY6A 1DANT 3WHE1 3KPNB 1CG9A 5EN2B 1N8ZA 4MQ7A 1F45A 2AJVH 2H9GA 2JB5L 4H88L 2M2DA 1T4KA 1QR4A 4KI5D 3X3FL 1JL8A 4YEFA 4WW1A 4Y4HB 1MRDH 4BSWB 1UM5H 1XF3B 3MLUL 4KV5E 3RDTD 5TQ0L 5I1KL 1YNLH 4LKXB 2Y36H 5ABDE 1JZ5A 2EDXA 2FO4B 2AJ3B 2R0LH 3ARWA 1X6NA 3VFRA 5JHDE 1EMTL 3MLZH 1QBAA 3ZKQD 1G7MB 2DMKA 4NN6B 4JO4H 2XYCA 4NNPH 5J7CC 2ARJQ 4A6YB 4XRCB 1CK0L 4J6RH 5MEND 4QRRE 4LSPL 4JCMA 1WBZA 1HSBB 1Q38A 2DWDB 1MJ8L 3O8XA 4I0PD 2IPTH 4HT1L 4PJCE 1HK6A 1FFRA 1BQUA 2DICA 1N64L 1NUFA 3LPGA 1QVOB 4RX4A 5CUSH 1E6JH 3ARTA 5CEZE 3RX5A 4OZHE 3VRJB 1IGCH 4YH6A 5EU5B 2R4RL 4KK5C 4U05A 4FTVB 3WMSA 1ZS8B 4XMKH 3VXQB 3NH7L 1P4BL 4F7MB 1FFNA 2RB8A 2P44B 4QHMA 1X5ZA 2ORBH 3MLYH 5I17B 4KRMB 4P46C 4FFZH 3FT2B 4J3VA 2IFGA 4XPGL 1C7TA 1VGEL 3QYCA 3ALXA 1RZJH 4LEXL 5L7XL 1F3JB 3ARVA 1CVSC 4NRZB 3S36H 3FQRA 3B3IA 5EC1B 5L8KB 4R7DB 3VWJD 1G0YR 1CL7I 5ISZB 1X7QB 3QDAA 4UDTB 1NC2D 4YFLF 5E99H 5FO8B 3PE9A 4NN6C 4RMWA 1AGBB 3VGFA 4QXWA 4OM0H 3CK0H 1IBGL 3T8XB 3TFKD 5EO0A 4JY6A 2HH0L 2P5WE 4FQXB 5JXEC 3QG6B 3A6BH 1NQBA 4DGIL 4GG6B 1UWGL 1IM9B 1P7QA 4XCFH 5KVFH 1KJ2L 2IJ0C 1ZMYA 4P3CL 3DGGB 4R26H 1F6FB 3G5YA 1B6UA 3WL9A 3BKJH 4PJIB 5L9DL 3QO1A 4G9DB 2V7HB 4NKIL 3ARDA 3MRPA 1GGBL 2VXQL 5C0FB 1MCOH 3OHXA 4NBZB 4D9LH 5SX5K 1KB9K 5SX5H 4PJFE 2Z92A 3IXAB 3QDHA 1CIDA 4PY7B 4DQOL 1IFHH 4Z8FH 2Y23A 3LRSA 3ARBD 4JHAL 4PV9A 1JUFB 3G5ZB 3G04B 5C0DA 5LGJA 2ZKHL 1RUAH 1NGWA 1J1PL 1T20B 1WK0A 3IDNB 4FNLL 2MSPA 5ALBL 3U7WL 3DX7A 4X9FA 4Z76B 5JHDA 1Q0XH 3ZE1E 4X7DC 5DVKA 1CCZA 1FIGL 5EDXA 1CICB 1J87A 4YO0A 3GIZH 2DQUL 4XX1E 1YEHL 2ITDB 3BH8B 3FO9B 4QRRA 1U8MB 3HC3L 1T5WB 4PJCA 3VFOA 1S7RB 2ICWA 1S3KL 2P1YA 5MERB 3WV0A 3VI4E 2XZAH 1DEEB 3EDDA 3IS0X 4JM2B 4LSUL 3IJYB 2UZIL 4XP9L 2YD1A 5CZKA 1TVHB 1IGJA 1IQDB 1QG3A 1ACYH 3BYTA 3FN9A 1R0AH 4X7SH 4JRXD 4G8EA 1SMAA 5DD6B 2V5SA 3ET9F 4JE4B 4JQXC 2O61A 4QWWC 1XCTA 4H1LH 1ORQB 4ZS6C 3GBMH 2Y9RT 3TBSB 1GCFA 5D71L 3L5XL 3K8MA 3WS6C 4QTHB 4OGYL 2JIXD 4B7LA 4L1DA 4HUNB 5IWLA 4RAVB 4LLUB 4L9LC 4F7CA 3MC0A 4ODXA 5C6TL 5GSRA 3GMPB 2QQLH 2VQ1B 1QSZA 1UADC 5FCSH 1CS6A 3CNKA 4O2FA 2OS7A 1T2QH 4GSDH 5D70L 4G6FD 4FFVD 1A22B 2NY1B 1NAMA 1OCWL 3OAUL 4MJ5A 3GSVA 1U8HA 2VDLL 2A6KB 2P5WA 3EGSB 1E28A 1S7TB 4XPBL 1EH9A 4LCUA 3CAFA 2ICWI 2VAJA 2XA8H 2FYYB 2HTKC 3S9DB 4HJGB 2BRRL 3HFMH 5I74B 2D03L 4AIZA 1UJ3B 4D3CH 1CE1H 1YECH 4M7KL 3LB6C 4XC3H 1ZA6B 4ZUWA 4H0HB 4KQ3L 1A3LH 1FNLA 3RWCA 3RZCD 1OM3L 1WZKA 2BVEA 1PKQE 5CSZA 5KVGH 3NIFF 1KPUB 1A6PA 1XCQA 1CGTA 1FRGH 1CXFA 3LZFH 3WXVL 2ATKB 3O6MH 4AENA 3D48R 5DYOA 1M7XA 2JJSA 5B3JF 5DA4A 1MY5A 1HQ4B 4U6YA 1MNUL 5D2NB 4DGVL 5CLWA 4L3ED 4GAYA 3HAEA 2IAMD 2H6PA 2DKSA 3CPLA 3P11L 2ZOKA 4H5SB 3TP4A 3PGDA 4KVNH 4ZPTA 4ODWA 1CT8A 4OGXH 1VFAA 4Q6IB 5E95B 2NY1C 3I85A 4X4XB 5I0ZA 1S9XB 12E8L 4JFPA 2WZPD 2IBGA 1D6EB 5FGRA 2WK2A 2MHAB 1S7QA 4GUPB 4PJBB 3MRLB 4HUUB 3BQUB 1MF2L 3BVNB 3QIUB 1I3GL 2DJSA 4UAOB 3V6FA 3DX6B 3UTQA 3MLWL 4JFDA 4XBPA 5E24E 2R2HB 1FZOB 3BP4A 3FTGB 1UCTA 1UJ3C 1UJTA 3VGHA 3EO9H 4XNMA 2PYED 4WU5A 4DJMA 5KN5A 3QCVL 4GG6F 3LSOB 3ZT7A 5FKPA 3TT1L 2IC2A 1EHLL 5EBLB 1DL7H 1F90H 4GKOA 4M02A 1DBJH 1IGYB 1I3RA 2Q76A 3SE3C 4CDGC 4PJIF 3M8OH 4QTIH 1AY1L 3SJVE 1HHGB 2X4QB 1VA9A 1QFPA 2H8PA 3EDEA 4HS6A 3LKNB 4ODBD 1EZVY 4LSSH 1YYLL 5EU3B 3MRQB 1T03H 2JB6A 3EYFB 4YHZL 1ZLSH 4F3FA 4WHCA 2DLFH 4S1RH 3MLXH 5F97E 4KY1L 2AJXH 2ZJSH 5T1DH 5EZIH 3FT3A 1DBBL 3HE6B 5IB5A 3L3IB 4JJ5A 1OB1A 4H25A 3TN0A 3V2AR 1HI6B 5CILL 5DGRA 4UV4H 4W70A 5KAQG 5HHOD 2BNQD 3QQNA 4GRLD 4UAOC 3B83A 3KR3H 4PGEA 1I1FA 4JM2F 3S96B 3NFPA 3HAEG 1IQWL 1HHIA 3K80A 4EXPX 4P5KA 4Q0XL 5DD3L 1PKQA 4K23L 4MVBD 4HUVB 5DI8B 3TIEB 1HKFA 4RX4D 1K3ZA 4CMMA 2HVKA 4YXLL 3O6FD 4ZO7A 5DUPL 3PV7A 4UQ3B 5SWSD 4MZ2A 1XGRB 1LNUB 2GY5A 3GSUB 4JFXB 5ID1A 1JZ6A 2J7LA 1DANU 2QL1A 1CFNB 5J1AB 3RIAF 2IPKB 4I0PB 5IW6B 3EOYG 2NY5L 2IH1A 4XPAH 2L0DA 1IC4L 5DD0H 3FQTB 2Z93B 3NCMA 3RPKA 2UYLA 1IEAA 3OKYA 4QRPA 1RV6X 1A1OA 3FAWA 4GRWH 2KH2B 3DUSA 1IKFH 1L7TL 3MODH 4NKMA 4AEHL 4ODSL 3KXFE 3MXVL 1M71B 4DZBB 1CXKA 2APWA 1XGPB 4MNQE 4CADA 1YJDC 2AV1A 3GKZA 1B4JH 1YN7B 3VI3F 5JLZA 3OKDA 4JVWA 3KYNB 3S37H 3E6HB 2OXGA 4QKXB 4TTGA 4OQTA 4XB8A 4G7YH 2OL3H 4EZMA 5KSUA 4D9RD 2P24A 3F5WA 3SDAD 1PGRB 1MIML 4PLNC 3IETA 1MLCA 4PG9B 1UWEH 2ICWJ 1XEDA 3MJ8B 5C0NC 1MVFA 3X11A 1NLDL 3H9SB 5EOQL 3ARDD 3MUHL 4QHKJ 1VFMA 4RNRA 4APQC 4BZ1H 4ENED 5A16B 2AQ3A 2CH8A 2WQRA 4MQSB 3B9VA 4F7PA 1VFOA 4OLYH 1M05B 5T5FL 2ID5A 2DDQH 5GS0L 2DBLL 3RVVD 4MAYA 4Z6AT 1ONQB 1WFUA 5DR5H 1QRND 2PXYA 4YXKL 1DUZB 4OIIL 3RUGE 1WQVT 2PETA 3UBXA 3QIWA 1A6AA 2VAAB 4K9EC 2C3VB 5KS9B 4ZNEE 4PJBF 3WJJC 1NCBL 1O7SA 2HRPH 1G6RA 3HI1B 3HNSL 4XC1L 2RCSH 1NJ9A 5L6YL 3W39B 2EC9T 1AIFA 5EU6D 3THML 3U4BL 5JHLL 5MHSD 2VC2L 2X9YA 4KVCH 3ZDZE 1U8QB 2Z35B 2I07B 1RVFH 1NH6A 1S9KC 2B5IB 3RVWC 3OR7A 2Y07H 1S78D 1DZBA 3DVFA 3CVHL 3TNMB 1UENA 3GMMA 5CHNA 5C09E 3UXFA 5F9OL 1YA5A 3A6OA 4QCIB 2OMNA 2P42B 1RZ7L 2ZPKL 4JFQA 4YDVA 3QCUL 4OD2B 1U92A 3ZHDA 1H8SA 1A7OL 1M6OA 1JWSB 3HNTH 1A6ZB 1G7PA 3E3QC 3PWPD 2VR5A 3SGEI 1RUKL 4ELME 3SDYH 3UTOA 5HHNB 1RUMH 4HWZB 2FH6A 3KXFA 1TZHB 1J1OL 3E8UH 4EI5C 4MJIE 5EBWA 4S1QL 4UNVA 3WO3B 2MMXA 5CJXC 3C5SA 3PJSB 4RWHA 3CSGA 1UQSB 3HNVL 4HBCL 4XNUH 1IGFL 3HLAA 3IB4A 3IJSB 2BNRB 3OG4B 4EOWL 1CFQA 3ZSTA 1FNSH 4X6DA 1MREL 3OPZH 1Q9OA 4OZ4B 5JOPE 1RZKC 2EZ0D 3KPPA 2WUBL 4HK0A 2B5IC 1OF2A 1G7IB 1G6VK 5DVLA 3CFEA 3UBXG 2HFGL 3FN0H 4WY7L 1GYAA 2AVGA 4JFEB 4F58H 4UU9B 2VLME 1VACA 2B8OT 5DJ0A 3ULUC 4RFEA 4Y7MA 3NIDE 4N0FB 1FZJB 3G6AA 5E9DA 1RQ5A 1AD9B 2BOBA 2WBJA 1CU4L 3VE0B 2XY2A 2VKXA 1OTSC 1MLBB 3CFKB 1WAAA 3RUGA 4AH2B 5IB2A 3VDAA 3NABL 1P6AB 4LF3A 1JYWA 2BC4B 5FUCE 5E2UL 1U8KB 4ZNEA 1AXTL 2EKSA 1AXSB 2CDGA 5ICZB 5M94B 1BVLB 5E8PA 5SWZA 3S97C 4J4PA 3O6LL 3L5IA 1LK2B 1HOCB 2X70A 3P77B 4L3EB 2IFFL 2IAMB 3EJYD 4RZCB 2CRMA 3UTTD 1WITA 4JFDD 3EYUL 1E4WH 1D5BA 3SHSA 2R2EB 3PP4H 2OCFD 3FQUA 1X5JA 3SKNB 4I18B 2D7NA 4DN3L 1MFDL 4M8VA 5IHUH 4MZ3A 2ZCLL 5C09A 2BHZA 4AK1A 1LP9B 4P99A 3RRQA 2A6DB 2AS5M 1OTUD 1JPTH 1PJ9A 1RJCA 3D39B 1UB5B 3PQYE 5EZJA 2DQEL 3V6ZA 2X7LA 3ULVE 5I30L 2E9BA 4PRHE 5IM7A 1WGOA 2V5MA 3QIBB 1FPTH 1HEZB 4ELMA 1CXHA 3JWNC 5J3HD 3SGKC 2GCYA 4MJIA 1JBJA 1ZGLA 4HQQL 3ZLQC 4LIQE 1P84J 3I9GH 1CG9B 2YRLA 1N8ZB 4Y5XA 5E6IA 3O9WA 1IAOA 1YEJL 4MQ7B 5FGCB 2DQHL 3QPQC 2H9GB 1RULL 3UJJL 3ARUA 1T4KB 1QUNA 5KS9F 1MAML 5GS0D 1QBLL 3U36A 4HJJH 2CJUH 1NAKH 4WW1B 5E70A 1AP2A 1UM6H 1MCCA 4FXKA 1NGQH 2WSKA 3QXUA 3C8KA 3BFOA 4YDKH 5C2BL 3VFRB 3IKCA 3BUYA 5I1JH 3NCYP 4FFYH 1JMXA 2AAVA 2HT2D 4GAJH 1KXTB 1WBZB 1NKOA 2W9DH 4JDZA 4WEUD 4ALAH 3ULUF 3EYSH 3O8XB 5GZND 1MCPL 3QIBC 4X83A 5BZDA 3WE6A 4KWUA 5F1KC 3MRRA 5HD8C 4N0CC 4KTEL 4ZFZA 1Q1JH 3BE1H 4QRPD 5ALCL 4QOKE 3MYZA 1FFNB 3RWIA 1NBQA 3PHQA 1J86A 3MACH 4QHMB 2J12B 4S0SD 4MA1B 1QLEH 2Z31A 5FYLH 4L4VD 2G5BA 1HWGB 4EQ2A 4G8GE 1N6QH 1XMWA 5DJAA 3UTPD 2B2XH 2IG2L 2D0FA 3B3IB 3FQRB 1J8HE 2GY7B 3PQYA 5FGBA 3UZVB 4U1GB 2OR9L 4Y16A 4OB5H 1UM4L 2EDTA 3U0WL 4PRHA 4AY0A 4KJQC 3NZHL 5IESH 2DM2A 5E2TH 1G9MC 1OQOA 5EO0B 1NMCB 3O8XC 4JY6B 4A6YH 1S7UA 2H2PC 4HKZA 2OTWA 4R8WH 3T3PF 4Z77A 5EH1A 4HCRH 1P7QB 4J23A 5H35A 1XGQA 4XWOD 2Q6WA 5BVPH 3G5YB 1A1NA 1U3ZA 4QY8A 3WL9B 5BMFL 3QO1B 2H45A 5EULV 3HN3A 3ARDB 3MRPB 3QIWD 5J12B 4KUCF 3BGMA 1AE6H 4I48A 1IGMH 4JG1L 3OHXB 2XT1B 2Z92B 3AGVA 1QSFE 4MA1C 3LRSB 2FSEA 2CLRA 4PV9B 2VLRE 1SBSL 2NY7L 4XTRC 5TE4L 5C0DB 2NTSP 5LGJB 3HMXA 1N2RA 1NGWB 2Z8RA 1IAIH 4ETYA 5C1MB 4NHUA 1MFAL 5JHDB 3DX7B 2EC8A 5FM8A 4S1SL 5EU4A 4GAGL 4JPKH 4YC2B 3NIGE 2ZWLT 4YO0B 3U2SA 4U1GC 3MBEA 4QRRB 2R56L 4O00A 4NQCA 3DTXA 4PJCB 3VFOB 3MV9E 4CKVX 1MCRA 2ICWB 2OK0H 1LP9F 3QHFH 3MV7E 4XVSH 4KUZL 4P57A 1K85A 1NMCC 5IFJA 3BD4A 1P6FA 1P5UA 1L0QA 1IGJB 3CUPA 1FLRL 4LPTA 1GGUA 5JOFA 4G8EB 4QOKA 4LVNB 1HHKA 5J1SC 2O61B 3PABA 3BZFA 1XCTB 5GISH 1QHPA 5GRUL 3BOVA 1I85A 5J12C 3RPIA 4NO0A 4KXZI 4M1CC 3ZKNC 1UCBL 3QHZL 5I8KH 2YA2A 3K46A 4RDQG 4UT6H 4X9IA 3D0VA 3TJEH 4G8GA 5HHPA 1IEBA 1OSZA 3B9KD 2CDFA 4F7CB 1VGKA 1VFBA 1L6ZA 4ODXB 4OV6F 1J8HA 2J8UE 5GSRB 5CEYA 3I02A 4NBXB 1KCRH 5T1LD 2WMPA 4O2FB 2VR4A 5C7XL 5T1KD 4Q9CA 2E7LA 1NAMB 2BZDA 3ZMRA 2QR0A 4RWYL 4D0DA 4MJ5B 3N1PC 4XWGL 3GSVB 1U8HB 2YD2A 2GIYA 3RU8H 2P5WB 3C2SA 1E28B 1HXMA 4PJGA 2CUHA 43CAA 4LCUB 3X3GH 6FABL 5E9DD 5ILTH 2WBJD 3GRWL 5DGQA 3BESR 3RAJH 2FJHA 4AIZB 1QNZH 5FGSA 4M4PA 4ZUWB 4OCXH 4HIEA 3RWCB 3UZEA 2X10A 5CSZB 1XCQB 4HMCA 1DR9A 5T3XD 5HYFA 1QSFA 3C5ZC 1MHPL 1DBAH 2W60A 4AENB 2ITCA 5DYOB 4QYOA 3RIAK 4C56E 5SWZD 5IWLC 3O4LE 4U6YB 2KZ1B 4AMKL 4AG4H 1D6VH 4GAYB 2FATL 3HAEB 4RAHA 1QTYT 3SDDA 3WSQH 4TN9A 2H6PB 3H9ZA 4G9FE 2VIRA 1GC1L 3CPLB 1XZ0A 2HKHL 2ZOKB 5F7KC 3PGDB 3PNWA 4LAQL 4ZPTB 4ODWB 5DMIL 1CT8B 3MV9A 4OD1H 1VFAB 3P30H 3MV7A 4EIGB 1K3IA 1Q0YL 5BJTB 3MRIA 1DDHA 1OGAE 4JFPB 2GUOA 1T22A 2JE8A 2AEIT 1S7QB 3QFJE 3H3BC 2D7TH 1VPOH 4LK4A 3C6LA 4M7ZB 2BK8A 2X44D 3UO1H 2DS4A 5I1IH 3V6FB 5IV2A 3UTQB 4JFDB 1OP9A 2MWCA 4XBPB 1P7HL 3RA7L 1JYNA 2YD9A 2DYPD 3BP4B 1OAZL 1Q9LA 4KKLD 2BRQA 3KHQA 5ANME 5KTEH 4M43H 1MFCL 5F70A 4JDVA 4XNMB 5F8RC 1N5YL 1MCIA 4WU5B 2KUTA 5KN5B 1DUYA 5FKPB 4TULH 5LKNA 2F5AH 1V05A 2DTSA 1CFBA 3ISWA 3LKRA 1I3RB 2Q76B 3KS0H 2GK2A 5E6ID 2J8UA 3NFSL 3TBVA 3LPWA 1EDQA 2BP3A 3O9WD 1PW3A 4KV5F 4HS6B 1GZPA 2H8PB 1FGNL 4KGLA 3CFJA 3S88L 2JB6B 1QSED 2VQUA 3ILQD 4K3DH 4F3FB 2GHWB 4OZFA 4NQVA 2PUQT 1MVUA 4GXVH 4G8IA 2I60H 1OARL 2VISA 3FT3B 4PJ7A 3ZTJG 3L3KA 4I3RH 1LE5A 5IB5B 1BD2E 4JJ5B 1OB1B 4H25B 3HC0A 3TN0B 4BQ6A 3DYPA 4PJCF 4M7ZC 1LILA 1BP3B 3EO0A 3TBYA 4U7KA 4PGEB 4ZXBC 1I1FB 3MA9H 3JUZA 3S35X 4EEEA 1MSPA 1PY9A 2DQIH 3S3SA 2YN5A 3NFPB 5E4EB 3SN6N 1HHIB 4P5KB 2HRLA 2XWJA 1PKQB 1FYHB 4G7VL 4PYGA 3G9VA 1I9EA 1R3LA 4X4YA 3MPCA 3VJ6A 4N8CH 4ERSL 1FG9C 4OSUL 3RKDC 4CMMB 2HVKB 4PTTA 4C56A 1EGJH 5FEBA 1CE6A 3SE9L 3O4LA 4LPXA 2FECI 3BDYL 5ID1B 3A0OA 1T83C 4YHKH 4HD9A 2LFGA 2ZUWA 1GPOH 4G9FA 5IB4A 4OCWH 2IH1B 3LKPA 3MR9A 2WWMD 2BXZA 2V17L 2VH5L 4JR9H 1CFVL 2GTZA 3U7YL 3AVEA 2UYLB 1IEAB 1LDPH 2Y25A 3JTSA 2Y6SC 4QRPB 3QFJA 1A1OB 1P2CA 4DGYH 5FO7A 4O9HL 2EYTA 4XT1C 4N1CA 3DUSB 5I1AA 1P9MC 2V9TA 5C3TA 4LDOB 4NKMB 2AKRA 4I13B 1D5IL 3TN0C 3OXSA 1SY6H 2Z4QA 1CXLA 5ANMA 2FO1A 1IKNA 4CADB 2AV1B 4XNXL 1BF8A 5E4EC 5JLZB 3OKDB 3FO2A 4G5ZH 3WIHA 4WI3A 4X9GA 1BIIA 1RSFA 4TNVF 4LCYA 4Y2OA 5KSUB 5F7EL 2P24B 3F5WB 4Y1AD 2JJUA 4OZFG 4X6FA 3IETB 1DQJA 2MQCA 4NNYA 3VGGA 1MLCB 3IFNH 1KLFA 3N1MC 5DVOA 1JPFA 3QI9D 4OF8A 3RWDA 3PWLA 5INCA 4URTB 3X11B 3R8QA 4UT9L 1IT9H 2VDKL 5JW4R 1BZ9A 5FV2A 5HYJA 4RNRB 1JWUA 3IF1A 5KG9A 2LABA 4GMSL 2LU7A 3DMMD 3ESUF 2ZG1A 4KKAC 3V0WH 5I8CA 4F7PB 4N5UA 5KAQF 5EORH 3VD7A 4Y4KC 3QRGL 3DI3B 4NUGL 4WUKH 4Z95L 5A3ID 3ZE1F 2AXFA 1F4YL 3KJ6L 4MAYB 4X9BA 3LAFA 4YWGH 1V3KA 1CN4A 2PXYB 1KCUH 1BD2A 1C5CL 1DBKL 3UAJD 4CJ0A 3UBXB 3QIWB 5JO5A 1ES0A 1A6AB 3VI4F 3MBED 4EN3D 2OTUA 4ODVL 3BKMH 4NQDD 4NQCD 3IDJA 2DTMH 1REIA 4M6ML 1G6RB 1N26A 1OWWA 1NJ9B 4EDWH 1H9VA 1AIFB 2P46B 3ARXA 3UPCA 4Z5RA 4LEOA 3EBAA 4L8DA 4K7PH 4DVBA 4UV7L 5KSVA 5FHAL 3WN5C 1U3HD 2NXYC 4K3JH 1PSKL 1OAKH 3OR7B 4KQ4L 1MWAL 1EJ6A 5DUBA 1PG7H 1A7PL 3GMMB 5CHNB 1OL0A 4KFZC 4WCYH 5IQ9A 1FFPA 4EBQL 1D3CA 4PS4L 5M7QA 1FHGA 4AQ1B 2C1OA 4F8QA 5TF0A 3S36X 4JFQB 4YHNA 4YDVB 5BO1H 1U92B 1WT5C 3TVMC 1M6OB 4MAYC 1G7PB 3OQ3B 1RZFL 3D2UA 5E08H 1DFBH 3BIAX 2CDEA 3AU1A 5KSAD 2EE3A 2P8LA 3KXFB 3T1WA 3WS3A 4P9HC 5HPMA 1JRHH 3GHEL 5EBWB 4JRYD 4KTDH 3GSNL 3C5SB 4NGHH 1FO0L 4XP4L 2X6MA 4HS8H 2VDNL 3HLAB 4IOFC 5LWYL 1H15A 4FG6D 1CFQB 5LBSH 3LQAL 4IHOA 1AXIB 4NCDA 4X6DB 3ARFD 1Q9OB 4UOJA 1LO3H 3QISA 4NBYB 2BOCA 1NCWH 4XPHH 1P5VA 3KPPB 5JTWA 4HK0B 1OF2B 3OKNA 1RZKH 1BBDL 5GHWL 3CFEB 5IVXE 2EDEA 1VACB 5D7KE 5DJ0B 4RFEB 3MXWL 4P5TA 3C60D 5H94A 4OF3A 3G6AB 4FQIH 5E9DB 1SM3H 3P3YA 2BOBB 2WBJB 3WFBH 5CJOH 3WKMH 2AI0H 1O7VA 1GL4B 4XH2A 4XP6L 4XNQA 3RUGB 5HHVL 2XOTA 4G6AD 5IB2B 1JCKA 5A43C 1KN2H 4LF3B 4MA8H 4J3OC 1JI1A 4MD5A 4TOYH 3C5JA 3AFLA 2EKSB 3LIZH 4EXKA 2CDGB 4HIIA 1I1AA 2J5LB 2FX9L 5E8PB 5SWZB 5BV7L 4G3YH 1G9NH 2X70B 4NZRH 4K7PY 4UTAL 4K3EL 1H3GA 4POZC 5LCVL 2Q86A 4GW1A 2BVQA 3T0AA 1YEKL 3H3PH 4DEPC 1BEYL 1D5BB 1JNNL 1CD9B 3QDJE 3UX9B 3FQUB 2OM5A 3GGWA 2WWKO 3WNKA 3N9GL 3I84A 4H0IA 3WBDA 5EOCJ 5C09B 3QSKB 1ZHKA 3HB3C 2HWZL 4U7MA 3LH2H 4JN2A 1YDPA 2XG4A 5F96L 1XAUA 4RMVA 5EZJB 3V6ZB 4X7TA 5MEPA 5GRVK 2X7LB 4BA8A 1I4FA 4IEFB 5KW9L 1AH1A 5IM7B 5TQ0H 2A38A 3P0GB 4HG4K 4WEBH 1EZVX 3ETBF 4ELMB 1G0DA 5D7JD 4LSTL 1C5BH 2GCYB 1NEUA 4MJIB 1RMFH 1ZGLB 4PGBA 5C0RL 1FNFA 5B4MD 5IFAL 5IBLD 1TDQA 5DJDA 3KYKL 1JGLL 2X89D 1BQHA 3ZYIA 2J5LC 5E6IB 4J4PC 4Y5XB 3T04D 1RIHL 3O9WB 1IAOB 2YRPA 3BPNC 4DN4H 3DNKA 2XG5A 2OX5A 3EYVA 4WV1A 3U36B 4N90E 5JQ6H 4N0YL 1AP2B 3V4VH 3CDGA 2Z0BA 4FXKB 3FB6A 3SPVA 4PYHA 4B50A 5IVXA 1ZHLA 3C8KB 3E2HB 2YC1A 4GMTL 4G80A 3IKCB 3BUYB 4BUGA 3MFGB 3MCLL 4O02H 1I9RL 4HC1L 2J3SA 3MNVA 3S35L 3ECBA 4JDZB 2XPGA 2Q8BL 2R29H 4ZG1A 1BQSA 2I24N 2ZOLA 5BZDB 1RK0A 1JGUH 3WE6B 2DQDL 1BX2A 4P4KC 3MRRB 4WVRA 4KDWA 4V1DE 1P4LA 4ZFZB 1CZ8L 1FCCA 3ROLA 4Y4FD 1A6UL 1RUQL 2VZSA 3RWIB 2JKXA 3MOAH 3PHQB 1JJUA 2QEJA 3R0MA 5HGHA 1DCLA 4W68A 3QDJA 3IJHA 2Z31B 3LEXA 2VZ3A 2G5BB 3QPXH 4PLJC 5BW7A 4RFNB 3CC5A 4XP5H 5DJAB 3UTSD 2FX8L 4X6DF 2XTJC 3K1KC 1CL7H 3E2HC 3ZKMC 4ZFOL 3BXNA 3PQYB 3WLWD 3ULSA 4WFGE 1E4XL 4Y16B 1BQHG 4YJZL 4PRHB 1RHFA 1GHFL 1WTGT 1CGVA 3RVUD 5DQDL 1FV1A 1QBBA 5HYJD 2LTQC 1JZ2A 1S7UB 1G9MH 3BN9D 4HKZB 4NJ9L 2OTWB 1OAYH 5E7BA 5E8NA 4Z77B 5FUCC 3D3VE 3NOIA 1DLHA 4QNPF 1NCAH 1WAAF 3RUGF 2AJVL 5H35B 4G8FA 1XGQB 5TPWH 4HLZG 2Q6WB 2GYSA 4H8WC 1A1NB 4QY8B 1W72A 3DYOA 1MRDL 1UM5L 1LO0H 4DWHA 4POYA 4M6AA 2HMIC 4I48B 1YNLL 2WP3O 1DP0A 2D0GA 2A83A 1EERB 2Y36L 3RHWF 2A74A 5D1ZA 2B7DT 2FSEB 1XR8A 2CLRB 2R0LL 3RGVA 2ARWA 3V9FA 1CLZH 3MLZL 1N2RB 4RFNC 2V7NA 3IFPA 3BEWA 4J2XA 3ZDZF 2XN9E 4NHUB 1RURH 1FNGA 4NNPL 3WNLA 4J6RL 5EU4B 1J1XH 2IPTL 3MUY1 5TDPA 3U2SB 3CX5J 3MBEB 3ULVC 4Y16C 3NA9H 3ORJA 3QDMD 5A2FA 4NQCB 3DTXB 1F58H 5E5RB 4DUWA 3FQNA 3RY5A 2I9TA 5CUSL 1E6JL 4LRIA 4JHBA 4P57B 1HKLH 1IGCL 5IFJB 2GSIA 4ONFH 4B5EA 1NFKA 5KJRH 3GMRA 3CUPB 4XMKL 2F74A 1TPXC 4V1DA 3W11D 3LOWA 5JOFB 4QOKB 4ELMF 4ZD3H 4OGAC 1HHKB 3P0YH 3PABB 2ORBL 3BZFB 3MLYL 1ZTXH 5JUEH 3FMGH 4FFZL 3VGAB 4X6EA 4Q2ZA 3RPIB 3ARGA 1RZJL 4NO0B 2O5XH 1QOKA 2VUYA 1AHWA 4F9PA 3VD5A 5CGMA 3S36L 3D0VB 3I3BA 3K7UA 3TA3C 4G8GB 5HHPB 1IEBB 4NM8H 1OSZB 2BCKA 2RGSA 2CDFB 3DX9A 4LLYA 4LSQH 1VGKB 4OFDA 4P0DA 1VFBB 4N5ED 3BYYA 2QV2A 5E99L 3VFSA 1J8HB 5CEYB 3I02B 3SCMC 5IB1A 1ZVYA 3ROOA 4OM0L 3CK0L 5F1OB 3KPSD 4JO2H 3OG6B 3H9HA 2VITA 5ITBH 2QR0B 7FABH 2ATPA 3NIDF 4D0DB 3A6BL 5A2KH 2FEDD 4JM4H 4XCFL 5KVFL 4DW2H 1HXMB 5CGYC 2M1KA 3WFCH 4PJGB 43CAB 1WEJH 3D3VA 4OTXH 2YR3A 4R26L 1AR1D 1TXKA 5ICYA 3BKJL 1JGVH 4HMEA 3STZA 4P4RA 3UJTH 1H0DA 2FJHB 5K9QI 2JK5A 3B5GA 1MCOL 4D9LL 3QEQE 3WNPA 4MDIA 5C0CD 4HIEB 1IFHL 2OJZH 4Z8FL 3FFDA 2DF3A 3VGAC 1MCHA 1RUAL 1L9NA 1I85C 1IMHC 1QSFB 1ZKAA 2W60B 3CFIC 5E8DH 1I1RA 4PP1D 2ITCB 4QYOB 1I1AD 1Q0XL 5D7LD 1RJYA 4Q74A 4HZLA 2XN9A 5K9QG 2Y7QA 1WIUA 1CIUA 3GIZL 1CFSA 3SDDB 3ZHLA 1HINH 1J8KA 4GRMA 2VIRB 3KLAA 1XZ0B 3CJJA 2XZAL 5CP3A 3PNWB 1MEXH 5JA9A 2E7LC 3MV9B 5L8LB 3MV7B 2CXKA 4L8CA 1BF2A 3AREA 4WFEE 1ZLUK 1CGSH 1DDHB 3MRIB 1ZLUH 1ACYL 1T22B 1NAMH 2GUOB 1R0AL 4X7SL 4AL8H 3C6LB 4XXDA 5FAAA 5F7UA 1AGDA 2ESVD 4JY4A 4RDQF 1I8IB 4G6KH 5TF1H 5IV2B 1R24A 4KHTH 3GBML 1A3RH 1JHTA 1Q9LB 2YD5A 3CSPA 1F6LL 4P2RD 4TNVK 1YQVH 4JDVB 1L0XA 3QUZD 1DUYB 1LO5A 3AS0A 2Q3ZA 4NP4H 1A47A 1TETH 3HG1E 3IFOA 5DQJA 3LKRB 2QQLL 4KK6C 3QQ4A 2E7HA 1BM3H 1T2QL 2WV3A 4GSDL 4U6VH 1VDGA 2J8UB 3TBVB 2C3GA 4OD3L 9CGTA 4RRPA 1BVZA 1GZPB 4LSDA 5ICXA 5MEOA 5C71A 3HAEH 3CFJB 3HKFA 1L0YA 3U82B 5IIEA 4YHPA 1X5XA 2QQKH 4OZFB 4NQVB 3T0EE 2XA8L 1MVUB 2N56A 4WI6A 4G8IB 2VISB 3HFML 4PJ7B 3L3KB 3MQIA 1LE5B 2CMRH 1FL6A 2VOTA 1CGUA 4D3CL 1CE1L 4Y2DA 1KCVH 4OI7A 1YECL 3HC0B 4XC3L 5D72H 2AK4E 3C6LC 2I5YH 1A3LL 1X6LA 4LRNH 3TBYB 3BUTA 3EO0B 3QEQA 5KVGL 4QHUA 5CD5D 4G6JH 1FRGL 4DUXA 2P5EE 4I3SH 2XWJB 3LZFL 4GXUM 1MJ7H 2VABA 3O6ML 4S1DD 1YEFH 3IDMA 4LDLB 1VERA 1R3LB 4X4YB 1J0ZA 3VJ6B 1FVDA 4JPVH 1KEGH 4PTTB 1SJEA 4C56B 4MXWH 3MXVH 1CE6B 4KROD 3O4LB 3G08A 4JB9H 4WWKA 1AI1H 2EE9A 4KVNL 1QO3A 4G9FB 5IB4B 2V9RA 4OGXL 4TVSa 3OKEA 3VXSD 3LKPB 3MR9B 5KVDH 1RU9H 3CFBA 4N0UE 2GTZB 1UWXK 1UWXH 3RZCC 3V7MA 4TVPD 5EUKA 2F9BT 3JTSB 1RZ8A 4LU5H 4RMRA 5DMYA 2NR6D 3QFJB 1P2CB 5FO7B 4OCNC 5J6GA 2EYTB 1ZGLP 3OJMB 5I1AB 3SKMA 2FIKA 4JKKA 2PNDA 3EO9L 2AKRB 4JO1H 4ORZC 3DO3A 3OXSB 4GLRH 2CSPA 2Z4QB 4MNGE 5ANMB 5HHME 3BP5A 4CBPA 1FNEA 3HA0A 5GS0H 4PJGF 5I15H 4P5MA 2HLAA 3EOAA 2YXMA 4IDJH 1F90L 4WI5A 3FO2B 5C0IA 1DBJL 4M6OH 4RMTA 1SEBA 4TSBH 5E56A 1BIIB 3M8OL 4QTIL 2HT4C 4LCYB 3HG1A 4PV8A 4HV8A 2DLGA 3QDGE 2FH8A 3F7RA 4X6FB 3CDCA 1DQJB 4NNYB 1T7XA 4OLZH 1JPFB 3LD8B 3RWDB 4UILH 4UOW0 3PWLB 4LSSL 4DFIA 4PRAA 5BOPA 5INCB 3IS1X 1CDBA 1T03L 1BZ9B 1ZLSL 5HYJB 1JWUB 1P84K 2DLFL 3V7AG 3IF1B 3MLXL 4S1RL 3W2DH 5KG9B 2AJXL 3VXNA 2ZJSL 5C0BD 5T1DL 1KGCD 3H8NA 4YUEH 5I8CB 2XRAH 5EZIL 3VG9B 3T0EA 2YSSA 4P2YA 1YY9C 1WBYA 4IJ3B 2AXFB 3H7BA 4KKCD 3ZDYF 2Q87A 3NIGF 1BD2B 5E4IA 3KR3L 3QUXD 3ZT6A 2NX5E 4AEIH 3BHBA 2BXYA 5JO5B 4ELKA 1ES0B 1I8LA 2OTUB 1ZANH 3IDJB 2Y5EA 2ZPKH 5IKCA 1PY4A 3U4AA 1H3TA 4XHJC 1IKNC 4ZAKA 4U6XA 5ELIA 3BDXA 4WDIA 2EDKA 1IZJA 4YIQA 4Z5RB 4LEOB 1MI5E 4L8DB 4PRNA 4DVBB 2GJZA 4OQTH 3KYOA 4P2QE 1L6XA 3FJTA 5KSVB 4OLVH 2P4AB 3BJ91 4XPAL 4PJ9D 2LVCA 1KC5H 4KC3B 4Q7DA 5DD0L 1INQA 4OUOA 5DUBB 4L3CA 1J0KA 4I8DA 4NC0B 1PBYA 4FN0A 5IG7A 5IQ9B 1FFPB 4N0UA 4YBLB 2FLBT 2X40A 5HI4C 2C1OB 2J8UF 5E8OA 2X2YA 3X17A 3VG9C 1IKFL 4YHNB 3MODL 5C0GA 3SGEH 3D2UB 3O6FC 3EHBD 2CDEB 4LCIH 3AU1B 3OGCA 3TIDA 2P8LB 4LOUD 2L7JA 3WS3B 1B4JL 5HPMB 4OIBA 1GJIA 3S37L 4MNGA 4GG8A 1EHXA 4P9HH 4PJ7F 3GRWA 1XR9A 4G7YL 2OL3L 1ED3A 2QADD 1AQKH 4UI2A 1H15B 1UWEL 1HIMH 1G6RH 4IHOB 3QDGA 4QEGA 1TLKA 4WENB 2V9QA 3WNOA 2NY4D 4BZ1L 2BOCB 3V0VA 4ZUVA 1V3JA 3OKNB 4OLYL 5JIPA 1QQDA 5IEKA 4LP4A 5IJKA 4P5TB 3BKYH 2BY0A 5DR5L 5H94B 3MV8E 3O3DA 4YBLC 2G9HA 4XH2B 1R3KA 4PPTA 3D85A 3TBWA 4XNQB 3IU3A 4FA8A 2NX5A 3TH4T 4M93C 3V8CA 4CUCA 4BQ8A 3O45A 4MD5B 3C5JB 2HRPL 2VDPH 2ADFH 1T66C 2RCSL 3DRTA 2C9AA 3W0WE 5I1HH 5E1HB 1KULA 4HIIB 3ARED 1I1AB 3NGBB 4W6YB 3GUTA 4KVCL 1ZHBA 4HDIA 1RVFL 1MI5A 3RGHA 3F7PC 4P2QA 2Y07L 3RVVC 2UWEE 2X4SA 2Q86B 4GW1B 2BVQB 1MAKA 1NUNB 2NW2A 2XWBA 3GGWB 4RGND 3VXRD 3C2AH 1OQXA 3LN4A 4FZ8H 2E8YA 1ZHKB 4PRPE 2YS4A 1RJZA 4JN2B 3OL2A 1YDPB 4P5TC 4WI7A 4PJXA 3K3QA 4X7TB 5MEPB 4UNUA 1I4FB 5ESQA 2MTPA 3SDYL 1RUML 1A9BA 4JQVA 3E8UL 2V6HA 1FN4A 1CVRA 2UZXB 3IFLH 4XNUL 4NQEE 4PGBB 2VLJE 1WC7A 1XIWA 5ERWA 1NGYA 5DJDB 1BQHB 1FNSL 5T3XH 3NGBC 3OPZL 5EA0H 3BW9A 2ED9A 4Y2DD 3T0WA 3QNYA 3RHWK 3P9WB 3F65A 4KDTC 3EYVB 2VRAA 4OI9A 4WV1B 3PXHA 1Z9LA 3FN0L 4IDLA 1D9KD 1T89C 4JDTH 4F58L 2DIAA 3CDGB 5ETUA 3FRPA 5C8JA 3ZKXC 3FB6B 3SPVB 2LAAA 3U48A 5IVXB 1ZHLB 2YC1B 4ESKA 5FM5O 4G80B 3TYFA 1PQZA 1BZ7A 4Y19E 3A6CH 2WBWB 3MNVB 1YMHA 3EZJB 4OCLC 2X4NA 3ECBB 4WWKD 4OLUH 1S7SA 2XPGB 1KF9B 2CKBA 2ZOLB 1RK0B 3CVIH 1AR2A 1BX2B 4O51A 3W0WA 1P4LB 4O5LH 3NZHH 4KROB 3ROLB 3H42H 4BQCA 1E4WL 1KCKA 3PG2A 3SGDI 3L9RA 2F53D 3L3OB 3PP4L 3BRFA 4YBQD 2OI9B 2UY7A 4WTWA 5HGHB 5IHUL 3QDJB 3IJHB 3LPFA 3JV4A 3LEXB 4YAQA 5IHZA 1JPTL 3CC5B 1BOYA 1ZLVH 1IAMA 1ZLVK 4U4BA 1EVUA 4P46A 1W2KT 2A0LD 1EEZA 3BAEH 3BXNB 32C2A 1FDLH 2CQVA 3ULSB 1FPTL 3ESVF 5DJ6A 4JPIA 3CU7A 1Z9OA 4WHTA 4FP8H 1FV1B 5K93A 1A2YA 5F72S 1BIHA 3I9GL 4NQEA 5E8NB 3R0NA 2VLJA 1DLHB 1CTNA 4NWTH 3J8F7 4KH2A 4G8FB 1B9ZA 4TRPH 3WFEH 1Z6JT 2GEEA 2DQFA 4HJJL 2CJUL 2IEPA 1NAKL 2GW5A 1KPRA 4JVUA 1W72B 3T3ME 4HKBA 2YWYA 3N06B 4H8WH 1UM6L 5DEGA 2VB5A 1NGQL 4YR6A 4PBXA 2A83B 5CCKH 5DFTA 5ADPH 2A74B 3M07A 2VL4A 4UOW1 5D1ZB 2R9HD 3VWKC 1TCMA 1NSNH 1XR8B 3FZUD 4YDKL 2OR8A 5IW1A 2BSRA 3RGVB 5I1JL 4FFYL 5BW7C 4WW2A 2V7NB 3IFPB 2JLLA 3BEWB 3Q5YA 4LSVH 4E5XA 1FNGB 4GAJL 2D7PA 3Q48A 2W9DL 4ALAL 3E1F1 3EYSL 2AQ1A 5TDPB 5T3ZD 4CAGA 4Q9BA 3RWGA 1WV7T 4OM1H 1IC1A 3FQNB 2I9T