2C4UA

Crystal structure of the apo form of the 5'-fluoro-5'-deoxyadenosine synthase enzyme from streptomyces cattleya
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
291
structure length
291
Chain Sequence
b'RPIIAFMSDLGTTDDSVAQCKGLMYSICPDVTVVDVCHSMTPWDVEEGARYIVDLPRFFPEGTVFATTTYPATGTTTRSVAVRIKQAAKGGARGQWAGSGAGFERAEGSYIYIAPNNGLLTTVLEEHGYLEAYEVTSPKVIPEQPEPTFYSREMVAIPSAHLAAGFPLSEVGRPLEDHEIVRFNRPAVEQDGEALVGVVSAIDHPFGNVWTNIHRTDLEKAGIGYGARLRLTLDGVLPFEAPLTPTFADAGEIGNIAIYLNSRGYLSIARNAASLAYPYHLKEGMSARVEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-FLUORO-5'-DEOXYADENOSINE SYNTHASE
molecule tags Transferase
source organism Streptomyces cattleya
publication title Substrate specificity in enzymatic fluorination. The fluorinase from Streptomyces cattleya accepts 2'-deoxyadenosine substrates.
pubmed doi rcsb
total genus 79
structure length 291
sequence length 291
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.63: Adenosyl-fluoride synthase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01887 SAM_adeno_trans S-adenosyl-l-methionine hydroxide adenosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.90 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Bacterial fluorinating enzyme like 2c4uA02
3.40.50.10790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 2c4uA01
2C4UA 2V7TA 2Q6OA 5FIUA 2CBXA 1WU8A 2ZBVA 2C5BA 2V7VA 2V7WA 2F4NA 5LMZA 4CQJA 2Q6LA 1RQRA 2CC2A 1RQPA 2Q6IA 2V7XA 2C4TA 2CW5A 2V7UA 2C5HA 2Q6KA 5B6IA 2C2WA 2ZBUA 2WR8A
chains in the Genus database with same CATH superfamily
4FUTA 4MA5A 4DG9A 2H1FA 3L5KA 3LA8A 3I2GA 4LNUB 3L5OA 3GJ7A 2FH5B 1NXSA 1UM9B 3NC1C 3OEHD 1PQPA 3TZLA 5BNTA 1GDTA 5E2AA 4IUYA 4RGVA 2WJ6A 4CU2A 3N53A 5DWVA 5K05A 3RRFA 5G0VA 3SDSA 1R00A 3HU5A 3O1HB 1E60A 1GILA 4UTPA 2PNJA 4C1NA 3LUGA 1HH4A 2XA9A 4NOLA 1ZNYA 1RMYA 4QQKA 1M33A 5CA0F 1PN3A 2L0XA 2IE8A 3HPQA 4V0LA 5E95A 4FS8A 3DZHA 1C7EA 1VPDA 2FFRA 2QY9A 3DLIA 5FO1A 3HZHA 5CLGA 5FBRB 4G8BA 3T3PB 1Q83A 1U3DA 3LKBA 4QRIA 3GFRA 4P4SB 1H8ED 1NI4A 1M8FA 5B6IA 1TVCA 4OM8A 5GAJA 1W4AA 3TQQA 1ID8A 1YB4A 5COQA 4E4RA 1A04A 1TF2A 1KEKA 3MTJA 4M8SA 3A6JA 1X1DA 1C7QA 4HRXA 1UMBB 5KUTA 4HTAA 4AKHA 3IKLA 2B2CA 1AZLA 2H65A 4U2DA 3E15A 2Q2QA 4XW2A 1TKBA 2FP3A 4NH0A 2VHYA 3QHQA 1HT3A 2AHRA 4YJ2A 1VHDA 1YL5A 4BN5A 5JDIA 1U3FA 3P9QA 1OBFO 2PTGA 1PUIA 2HIMA 3MCAA 2CMKA 4G5GA 1CS0B 1TADA 3K2IA 4P31A 4UMFA 5E2IA 4D8XA 5FOVA 3I1IA 4WECA 1PGOA 5H02A 4KPFC 3KUDA 2JLWA 2WD7B 1NSTA 2OXEA 3LC2O 1O03A 3PFKA 3UZUA 1DXHA 4JYPA 5EE3A 1KK3A 3VV2A 1E6WA 2XADA 4WAUA 4BO7A 1QMPA 3VZQA 4C5AA 1QMGA 2HNAA 1TKCA 2DQYA 2JZNA 3HVHA 3QG1A 3W2FA 5ELMA 5C52B 4N41A 3PLAE 2DUNA 2GCEA 1KEUA 4EG1A 1EHIA 1KDOA 1S8AA 5BOSA 1GNQA 3D3WB 2P3QA 2YVKA 4QTZA 3PQDA 4XQ0A 1TUBA 3WGTA 4G5YA 4MVJE 3K4QA 5JZBA 4CTKA 3Q8KA 4X1KA 3Q8LA 4ZFNA 5DHAA 2VHJA 4EI7A 5DV9A 2VP0A 4G8CA 3IE2A 1KDYA 5FNZA 2H52A 3TFOA 2I8AA 2XRMA 2EFYA 3SK0A 4LTDA 4LGVA 4AN4A 2SKDA 5ECWA 5E6UB 5JCJD 2XKKA 3JWPA 5JH7B 2JFOA 2P6RA 1B16A 4DARA 5CDSA 3EK2A 3ICVA 3R7WB 3CF4A 2C8JA 4X0EA 3ZW7A 2K4MA 1N3IA 3TNDA 3R7NA 1W73A 1QC5B 3SBXA 4JNCA 4KWIA 3CW8X 4L3WA 5LZ9A 2BGMA 1Q1NA 1Z16A 5TQ2A 2PUTA 1ZCFA 3E1GA 4JBYA 5H5JA 1QH9A 1F8FA 4IIJF 2VPWA 3KL4A 1SD2A 3T0FA 4MGEA 3IAAA 1BDIA 1FFHA 4NEGA 3R7AA 5CVJA 2UVPB 3CZAA 3VPHA 2BZGA 2GK7A 1SU4A 4EJSB 1ZM7A 4Q19A 5EZSA 3EW9A 1NC3A 2WV7A 1UJNA 1YRQA 4CMJA 3SQMA 3L0ZA 821PA 1XV5A 1ZX1A 4OQZA 3L6EA 5J43A 1Z3IX 1CVIA 2FLVA 1Y7IA 2Z58A 1I5OA 5BV0A 4FW9A 3OZTA 3HLKA 3PEYA 2A4MA 3DDNA 3PNMA 4YCMA 2O7NA 3L82B 2HD4A 2I55A 3CW9A 4ZQHA 3K5IA 4FMCF 3PEUA 4QUZA 3ASZA 5JNRA 1JHUA 2OWDA 2J07A 2XMRA 4K5QA 4C22A 5J58A 2AFHB 1DBVO 1QF7A 2WU3A 5A03A 2K87A 5B7NA 3G82C 2RAPA 1L5KA 4AURA 2Z6VA 4RY9A 5AOCA 3I0ZA 5IDXA 2PZJA 1UBEA 3M6FA 3VDXA 1SOAA 4EYKA 5KU7A 4Z8XA 2OBTA 4XIFA 4W5QA 2JKZA 3MHPA 2PUJA 2WSIA 4FCTA 1THGA 2XUJA 4PO3X 4N5LA 5L7YA 4CTNA 3L0PA 2G6TA 3ZWOA 4X65B 1GXSA 3PYMA 3JRWA 1P81A 1SJ9A 1DRWA 4F6CA 5TLSA 1DRKA 1G42A 5JTTA 4II2A 3UAOA 2YJ5A 3G8BA 1GRCA 3OQJA 4M0CA 5T3YA 4D4HA 3DBIA 1OTYA 1UOQA 3G17A 1WZEA 1Q0RA 3P0EA 4V3BA 5DMXA 1ITZA 5ITSA 5A9SA 1IN1A 1EDOA 2VYND 5EWJA 3DMRA 2H5JA 2WJJA 2FW0A 3CU5A 3K0AA 3UFXA 2ZT6A 3PUYA 1UZUA 5FAKA 2RJ3A 3HM2A 2NU8B 4MGIR 4HQNA 4LC1A 3EXEB 4M1ZA 4ZKEA 3V32A 4BFSA 1BDJA 2ARKA 3R7DA 2FQXA 3AY6A 4BN4A 2DPGA 1O1YA 2HRDA 1G5PA 1MEOA 1TAGA 4QPZA 4I7EA 2PL5A 3PE4A 5BYKA 2CT8A 3PDCA 2P3SA 4XJSA 4EPVA 4R8LA 1O3YA 1K63A 1DELA 1XAHA 5HRUA 1ZN9A 1N05A 1A5AB 1RDFA 1UIMA 3E22B 1CD5A 3JZIA 1BH6A 3QUCA 4I8XA 1ZBDA 1Z5VA 2ODWA 4GZ5A 4TUYB 1QAQA 2H4XA 4PC7A 3HCDA 1NUTA 1CR2A 1C0KA 4XMYA 3QLVA 1TTTA 3CIFA 4MICA 3DZ8A 4FYIA 4RANA 3OJOA 2BUBA 2NOAA 2VP5A 3BKXA 3R3JA 4LZLA 4XOPA 3VKVA 4D5GA 4F1KA 4EJFA 3T7TA 2A9PA 3PWZA 3UT5A 1BQEA 3FUTA 4X91A 1D1NA 3A4YA 2WZQA 4ECEA 3F49S 1I5EA 1QIGA 2BFNA 1SUDA 3BMXA 3CZ4A 4HDNB 2I2DA 3L4BA 3QG5A 1JWLA 2AIRA 4X64B 3AEQB 3SGLA 1BEZA 2VHZA 1C1YA 2UUAB 1QOZA 1NWCA 2Q4RA 5E6SA 3GPLA 4RVDA 2GVNA 1AB6A 1KMHB 4FFVA 1ZJJA 3QVWA 4HXFB 3SLGA 1GUYA 2YNMA 3LUFA 4AKTA 2ORED 3A6DA 2Q0HA 2XTZA 5AJHA 3L8ZA 4YRCA 3RFCA 4U7FA 3P26A 3SQDA 4OXKA 4OU4A 3BE4A 2PT9A 3FKQA 1YFKA 1V11B 1T6YA 2GYVA 5L3QA 2GQ0A 4ZPJA 2XYHA 2BCEA 4LG1A 5EKSA 3V4PB 5LDDC 4D26A 4KG7A 2VXCA 3V8RA 1EI9A 1E8NA 2FK8A 4GYWA 4Z4IA 1UBFA 3KEOA 2QLBA 2FA9A 3L7NA 2H06A 4UU0A 1YUNA 3N3BC 3QBEA 4IRUB 1N77A 1RYZA 1LDBA 1SCAA 1DJPA 4GO1A 1Z6XA 3L7MA 3LBFA 2P0AA 3QF4B 5ITZB 3WAGA 5IWAB 1P4JA 1N2XA 1RAHA 4NWIA 4MWTA 4TTVA 3QXHA 2X3FA 1KXJA 1CYEA 4W5OA 3WIOA 4QYTA 3QPCA 5DTQA 3F3MA 1U1IA 1W85A 2PRYA 3K73O 2GPTA 3OU7A 1S89A 1FLNA 2DU8A 4ESHA 4I6GA 3RM3A 2EJBA 3PPWA 1JR3E 3UMJA 4G0XA 4CWAA 4M83A 2VC2B 5JHGB 1XHLA 2DP4E 2B1GA 1NYLA 1X7ZB 1ZCZA 1XCLA 3ETJA 4B82A 1L5SA 3ODGA 3ORRA 4WKCA 2N1MA 4MHTA 1X92A 4H6PA 1H2AS 3L0BA 4P1ZA 3A26A 4KC0A 4PW0A 3H6KA 4DOMA 1IXZA 3DWGA 5HF8A 3ZNOA 3EA5A 3C8DA 3HBNA 3RTAA 5B3LA 5LB4A 4MI9A 5DNWA 3D3EA 3R7SA 3UQZA 1Q2UA 1UMKA 1L7QA 2KB0A 1DAEA 1A96A 4KACA 3OW7A 2G1JA 3VKFA 1AA6A 1CQZA 3N2YA 2BAGA 3WMEA 4S1PA 1X1SA 4O4LA 2H57A 4BVGA 5DWDA 3G9UA 3X44A 4YIHA 1H65A 3ESCA 3DE2X 5L3ZA 4KMSA 1GCUA 3IJPA 2EQBA 2FPXA 3TS1A 2DY0A 2VAVA 2Y4NA 4LHZA 1FFYA 5IZCC 2ZT5A 4F11A 2Z57A 2NM0A 3KKEA 2CL7X 4V02A 4BBZA 5I3ZA 2JFWA 2JFFA 1FCJA 3DXYA 3HKCA 5FQOA 2VJQA 4BMOB 3EQ9A 1C4WA 3OI7A 3TW8A 2X2EA 2O6HA 1VG9B 4M9XA 1JHRA 2DGDA 3JZFA 5IAEA 3H2SA 2JC3A 2ZIAA 1XCMA 2BHTA 3QWAA 3TZHA 2HQ1A 1AXRA 3DDZX 3NGLA 5JO0A 3SFZA 4F0JA 3Q8MA 3Q0IA 5FWAA 3RHSA 3GPCA 4J4BA 8ABPA 4B4DA 3VHLB 2WD9A 2D7DA 3CSUA 3ZWPA 4X95A 1ZU4A 5TDHA 1VGRA 4RDJA 4G5FA 3MIIA 4H15A 4HQ6A 4GP6A 4PRLA 1JQEA 5JSHA 5B1EA 1GNSA 2YZKA 1VBFA 2IHJA 4IDPA 1Q12A 1AMUA 4N6GA 2SHKA 1UMDB 2BMVA 1RFGE 5KZMB 4HEQA 2APJA 1JEOA 1VSUA 5CPBA 1N33B 3ZCQA 3ZXXA 3Q88A 4GKVA 1SUFA 2XX3A 3ZHBA 4WZKA 4DE5A 4JBGA 2IXTA 4G1BA 3DMHA 1BN7A 1FUIA 3CKYA 3M70A 8GPBA 3DNPA 3QKTA 2HZBA 2YY7A 3EDQA 5JMTA 3O3MB 1TEXA 3BGOS 5LP6F 4K9SA 2RHDA 1NF9A 3BXZA 1HTWA 2NADA 2ZSKA 4ENTA 1WOMA 3FPKA 2HBQA 2H1SA 3BCFA 1JHZA 3KV3O 4DREA 4Q7LA 4M6WA 4ISCA 4JT8A 1OUMA 1OZAA 3OM0A 2DUMA 4BECA 2BTEA 2B83A 4CCYA 2OCBA 4MHSA 5KHLB 2OHGA 5CGQB 2ATCA 5C3MA 1L5HB 5M3BA 1AZTA 1GG2A 1EFLA 2PO7A 3IQEA 4QXRA 4WNYA 3IESA 4RELA 1CERA 1RAEA 2WPNA 1E0AA 2RK6A 1WEHA 5I4CA 1TCAA 4BE9A 1ODKA 3CISA 4KIFA 4AZ3A 4OHBA 4MDFA 3O1JC 3OE7A 4XYEA 4TOIA 3WGNA 3C6XA 1UKBA 4X06A 1J9EA 1SKAA 5JATA 3HG7A 2YQ4A 3L92A 3CX3A 3A35A 5B2EA 2DHDA 4KDEA 5FPTA 1UFKA 5LQNA 2Q6VA 1FXWA 3I52A 5D2CA 1Y89A 1VPLA 1E7WA 3FCAA 3GRFA 4PICA 1AQ6A 4BVBA 1DO0A 1LVHA 2ZBGA 2L18A 3UK6A 4I36A 3W77A 1ZK3A 1L7PA 1P4MA 1F0NA 3JQ8A 3T3NA 1PZNA 3STYA 2NG1A 5HHTA 3SZ3A 3V7WA 3W5UA 3P0FA 2F9LA 4DB2A 3LF2A 4FZJA 1UMCB 2CVOA 4RZIA 2G9QA 3EC7A 5FUXA 4FBGA 4RK4A 1NI4B 5A4IS 3PI6A 3TECE 2W7TA 2WJ3A 3JYQA 5LQDA 2P35A 1QU3A 4OQYA 3LPCA 1QE0A 1VBNA 3LYUA 1E2BA 1DTWA 1TA9A 2Q3EA 2AF4C 3EIOA 3I34X 4PYLA 4P83A 5B2ZA 5B3AA 4CG1A 2VBUA 1ZRSA 2QSUA 4ZI7A 3RQSA 3REFA 2EP8A 2VPZA 3OTWA 3IALA 3TLMA 3WMXA 1KMHA 4R5MA 4RTOA 4RDKA 1KYTA 2XMGA 1DRUA 1ZJZA 1LX6A 4HE5A 1D1SA 2JGNA 2E49A 4LOJA 4ZZ3A 4NG5A 3ODPA 3I0NA 1OR8A 4Q66C 2IYTA 3I62A 3SM9A 1E9RA 3RHFA 1U63A 1Y9EA 1PDOA 1ADBA 1TA0A 3RRYA 1P33A 1SC4A 4JLUA 1OBCA 3BMQA 4DYDA 4PFQA 3FYUB 2JFZA 3C45A 2NXNA 1AIPA 1Y8RA 4O02B 1U2DA 2YZNA 4FCWA 4TT3D 5SV2A 4CNQA 5KU1A 5DHPA 1K98A 3WYDA 4BJ3A 1Q95A 4F1WA 1AUQA 2IF0A 1NU6A 5JNLA 1T6BY 5IMBA 5CD1A 1SZCA 3NH9A 1NTOA 4HUJA 3ZGNA 5INTA 2GCGA 1J9ZA 1KI1A 3INTA 4M9CA 1GTRA 3OECA 1ES9A 4Q3DA 5AI6A 1BCSB 2VPPA 3G6KA 4J0KA 3TTSA 4N76A 3BFPA 1PHRA 1F2TA 2XQFA 1DGQA 1HI9A 4Z4SA 1RZRD 1P5FA 3LPMA 3MTQA 4YRRA 5JYDA 1QYRA 4GBGA 2BHNA 2CDNA 3SIXA 1M2VA 1CJKC 1PEDA 3CE9A 3F8WA 1G5HA 2ID9A 1XZBA 3BCUA 1GTSA 1VL5A 3WQSB 4ZT7A 3W2HA 1RWPA 3M3DA 3TW4A 3ZGOA 4EKEA 2WHYA 5CDTA 3REOA 1EIWA 5E38A 1ZVJA 2FSFA 1C9DB 4JLDA 4QNNA 4BO2A 2ZIEA 2NSYA 1PGNA 1GV1A 2OSVA 2PHZA 2XE6A 3AR2A 4HDRA 4HNAB 4IEFB 4W1SA 3K20A 4R4JA 1WZUA 3SNKA 3C98A 2HMAA 5B30A 5K4HA 3PLNA 3HP7A 621PA 3DBHB 1IHDA 1U5BA 3AY0A 3COSA 1YU6A 2NTJA 5EPOA 1CPYA 2WE7A 3LQFA 5ECYA 2V7WA 2FN7A 1WSRA 1E3IA 5CUQA 4M1OA 4AJEA 1YFLA 1SUWA 2G4VA 4YEJA 2KS6A 1DLIA 2IWHA 4A82A 1JPNA 2HMVA 5C5EA 5K5EA 1DFHA 2YJ3A 4K88A 1ZI8A 3D8RA 1T9CA 3L0DA 3VU0A 2AN4A 5EMHA 3HLYA 1TZCA 1B8VA 4WXYB 3OQMA 1RCUA 1ZJ5A 3O8BA 4AS1A 2ZW9A 1RWMA 1NRXA 1YA8A 2HM7A 3DD5A 3MXTA 5TMEA 3RVQA 5JEDA 3HA7A 2DR0A 1T2CA 2GPSA 4WADA 4DWOA 3YASA 2HWKA 1YWGO 1R9GA 1PK8A 4ARZB 1QE5A 1HC7A 4X63A 5FOWA 3E0QA 5LUBA 2C4VA 4P5EA 1JL3A 2E3JA 3BH6A 5UKDA 2HU7A 1QRAA 1QCYA 1YDMA 3ACBA 3HCPA 7REQA 4CM7A 4BZWA 5C8DA 3GRVA 2KBEA 3LOPA 3N2IA 4UHHA 1XEXB 2R9VA 1QG4A 1PK9A 3UXHA 4CETA 4IHJF 1HXHA 4CCAA 2HDNB 1X8XA 1SK9A 2Z9DA 3I2JA 1NFQA 1ZDMA 4K03A 2PIAA 4UDOA 1E3EA 2HMWA 3U7IA 5CNMA 3DHVA 4IHAA 4D8YA 4NBSA 5HJ7A 1GZ3A 4PNZA 1IBLB 2I7XA 2FPKA 4MGKR 5AHOA 4CEJB 5I9SA 1MLDA 3E84A 3VKWA 1EP2B 4ZT2A 1YBFA 2HHLA 1SHJA 2JAWA 3R8FA 4A03A 2O5CA 3NUQA 1AKUA 4LHSA 4XRRA 4RCYA 3KJHA 4QKQA 3EZXA 4I5DA 4FK8A 5DK4A 3KSMA 3LQYA 4DA7A 4JJ7A 2OLKA 3UIEA 5E3JA 1C4KA 5ICMA 1CB7A 2BGRA 3CR7A 1YMVA 1E5QA 4Q34A 4DIBA 5FPYA 1C14A 1EFDN 2F9FA 5DM2A 1GSIA 2I34A 1TYZA 3OZBA 3FPCA 5JSUA 1QVWA 3X0DA 5H8WA 2Z4TA 3D7RA 4NZPA 5ADWA 3QXXA 4FB4A 1KDRA 1C0PA 4IDQA 2ID8A 2VRWA 3FCEA 3FPEA 3ITKA 2MSKA 2ODQA 1H2HA 3GMTA 4JGBA 4ZXFA 3ZK9A 1WUKS 4Z9YA 4ZO7A 1JA0A 4C6TB 3SJZA 3MJFA 3D4OA 4MPDA 3G7SA 4PGAA 2E4AA 3UGTA 4YACA 4W1PA 4LW8A 4Q1FA 2BW0A 3R4VA 4C0XA 2X5OA 3JQBC 4P5DA 5B2FA 4Y9TA 3TN7A 1XDSA 4Y2TA 1ODTC 3KZMA 4O4IB 4KREA 4HFNA 3UJ9A 2V74B 4X6XA 5KBYA 3SMQA 1KK1A 3BFVA 3LBHA 3RYFA 2WJGA 1WA5A 3KQVA 4CKEB 3DKVA 3HBLA 2P2GA 3QQ5A 4G63A 3HJUA 3HZRA 4I1VA 4KQIA 4X85A 4GPBA 2NU6B 4TSFA 1VQPB 1W8IA 3FHLA 4CMIA 4ZQEA 5TNXA 4N0PA 3MAGA 4ZODA 3ZHTA 3NHAA 1QP0A 3PL1A 2QQEA 4IKEA 1Z4IA 1GUAA 3QH4A 1KO1A 3JX9A 2JLBA 3T9CA 2YNMC 2RHOA 4HAVA 1SKQA 4IICA 4BWVA 4ZDIA 1T1EA 2EBHX 2WQZA 3NOVA 4B47A 3HCEA 3GIRA 5EUBA 4A0RA 4HLUC 1XMQB 5AI0A 4ZI3A 7MHTA 1NB0A 1IN6A 4AC9A 3GGOA 5TB5A 1X15A 4IO0A 2QUJA 1DC6A 1KAMA 3LY7A 1ZZGA 3KZ1E 3IVXA 1F4VA 2VNIA 1TT5B 1OAOC 3D4LA 5BQPA 5EC8A 4BFTA 1WG8A 2HEGA 3EF3A 3FNHA 4ZANA 5BRNA 1G3UA 3OA0A 4DR5B 3ZD6A 4CT0A 4QVKA 1SIOA 3HL0A 5KQPA 2Q7OE 2VUIB 4HPJB 4KU4A 1MAHA 3UY4A 4PSKA 3JZAA 5I9TA 5J47A 2WWXA 2AC7A 2ZJ0A 1CZRA 3QEMB 3RBVA 3OM9A 1DEKA 4Y6SA 3EXHC 4EQ6A 1QF6A 1L6IA 4MV3A 1PJ4A 1M72A 1EG7A 3ER6A 4FC6A 4UHJA 4WL0A 1P5RA 2ZJAA 5TE9A 2QBYB 4OX9Y 4B3DA 4C3OB 1RLJA 1YE3A 4QYWA 2BBTA 3BJEA 5D5PA 5BW5A 4FE7A 4Q4CA 2RDMA 3I6ZA 5JVDA 4R84A 4UXHA 3FSGA 2Z1MA 2CFIA 1J22A 1RFLA 2PKXA 2R97A 3H1AA 3LH5A 3MTBA 4IGKA 4QWWA 4C4TA 1MB0A 1U80A 4H9GA 4D5EA 2O8DB 4AICA 2XWBF 4GBMA 4ENPA 3FAKA 5E9JA 3X3HA 3OJCA 4DUYB 3MTEA 1KZLA 2A33A 1D8TA 3H9CA 4JLPA 2YZ2A 3IT0A 3C74A 4L27A 1NP7A 1EFTA 1KQSB 1A72A 2VPQA 4LHVA 1UC5B 4DS3A 3ZDCA 4O4JF 2PCLA 3NS7A 3UYLA 5IMSA 3GJZA 5EMJA 3RIEA 4G5XA 4TVSA 1I7SB 3A2NA 1D8AA 3AH8A 3HXTA 1SKBA 3LUJA 1UJCA 1XYYA 1UF9A 4GMFA 4JB0A 5BXQC 2NGRA 4HB3A 4Z4FA 4MAFA 4OHZA 4W82A 2HW8A 3FLAA 1E5XA 5GM1A 2IY9A 5F1PA 2IS2A 3RYIB 5G0WA 4HNAA 4TTJA 3RSSA 4EUKA 1YBMA 2EOAA 1U0GA 3CVUA 2PLNA 3GR6A 3GLQA 4KYIB 4MMZB 2AA3A 1B74A 1N1GA 2P0EA 1P3DA 1MIOB 1YC5A 1N07A 2A4KA 2H00A 4EJSA 1W9XA 3WYCA 1VQMB 1JR4A 1T13A 3ZZUA 2IEBA 3B48A 2Q7DA 1BXRA 3LBAA 2ZZEA 1GN9A 3C3YA 4KQGA 1NW6A 1NR7A 1M8PA 1VJ0A 2NXWA 5C3UA 4ZYXA 1YJAA 4OGKA 2HMSA 5C35A 5FIUA 1OZHA 3KWFA 4RGYA 4YRAA 3HQ4O 3OESA 1B6RA 3VTAA 4JT2A 3F7TA 1YC2A 1X1QA 4F3CA 3OHPA 1W4ZA 3B51X 4L9RA 4WESA 3FDZB 4WV3A 3Q41A 1U65A 4JXZA 3AVYA 1P45A 1EDZA 1U6JA 2GPAA 4LE2A 4HOYA 1SVLA 4I99A 1E9VA 2ZEJA 4ZT3A 5FQNA 2XMPA 2HU8A 2Y0CA 3FR7A 3HYLA 4XVQA 5IK2D 2VNAA 1KZ1A 2XUQA 4MW1A 3LV8A 4WESB 2NYAA 3HJNA 1N0VC 1KJNA 1W1UA 2NQ2C 5I7SA 1OKKD 4NZMA 1WB9A 4QLAA 2BTOA 1S4QA 4HMOA 5F33A 3DHYA 5CRIA 3K0CC 5IT9A 3WWDA 2Z43A 4OD0A 2ZYVX 1NVWQ 3DMYA 3ELWA 5BN4A 1ABEA 4UBOA 3K0KA 5AKXA 4F2DA 3URKA 3LQQA 4AUKA 3UJ8A 1OFHA 3OX1A 3PPIA 5AK0A 1TPZA 4J0HA 2XI4A 3TLJA 3RROA 2WABA 3QNWA 1F3LA 4A27A 4JOSA 4OH1A 3ZCUA 1MB3A 2P4QA 2A7XA 2OHXA 1E7YA 1QK3A 1IPFA 4X7EA 2HFKA 4KDCA 4UFNA 1XPOA 1UEJA 3A4LA 3ZK7A 2IUTA 1GFWA 3NANA 4HEHA 1VJ5A 4ZPXA 3QITA 3C7DB 4XQFA 1II8A 1X1AA 2IHBA 2JLRA 3NHJA 1UBUS 2GFQA 2QN1A 3T3DA 5FA8A 4X62B 3K0SA 2P11A 4DR3B 1MG5A 3L41A 4E6PA 3FYUC 1GTG1 4CKXA 5KOIA 1OYWA 2WIJA 5LZ7A 3L7IA 3GY0A 2ZWVA 3PPYA 5KYWB 1NN0A 2HBZA 3WJ7A 2W37A 3O4IA 3ZX4A 4PX2A 4BS9A 3ADOA 3LWDA 5P8WA 3PHLA 2EWWA 2X0FA 4DW8A 5JNTA 4WCDA 4WRRA 1TEZA 2VHXA 5ESWA 5DIZA 3USCS 2IUYA 2WIBA 4YFYA 4YV1A 2V8BA 3GCXA 2G17A 5E6RA 3F2VA 4E51A 4NYIR 3GVLA 1OFUA 3QKSA 3AHFA 3LSTA 1D5WA 4L4RA 2C04A 2NNWB 2AK2A 4ZYUA 5F2NA 1XNJA 2ZS9A 5E4JA 4JV5B 2CDCA 2XBUA 4RD0A 2QEXB 1YZUA 2BR5A 4J16C 3ZHYA 2B5OA 5JFOA 4KH0A 4A1OA 2B82A 1H3NA 1Z4QA 2GOYA 1AVTA 3DMPA 4UM5A 4D9NA 3T9AA 2IXBA 4V0ME 3U7JA 1TA4A 1XAJA 4ZTBA 4BZQA 2BPOA 1NX9A 1T5TA 5CFLA 1JFFB 2PUGA 2A14A 3ENZA 2OPBA 4IJVA 4J0CA 4PHGA 1U3UA 3HKDB 2V4MA 3CNNA 4GX1A 1KZYC 1C1XA 1Q44A 1DEHA 4I5IA 5B4TA 3AUXA 2VG8A 2F67A 4PFKA 5FT9A 4EJ2A 1ZD4A 3FYUA 4LI3X 4JODA 1R4MA 3BDAA 3VSDA 2VUUA 1BTOA 2WWHA 4IX9A 5HDBB 3V1MA 3D9QX 3R6WA 4CIWA 3HJBA 2BZSA 1EX6A 2GETA 4M9ZA 5A05A 1H0RA 2HR1A 3VOBA 1YHZA 1OX6A 1WBJB 3D02A 4G6IA 1RC0A 3EARA 3A4VA 3RSLA 3UT5B 1WB4A 1ORTA 4NYJR 2CHFA 1G3IA 3HBFA 1PR9A 1J7KA 2J1LA 5KNCD 3FCYA 4RVOA 3Q0EA 5JAHA 1ESDA 3LX8A 1JGTA 2FWJA 5EEHA 1Z8DA 4UTXA 3VPGA 5A3QA 3GVHA 3LAWA 5C1PA 1H94A 5CFRA 5CYPA 3UB2A 2PLRA 3MGCA 2Z2KA 5IVKA 5JPDA 2VCYA 4UDNA 3ZWBA 2C4TA 1O97D 2OV3A 2V7QA 1PZGA 1ZD5A 3JAMA 3HVRA 1OLUA 1NVFA 2FJUA 2ZIUB 1JVSA 1JBQA 2D0PB 5K9ZA 3L7AA 3TLCA 3NBUA 4WK2B 4ALLA 2PGLA 2NX2A 3C3EA 4J1QA 4X1IB 5J5AA 4LFCB 1ZKDA 3V8PA 1A9XA 1QB7A 4I08A 1J06A 2AFRA 4UUBA 1XBTA 3U5ZB 5BVGB 3E1YE 3S81A 2O1WA 3GD5A 3R7FA 4QFDA 1N6PA 1BU8A 1HQDA 5AHRA 3STVA 1XTRA 5LIPA 2JB9A 4QOEA 4ML3A 4DQXA 2AR7A 5CPFA 3H1BA 4TYWA 3IUJA 3O8QB 1B6GA 4J2OA 2PGJA 5A8AA 3BN3A 5DI3B 1VLHA 2PT5A 4F2GA 4ZARA 3D7LA 1OKKA 2Y9PB 4GQNA 3N8HA 2ZYUX 3KHUA 4MB2A 1A8IA 5GWXA 1ODCA 3FCSB 2WZPP 1TF7A 1BXRB 3NHRA 3AUAA 3NNDA 2NO1A 3PC8A 4WBNB 5E0KB 3GJYA 2XHEA 2B69A 1NVVQ 3ETHA 1U1GA 2FHPA 3TTXA 5J4HA 4DNFA 4HGZA 3OJ0A 3S7TA 2QRVB 1C41A 5EZYA 1Y81A 3KXLA 4COKA 1ULTA 2BR4A 3T3OA 3RUDA 1VCNA 3FDZA 3OP4A 4N3AA 2ORYA 2OP0A 4BU1A 1YQUA 3IR6A 4HFRA 1IJKA 4BJ6A 1BDBA 2J3JA 4ZGGA 1MPXA 3IMEA 3Q15C 3D0KA 1Y3AA 1PJ3A 2FDXA 1KQNA 5K20A 3T1YB 2OO5A 2GWHA 4KHZA 2NQTA 3VR4A 1JILA 3DTNA 4L0DA 1A1SA 3TVTA 1NY5A 1L8QA 3SXUA 1SXJB 4IILA 1OCEA 3L7YA 5IC5A 4PNHA 1TJ3A 1DE0A 2G1UA 4ITUA 4O4LB 5ITVA 1O9GA 1QTQA 3BHJA 4MZDA 2BC9A 2Z6UA 4YBRA 4BB9A 1N5IA 3RABA 2DWOA 4PM4A 3ZU3A 4HPXB 1JQBA 4WA7A 4S04A 3CCEB 4GKAA 1DQPA 1QHNA 2C83A 4CM4A 2QVZX 1IOWA 3ESQA 1TTPB 4DUGD 4DSZA 5BVHB 3PPVA 4WBNF 3VJMA 4EWLA 1SOMA 3D1VA 4GGPA 4DFDA 3O2SB 5AK6A 3OPOA 1EU1A 2IBTA 1RRGA 2M6SA 4MKFA 1BCRA 3D8TA 2ZJBA 3VBEA 3AONB 1QP8A 3WHIA 1XD8A 4MMXB 2FUEA 2HV9A 4DMLA 2VRCA 3KV1A 1RQXA 3GDHA 1BMDA 1SUPA 2PSSA 3HHEA 3FMPB 3DYBA 4R3UC 5KQSA 2IPOA 3ROMA 3OICA 4KL8S 1Q57A 1K7YA 1OB5A 1P9LA 1J25A 3GVJA 4X7FA 1RABA 1XZJA 2YS6A 3MS2A 2JEOA 4A1FA 2CFOA 4BUCA 2I4OA 2CB9A 2IQ5A 2GEBA 4XR6A 3FSGD 4IH1A 1RPTA 1G2OA 2WMOB 4KVGA 1UJ4A 3BMOB 3P19A 3DAHA 4HI0E 5F2EA 3ZD8A 1GCIA 3BBPA 5D51S 2JCBA 1N6RA 4DZRA 1NI5A 4G9EA 4LRYA 1FYDA 1P7CA 2EG9A 2AMJA 1VJ1A 3N2GB 5CEJA 5J4VA 4QXMA 1MQAA 1U0TA 3WADA 1GLVA 4GC5A 3BMOA 4BEJA 2V7QD 4LN1A 2J59A 3T7EA 2ZSDA 5T7BA 1ZMOA 4JDPA 5IVIA 2GREA 4FHEA 4IWYA 4NF2A 5C4GB 3S5UA 3EZ9A 3LJKA 3LT0A 2V6JA 4LNHA 1X7XA 1NVMB 4UAGA 3HBJA 5EAIA 3V55A 4C6HA 4A5SA 4CPDA 5KYKA 3ZY2A 9LDBA 5A6SA 5J5CA 5EI5A 1VQ1A 3Q9UA 3FWHA 1C3VA 1QYXA 1F0KA 1I2BA 2RGNA 2R7AA 4FT2A 4KLZA 1UFVA 4A2WA 4B7AA 2C5BA 7YASA 1JDNA 4J29A 2JJ2A 3Q40A 3DLCA 2NVWA 1GO2A 3O3OB 4WZAE 4Z4UA 1SU7A 1UD8A 1ETHA 3W4JA 1KQGA 1GZUA 4AJPA 1X70A 4G5RA 1X2EA 5I7AA 2HUNA 1NNEA 4C7KA 1K08A 4E1VA 4W9NC 4BFZA 3W5IA 1ST3A 5K0BA 2Q1XA 3VPDA 4CYMA 1ZGZA 5B7GA 3SR3A 2YHUA 4RPBA 1WCYA 3UO8B 5AKZA 2C07A 3FVQA 3W5HA 3TG8A 1T0JB 1TF5A 1RHJA 2HXGA 2DTXA 1I14A 2J08A 4IRMA 3VYVA 1KS9A 3EVDA 4MX8A 1YACA 3NTXA 5ALNA 4Z5XA 5KHOC 1BFDA 1K8RA 4ZHQF 1EXMA 1A7AA 3BL5A 4HYEA 3ZXYA 4BLPA 4CRWB 5AW8A 3ITDA 3ZI4A 3ZW8A 3FJYA 1Y3FE 2VH1A 3GMDA 2RONA 1YK0A 4I3GA 1N6OA 3DXXA 2VNJA 1NRJB 1W1WA 1T6ZA 2F3QA 2P3OA 1Z0JA 3C8MA 4M7PA 2AOTB 3LT5A 3WP1B 3WTBA 1AV6A 1K7XB 3I37X 3GDWA 5GM2A 5LCXA 2O8DA 1D2AA 3K53A 4JXJA 1U2GC 2ODNA 4JBLA 1SCBA 2PBLA 1BNCA 4FMCB 1C3JA 3W2TA 4GWLA 2YDYA 1PWEA 3BM5A 4NS1A 3FW1A 3UK1A 4JY7A 4LX0A 1H6CA 1CW2B 2WPDA 2QLTA 3GAFA 2DERA 4L5JA 1BJRE 1JLHA 1XA0A 1NMXA 1TYEB 4ON9A 1A9XB 5ESDA 5BR4A 2RGGA 5I7HA 3TSOA 1G8MA 2CVPA 3ECAA 4FMDB 4NJOA 4O6VA 5L8VA 5A5GA 1JU3A 2XD9A 1GR0A 4EGAA 3FHJA 3DKRA 3EW7A 1GTMA 1D9XA 4NHOA 1J70A 4HX5A 3IEMA 3FTFA 3NONA 3A3GA 2XTJA 1Y6FA 1AS0A 2O3RA 4FEAA 3C8ZA 3N8KA 3O8QA 3ETCA 1Y5NA 4BMNA 3HCOA 4N8SA 5EMNA 4TZTA 4O3FA 4MSUA 2VHTA 2E2WA 3DE7X 5EP1A 2RG7A 3U39A 1ZO8A 1O94C 2XZPA 3BMQB 3GNTA 1R50A 1OJ7A 1UJ5A 1T5HX 2B0JA 1ULZA 1UM9A 2FW6A 4ND1A 3VHXB 3ZI0A 5KTRA 5ELXA 2XR1A 1IHMA 2C59A 4RD2A 3AJDA 1KMMA 3BC1A 3ETLA 3IEKA 3OFVA 3ZTYA 3G0CA 1QVFB 1CG6A 1LB1B 1FK8A 1RW4A 3ABZA 2H2FA 3QPWA 1QVZA 4JR1A 4LSGA 5IVHA 2DUUA 5AXDA 2C4NA 3MUOA 2OCPA 4NX2A 4XWWA 2BEJA 4MUNA 2A6PA 3JARB 4QJ5A 4ZOLB 2C7OA 1KEPA 4M2LA 1OV4A 1PKEA 3SKBA 2CF4A 2IC5A 4AY5A 4HIZA 4CGYA 1CJCA 5FO0A 4BQIA 3S1AB 5A71A 2E4XA 1J1IA 2H4JA 1Z8HA 2AMFA 4JBHA 4OPVA 4EAQA 3H84A 1ZH4A 2A3RA 4OBWA 2GEFA 4J9UE 5ICSA 1FZTA 2GEKA 1ZRMA 2YWRA 3GNSA 1PJ6A 3AB7A 1ABFA 1I1HA 5M34A 3PQ2A 1Z0IA 1VLZA 2VT6A 3IMCA 4X7PA 3K9BA 4H7IA 3QHAA 3ES9A 2M6KA 1CWUA 4EYOA 3RSFA 2JGJA 5IF9A 1U0LA 3FVRA 3EGEA 4MR7B 3IVRA 3OKPA 1M2KA 5CR9A 2ZZMA 3LX5A 3COYA 4JT4A 3V1TC 3SC4A 5FKJA 1VA5A 3RT1A 4R8MA 1E20A 3ZQUA 5F23A 4G5OA 3HYSA 2GFHA 4QU9A 3RIMA 5FPQA 1E5DA 1IY2A 1A7KA 4TLAA 4ALNA 4M9SA 1VQ5B 3GRKA 4HB4A 4GICA 3VKHA 1SCQA 5JASA 1CTQA 1G0OA 1WXFA 2QTCA 2XMCA 5ABPA 1FP2A 3HXQA 3SSOA 4L4XA 4ZVSA 4FGJA 3CRQA 2I7CA 2XZTA 1RAAA 3JPWA 1NVDA 3E7DA 2CLCX 3EGCA 1VL6A 1M8GA 2ZS7A 4OUKX 3C3WA 5JDIC 4QTXA 2IYLD 1B8OA 4TYQA 2WHPB 2V0GA 4Q05A 1T0BA 4D99A 1YZKA 2I2BA 3C7AA 1IE3A 2I1QA 3I6MA 3RSHA 4DJ5X 4UNIA 1OY1A 2YXBA 3S0JA 5IANA 2W5UA 4KNYA 5DWQA 3GZJA 3IQWA 5I45A 4PFSA 4RU1A 2IVFA 5FR2A 1OI4A 1RZ3A 1E62A 1DCKA 1SIUA 4ERNA 2UXDB 1YHYA 2RKOA 4EG6A 2P91A 1LLFA 4O4JB 1I7LA 4KQJA 1NWHA 3SNHA 4G2NA 5BN1A 5KSPA 1T25A 1CUGA 4M0UA 1YE5A 3LLMA 2PLWA 3U5TA 2AEFA 1RQRA 1OXTA 2ZJOA 3K9GA 3KCQA 3PG5A 4DUPA 3NBKA 1MNAA 1ZOIA 4R2JA 1CUXA 1Y6ZA 4L3VA 4RNDB 2BFWA 1GT6A 3DQPA 3QKSB 4OHVA 1HZEA 1LPOA 4PZUA 4TV8A 1LPAB 1P75A 4ZO9A 5B37A 4B4KA 2J0QA 3VKGA 1E2NA 4KR0A 1DX6A 3HXLA 4NS4A 5C8ZA 4GMHA 2IHYA 2ZS8A 5CDHA 4PC3A 3M81A 5JC8A 2Y0DA 1H5NA 5JLAA 1GGKA 3WKAA 2FMUA 1K8QA 4BLQA 3WB2A 3NAMA 1ZK4A 4X9XA 3WYNA 2FPRA 1FMJA 1L1FA 2X8JA 1E3WB 3KT8A 4HBZA 2B5VA 3SHOA 1IQUA 4A10A 3GVKA 4MUEA 1O6FA 4QT4A 1XVAA 2CK3D 1ECFA 1Q77A 2OM6A 2W2LA 2XLCA 3I0MA 4ZI7B 2VI5A 1HDOA 2GPYA 2R6GA 3NWBA 3PB3A 2QXUA 2LKCA 4AXXA 2HJRA 3RAFC 2FWPA 1OLXB 4FMBB 1I1NA 3OO0A 2I03A 4YPVA 5BNFA 1VYUA 4PR3A 1K0UA 4WI1A 3SU8A 4E1AA 3U4MA 4OHPA 2HQBA 3CLSC 4HNRA 5COBA 1U2QA 2ZP1A 4LDPA 1K06A 4R5HA 3S28A 3T7SA 1VBKA 5IXYA 4E5UA 1MX9A 3ZIAA 2P6NA 4N5NA 4W7IA 5TY0A 1AN9A 3IOBA 4NYIQ 3QF4A 1KC1A 3PVDA 3Q5DA 3QU4A 4FIZA 1RKXA 4UC0A 5EQJB 5JXGA 1FYEA 5HJ2A 3QQPA 3B20A 3SCZA 4CIBA 5IUJC 1W2HA 4AY2A 1P2FA 2NPOA 4QATA 3C3JA 4X71A 1GAXA 1YASA 4JC5A 3RTEA 4QASA 4R0NA 1YA6A 1O96A 1U1EA 2CFRA 2P75A 4O1HA 4ZDWA 4Z53A 4IX1A 5KJFA 3WFZA 2I76A 3WGVA 4JCOA 3D4IA 3EIFA 1Q0SA 1Y6RA 2EBWA 1Q22A 3S1SA 1CQJA 4OKSA 3VX3A 1V0EA 1I4OA 2LIPA 1MV8A 2WJHA 4FFDA 1CUZA 4NZOA 3VPXA 4NR0A 1NBEA 2ZPTX 3EQZA 3CW2A 1VHJA 4HF7A 1OLSA 5GJWC 3W4IA 3DFFA 2DVMA 3ONYA 4DPMA 1QS0B 2XUHA 3D6UA 2QSZA 3JTMA 3AUYA 1QIDA 4FSHA 3TZ6A 3N7AA 1E79A 5TV2A 2FY8A 4GC9A 2WHXA 3BE8A 1Q86D 4RPHA 2GESA 2WA1A 1FDUA 1HG0A 2Q9CA 3RBXA 3EULA 3SJCA 4J91A 2AFHE 1C2TA 2A94A 3QVMA 1GKIA 2GYYA 2QRGA 4M1MA 4BQPA 4Q48A 4M1YA 1XU9A 1MIOA 2PFKA 2QW0X 3NLLA 1CUJA 4PSAA 4R01A 3U56A 4QL3A 4RMHA 1QHEA 4MPTA 4F38A 3AOGA 1XYGA 4Q7QA 1E1RD 3W5CA 1GGJA 3W5AA 2Y1CA 4AAYA 3TLZA 3NI2A 3JYHA 2GN8A 3CE6A 1K4MA 4KLNA 1KOGA 5TR9A 2ZUVA 1HDRA 4I3HA 1G0NA 3KE8A 16PKA 2QWXA 3FETA 2CCKA 3RFUA 2ZYIA 1FUEA 5K3SA 4RA9A 4A0HA 3HUFA 5DN6D 4B81A 2CWDA 1DIAA 4NYMQ 2DAPA 4P4TA 1GDDA 2O8CB 4DCOA 1VIMA 5CCEA 5GONA 1CDEA 3DEZA 1HTTA 4X8OA 4F6RB 1AK2A 5IKPA 3I83A 3RSQA 1Q1BA 1V8OA 3LXXA 5FTNA 4PF1A 4ATNA 4HWTA 1GEGA 1L7MA 4CTJA 4IDOA 7ADHA 5IT4A 2VDPB 4NE9A 3LWBA 4IINA 4LV5B 1GKUB 4IQ0A 3OZFA 4ZEXA 1L5OA 4GM1A 3PEWA 2ZJ8A 1JQAA 1NLYA 4RHXA 5B58T 2HMTA 1NN1A 4M8NE 3NHFA 3TKAA 1IBSA 1HOXA 1C3LA 3ZU4A 4CT5A 4X1OA 3GUVA 5KNLA 5A2GA 3EXFB 1MO5A 4E5PA 2J9ZB 4BFXA 2PYZA 3THOA 1MGPA 3K5PA 4REQA 4TTSA 3TIGA 1EUDA 1PU2A 5B1YA 4FNGA 2I78A 5D00A 4D9KA 2IVZA 2QVYX 3QYJA 4Y0VA 3KPUA 3T8YA 3WA7A 4D4KA 4WJKB 4WTOA 3WIDA 2A1IA 3KQQA 1BROA 2VJJA 1Z2AA 4RHTA 4D79A 5L3SA 3L04A 5BO5A 4HZUB 3VO2A 2QTLA 5KSZA 1ND6A 4BDTA 4Z4ZA 4PQFA 2ZXFA 1RLIA 4P12A 4PN7A 4ARCA 4RD3A 1O8CA 2J6CA 2YL2A 4N0MA 5CD9A 4QTTB 2RGEA 1CUDA 1UXHA 3FNRA 4G25A 2QP4A 4RVUA 1GPKA 2H6EA 3EYWA 2XRFA 3EGXA 1HVXA 3LQRA 5TRDA 3MTGA 3NIWA 3IULA 5FLKA 1ADCA 1OBHA 2NACA 2B2NA 3CLHA 2VBVA 1C9KA 4PONA 5AJVB 1T29A 3UJDA 3HK2A 1ZD3A 4ZQBA 4CEIB 1Z5NA 2PDAA 3K8YA 3ASSA 3ZVRA 2ILVA 3RW9A 1K6JA 1P4GA 1UC9A 1HT2E 2AFIE 5K6AC 3UF0A 1TMYA 4D42A 3O4GA 1KOJA 3HSSA 5J59A 4UZEA 4IJUA 4B71A 3M34A 2AJLI 2F4VB 3PITA 5KQMA 4WFIA 3ROKA 2AWOA 3KTAA 1DIOB 1XPJA 3ADKA 3E2PA 3BIJA 3OIWA 4MLCA 3O1IC 4QIHA 2QRUA 4GKKB 1L1QA 1OV6A 1ABBA 1Q7GA 2G5PA 4TROA 4BTLA 1WNTA 3KFXA 4HFJA 2Q4TA 5F9HA 1U0EA 1KEEB 1IBKB 1IIBA 4MEBA 5THXA 2QN9A 4C0KA 4UE2A 4Q9IA 5TMPA 1H9CA 4ZJUA 2WM2A 4ILEA 1PKXA 1JT9A 3AHCA 4C4RA 3P2EA 3JAWA 4B0OA 2G07A 3BB1A 1JXAA 4RMJA 1TQDA 2F1IA 3PC6A 4V39A 1UC4B 2HF2A 4Q3OA 2FFAA 4DLYA 3M6XA 4YV7A 1XD2A 4LJ9A 4XGQA 3QE3A 4S05A 3MERA 2HIHA 1TK9A 1XTZA 1DPFA 1H23A 3GDOA 1II8B 3II6X 2CLDX 4MO2A 4N5DA 2NU8A 3VUFA 5K8IA 3B8HA 1F7UA 4Y9DA 2J3DA 2ZSEA 3WLRA 4GRIA 3OY2A 4B6QA 1Y33E 5AW5A 2AV6A 1HZZA 4RDLA 2PXXA 3N0WA 4U6NA 4CKWB 1VKNA 3CSDA 2H4FA 4Z4QA 1LI7A 5IDVA 5CBPA 3GWZA 4Q1DA 1VKRA 1IXSB 5KCMA 3OZUA 1HWYA 3QX9A 4J9VA 4D6PA 2VP2A 3ED5A 3UC9A 5KYUA 5TS3A 3GQBA 2IOFA 2M2IA 4EF5A 1RVV1 4I66A 3TLXA 2VF8A 2GPNA 2DPHA 2ZRKA 5CNJA 3DZDA 4HTFB 1H6AA 4FZ5A 1OA1A 1T8WA 4HGNA 5HYVA 2RH9B 4IIUA 4OX9B 2UXCB 2J46A 1V25A 1P60A 4Z0HO 1POWA 3NHZA 3R24A 4M86A 5SYMA 1XKLA 2H2HA 2PZEA 3AKEA 3OTGA 1QWSA 5AI4A 3WMFA 4KR3A 1O4WA 3ER8A 2K2QB 4KSCA 3IFSA 2IEYA 5CM8B 1LPBB 1N1EA 4UDYX 2F64A 4BZZA 1L4NA 4EITA 3T99A 3VPBA 3U4HA 3CA8A 5EQFA 2GZSA 5G3ZA 4LV6A 4HMQA 3UA4A 4E21A 4DIEA 1X1CA 3N58A 2COKA 4QOGA 1JR3A 5T4BA 1HZJA 2LZ0A 3RF7A 4HNTA 3COVA 4Q3CA 2D1SA 2AJDA 1M1NA 3PL5A 2H7VA 3IUPA 1WUHS 1EE9A 4L5IA 4CKCB 4S1WA 4R8SA 1J8DA 4HSEA 4LYYA 3TXXA 5L3QB 2G72A 4MGYR 4MP3A 2V3CC 2D0IA 1CKEA 3BWXA 3DW1X 1KO4A 1M7HA 2R8EA 2EF1A 1G4HA 4U2FA 1NMQA 1PVOA 1JWAB 1WEKA 1YFZA 3KQKA 1JAYA 1DPGA 1XFAA 2IRWA 5BSWA 2FB9A 5KYYA 2Y0BA 3HCRA 3RBAA 3S29A 2E85A 4GEKA 4YHBA 5DPMA 2FDCA 4HRAA 4DR1B 4Q7KA 4QXPA 3TYXA 1IQRA 2FPOA 1MHTA 4X61A 5EY5B 2A3NA 4G2TA 2R96A 2X4DA 2QMEA 1UOOA 4X20B 3WGIA 2AE2A 5FEUA 3DULA 1WDKA 1CETA 4W8GA 4X1KB 4YJ3A 4ZU6X 1KDZA 3FNBA 3OWHA 4XLZA 3FTCA 4CFYA 7REQB 1AUXA 3ZQ6A 3EB9A 1A69A 4WX2B 3OQ1A 3WJ2A 2CXRA 4Y2SA 2ZCJA 2WK1A 2ZBUA 1EWVA 3UWOA 3AZOA 1XNQB 4PCVA 4PABA 3THWB 1YDFA 2YVUA 1SEVA 2W2MA 3QEAZ 5K0SA 2BDUA 3NBQA 4B9EA 5AJWA 1NVGA 1W34A 1FU4A 4D9FA 2FUCA 1RBMA 2LDBA 4F91B 2XCRB 1ZQ1A 4CMGA 2Y93A 4KI7A 4PRZA 1RWQA 5I4BA 5JS2A 1PWYE 5ILOA 3C6QA 1XHEA 1RLOA 1FXSA 1YB5A 1L8XA 3QY9A 1M8JA 3OQHA 2VF4X 3TQRA 3CZRA 3GRCA 4NBLA 1DTSA 5AXBA 2O8FA 3AETA 1JMKC 3FVTA 3K4PA 3ZNPA 4J76A 1SM4A 1JQLB 1RE0A 3GXBA 3KVVA 4LNAA 4XUGB 1QU2A 2QRNA 5C9ZA 4K46A 1KYVA 3IT1A 3WL4A 1NF2A 3HVUA 3K31A 3M89A 4FX2A 3E05A 2Z98A 2I65A 3I04M 3PNBA 1EHCA 1XF1A 4RD1A 2IYXA 6GPBA 2D1QA 3OVMA 1MVLA 4JJZA 2YX1A 1EBBA 3TL3A 2WB2A 2VZ0A 5CT8A 2G1KA 3A1DA 1E69A 2QMYA 3EXG2 1VE3A 2JJ8A 5FX2A 3MGKA 4X84A 1R6VA 1J7JA 3K0CA 5HZAA 4C3UA 3T7RA 1R0RE 4QBKA 2VL7A 3T5DA 1FYVA 1SVNA 1MQ9A 3G71B 2X8LA 4YXWA 4Y6QA 2QIPA 2C31A 3UB3A 4D0SA 4RTPA 4I4CA 3PF8A 4KGDA 4PFJA 3Q1KA 4PHCA 3C3PA 4RSRA 5A4DA 2DR3A 3OP1A 3EXAA 2HCJB 2D00A 4PAMA 4ZCSA 4TMWA 3TGWA 5BV2P 5HZMA 2BKAA 5COAA 2OUIA 1HFKA 3GEPA 5TMDA 4BNZA 2GXAA 3NV9A 4Q7MB 1EVIA 4LF7B 1CJBA 4FFRA 5DO9A 4AZ0B 4QODA 2GPJA 2R44A 4ZOLF 2RAFA 5HX7A 1JQKA 1E1CA 1H9AA 1KHHA 2WIFA 3WMWA 3ZCPA 4Z1MA 2E55A 4P3IA 4WLOA 5LQJA 4LDNA 2G1AA 3LRTA 2QUAA 3KK0A 3KPVA 4MPPA 3WVNA 1JZSA 2HXSA 1JFVA 4NBVA 1HA3A 4UXJA 4CW7A 2R8OA 3DGEC 2QNRA 2PXAA 2MSEB 1UH5A 3G0BA 1YBVA 3WTCA 4IV0A 3Q85A 1TYDE 1Z34A 5DBEX 1DQZA 2GEDA 1U8AA 1QIHA 1C0IA 3H5VA 1L5HA 6ADHA 2WT8A 1E2LA 2O6LA 4A8JA 1RLMA 3A7DA 5DXAA 5JD6A 4HDQB 2PFGA 1TYBE 1N8NA 4MPJA 4JVOA 1TW2A 2FWAA 2YRXA 1S3FA 2ZBFA 4MUGA 5H83A 1ATIA 4AT1A 2OBNA 1KI2A 2AFHA 1YS7A 4TQ9A 5HDQA 3U6KA 3DUFA 4ZZ0A 2ZANA 1IRXA 1K2WA 4ABYA 2VFAA 4A92A 1O54A 4C2AA 2J3LA 1LKZA 2Q5OA 4JP3A 2ZUSA 1N7GA 4K9QA 1FFBA 4PZDA 4MDHA 1QO0A 3H1GA 2FPPB 4N12A 3FDFA 4K6CA 3E9DA 1QH1B 4G9BA 1NFFA 3H13A 3KKNA 4RWEA 3O0DA 1UBSB 3GT3A 3G2IA 1MPTA 2Y1LA 2DQZA 3C43A 5A6SB 2I6SA 2O2DA 5GGYA 4LF4B 1E3ZA 2NZ2A 4XDYA 1BGVA 3V76A 1Q74A 4S35A 2GBLA 1NL3A 3DEYX 3HB5X 1E18A 3C2QA 3NP9A 4IDGA 1GAJA 5AOAA 5BSHA 5KYTA 2CMFA 4IH9A 1QS0A 2ZYAA 3R5XA 4LZAA 4QSHA 5EGSA 3O4VA 1K88A 1I7QB 4J43A 3AHJA 3DV0B 3ENVA 1XEFA 3CM0A 2CDRA 5I9LA 2JJ1A 4Z4WA 3I9FA 4LA4A 2XNSA 4IIVA 221PA 5C31A 3CURA 3PKIA 5BVGA 4L2IB 4RIHA 2QG9A 2BHRA 1Q11A 4EVQA 3IO3A 2J30A 4ITRC 2XXAB 3OHMA 3FD8A 1JF8A 2CJXA 2KW5A 5CBKA 1PR3A 3OT1B 3EOBI 3PKJA 3TLAA 4YHHB 2FOLA 2RH8A 3WYEA 1VQ7B 5J2UA 2CXOA 1LPPA 2BEUA 1GQ2A 4J0QA 2QTMA 4XM3A 4WZBB 1MEJA 2VZ9A 1JHYA 3ZDXB 5NLLA 3WAKA 4RY2A 4PG6A 4X7DA 3DLHA 1P1HA 5C8YA 1Q15A 2JHAA 1G8SA 5J5VA 2BYTA 2Q1YA 2KHZA 3TMAA 1GU0A 4FOTA 2B8NA 3I5UA 4BLRA 4F3TA 4PZPA 2A5GA 5KYXB 4I8IA 4NECA 5TC4A 1MH9A 1NVEA 4OO3A 2ENUA 5K1ZA 3FPBA 4E0BA 2QJRA 5IM4F 1C9NA 3V7YA 1SH7A 2IPXA 4C0BA 3RK4A 2OTCA 1MF7A 3R1IA 1FX0A 4PZYA 4TRJA 5HEKA 3NUGA 4MKRA 1P8JA 3CC8A 2O0KA 3OMXA 1RWVA 4JU8A 2EP7A 1FDWA 2P68A 4LMPA 5HR5A 2H4ZA 2P9ZA 4JUCA 1R6AA 1MOZA 4V38A 3QEMA 3UG7A 3NAGA 4CN9A 5B4UA 4RHEA 1XFDA 2J3IA 5KOHA 2ECQA 2CK3A 2QTRA 4X0CA 2R6HA 3MYRA 4LTMA 3UAZA 1PAUA 1OYYA 2CLSA 4WMLA 2IW1A 4OGFA 3MS4A 5HWSA 5ITZA 4NAHA 3GFFA 4CZ2A 3DBVO 1W4BA 2QKYA 3NNSA 1NASA 1K4KA 4RSMA 1H3EA 2HIAA 4D0NA 5JJIA 2ECKA 2JDIA 2SKCA 4PBRA 3GN1A 5IBRA 1XNRB 2JLUA 1GDHA 4EGFA 1FS6A 5LXTA 3CH4B 3GROA 1J0DA 4OJQA 3PCXA 3PC7A 3BJRA 2D54A 1EUCA 3QTBA 4LVOA 1QG6A 1J5XA 1Y37A 5JNUA 3AERA 1IHPA 2P6PA 1F6BA 1YB6A 4M7RA 4ACAA 1VL1A 3EGXB 1MG0A 4LXYA 5DLQC 3RYTC 1TYCA 4I1UA 3SS8A 4CR7A 4I1YA 1YULA 2OAEA 1PFWA 4QAJA 3RAPR 4HVTA 2XEDA 1E32A 2E5FA 2W22A 2PRZA 1TXGA 1KSJA 4YO8A 3KKLA 2B1IA 2G40A 1G5TA 1U0RA 1Z4KA 5AW9A 3RSZA 4DEXA 2EZ4A 4LFBB 1Y9ZA 5JZSA 2HYDA 2GLXA 5CIWA 5DW3A 3WQBA 4NICA 5JG7A 1GPNA 1QGED 1QPBA 5E6RB 1E6EA 1QANA 1ZKMA 2QRZA 3EODA 1VJRA 4FQ8A 4EG3A 2NP6A 4FSDA 1TO2E 2GM5A 2XJ4A 2TRSB 4GUAA 4DCUA 4NNJA 2OC4A 5AESA 5HQTA 1JHXA 3PNLA 2NTYC 4EO7A 4A2QA 4WY5A 1PTJC 3F6CA 3E3AA 5K3OA 2HJGA 1ZI9A 4IO1A 4W8OA 4BZXA 2C29D 3K09A 4HEA6 2X13A 2FZWA 1RYHA 4L0MA 3GOQA 1JKFA 2FN3A 4FYYA 1CLUA 2CMHA 3OFND 5HGJA 2GMWA 2PN1A 5AKYA 2NV4A 1U0JA 1HEIA 4LYFA 3LFTA 1U7XA 1M2FA 4GFDA 4XRGA 4MYRA 1H8HD 1RM0A 5AVKA 3D5TA 3B7PA 3LW7A 3VKUA 4GRAA 2C4MA 1X8LA 2XZDA 3GCWA 3C6KA 3F6EX 1QRUA 4PYJA 1Z2CA 5DNDA 2ANBA 4YECA 3MUFA 1BKDR 1AMNA 1TAQA 1WU7A 3M1LA 1KFKB 4EMSA 4OI0A 4Q3EA 2N75A 1F6WA 5IPFA 1R4MB 4V0NA 3K9QO 5BSFA 2OG2A 1USUA 2OHVA 2IA5A 2PRIA 2REXB 4MKGA 5T4HA 4BATA 4E6EA 4ZTUB 2QQ5A 4F12A 5K03A 1FDRA 1MORA 1P1KA 2H0QA 3AUJB 2XYPA 3F78A 1ADFA 3KXPA 4E2ZA 1XL1A 4A8TA 3R0QA 2QRJA 3BD6A 3WY9A 1GQYA 3DEIA 3DA8A 1D6MA 4OCZA 3WDMA 2CXUA 5BPHA 5JPCA 3UMGA 1DB3A 4HUQA 4Q3KA 3A1PA 3ZY5A 4WZEA 1F1BA 1XQYA 3S4YA 5IBCA 1I94B 4OXIA 1UWVA 4KIWA 1P1CA 3BORA 4M4SA 1XMOB 3DAGA 5BNWA 2WOOA 3DTTA 1QJCA 4IIJA 3DLAA 3GJ4A 4EW1A 2D6FA 1W9HA 4D6YA 4HADA 4KQ9A 2IK8A 2NTVA 4XX0A 2PGDA 3ZV5A 2VJYA 4C88A 5AVYA 2C03A 3B8EA 1KIMA 2PT6A 5FBVB 1KNQA 5K0LA 5IAOA 3IMGA 2P78A 4WZTA 1DG9A 3D6MA 4NDZA 3S99A 1PQWA 5HFJA 3L0IB 4M54A 2ZT7A 3DYVA 4UBKA 2WTEA 4ENSA 5ICCA 1AS3A 3QUBA 5AHWA 1R4AA 4KH1A 3ZGLA 1U90A 3IBTA 2IKQA 2WEKA 2XGSA 3F7OA 1WVMA 2GHIA 5I5GA 3DBLA 3IA7A 3CHYA 3CLRD 5AT1A 2HPZA 1WPGA 3BA6A 3DBOB 3EZ2A 3FYCA 4KNWA 2Y05A 4C04A 5FUQA 1PT5A 3FUVA 3NT4A 3TR0A 1PJTA 3RG2A 3JU3A 1Q20A 3G2KA 1NBMD 2WKSA 4BQQA 4CMBA 4DNRB 1ZUHA 4FIDA 4INJA 4P9NA 3TVYA 3JWJA 5FHRA 1XD9A 1NMZA 1S5PA 1ZC4A 1B14A 2NZWA 2PVCA 2Q9AA 2A59A 1TU4A 3HDGA 3QVGB 1I0IA 4KO3S 5A4KA 2JGFA 1Z6AA 2FX3A 2RIRA 3B1ZA 1FMLA 1Z6YA 4Q93A 1QRSA 4FBMA 4JOBA 1L5QA 3WGUA 1CUSA 2PUEA 1SHZA 3LHKA 5AKHA 4LZPA 5A7FA 1W76A 2WVHA 4F6RA 4XVCA 3FRHA 5EP4A 3C6MA 1H9BA 3GLHA 1YJBA 2P7HA 3I72A 3PLRA 4G4SO 4I1RA 3KOUA 1DRVA 4PY2A 4F3RA 1E1MA 3INGA 4GOOD 4FFLA 1SA0B 2TMYA 4R8RA 1UKEA 4B3IA 2C5LA 3T1OA 1ZVQA 2A7QA 1AKEA 2JIMA 2PZLA 5AOBA 2K7FA 3QY0A 2NYVA 4WW0A 3RKSA 4RDCA 1NG1A 3AEUB 1KYXA 3QJGA 4WZAA 1HOTA 4XJXA 5IYQA 2Q99A 2W0MA 3BL6A 5KYXA 4L8GA 5CA0B 4L9SA 3GZNA 4G41A 3LP6A 3IUEA 3S1LA 2QUIA 1VI2A 1CEXA 2OTLB 1UKZA 2G67A 1USIA 3SWWA 2ZRHA 3I76A 3O3CA 1ODSA 4RIIA 5K0FA 1JYFA 4F8EA 4EM6A 1UWCA 2NZ8A 3IAEA 1IXYA 4DGQA 5IBQA 1WHSB 2J6IA 4HNHA 1F14A 1VSQA 2WICA 4ZVUA 4ICIA 4QGBA 2GF2A 1KJYA 3E20A 1RYFA 1KQOA 3W2IA 2V31A 2NUBA 4QDUA 4NYMR 1HMPA 3WYFA 1Y48E 4PYMA 1CQIA 4NBUA 4R54A 1MX3A 3KYCA 3IMKA 2XAAA 2KVOA 1GNLA 4G1VA 1FRFS 4ME6A 3RRJA 1FVOA 2BP7B 1OU4A 1NKTA 2I8LA 4ZC1A 4ZCIA 1JFRA 2QP9X 3G1TA 2NUAB 1YVPA 3UBMA 1SC3A 2I33A 2Q50A 5IH7A 2B7LA 3PV0A 1TOAA 3I4CA 5GONB 2E4WA 3ZV3A 3LCJA 4KAFA 5EIEA 2JK1A 3QFHA 1D0SA 4TT3A 2A5JA 1ODIA 1WD5A 2OESA 1QLHA 2DLCX 2JIDA 2PANA 2ZBDA 1PJ8A 4MVJA 2FWMX 3H5AA 1V3QE 2ZBEA 2W2LD 1I2DA 2P3MA 3JQEA 4COOA 4H08A 2PMCA 1OREA 3ZHXA 5HZGA 1ZMXA 3O4HA 4FYMA 2VUSA 1XJ0A 3IB6A 4N7RA 4NCIA 1I4WA 3EPKA 3QLTA 3BICA 5T41A 3I61A 1Y1TA 2IF2A 2OLEA 5DHTA 4IFIA 5LU9A 1KORA 2ZUEA 2PKWA 3IO5A 5KOYA 1Z5GA 2IX3A 3IKTA 4HH1A 4U00A 5AI5A 1DAFA 2ZDHA 2R0QC 2XT0A 1BO6A 2BFCA 5CCXA 3ABSB 1OXUA 4HWGA 2PMKA 2Q0QA 2CLOB 3PUWA 3GEIA 3KXIA 3UMBA 3IV7A 4KIUA 4PRKA 1NJID 1OPRA 2HSJA 3AFIA 4HJXA 1L4MA 2BLLA 2GA8A 3A1VA 1WJGA 3E61A 1SIBE 3LOQA 1AKVA 2WSMA 3ISVA 1Y8CA 4KGXA 3Q4GA 1KE1A 4F6LA 3SQWA 1I0ZA 3M0EA 1JDPA 3R0JA 4R9SA 1QR6A 4RV9A 3PTAA 5ETJA 3ESXA 1NQUA 2A0XA 4ARVA 1XEXA 1MO2A 2R87A 4Z0PA 5J63A 4DMHA 1N32B 3CF0A 1JR6A 3ZQKA 3V8NA 1J23A 3PQ5A 2ZJ5A 2PSEA 5U4QA 4WCVA 4JQOA 3W9UA 2YVAA 1K8ZB 3V2HA 3MW8A 4AY3A 3RUFA 3UHPA 3QZUA 4J07A 2ZZFA 5DNVA 1YRWA 1BVUA 2OY0A 2MCFA 4PYOA 3HM9A 2WSLA 2X1VA 3ANNA 3JQ9C 4MUHA 4K9NA 4KWHA 3VR3A 4EYEA 5CIQA 3AU8A 3Q0TA 4ZAXA 1ZMTA 1GPAA 3E5RA 4DM4A 4OFBA 4MDYA 3ZZ0A 3P9YA 4QJIA 2JBAA 2UYYA 4QPJC 5ALRA 4D57A 4GI5A 3EEFA 3EIHA 2WU0A 3H2KA 3K1AB 4I55A 2FSPA 4R41A 1JX6A 2C7PA 2DR2A 1JEQB 2REOA 3G8CA 1PGJA 3QYPA 1QE3A 4IQ8A 2HJVA 5DSZA 1N75A 2XAUA 3L01A 4OGLA 4YXWD 2FAXA 2HJWA 3ESRA 4MW0A 2P27A 1XZDA 3RWOA 2FMXA 5BSXA 1ORDA 3BMCA 2BJVA 4S12A 5AMXA 5T6MA 1UXOA 2VAXA 1DKPA 1A9YA 3L2OB 2DOKA 1V26A 3BWCA 2FNAA 4UVGA 2A78A 3L8HA 5H3HA 3S55A 3K4HA 1RJWA 1ONBA 1DRJA 5DX8A 5KAMA 3PCRB 1K1EA 2PVPA 1IRIA 4B7CA 4CLOA 3RLFA 3BFKA 4WOBA 1I0LA 1PS9A 3UH1A 4K9LA 1HQKA 3FN4A 1I7PA 3BHNA 4YCAA 1YZTA 4O2BA 1JSCA 4B3CA 1TAUA 3HO8A 1L0BA 2FPWA 1QHXA 4FKMA 4JMPA 4MS4B 1Y3HA 4RO0A 4GE0A 5I9BA 2I4RA 1K5DA 2EU8A 3JASA 3LBNA 1IEQA 3GIWA 3T7AA 1BS1A 4JI5B 4DYVA 5LYJF 4ZK6A 1BLIA 4NABA 3DSRA 1KEVA 5A06A 1NM5C 5AW0A 3K70D 3ASRA 4YJ3B 4RLQA 4B48A 4MUFA 4E5KA 3NIBA 4IXNA 3B7GA 3QXJA 3EGOA 3PIRA 1P72A 3K72B 3IMFA 2GSWA 4Q4JB 4O0MA 3TRJA 4O2LA 3PIDA 3FCOA 5EJ5A 3QA9A 3ZBQA 5KJ6A 5CLQA 1S7GA 2GA9A 3Q9LA 1SUIA 4UNRA 1FYFA 2JVJA 3C3AA 2I67A 1GNRA 2O2JA 5T5QA 4AX8A 4CG2A 1TQ4A 1YVDA 4U0KA 3TD6A 1Z5ZA 1ZM9A 4RSHA 4Q0MA 1T0UA 2H1IA 3DAPA 3JCZA 1BQ3A 2W2KA 5IVPA 4C7OA 3DDCA 2SICE 5I9IA 5EXTA 1D7AA 2JAQA 1WB5A 2DPXA 2P4HX 2VYFA 1UL1X 4I6JA 3QJYA 3EWAA 3QA3E 3PRJA 2A35A 4C2BA 1R74A 1X1RA 1R7RA 2E1BA 2C20A 3PDIA 2PWAA 4KAAA 4I14A 1NA5A 3LRPA 2YFKA 2ZCUA 4DR7B 3R8CA 3DZGA 2X53S 3IUBA 3D4NA 4QAQA 3TTTA 3DE3X 4YRNA 5CB6A 2CCGA 2GBGA 4LCEA 4GX5A 1JEJA 2H85A 4OL0A 1SCDA 1OGYA 2GN0A 4YAFA 2HQOA 2YDXA 3PGA1 4MI1A 1P6QA 4FOSA 4C0QC 1RXWA 4S1NA 1TZKA 1M6VA 3LVFO 3RRZA 2HWXA 3CRNA 5LKAA 5I47A 2FF7A 3PNYA 4TV9A 1ZH8A 2ABWA 1AHIA 3VVCA 4AJ4A 4HG2A 1II0A 3VRHA 3ZDZB 3QV1A 4DV5B 4AD8A 4RV5A 3RTDA 1JXMA 2G5CA 5AQ1A 1K0FA 1QHSA 4KXNA 4MB0A 5JNSA 3ZTTA 2AOUA 1IEXA 3O2NA 1YQQA 3PD0A 1EFAA 1N2IA 3FUUA 3CF6R 4S1TA 2NUPB 4L7QA 1N8SA 4P6VF 1RYNA 2XMSA 4GX2A 1QZZA 2P5TB 3D59A 4OQEA 3FFTA 3K15A 4HS4A 4ZAYA 4HDSA 4MOWA 2W8BA 1XAGA 3ZCXA 1WSDA 5AK4A 4OFZA 4XVRA 2DIEA 1JHOA 3BMNA 1Q21A 1Q0TA 3MT7A 4ARUA 3U31A 3R44A 1Z8NA 1FLDA 1JMVA 4Y18A 1E9BA 3FG9A 2DJ5A 4XEHA 3P2IA 4EEZA 1U8CB 2JJ1D 4GHWA 4URUR 3Q2IA 3I32A 2ZXHA 2YVQA 4HEA1 1E7RA 5AVVA 4QJBA 4Y3UA 4FHDA 3CUYA 3ROPA 3WK6A 2VP3A 4LGYA 5DLPA 1B8PA 4TS3A 5JU6A 1DAGA 2PWZA 5HPYB 2XITA 3EWIA 2I4TA 3L93A 4PCAA 1BIFA 2V7GA 3DWFA 1FE8A 3FFBA 1AS2A 4M49A 4C08A 4NFHA 5CFQA 4GXQA 3Q3AA 1Z33A 2QYHA 2QV0A 2C9OA 2YHBA 3U3RA 3KZNA 2AVDA 3X1YA 5JRDS 2PQMA 3AW9A 1ICEA 2B1JA 4IHKA 3E8SA 4GI7A 3JVDA 1ZHHA 5AKLA 2P5YA 3DT8A 1PG0A 2LUOA 5LNK6 2HF9A 2JJQA 4F71A 1CIJA 3LDGA 3KD3A 1XROA 4YCJA 1SQGA 4D46A 1RXVA 1J90A 1FYXA 2AYZA 2BZ1A 3OJFA 4RQTA 3HXOA 1YZGA 3OM8A 3VTZA 2WT4A 1I51A 4FHGA 4H35A 4YRTA 3M83A 2EHDA 4FB5A 2LNDA 2D3WA 2Q07A 3EUEA 2YJGA 4P4NA 1FTGA 1Y7TA 2Y68A 4URYR 1LSUA 4MVJF 4OU5A 3GQBB 3BC9A 4I9HA 4U2EA 4BNDB 1KMNA 5D5QA 2UVDA 1GQFA 1OFGA 3FNGA 4H31A 4JLJA 1XE3A 5K3BA 3CUWA 3HB1A 1NUQA 2J3MA 4P3OA 3WRYA 4EHKA 1NIJA 3GD7A 4L72A 5BN4B 3PTZA 5AXAA 2ASVA 1OAAA 4C2TA 5BY2A 1SB9A 3JQ7B 5IN5A 4DMRA 1B73A 4LX8A 5CB4A 4RXMA 3PXAA 1XTKA 2P41A 3CLTC 3OOWA 1U8ZA 4N3BA 4ZGNB 2UXBB 3O26A 4KKUA 1N92A 4JR2A 1V43A 2Y76A 1SQ6A 5H59A 3H18A 2OSBA 4HDKB 1F4LA 5I7RA 4OQ4A 2H54A 1V37A 2ZAGA 5LC1A 2WLSA 1KTVA 2V97A 3DC7A 4P33A 5DM0A 5JAQA 4M55A 4K6GA 3SM3A 2R00C 2ZQYA 2QTTA 2RIPA 3GHYA 3RTCA 4YV0A 5JECA 1TL7C 4LUCA 3MWLA 4BO9A 3ZHZA 3RS2A 4IP0A 4MS1A 5CTAA 1FFGA 1P77A 1VMEA 2C2YA 3KUUA 5EYPA 1B3RA 1YRAA 1RU3A 1L7NA 4GI3A 4O4IA 1T5EA 4M0KA 5FCDA 4BRZA 1YKGA 4FFWA 1FNNA 1FFWA 5J1SB 1TC2A 4G85A 5JBQA 1S2LA 5D3QA 1FTSA 4YAOA 4TS1A 1CIVA 2IU3A 3U9LA 3CCRB 1G9SA 1PJLA 3NXKA 4J1SA 3C7TA 4JLWA 1S8OA 4L6AA 4ZVOA 4ZVPA 1DTWB 4MV8A 2ZTNA 1JDVA 4D41A 3MJVA 3K09C 4P4SA 1C9EA 4BV9A 3LZDA 2DY1A 1UBMS 1G9XA 1W0JD 2X7JA 1AJEA 2Q5HA 4XORA 1XCJA 4OBEA 5F7OA 3SQNA 1Q17A 4EPYA 1ISPA 1MNQA 4YR7A 5DE3A 1QUFA 1KI3A 2H11A 4QICA 5D85A 3AIMA 4KQ1A 4XASA 4D8WA 4BHTA 1HL3A 5TX7A 1IPEA 1E1KA 1UD5A 1I32A 3KR2A 1GTZA 1T10A 3DV0A 4C0AC 4DQ0A 3SBDA 1PS0A 4MWGA 4G37A 4OLHA 2GJKA 3UMYA 3MHTA 1YAHA 2GGSA 2KI5A 4B7UA 1IVNA 1D7OA 3E2MA 4DLKA 5HFAA 3RS3A 4EJ0A 3AHGA 1DCTA 1XZGA 1PT7A 4Y6RA 1QX4A 4JJGA 3ETDA 2HA6A 1U0BB 2EV9A 3Q6NA 1IQPA 1BKSB 4FNMA 4YAUA 1FSFA 1ZJ6A 2O3UA 3VYUB 1UZAA 4G0VA 4MRMB 1M0TA 1ZITA 4H1TA 2E4VA 2D2IA 2VR1A 4V2IA 1YX2A 2BFMA 4WKGA 1XLWA 3TCNA 1TECE 3WIEA 3R23A 1MC8A 2GI4A 4IQGA 1GJRA 2GN1A 2O8EA 3GVPA 3HXKA 4E7OA 1E1QD 1F8YA 1M1YB 1RR6A 1V5EA 1M1UA 1NVKA 2IW3A 2O23A 1SCUB 3QRWA 3JU4A 4JJFA 4LY3A 1GVHA 1X87A 2QRKA 3LCUA 3RC1A 3U3ZA 2QVCA 1TK3A 2VDKB 1TU0A 4NZNA 5IW8A 4LXGA 3K96A 2WYRA 4CMEC 1D1TA 3BIFA 3FOAA 3JQGB 4YALA 1Z74A 2HTEA 2AFVA 4ZJYA 4B3FX 1N9GA 1Q7YD 4TXLA 3M1YA 5F2OA 1UMBA 2QI9F 5L45A 4PZEA 3DS8A 3GRYA 1EX1A 1VE1A 1F5NA 2A1UB 2BUCA 3EY4A 3DV9A 2J5QA 3WDLA 3K9FC 1JIIA 3L8DA 1VQ4B 3VR4H 5HIKA 2I3GA 5IN4A 4QDOA 5C51B 2Y99A 4RKYA 2QU7A 3ZQJA 4CL8A 1Z7GA 1G2PA 1GARA 1CY6A 3PZRA 4CM4B 1ZCBA 1BG6A 1RWNA 4L07A 2GPBA 1E2UA 5IABA 1S8FA 2RK4A 5BSUA 4A2CA 3GPBA 3LVRE 2VTBB 1P7YA 4TTIA 2E4YA 4XSGA 3F96A 3O8DA 2W11A 3DCJA 4DXAA 3GEBA 1QRTA 1TZMA 3KEFA 1A76A 2OK8A 4XAQA 3K6SA 1O77A 2WMNB 3TM4A 1CEQA 1M5UA 3CZQA 1PG5A 4R81A 1LLQA 1ECJA 3H11B 4AJ2A 5JXIA 5FBKA 3QP9A 5BV1A 2KLBA 1ZRNA 2JZOA 3MOSA 4WLEA 1VYTA 3ZE1B 1MUUA 2J3KA 2QRVA 2VT2A 1W9MA 1ZHFA 4LWZA 4MV7A 5E7MA 4C87A 3PWTA 4GP7A 3LQ1A 4QDTA 3CBQA 4Q3BA 3CCMB 2XSZA 2Z5FA 1RQLA 1WAMA 1KVUA 3HVKA 4V03A 5KO2A 1XKQA 1NYTA 4P53A 3T1NA 1LDYA 4AY6A 1MOSA 4C43A 1A9TA 1N5OX 4EYGA 3CEMA 4GXTA 1J24A 1ARZA 1PS8A 5LNK1 5BSKA 4ZC8A 2QL5A 2R25B 2YBDA 3N0VA 3ONEA 3WWEA 3WKBA 5DN6A 4CUJA 1X3LA 3MBKA 4HUQB 4ZRDA 2V9ZA 1NZDA 3HU3A 3EGWA 2OD9A 3R3VA 5EJAA 4PLZA 4D96A 4NPCA 1L1EA 4U63A 5EJ4A 4DABA 4DV7B 2VH2A 1VRVA 1D1QA 1YF3A 2PA3A 2C4UA 2J7KA 4G26A 4XIJA 5L95A 3OF5A 1JDJA 4UVDA 1NF8A 4FNOA 4Y2RA 2J45A 4I55B 5FPHA 3MCZA 2IY7A 2PZMA 2IITA 2WHEA 4IOJA 3BK7A 1FDIA 3WAJA 5FNVF 3J81A 5DYWA 1X1EA 6Q21A 1A82A 2PV7A 3IT3A 3IQDB 4YJ3F 1E3LA 2X0NA 1E63A 4MLDA 1NQTA 3D8SA 4RE6A 4DA9A 4YPOA 3KTOA 4PS1A 2QF7A 5IAGA 4ZYZA 2G8NA 5AVSA 4LXXA 1MVOA 2ZATA 4IJKA 5IJ0B 4HNSA 4IFEA 2POCA 5B6PA 4BIMA 2O2HA 2WU8A 2V4UA 3G5MA 4BAGA 1ZR4A 2C3YA 3DGFC 1QTNA 4CLOB 5T4EA 3CLKA 4G0NA 3CX4A 1NY6A 2FMTA 3QV2A 2BMAA 3ZKWA 3UJPA 4AIRA 5DGHA 2OXTA 1BZYA 3SZLA 4OAPA 1OC4A 4UQOA 1C0EA 1EVEA 1KYYA 2HJHA 4MYSA 2AKAB 2QTWB 4KFCA 4NCHA 3AFMA 3NETA 4YN3A 3ZJVA 2DM6A 3A6ZA 5KYGA 1V3VA 4BKOA 1P74A 2PT7A 2O2CA 3MLBA 3MLAA 2J09A 4N49A 3RVPA 4Q9NA 1XZLA 1W0KA 1TLTA 2GKSA 2A9KA 3EZ6A 3AEKB 1G7RA 2FRVA 2I62A 5JSZB 3L4KA 1UAAA 2IP2A 2FHSA 1TM1E 5CFOA 3IIEA 3THYB 3IB3A 3JR3A 3HR8A 1W7AA 1ZLYA 1ZICA 3VDQA 2XT6A 1J8VA 2O06A 4JX8A 1IPHA 4OJTA 3A0RB 5EUMA 1R6UA 1C9MA 1R66A 1JECA 1IEVA 1UKAA 3CC2B 1SAYA 5HFNA 5EUCA 3WWOA 2N42A 4M8LA 2G6BA 4R2MA 3X2FA 1YZHA 3S8EA 4KXLA 3SSMA 1USKA 2VHWA 3D1JA 3GVCA 4NU8X 3TEJA 2HNKA 4WE3A 3UVEA 5LDHA 1P7VA 4DA4A 3J80A 3JQAA 1K5GA 1NM5A 1R10A 2FJPA 3THRA 4EFDA 4JEHA 1R15A 6CHYA 5CMLA 1OFTA 3G8YA 3MWGA 5PGMA 1U28A 3NKVA 5BR8B 3C3XA 5EIBD 3VPAA 3ZTWA 3GFGA 3IXLA 3LT1A 2HCTA 1Z45A 3GLHE 3RAEC 2WE8A 2NO5A 1FIUA 3AJAA 1AV7A 1CY1A 4MKIA 3ANMA 3VI4B 4E2WA 1R5NA 2C5FA 1VB3A 2J6HA 3LFUA 1Y5LA 2M6RA 2CNDA 4K2HA 5ARBA 1OOEA 2ECOA 1K3TA 2WJWA 4MVJP 4AQYB 2YC2C 4Z9BA 2PV0A 5EE1A 4QOIA 5AOVA 4Q9HA 3D2LA 1X7ZA 2X4GA 2OB2A 1FSPA 1UADA 2BFOA 2BMEA 5TPWA 5KYVA 4IS3A 1QH0A 2ZTGA 2PKRA 2BFFB 1CY8A 4CL2A 2AD5A 4MAMA 1HSZA 1H85A 1XA3A 2ZWOA 5ERXA 3WRXA 4M37A 4QFCA 4ZAGA 5CFMA 2DWUA 13PKA 1U81A 4H4CA 1P19A 1E2HA 3H65A 5BSMA 1E4YA 1XFOA 1ZIPA 1F60A 4DT1B 1UPBA 2VDUE 2VQDA 4NZYA 4RVSA 4Y1GA 1I33A 1YDGA 2XUZA 3TJRA 4AQDA 4B8YA 2W6CX 3SYMA 1CDOA 3DF9A 4AKIA 3KAJA 2E9SA 2ZR9A 1KYIA 1MGOA 2H7XA 3Q5EA 1FNMA 4IJMA 5FOTA 1CE8A 2ORIA 2EP5A 1BX0A 4WIAA 3F6RA 1OGIA 2OAP1 1PL8A 1KH3A 1EFUA 2Z1NA 3D4PA 4ISBA 4I0WB 2BM9A 4RY0A 3U3OA 4F06A 4PLGA 1FW8A 2Z5LA 2H48A 1WMAA 4L16A 2BUAA 3BCRA 4OK6A 2ZIVB 4TKUA 5LR6A 1NPYA 5EERA 3L06A 1KE2A 4FX5A 1CNFA 1LXCA 2GBPA 3D4BA 3L6DA 3N0XA 3NWJA 4Y6OA 2Q29A 4R1QA 3VNRA 3EJ6A 2YHSA 5AJTA 3LZ6A 4B3SB 1XVLA 3NRBA 1R6BX 1X13A 2JEYA 3EXIB 1XHFA 3QVTA 4FNAA 5EWMB 3DFIA 3OCYA 4CF5A 1XCOA 3VR3D 4RK5A 4JFRA 4RK7A 2IZ1A 4RFSA 3TQHA 4N7JA 1DX4A 1ICIA 1O6ZA 1CRQA 2ROQA 2EW2A 4IFBA 5TPZD 1FXWF 4PG4A 4XARA 3GEHA 4GU5A 5C0OE 4P0QB 1CRWG 3V8EA 1YOVA 3BPSA 3EXIA 3E1KA 4JJIA 1JLLA 5FFFA 4UAVA 1NDUA 3TIVA 1Z6PA 4H7EA 4TYMA 3KKOA 4H1WA 4ALIA 2QL9A 5JCOA 1J0XO 2IYPA 1LDMA 1Q6YA 1K9VF 2FZVA 5ALQA 4U39A 2O54A 2NZXA 3ZGVA 2GXQA 4AZTA 2ZRCA 3ST7A 3TQIA 5JS1A 2FMIA 2R5FA 1TKAA 1P7ZA 2VSNA 4U2CA 5B6JA 1O6GA 4HO1X 3U7QA 4WGGA 1N36B 3DUWA 3OO1A 3HYRA 4P3KA 2MU1A 1E5VA 1AKWA 3CH5A 2L69A 3CZPA 3JQ7A 5EPEA 3AYXB 1VHQA 3UXMA 4YCNA 3KBBA 4X8IA 2ASEA 4LBZA 3OQBA 2AN3A 4JP8A 1U2EA 3MVEA 5DLEA 3K9NA 1D2GA 2X0DA 3RSOA 1WY7A 5LDGA 3T4XA 1VSBA 1ZEMA 2QVBA 3NHSA 1CEYA 2W90A 3OCZA 2EJUA 3ILXA 1JKMA 1BW9A 2CZCA 2ERXA 1NNI1 2AQKA 3LQ4A 3FF4A 5IX8A 1RAIA 1QVAA 4LOHA 4C20A 4KQHA 1ZNWA 3KRTA 2QA4B 3I56B 3TEMA 3GIDA 5LP1A 1UBKS 1QAMA 3L40A 1EQUA 1VI6A 2QRPA 3EXHB 3IAHA 3SDZA 2HB6A 4B73A 1IN8A 4HXYA 2WG0A 3GBPA 4BBAA 3HE3A 4RH3A 1TVKA 1R8YA 2SCUA 2COUA 3PHGA 2C1ZA 5DTMA 4BO0A 3R0XA 1HZZC 1CVLA 3DBLB 3VPCA 4RTJA 1TRHA 4QOHA 3GJTA 1M2NA 4TWRA 1DCFA 4C6TA 1L4KA 2CSXA 4CQMA 3EZLA 2IV3A 2YHAA 2PZFA 4JKOA 3RYHB 4OHCA 2QI9C 1RRFA 4YQZA 3F9RA 3A8JA 1R9MA 3Q1LA 2YYYA 4WVFA 3CFYA 4YP1A 1LNSA 2BTQB 2H0AA 2R6DA 4M21A 1BDHA 1SXJC 4WZBE 2DUJA 2D4HA 4LZWA 2M9MA 1ISRA 1X1BA 4FGSA 4DL9A