2C4WA

Type ii dehydroquinase from h. pylori in complex with ah9095
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
AGLVPRGSHMKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSEYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Crystal Structures of Helicobacter Pylori Type II Dehydroquinase Inhibitor Complexes: New Directions for Inhibitor Design.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 61
structure length 168
sequence length 168
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2c4wA00
3N87A 4CIWA 3U80A 4B6QA 4CIVA 1H0SA 5B6PA 4CKWA 1H05A 4CIYA 4KIWA 4RHCA 1J2YA 3LWZA 4CKXA 4CL0A 2Y76A 4KIJA 4B6RA 3N86A 2WKSA 2XB9A 4CKZA 2C57A 4B6PA 3KIPA 1GTZA 4CKWB 1UQRA 3N8KA 4KIUA 4V0SA 2DHQA 2C4WA 2Y77A 3N59A 4ZC1A 4B6SA 4B6OA 3N76A 3N8NA 2XD9A 4KI7A 2XDAA 2Y71A 4CIXA 5WRFA 4RC9A 2XB8A 2BT4A 1V1JA 1GU1A 4CKYA 4L8LA 1H0RA 1D0IA 3N7AA 2C4VA 1GU0A 1GQOA 2UYGA 2CJFA
chains in the Genus database with same CATH superfamily
4KBYA 1NZJA 1UL1X 5KMGB 1KYZA 1NJ2A 4ZHSA 4QLAA 4AF6A 4LZAA 3P71T 4NZMA 5KHAA 4WJKB 2O7RA 2A5FA 4PAWA 3K9HA 2IYZA 4TYMA 3UCFA 4D9IA 4FDMA 2PFKA 3F6EX 4WK2B 3A4TA 4CLOA 4JI4B 1ZNQO 3PC4A 3R0VA 4Y2VA 3F0TA 1ICIA 4WLUA 1Y8CA 1RHRA 2QG6A 3PC3A 1DFIA 1YI1A 1BWRA 4P2BA 1X80A 1B41A 3I9OA 4XAQA 2XKKA 3TBKA 1U2GC 4KV7A 5U9CA 3A3OA 2YQ5A 3GB9A 2EJBA 1FPQA 3DO8A 1N5MA 1K97A 3L7NA 1WLSA 3UAYA 2VCHA 1ORHA 1DXQA 3I28A 4CQLB 2B7BA 2JVJA 2Z8YA 1VSVA 3GMDA 1VA5A 2DY1A 5B4TA 2F3SA 4JLWA 1BHSA 3CVWA 1H05A 2X0RA 1YR6A 2GSDA 1QLJA 4IZOA 4LF8B 5GGYA 5U4QA 3IKLA 2P78A 3B48A 3OTQA 3WVNA 1V3VA 4MVJE 4QPJC 2XJ4A 4AZ3B 1FFSA 4UVIA 5TPZD 1L8QA 4LF9B 1CC1S 4JA0A 2PX6A 2ZM6B 2I1VB 2XQKA 4TZKA 4EJ6A 2Q9UA 3PZRA 2XCSB 1N2CE 5A04A 2GXUA 3EVZA 4KE8A 3NATA 1NHWA 4QU0A 2ACEA 1W48A 3C6MA 2FFAA 4O1HA 3TJRA 4AY4A 3DAGA 2ZJFA 2FZLA 2Q8NA 4QOSA 2W6CX 4RYLA 2Y05A 1FDVA 4CM9D 3IV7A 5FWDA 5L7WA 3LC0A 4L57A 3QV2A 4Q4JB 4V38A 1XBTA 1S7CA 5FR2A 2BD0A 3KYDB 4UM9B 3EX7C 2V3VA 2MWMA 3G0DA 1EVZA 1B8PA 2O14A 3GFFA 3HFGA 2HO4A 3I8XA 4ITVA 4NQRA 3ZCXA 3N2GA 4F9TA 3K5IA 2VRNA 2FN7A 4LOKA 4TRMA 5GAJA 4ALLA 3UK7A 1XA3A 5IVIA 4CNQA 1M2KA 3WLEA 3TQHA 4A0RA 3FB1A 3K5PA 4DCMA 5K6RA 3CH6A 2N46A 3LUBA 3RPEA 1CS0A 3SDZA 4TZ0A 2QN1A 3TZQA 1Z35A 4G5FA 2B25A 1G41A 5G53C 2WMYA 4LDPA 4AL4A 2AG1A 4RD1A 1UH5A 3DEAA 4B3DA 4V02A 4ZQIA 2GEFA 5J4YA 4BAZA 1EK0A 1YZFA 2BHLA 3IPRA 5IBPA 1RXWA 2CNWA 4ZEXA 2M6KA 1F2UA 4TVOA 1Y4SA 2B5VA 2UUAB 1G8KA 3ZHYA 5AJWA 1W73A 2QV7A 3WK5A 2ZVJA 3BMNB 3GRZA 3ZZUA 3NNNA 2O9JA 4LTNA 1MNQA 1FNSA 4HSGA 4MJLA 3RTBA 3I8OA 2P4QA 1UBSB 4KIUA 2O2EA 2D00A 2QG9A 3D3KA 2ISCA 1MZVA 4TTTS 2YOHA 3STXA 4DR5B 5B3LA 5ALTA 5IKOA 4Y0VA 1GG2A 2EG9A 4RIGA 3G0IA 3A3PA 2JI8A 4DLUA 3OP4A 3RVPA 1SMKA 2X0IA 1BX3A 4MWGA 2I3GA 3FDZB 3ZHOA 1YGPA 3I61A 2PZAA 4CMHA 3OZEA 3A2KA 3OWXA 4TKVA 1RTKA 4KFRA 4RF5A 4DA6A 1U3UA 2NTVA 4R6WA 2XX3A 1N33B 2FHPA 5G1OA 5F2OA 2QTNA 4LS3A 2QTMA 4EMSA 1L1RA 1V16B 5FBHA 3RU9A 4PR3A 1YI0A 4KRXA 5ARDA 4DCUA 2DQSA 5TQ0B 2IYLD 4P08A 2AC7A 3EEIA 3V6MA 1XZKA 1RM5A 3GJ6A 3VI3B 3C3BA 1B76A 4TMYA 4TQAA 4WQMA 5EHXA 1SVKA 3RJ9A 2ECKA 3UHOA 2IBTA 3PFNA 1B43A 3GNTA 1RQPA 4M76B 3ZDAA 4N8EA 1VSTA 3IFSA 3HCPA 4YYZA 4UCQA 4UM8B 4F2HA 5FBLB 4IHAA 1WMDA 3TLXA 2NQ8A 1OXKB 3OHSX 1HRKA 1PFUA 3TM5A 5BMVF 2F1OA 3CSDA 2YRWA 3R44A 4KLCA 4R5MA 3FLBA 3CNHA 3I37X 1JJBA 1BU5A 1FK8A 1EAMA 2QW8A 3VR1A 2C9CA 3WXBA 1AF7A 2ZVDA 1Y3CE 2I6XA 2GVNA 1J09A 2JFWA 4KBGA 4NFHA 2G9NA 4D5GA 3WLSA 4A6PA 3ETGA 3C3EA 3RLIA 4IQ4A 2IXBA 2DR2A 5E1MA 2XBLA 4ZREA 1YFLA 2WWIA 2VJBA 4KXQA 4U9HS 2OZLB 3HEBA 4C78A 3VPDA 3HJAA 4OUDB 5FI1B 2YVQA 1CP2A 1U7WA 2WZQA 4I5DA 1O6BA 4B4VA 1FCJA 3RKRA 4I4NA 5K01A 1NP3A 1TTHA 2G1UA 1X7WB 4Y2TA 4M83A 4B9EA 1IULA 1IZZA 1QFJA 4BAGA 3DT8A 1SD2A 1XJWA 2FLWA 4BC0A 4NBVA 4L5AA 1TOAA 1XPRA 1GP2A 1NUAA 1C3LA 1PT5A 1NVXQ 2Y6VA 3OU6A 2H1RA 2I2WA 2QNRA 3ZCSA 3LVQE 3F4BA 3GC6A 5REQA 1U1EA 3D7MA 3DL4A 2J3EA 2LCIA 2X2EA 2YC4C 3L4JA 3MJEA 1TU4A 1KVSA 3K4HA 1RT9A 5A7GA 4MI6A 1PV4A 5I7VA 1H4SA 2EX4A 2RGDA 3TW8A 1JIJA 2V0GA 1ZN7A 3G8YA 1PBTA 4FNOA 3DHWC 4EYGA 5ERXA 2RGUA 1Z4QA 4HZIA 3ZVKA 5CAEB 3KD3A 4MR9A 3ZCQA 1RKUA 1U28C 5CLGA 5JFTA 2QL7A 2BP7B 4PAQA 5EHQA 3TI7A 3ZY5A 3F5MA 4HB3A 1GQOA 4BNJA 1Z3IX 5JG7A 4W82A 2NU9B 4MWSA 2OKGA 4E6PA 4H0NA 2CN1A 4X20B 3W1WA 4MCHA 5TIIA 4JBHA 2J3KA 3RGGA 1IDOA 5LIPA 1SC1A 1L7VC 2WKSA 1XTZA 2IU6A 1JU9A 1K98A 3C6XA 3NVDA 4LXIA 5K0CA 1IB0A 3N0RA 3NC0C 3W8FA 5CB4F 1U3VA 4Z4CA 3HJRA 1RXCA 5K8VA 1ZQ9A 5JAPA 2PMFA 1Q1BA 3CCFA 2RHBA 3T1QA 1AM4D 1AHIA 1MV8A 1N9ZA 1Y5RA 3CUWA 4G41A 1EWRA 4XI9A 3T7TA 3PRHA 4HWRA 3R77A 4J1TA 5DISB 4IHQA 3FCOA 1FLDA 5FCDA 1FA9A 4PX5A 3BD6A 4PFSA 4FWTA 4PC3A 4Q4CA 4Y9DA 1MAAA 3H75A 1Z7EA 3SR0A 1INLA 1OWNA 2Y0BA 1M1YE 4N48A 1J06A 1VKRA 1YBAA 3PQ5A 2GUWA 3FYUC 2XOKA 2DTXA 3PXUA 4KR0A 4W8OA 4BRUA 2BGNA 3QPDA 1CF9A 5I9NA 1R88A 1WMBA 1WRBA 2A9OA 2AI1A 3N2NA 2F4NA 5DSZA 2Y6UA 1C0LA 1S2NA 2ESRA 4IV8A 4YQEA 4TROA 4FGJA 3RJMA 2H4FA 1ZM7A 1VBKA 4G63A 3PXBA 3TSCA 5LQJA 1Y6FA 1PR9A 1DQNA 3R0ZA 4G65A 5JRZA 1SCAA 4ER3A 4F71A 4D92A 4AULA 2O2JA 2GVZC 2P2NA 1NJFA 2PXHA 2BMFA 4FQ5A 2HRBA 4MUFA 4ONEA 2O7QA 3V4ZA 2W6JD 1NXPA 1IUKA 1PX2A 1XRQA 3EIWA 3OA2A 4D3SA 3OFND 5JASA 3E4DA 4R0MA 3OZDA 5C1BA 4LYGA 5A6SB 4RLQA 3CVXA 3CZCA 1T6NA 3N0VA 5M7EA 2PRSA 2QZ4A 2BVNA 1HTBA 4U9IS 4HWKA 4JITA 3AHHA 2ADMA 4GDMA 1I7QB 5L51A 1AN9A 1UMCB 3VR6D 5KHOC 2G9RA 1JFFA 2C2HA 1IPEA 4HEA6 2XRFA 4KK3A 2IITA 1G8AA 1K3FA 2VR1A 3I2YX 2F43B 3U7HB 5KHLB 4E3ZA 3FCAA 4D4JA 1ZHFA 4ZVUA 3VR5H 1KAEA 4M99A 3NHSA 2C5LA 1SQSA 4BB9A 2J09A 1YL6A 4Y6QA 1U5CA 1SPXA 2HBQA 1YZHA 1GTJ1 3LDFA 3W6OA 3AWIA 3H1GA 4LZLA 1YIOA 3CR7A 3I6ZA 4LZOA 3GLHB 3KG2A 4NCJA 1LPMA 2P4UA 2AGVA 2FUNB 1YHZA 3IPCA 3QSGA 5J1TB 4Z4HA 4MW7A 3R5SA 2JRCA 1PHPA 3FJ1A 4MMYB 1SC6A 4R7GA 3S27A 1WUHS 2AXEA 1PT6A 3JQBC 2AXQA 3BH0A 4NIMA 1MO3A 3P94A 1KRWA 4EZEA 3GNQA 3DBVO 1WBJB 1JSXA 3C8UA 3SLRA 4JUCA 2H1SA 3S1SA 5LC1A 3H1EA 2IP1A 2ZANA 4WE3A 5H82A 5FUVA 2LIPA 2J9FA 3S2FA 2REQA 3IQDB 3JQAA 3NB0A 4IS2A 2D0DA 3B8EA 4JGGA 1GZ4A 4ND5A 4C06A 3IPXA 1V96A 1EDEA 1PGNA 2ZBUA 1XNRB 1M7BA 3I45A 3V4OA 1EFRD 4FMBB 4KRFA 4JGBA 2H31A 3IC5A 1VHWA 1H1TA 3AV3A 2VO1A 4N12A 5SY9A 1VL8A 3TB4A 4C4TA 5B7GA 2ZB4A 4Q7MB 3UANA 1LBQA 2VPPA 5IAJA 4M0UA 1MAHA 4Y0AA 3SXUA 1ZJJA 4O2AA 5FLEX 2BFEB 1CXZA 1TM7E 1T26A 4Q9NA 3KKOA 1QHSA 1C0KA 2OP1A 3FF4A 1QWSA 3AF4A 3L0SA 3BOSA 3OT1B 1LI7A 2VIIA 3F46A 2EW2A 5EGNA 2E3JA 3T9EA 3CZAA 3C74A 4YJ2A 1O0BA 3UJ6A 1WXFA 1RQGA 4OJKA 2GOYA 4OSPA 4I50A 4JSRA 4C0QC 2VZ0A 1F2TA 3EPRA 5I3CA 4KPUA 2GN6A 1A7JA 5KTOA 1HMYA 3JW8A 4L22A 3CR8A 4PIMA 1GFSA 2FRXA 3DE7X 1J90A 3L18A 1V3TA 1AA9A 5CDUA 3TLYA 4A82A 4EB8A 4GMDA 1VPDA 2NVWA 5DBFA 4K6CA 4UEQA 5IT5A 1KQNA 3DNMA 1E0JA 3CUKA 3QFSA 1FFXA 2AOXA 2ZIXA 2R8EA 2P8JA 4MW9A 1JLMA 2YYYA 4TRNA 4UQPA 5AW1A 1Z2PX 4PO1A 4LQDA 3KTDA 2VPIA 2C4KA 1OLXB 4NDNE 4Y67A 5ALKA 1NM5C 2B4RO 4X90A 1NW7A 2J9RA 3V8QA 1VHLA 1I1HA 4QQNA 4CM8A 3AEXA 1QUFA 3UUFA 4AUKA 4G0ZA 4C03A 4KQJA 1P0PA 1XJQA 3GUVA 3NQ41 4IJQA 5CW2A 5E7JA 1RXYA 4BWYA 2P2SA 4LHSA 3ROMA 5KEIA 5FA6A 3H3XA 1J56A 1IHOA 2Q5IA 5B3JC 2WNSA 3C98A 3I6IA 3SICE 1ZIOA 1P4RA 1EBFA 3EIXA 2AN4A 5TF0A 3HV0A 3BWXA 3RFUA 2QL6A 5K7SA 5KTNA 3BK7A 1FP6A 2QLJA 2VN8A 3SNKA 2OM2A 4LY9A 4BPRA 3L8HA 4C7VA 1X15A 4MVJI 3RSLA 1JLKA 3AUTA 3FVTA 8MHTA 3DDHA 4BB0A 1KH1A 2VUSA 1Y1SA 5CGZA 2EWVA 2OOKA 4RA6B 3U4QB 5G40A 2G1AA 3D54D 1GZUA 3BPSA 4ZCPA 4WH0A 1KOGA 5A1TA 3H8VA 2C59A 4RPIA 4FLEA 4H7DA 1H65A 3VZCA 1JIKA 4GYYA 1ULZA 4K6HA 3RC7A 4RTRA 5JY6A 3QBTA 2QW1A 4FGKA 4PZLA 1J2JA 4BY9E 3ADBA 4DF3A 1KIAA 3K0AA 4Y7CA 3S8YA 1QIMA 3BF8A 5IK2D 1V4BA 2OZEA 4AK9A 3CLTC 4DGQA 1SCIA 2H2AA 4JQSA 5EWLA 2QKYA 3MS7A 5BXQC 3H42B 1TT7A 2GF0A 1NNUA 2SBTA 4DR6B 3AY7A 1ST3A 3EZYA 3OPYA 3M5WA 2FGJA 4M49A 4HN2A 4WZZA 1PLLA 2FXVA 4P81A 5DYTA 4AKGA 4TUYF 5EXTA 4ZHQF 3HVRA 5FQOA 1GV1A 1RNLA 2GUGA 5DLPA 5IKEA 3GYBA 1A9QA 3QVGB 3SOZA 1XHEA 1Q0TA 2QRVA 2VQSA 4HFJA 3VHQA 1FQKA 2OGWA 1CU1A 2JFVA 1H8HA 4XD2A 5L3SA 4EF4A 1Q7EA 1I7SB 4IS3A 4LGYA 2ZTLA 3QWHA 1D2RA 3T61A 1GPBA 3VR5D 3DTVA 4JP5A 4JWTA 4F2PA 2O0HA 3ZYZA 4D0LB 3DDCA 1CUSA 1JG2A 1G1MA 3ZWOA 4CR7A 3I1JA 4G1MB 1Z12A 5DNAA 3ASVA 3DZFA 1FSGA 5CLHA 3A0UA 4K5QA 2OZVA 3NGLA 5EXEA 2A58A 4ETWA 2J45A 5BR7A 1EGVB 3T3EA 2ZM5A 1G8YA 2WRZA 3E61A 1I1NA 2CWDA 1W4AA 2XGOA 5EERA 4LZPA 4GP9A 3QW2A 2BBTA 1MEEA 1DWPA 2X6TA 1L5FA 3PKIA 5LVAA 3WGLA 4UHEA 4AF8A 3U9TA 3KR1A 3JZMA 5I6DA 3SQWA 3B5EA 4J94A 4QATA 3KOZA 1AN0A 2NQ2C 3B3QA 1Q20A 2B8NA 1J8FA 3LCMA 5JNWA 1KDOA 2B98A 4MINA 1KZHA 4JBXA 4I1SA 4BVAA 3BGVA 1XRMA 2GD2A 4TSRA 2RB4A 4FT2A 4JVOA 1QH1A 4FYIA 4US2R 2ZVQX 1P8AA 1VG9B 2H1WA 2VHCA 3MF4A 3MJTA 4IILA 3WDKA 4A0SA 4JB3A 1YVDA 1R16A 3NU1A 4US1R 3SJ7A 4DIEA 4REQB 1ZONA 1NW9B 2Q0XA 4PRLA 3MJCA 4Z1MA 1I9CA 3AR2A 3ENZA 5UKDA 4MGEA 3NM4A 1QX4A 4JYBA 4R8RA 4YUVA 1O2DA 2DCUA 3AXTA 1XK7A 2GYWA 1XEAA 2F3QA 3RSSA 3C3MA 1XDBA 4KJXA 3U13A 2G4CA 5B3AA 5FUWA 3RFXA 1GA1A 3SK0A 4QYTA 4EB6B 1ZK2A 2YFQA 3JALB 2Q1TA 3NMUF 2J0VA 1ODJA 2BC9A 5KJ6A 4AW9A 3L7LA 3J80A 1Y1QA 3SEAA 2LCFA 4F2WA 3NUGA 5IH3A 1UBNA 4K28A 2AI3A 3WKBA 2EGUA 2CJWA 2IE0A 3NKLA 5JRDS 1J0XO 4QBIA 3ZY3A 2QP3A 3USCS 3KAPA 1T5IA 1NNI1 3HUEA 3PCXA 5EKUA 5KJCA 3V2GA 1P75A 5BN3B 2VK4A 3L1JA 1QYWA 1I3LA 1JKJB 4QWWA 1DRUA 2A1TS 1QRSA 4GICA 3PF8A 4B7XA 1L5RA 3GF4A 5IJ0B 4N41A 2PR2A 3P27A 4BCDA 2GPSA 2WAOA 1PNOA 2BMEA 3KETA 2R97A 3TM4A 2XAAA 3NGXA 3PPXA 3EGXB 3K1TA 3AR7A 1WE2A 1S02A 1KSHA 1ESDA 1Q0UA 4PSVA 4FNAA 3PNPA 2WM3A 4WTOA 4ALKA 5IMSA 3D6UA 1ZGHA 1BKSB 3QVLA 1JJIA 1RCFA 1E8MA 2FUKA 2Y4OA 2LR0A 1YL5A 1Y89A 3QKIA 4RWZA 4Y8VA 2I2DA 5B1EA 3VQTA 2FJUA 3IQFA 5CLIA 2BGUA 1R64A 2E7ZA 1UJNA 3MB5A 3RKSA 4R8VA 3HBFA 1GN9A 4LMAA 4BQPA 1SB8A 4H7JA 4IMJB 5CM2Z 4ARSA 2RHGB 2EQ5A 3NOOA 1DSSG 2DHQA 2ZJ3A 5AVKA 1KERA 3MNFA 4AG6A 2BYTA 2C2MA 4QDUA 2NU6B 4YAJA 4E32A 3IMFA 3SS8A 3R0JA 4OFWA 1LSJA 4GI1A 4TLCA 4TWIA 3W04A 2H0AA 3H05A 5FADA 4RZHA 5C34B 1RLIA 1KBQA 4B0OA 3CONA 2WIGA 2HNKA 5IF3A 3JAKB 1KO1A 3KKLA 5HKKD 4BMZA 1QYDA 1JLHA 1H3FA 1UPTA 3JQPA 4Z6KA 2IEYA 5KOJA 1USKA 2GX6A 4OFBA 4OCZA 2E4WA 3ICWA 1V7QA 4NZPA 3FYHA 2YV5A 2ZSIA 1PTJC 2YXLA 4R0VA 5HRUA 5AHRA 5B6IA 1U28A 3PLNA 4HX9A 4C7JA 1CD5A 4RHTA 3QVSA 1NJ1A 1N8SA 1CUGA 3BMCB 5AW5A 1DBQA 2PD4A 4Y2SA 1K08A 3LOQA 5LCXA 2IPNA 4PZ0A 2FOIA 5AJVB 1AKUA 4X0EA 4X7RA 1V95A 4Y1RA 5I9IA 5BO5A 3K16A 4W5TA 4URHA 3OTOB 4G37A 2JF0A 4MYDA 1PIWA 2X9LA 1PAUA 2YC2C 1M76A 3UV6A 4QFDA 4MUNA 4NARA 1DJPA 5SYMA 3U09A 4TVBA 5AM2A 1A4UA 1RD4A 3LT4A 4XRRA 4F5WA 2FN9A 5F98A 1ZC3A 2PBLA 2XRZA 4ON9A 2JHGA 4R9VA 4OJTA 1ZH4A 3CUTA 3G8DA 2QEQA 5AQEA 3EGIA 3CLVA 1WXWA 1GRRA 3F3KA 1SQGA 1JE1A 2PZEA 4ACBA 3DMGA 3OZUA 4KLAA 4AD8A 4CTJA 3H87A 1JFTA 2UXCB 4D8WA 5JNRA 3GEEA 4KYIB 1DEHA 3GJYA 4MWEA 2FX2A 5AHWA 3KEQA 3VU8A 1K86A 5LZ5A 5AUNB 3LT2A 2XMGA 2WSIA 1IHXA 1N6PA 4DPMA 5D84A 3UOWA 3NHZA 1LS1A 4F60A 7AT1A 2A0XA 3PQDA 4QA9A 2PN1A 2YJ3A 3E70C 3R7FA 1O5TA 1XRJA 4KI7A 1FVFA 1BD4A 1I13A 1YE3A 1JA0A 3RYFB 4LRUA 1P2FA 2WPDD 1O6GA 4BO0A 3E7FA 1GQSA 5DGHA 2JIPA 2PVPA 1H6CA 1YR7A 2VDKB 1LW6E 3HVUA 2XNDD 4IIGA 4LJ5A 3OEEA 3LK6A 3QBEA 3UK6A 4IVRA 3OCVA 3KR0A 3EWAA 3WLRA 4BNVA 2W2OA 2JIMA 2M6SA 1TA0A 3O5AA 4GXQA 2HA3A 3AHFA 1TYBE 5BQ5A 3RT7A 2AMVA 3GJ4A 1CF2O 3FG9A 3QFFA 4YQZA 2WIFA 4B3BA 1E2EA 3BZBA 1NW5A 2GFQA 2YL2A 3A6LA 1DO2A 4Z0PA 3ZDCA 1MO5A 2XCTB 4AYXA 4QDXA 3QG5A 5A9SB 2AYZA 4M1ZA 3IUMA 4J0FA 4I6EA 1WPXA 2FMKA 1O97C 3ANXA 3PXCX 4JZYA 4KMSA 1GPUA 4QJ5A 5F7ZA 2PKXA 3TQQA 1KQPA 3ZHUA 1IH8A 3B9BA 2RH9B 3CPSA 2H2GA 4N5IX 3F49S 4C3ZA 1VSQA 3HK2A 2WLTA 4BNGA 2IS1A 2A1TR 3ZJUA 1U6IA 1H2XA 1TF2A 4K9NA 2ZQ5A 3DHEA 1A7UA 3C5EA 2OZKA 3JQ6A 4N5LA 3E3NA 4LK3A 1LV8A 2VLBA 2J0EA 5ENDA 2D1RA 2XCUA 4JXZA 3AM4A 1CHDA 3WNQA 3SQDA 2PS9A 1Y3IA 2J07A 4OQDA 4UE3S 2K7ZA 3HBLA 2W5UA 3KU1A 4GC9A 1E64A 4R9NA 4DCSA 3YASA 4ENUA 2DWQA 2V6FA 4UMEA 3RADC 1TJPB 4PHHA 4H1WA 2O8CA 3DLIA 5T41A 5JJLA 4QXQA 1II8A 1KQOA 2DTEA 2FEMA 1Q1NA 1K8ZB 2QD4A 1H6DA 3OOHA 4O5AA 4ZC1A 3U6BA 5G02A 1TPZA 2KE5A 1E9SA 3FHLA 1MQSA 4QUKA 1KMHB 2IYYA 4BN5A 4E5NA 5EPUA 4LJYA 5C51B 4UHKA 1NXSA 2CB9A 3PFGA 2N0SA 4BMNA 1IZYA 4BFWA 3F5FA 3BM5A 3H1FA 2IH4A 2CVQA 2FPWA 4Q3EA 3L7DA 1YOVB 2EGGA 1FXUA 2HF7A 1DQSA 2WV9A 3HDHA 3KB2A 1L4NA 2VDWA 3T5GA 5KU1A 2BTQB 2I66A 4I14A 5DOZA 4F9FA 1ZVVA 2ERCA 3I0NA 1VE3A 4X00A 1N3LA 3D1LA 4FFWA 5H3HA 4ZC8A 1VIMA 3DOOA 4X3PA 2F64A 1RBYA 5F35A 2FEWB 1TLTA 2JVIA 3TE6A 3LIIA 1RWMA 4N3GA 4QQKA 3T3NA 1U2QA 2I4RA 3IR7A 4C0JA 4OK3A 4QYMA 3M33A 4MWCA 1JA9A 4C2AA 3DBHB 1I7NA 1MG5A 1UBGA 4XKJA 1DKNA 1JIVA 2BFWA 1L4UA 3A7DA 3G9TA 5HIJA 3WNDA 4PYLA 1QQ6A 2ST1A 4ER6A 2R0QC 3ZH2A 4E5UA 5JV5A 2QVGA 1RPAA 3A1CA 4A8HA 4CFSA 5IWAB 4RULA 4QGBA 2OQVA 1F8GA 1KYVA 2I2XB 3PIRA 1ZLXA 4LOAA 1MD9A 1CNMA 1JYFA 4DRXB 3ZW8A 3ELYA 5JS7A 1EIZA 4JZKA 1RQNA 4QEDA 3AJ8A 3EVEA 4X6UA 1TZJA 1JIUA 1WXEA 2PK3A 2FE1A 1U0RA 2O2CA 2B1JA 4FLMA 4KDFA 4J9UE 4AFNA 1EGHA 2Z6QA 2HNBA 1UMDB 3MJVA 5A5VA 1ONPA 1EVEA 1RP7A 4RFLA 2PJDA 4ZGGA 4RLHA 3V2HA 3PJDA 3MVEA 4ZU6X 2YV3A 3UFBA 1CYDA 3D0RA 3F5DA 1Q0ZA 1FL9A 2H1HA 3REQA 3ZQKA 4EK9A 1W30A 3NTQA 3QVTA 2GPWA 4JXJA 1H2FA 1L7NA 3OFJA 4K81B 4UAGA 4B85A 1S1MA 1FBTA 3CE9A 4P4SA 4YAEA 5DCYA 1A2BA 4OIFA 3GLGE 4AYTA 3CPJB 2WFLA 3G82C 3LPCA 1P72A 3OE7D 5KCMA 3KJIA 1GNLA 2BISA 2Q99A 1X13A 3RC1A 2AC2A 3JD0A 3TEJA 4Q9KA 3ET5A 1ZGJA 2EBWA 3BFKA 4YJHA 2FWIA 2PWZA 1UBHS 2PV0A 3E2IA 5BVGB 4NH0A 3ZK9A 1KEZA 3KBBA 3KJQA 1Y5IA 2IEAA 1RPNA 3P0EA 3QTLA 3RS4A 5CFRA 2ECQA 3E2MA 4KK4A 2FR8C 2GARA 3EDQA 1GXSB 2BH9A 4BCCA 5EJEA 3ZU6A 1X8KA 1X1CA 4RSRA 1BN6A 5TC4A 3HDJA 5B2EA 3ZXXA 3KZKA 3ZZNA 3MYRA 1PUXA 4C7OA 4J03A 4QYXA 4CEIA 2QYTA 3OQBA 4WFKA 1CZNA 1ZJZA 1XL0A 2EATA 3IP8A 4QFCA 3RTDA 3G7UA 4MTLA 5GZ6A 3PGA1 2P1RA 1BDHA 2PJUA 2GZRA 2GRAA 4YP0A 7REQA 2EP7A 3GLFB 3HU3A 3QKUA 1Z06A 2VNHA 2NZWA 5LZ4A 2ZPTX 3PI6A 4BLQA 1QO9A 1KEEB 3PUZA 2OFPA 4HJRA 3SYKA 5HG0A 4WZAB 1C8VB 4R40A 5CD9A 2VDPB 3U44B 1YHNA 1YUMA 2BL4A 2J3QA 2ZTUA 4L0MA 4TGLA 1IBRA 2GEKA 3IBSA 2HGZA 1HG1A 3ND9A 1XA4A 4C05A 1RCTE 2QJOA 4PGHA 2P9BA 3AVYA 2JLWA 1ND5A 1ZITA 3WBBA 2IZOA 2D7JA 1ISPA 2ECOA 1TYZA 3DE6X 3LBAA 4UVDA 2TS1A 2UZIR 5DTQA 3S2GA 5JXWA 3V3KA 3PJRA 4JYMA 5DTJA 1X1AA 1XVVA 5KYXA 1NQOA 2HA5A 2XMSA 1XCJA 3R6WA 1EQ2A 2BGLA 3P4UA 4MVJA 4DWJA 3AONB 3P9CA 4CCYB 5CDSA 4YMGA 3DLHA 3TLCA 2C29D 2PT9A 2GFHA 4ESVA 2KMLA 1C7FA 1N2CA 2PS3A 4EYQA 5KNCH 2ONYA 1DBRA 1X86B 4KNYA 4FINA 3T38A 2TYSB 4LV8B 2MCFA 3CBQA 2D0OB 2XNDA 4B40A 1XVAA 3KXKA 1K7CA 3ED1A 3KUDA 1ES9A 2LP4Y 5DN9A 3ZI0A 4FIDA 2Y92A 3I0ZA 5BW8A 2CDBA 2J30A 3M4ZA 3HNRA 4PW0A 4AJJA 4ZI3A 1GSIA 3JVIA 1JHMA 1SK9A 3DE0X 3KLBA 3LLCA 4WKOA 3KTFA 5AT1A 4EJFA 5EE9A 2WVAA 3MQ2A 3MAAC 1DIRA 3ESQA 2F90A 2JFGA 2G3YA 4X65B 3GIWA 2H7YA 1XI2A 1NN1A 1QYXA 1SVUA 3FI9A 3MXOA 3IBYA 3NHPA 4UDXX 3HYLA 3BB1A 4I36A 3UGKA 1EX7A 4BUZA 3U17A 4WI1A 2GSWA 1TAUA 3U61B 4Z0HO 4UM7A 3E5RA 3PUVA 2VH5R 2KW5A 4RZXA 5C8DA 2CNBA 4LJ9A 4ZVQA 2V6GA 2O0JA 2CDAA 3RT9A 2JG3A 2X4IA 3IA2A 5A4IS 5KCZA 5GPBA 1SBCA 2BKXA 2NZUG 2P77A 1DKUA 4W5NA 2VHZA 5T6MA 2EJTA 4XYEA 5B4UA 2H4ZA 4UD2A 4HEJA 3K2IA 2F1JA 1UOPA 1EE2A 4Q1AA 5EHIA 2HXSA 4ZDJA 1KZ6A 2PKCA 1MOZA 1ZD4A 1FDRA 3M6XA 5AVTA 4UUQA 4ZAGA 3DXXA 3IVRA 2J0SA 4MROA 6REQA 3ZU4A 2YZMA 1UC9A 2PSHA 1YRQA 1G1AA 2SCUB 3D5TA 3ISTA 1GRQA 4FUQA 4BIIA 2Q07A 1Q22A 3VU3A 2EQBA 3UYLA 1KH3A 1YR2A 3S44A 5EMKA 2OB2A 2UUPA 5HF8A 2BFCB 3AFIA 4U02A 5IDWA 2HTFA 1CT9A 1DKOA 2NSJA 1TLLA 3FPFA 1MJHA 3R4CA 2HJRA 1GR1A 1K27A 1DTSA 2R87A 4RL4A 4XB6B 3T95A 1SN7A 4ESOA 3WGIA 1CR2A 1XTBA 1ZC4A 2QS9A 2XUKA 3VYVA 3A6GA 2FDRA 3LKVA 4RJKA 5A0FA 2W2LA 5CPFA 5KVCA 2EXXA 2ZRQA 3ONVA 2N3ZA 4RK6A 5JWHA 4DG8A 5JU6A 1E1YA 1HSOA 2V55B 2Y1XA 2E4ZA 2YX1A 3BC1A 1FQOA 2DJIA 2FQ1A 2WMOB 1FTSA 2GTIA 2YXDA 2ZSEA 3ADKA 3NAQA 3ONWA 3I52A 1ID1A 4Q1CA 2YVKA 1YUNA 2B7LA 1M6HA 3S55A 1GZ5A 1MGPA 4G5XA 2ZSDA 3NH9A 3H6KA 4QNNA 2W70A 1ZH0A 3A4VA 3WGYA 1RJGA 2GPYA 2RHLA 3OE5A 1E7YA 5DM70 1REQA 1UP4A 1H5NA 3VISA 5IEJA 5KBYA 3QPAA 1ZO8A 1UWCA 2DSTA 4NS1A 4N76A 5E6RB 1AQUA 1HO3A 3ILYA 3HKEB 3AT1A 1A9YA 2A94A 4MRAA 5HTKA 1JR3D 2I4TA 2NNLD 1JQ3A 1E58A 4AJ1A 3SEFA 2F6RA 3Q0IA 2ZKLA 3ZUPA 4MV4A 1L5SA 1IIRA 1HQKA 1OZAA 1X7XA 3MPUA 4BFZA 2BRUC 4AN1A 2GDJA 1VHJA 4RFSA 2ZW9A 2CLFB 1DUVG 3SHFA 4JLSA 4DC9A 2H06A 3OU7A 2CJPA 2Y27A 2HIHA 5IBCA 2NU7A 1GGFA 2RJOA 1QO0D 4PWYA 1I3OA 4EHHA 4K9RA 1OQAA 3PPWA 2H17A 1JB1A 3KYIB 2QN9A 1J21A 1CS4C 1TA9A 3OEHD 2XMRA 3HKBA 3NAGA 1AV7A 2NSDA 2XUDA 3E3MA 4GKAA 2VAXA 4KIJA 1MN6A 5TF4A 3IVGA 5BT9A 1K5DA 2ZI5A 3HFRA 4CKZA 4URWR 3GDOA 3N6VA 16PKA 3TZ6A 4F4IA 3BIOA 3RRMA 2ENUA 4PQYA 3BRQA 1UPUA 2HUNA 2J41A 1EFVB 2EBFX 3UK1A 4QOJA 1N6NA 1M2OA 1UWLA 2AUMA 3E0QA 5E6UA 4XFJA 3AFOA 4COOA 5E7IA 2FN3A 2NXCA 5CDGA 2GN4A 3D4BA 1T9GS 1QH9A 3GRRA 3E1GA 2NO4A 2DFDA 4ZQGA 3GEGA 2M98A 2ILTA 2OGTA 3DMTA 1OSNA 1M83A 1I7PA 1UANA 3HGTA 4MGYR 4MQFA 4RXUA 2CXXA 2OYRA 6AT1A 1NU6A 3S1AA 6ADHA 2FMHA 4I1IA 4J3NA 5IFLA 1DTWA 1Y9ZA 3EA4A 4RIFA 3NH6A 4YS6A 1EFHA 1E9CA 1IG3A 3CR3C 4JEHA 4LXQA 3E9MA 3L43A 1P0QA 5JARA 3WMGA 3PDUA 3GRVA 4LV5B 1GPMA 3IVMA 3LL7A 1V8ZA 3NP7A 5IYZA 1SCQA 1IU9A 5ILQA 4RTOA 3U3KA 2DC1A 2VCEA 3K7EA 4CT5A 4Y2PA 1YMQA 2V5VA 1EWQA 1FMCA 2Q4DA 3EMKA 3NALA 1DKRA 1EESA 1VI5A 3M9LA 2JVKA 3VJKA 3L4SO 4M9XA 1OCEA 3PIDA 1I4DD 2Z2KA 1U7OA 2JAXA 1GCAA 3Q2IA 2GS9A 1H0SA 2PAAA 1X94A 4RELA 2RGWA 1JAIA 3K1JA 2AW5A 3ESDA 5BV2P 3SC3A 1T2AA 1MHTA 4NG4A 4FE7A 2Z1NA 4Q47A 2G80A 2OO5C 4Q66C 4L7QA 4UBLA 1ZAKA 2PS0A 2WAYA 3QVJA 4H7PA 1M1YA 4QNMA 4TV9F 1TQ4A 3GA7A 2JJMA 3CLUC 3DTTA 3KUKA 1HMPA 4LMBA 1E1QD 1K0FA 3IIIA 4UUOA 1K63A 4ZCSA 5SY6A 3IKMB 2Y0DA 4B7UA 1HLDA 2OK7A 1N1DA 4RVDA 2WTXA 5L4NA 1NKSA 2HRZA 5KWVA 5BWCA 1MA3A 4FEYA 4B6OA 4D4LA 5FLKA 2OV6A 5CJ2A 2TMKA 3B13B 3HL4A 1ZWKA 3IDZA 2F00A 4TKLA 2C7BA 5D3MB 5D6OA 4AJKA 5KMGA 3OJFA 5J2TB 2C95A 3T1YB 3RRNA 4YMIA 1YR8A 4HQ0A 4XQ0A 1LLFA 1RRKA 3V48A 3FTEA 3TYXA 2BLNA 2V74B 3DOCA 4TTAA 3SX2A 1AUPA 1V9CA 1H3EA 1KU6A 2AG6A 2QRJA 4QKQA 3BGWA 4F2GA 3ETEA 4JVSB 1MH1A 2FZVA 2WYVA 2XITA 4ESEA 1T3LA 1NE7A 2QY9A 4MIKA 1KNXA 5DNUA 5LLDA 4I4TF 4E30A 2FKNA 2BEJA 5JSZB 3SDSA 3NFRA 3NCHA 5H02A 3FCXA 3HNOA 2O1WA 1CR4A 1KI4A 2R86A 4DIOA 4QXOA 4G89A 4ARAA 1Q2XA 2JFYA 5LZ8A 5BN4B 3SY8A 4Q7KA 4BO5A 4EW1A 1UJMA 4CQLA 4PCUA 1P19A 4Q9IA 3FMIA 3FPGA 2PANA 4R1OA 1ZL2A 1KPHA 4H60A 4IDDA 4JP1A 4MQMA 4NBSA 5AHXA 5F33A 5AXBA 1V1JA 3HBMA 2NV0A 1RWBA 3A70A 2J67A 3WWEA 4B76A 1NDUA 4PX9A 2I8CA 2BGJA 2Y99A 5TXGA 4OKIA 4EUEA 4F8JA 5E4JA 1JHYA 4ZXFA 4K9PA 2QOEA 2BF7A 2VP5A 2YJ4A 3LPNA 4LECA 2VT2A 1VPTA 3MQ4A 1LLDA 3RVBA 4BLOA 2Z6UA 4XJVA 2OL4A 1Z0IA 1DBIA 2C54A 2WLSA 1AE1A 1XWIA 3ESAA 4FSDA 4YB8A 1E6UA 3DJYA 2KI5A 4PZYA 3V1NA 1PJQA 3T94A 2E4AA 1HNXB 2D62A 1V5WA 1DT3A 2G5GX 4IMRA 4XXHA 4L8FA 2UVDA 1JMYA 2ZG6A 3KYDA 4ZANA 1M8PA 1CVIA 4M1QA 3L8EA 1KFCB 4P58A 1NONA 2X4LA 5BPHA 3ZWQA 3O2JA 4KQXA 5EC8A 3NGMA 3UMCA 5HIAA 3AESA 1NN5A 1R5OA 1W85B 1WCYA 2J85A 3AR9A 4R84A 2HGSA 2PX4A 1PS8A 1FUIA 1N1EA 1G5FA 3CX6A 4DUPA 4FHEA 4X62B 3FFXA 5AXCA 2B6NA 1F1BA 2V3WA 4YIKA 5I4BA 3IE1A 1ND6A 3AMVA 3D8RA 4GI7A 4HY3A 1JVBA 1ULTA 4NBTA 4YVFA 1K7SN 2D1SA 5KWJA 1CRZA 2A4MA 2LKDA 1VLZA 1CW2B 1UZLA 1T9GR 2K87A 3MZ0A 1E0SA 3AI3A 5EI5A 3R8CA 3RYCA 1I2DA 4AIRA 3KE9A 2P4EA 4MWTA 5EKXA 4DLBA 4E4RA 4Q7JB 4UHCA 3BMNA 2LRHA 1W93A 3KBOA 1YGYA 3NTUA 2IYSA 2ZUCA 4JAVC 4U6NA 1EIWA 4RQAA 5LOVF 2B37A 3LRXA 3F6SA 4H27A 5C7YA 4J90A 4XJSA 4URFA 1W0CA 4EENA 5E95A 1AH2A 4G26A 3BRWA 5F5LA 3EIFA 2AR7A 4JR1A 5IUJC 1FNCA 3DZKA 4A8JA 3ZXSA 1XZPA 3TX2A 4JUIA 4G0WA 3WP0A 1MC8A 3PK0A 2BKAA 2G04A 3IUEA 4MPTA 5A4DA 1XTQA 4WVFA 3R7WB 1UINA 2C7VA 4MRSA 2ZWIA 3FDZA 1TM3E 3MOSA 2BMDA 3PUWA 1KVQA 3H83A 1EPUA 3CUEF 4JXXA 3CXRA 2OSBA 1P45A 2RC6A 3ZXUB 2I6QA 4QO7A 1QO0A 3IT1A 1L1EA 1LPAB 3NHFA 3VR2A 1U0NA 4YMLA 1YACA 1O9BA 5L9AA 3ZY6A 1DDIA 4CKYA 2XSZD 3VV3A 2VAMA 3BHJA 4UMDA 5KNDH 2VEOA 2AVDA 1EEHA 3E7WA 4OQMA 1GA4A 5GGXA 2QIOA 1NASA 5GVRA 5TQ0A 3TMKA 5BMVB 4YCMA 1EXDA 3WSVA 2JIRA 2YFYA 3GCXA 4WCDA 1RI1A 4G5YA 2GERA 5FYQA 4PX3A 4H6XA 2BHNA 3WMFA 5FKJA 1DV2A 4F11A 1F8UA 5JS1A 1BOOA 4H7EA 4LQ4A 2HZBA 2RD2A 5ECDA 1CE8A 1QLWA 1EVYA 1T13A 5JNVA 1KEUA 5LB2A 4B82A 2DHDA 1C1XB 3HVJA 4C9BA 1KZYC 3FOEC 3MS4A 2YR0A 1U0LA 4WINA 3H5NA 1UKCA 1II0A 3BRCA 4AQ7A 4B3SB 3W2HA 1XRRA 2IVFA 3PT5A 4DQKA 4QUBA 1NVBA 2HSDA 2I2FA 2LGJA 3ZWPA 2BKUA 2PIDA 3HCWA 2WI8A 1VG8A 4HVLA 2RARA 4FLFA 3UC9A 4HMPA 3E9YA 5B37A 3UMRA 2HSGA 4US0R 1G7SA 3Q9NA 4G1VA 1JWLA 4PNZA 5TLSA 2VK8A 3CEAA 1IEVA 2P75A 3V8VA 2B6HA 2HJVA 2R00C 3ZW7A 4EFDA 2QZ9A 1U2TA 1IY2A 4Y30A 3B5JA 4F5EA 3FPCA 4WCFB 4YMVA 3RS9A 1J23A 1YBVA 2P79A 4BXOB 1JQ5A 1E6CA 1ESZA 4Z2YA 3AIMA 3IV9A 3Q8KA 1BXRB 5F1OA 1Z4PX 4LY6A 3C8DA 4QUEA 1GPDG 1X7WA 3EEQA 4QREA 1Z18A 1T0UA 5E9QA 5H1YA 3SOPA 5F4ZA 1NRIA 2W6MA 4QHYA 3CURA 4QG3A 2PL9A 1S0UA 3ENVA 2IHZA 3OQPA 4HN4B 4QXPA 4BO9A 4BMCA 2Q1SA 4NH4A 5IT0A 3LDHA 4MRVA 4RKWA 4UHHA 5G4KA 5FA8A 2GN8A 4EUSA 1QE3A 2K2WA 4NNJA 4TL8A 1USUA 4NENA 4YMHA 4FGZA 1E1QA 4UTVA 1RHMA 4B2YA 1JKMA 4B48A 4IIFA 3G68A 3RSFA 5I8WA 1U2PA 2AA3A 2EBHX 1Q1AA 1UQTA 5CAEA 5CB4B 3HUTA 3OE1A 5DLYA 2A1UB 2CUTA 4BU0A 5IDQA 1HRDA 1SRRA 3VHXA 1LNSA 3G13A 1D2GA 4FYYA 1NN3A 3DEHA 3L8FA 3P9KA 4MAMA 3TKLA 2RONA 3KB6A 1P60A 1GQFA 3R3YA 3TLBA 3AQIA 4KWHA 4D9FA 3GQVA 3OZCA 1LD3A 4HLUA 5GONB 3WKEA 3ZCTA 3RAEC 1YZLA 1J7JA 5JBQA 3IOEA 1HXHA 1UDRA 3D1VA 1F5SA 1Q7CA 5IUNC 1BJTA 4YMSA 4WZBB 2OCYC 3AJ9A 4G5OA 4NU6A 3I2KA 1MW8X 3FYDA 3TBFA 3KS9A 3BDIA 4WMLA 5CFNA 1QHIA 1NXQA 1R2QA 2X23A 2YIMA 4JKOA 4RCVA 1QPGA 2VH2A 1EHIA 5F9MA 5AW2A 4DILA 2YUTA 4TKMA 3TZEA 2ZAYA 3QI7A 3T5MA 5ELXA 2YZKA 1CJVC 3FOWA 1LBHA 3KHSA 4WWHA 5BNFA 2BDTA 4OKNA 1V11B 3L0CA 5JADA 3EXIB 3QELB 2O50A 3TUZC 1XJ0A 3WISA 5AW0A 3CIOA 4MDYA 4X1IB 3WAGA 4IF4A 2ZREA 3THOA 4RK5A 1NWHA 3NO4A 1E89A 1SUWA 1VGVA 5CP8A 4AECA 4CKEB 1K3UB 3AHEA 3I4CA 3DA8A 3OKCA 4D02A 2H11A 2YZGA 3WL4A 1VJ5A 4O29A 2GBPA 2Z5VA 4WY2A 1N6RA 3OVMA 1JL3A 1IJEA 4Z54A 4XYBA 3VH3A 3TI9A 1DMRA 3DMYA 1CY1A 2Q9CA 1NA5A 1OFUX 1G8HA 1GLNA 1M7HA 1K4MA 4D3XA 2HN9A 3IP1A 3LCJA 4RTNA 3A05A 3LQKA 5JMTA 1SKAA 1W6RA 5C4GB 1UM8A 3NHLA 3ZY2A 2E89A 2CT8A 1L7AA 1S01A 2C07A 2WTMA 1VYUA 3FROA 1W29A 2XUFA 3EZXA 1RVV1 3PFKA 1NOKA 4H7FA 4YQYA 5K3DA 3Q5DA 5THKA 1FU8A 2BF4A 5ALDA 4F1KA 2A5DA 2GO1A 4TKUB 2V5AA 3U1TA 4PTYA 3ZDQA 4OF4A 5A6SA 4NCIA 3ZHVA 3FKJA 4HTFB 4Q21A 4RYDA 1RJ9B 3GT7A 4P4LA 3OI7A 4PTZA 2ZRKA 4W9NA 3RSHA 3NS7A 2ZQZA 1EFCA 2EIHA 1UMCA 2P40A 1WV0A 1P3JA 2F59A 3TVYA 4V3CA 4BVLA 1KK0A 2MINB 1VDMA 3R09A 2FLKA 4RHFA 1E2JA 3MSCA 3STTA 1BAPA 2Q8PA 5K3FB 4WHMA 3D8NA 3E7XA 3M8KA 3K53A 4OO3A 3RS3A 1MABB 1VQ1A 2IYVA 4HDRB 1TA4A 3AFNA 5TGDA 3S4YA 1FBNA 4GLFA 4XLTA 3O0DA 1JRLA 3LMKA 4TQ9A 3TD6A 4E4TA 1NMEA 1Q15A 2A5GA 4MJ7A 1H2WA 2VDRB 4XM2A 3K0KA 3MWLA 4MIYA 1WB4A 1Z6AA 3DP9A 2WHPB 1COWD 1KVTA 2I4LA 2XMZA 4FFBB 4O0LA 1KY3A 4TTIA 4YLEA 4GO1A 1IWBB 3MBOA 3O9ZA 5EXDA 1NNLA 1ZKMA 2G82A 2HC9A 2CJFA 2FSHA 2UYGA 3A3KA 3ZHBA 2JCSA 4PY2A 5ALWA 3L4EA 2F8TA 1A98A 3ZTYA 2NIPA 3EAGA 2CLCX 1IHPA 3ZK7A 2VG8A 5CM8B 4JOSA 3DVRX 5FPSA 4DIUA 4XDHA 1FSSA 2IWRA 2Q3FA 3UT5A 2IDKA 3K9GA 4QO8A 5G3ZA 4EJ0A 3QP9A 1SCJA 4HWOA 3X1ZA 2MOKA 1E5TA 1PZGA 4V2UA 5AKKA 2G9ZA 2GO7A 2Y68A 2VDQB 3ZIAD 2G8LA 3ZU2A 3O38A 2ZAOA 3GRPA 2I71A 4M4SA 4DBZA 1EFKA 1ZIDA 2WFAA 1RXSA 4RXTA 1B8NA 2O57A 5DE3A 2PXAA 2R5FA 3LXUX 1C3JA 3HEAA 4X54A 3S28A 1GLGA 2YUIA 3HJHA 4Y2YA 3IX7A 4F56A 1DC4A 1T29A 1JJ7A 2EFDB 4H08A 3ZOZA 3HDGA 3NYWA 3E05A 4ZU3A 5J58A 2QROA 2VJDA 1OX5A 2OXFA 3GNLA 3RAPR 1PT8A 1Y82A 5KYVA 1T5SA 3RC3A 2QF7A 1NMYA 1IQUA 5F23A 1VA4A 2XH8A 4D9HA 4I1RA 1M2EA 3OT1A 4OB7A 1QZTA 2VTDA 2RGCA 3R3WA 4LWQA 1JQBA 3MOIA 4BFLA 2LE0A 1E2GA 1M2FA 1ZK4A 3AHIA 5TS2A 5AW6A 3ESBA 4E7PA 3L40A 1WBDA 3GQBB 5LLSA 5A05A 4M8KA 3Q85A 2JAUA 4IMIB 4RVCA 4Y6OA 1BVRA 3U37A 1V9LA 1Y42X 1KWKA 1E3EA 4W7IA 1PEAA 2CVFA 3GPDG 5FPHA 2OFOA 5L3RA 5C52B 2C7QA 1QR2A 1RWXA 4G0QA 4LVUA 4LKOA 5C0OE 5DNYB 3F9RA 3UXHA 4FNMA 1U80A 3SBOA 2WF7A 2XQVA 3HZZA 2JLUA 2ZTHA 2A9KA 1I10A 1FVHA 2FX3A 4L6CA 4QJIA 2I3BA 3RH0A 1C2TA 2ADFA 2HRQA 1RRFA 4N6OA 2IUSA 2OORC 1G5TA 2ZRFA 2FQYA 2VRBA 4AN4A 3SSOA 1G8GA 1Y9EA 3KOWA 5IM4F 2OO5A 4RBNA 4DRZA 3DOIA 3C3DA 1XT6A 4NXMB 2XEDA 4WFIA 4C0XA 1E60A 4ZVRA 1SHUX 2EFEB 3NETA 4MUEA 1Z75A 1QHFA 4TMFA 2EC5A 1B3BA 2QTZA 4ZZ0A 3P2EA 1J33A 1A2OA 3LUCA 3PHLA 1TEXA 2Z0MA 3GWGA 3IJRA 4BQRA 3T5AA 5IM5A 2G76A 5AVZA 3M7IA 3UICA 3HCCA 3D8HA 4YXWA 5G0TA 2ECPA 1KMNA 4YPOA 4LC0A 4N6GA 3ZQ6A 1ZUNA 3IKVA 1M8KA 2AH5A 2JS7A 5ECGC 3ZNNA 2PUDA 3IERA 3WO1A 2YKGA 3NOQA 4JLAA 1KEVA 2ZR9A 2IXTA 3QEMA 4K6GA 1NI5A 1CDEA 1EHCA 3O4RA 3WLMA 2G36A 5LP6A 2Z4TA 3DZCA 3C6QA 3ON5A 5FOSA 3ZR4B 2Q6LA 1F6WA 4U7DA 3LUJA 4PG4A 1QTIA 2WIDA 4S1TA 1A8UA 2E5FA 2ZJ5A 4W8HA 3ROQA 3VU9B 2AOUB 4BNTA 4CMCA 2BZ0A 1A8IA 1NZDA 2R1VA 3VOBA 4B6GA 4MQEA 4KRGA 3SXJA 3ILVA 3UBMA 1J8MF 4IXNA 4LVCA 5K6AA 1XNGA 4B6SA 1NRXA 1PQUA 3N53A 4MGHA 4ZO8A 4YO8A 1CQJB 4HRVA 1TGVA 3QMPA 4F38A 5EWMB 3R9WA 1ZMRA 2Q3EA 4BZPA 4TUYB 4ZHQB 1CY7A 1WBBA 4DXDA 4DQVA 1RQ2A 3R3XA 5EL0A 2Q49A 4K87A 2UVPB 3UJ9A 4BUCA 1QV7A 2O1SA 1HE5A 3I64A 2CHFA 2WICA 1TEHA 3I39X 4QJ3A 5M2QA 4NFLA 2AR9A 2EYQA 2HA2A 3B1WA 3Q7SA 4W5WA 2GHTA 4U2GA 1UQUA 3FPAA 4CHGA 5CA0F 1K2WA 4R2KA 2QA5A 1DDGA 1WMSA 4YRDA 1GGEA 4BRZA 1ZRHA 4NG5A 3GPLA 3CEMA 4BX8A 1AQLA 3L8GA 1KQ3A 2OQ2A 1H2RS 3UT0A 4AJNA 2HDOA 5FAXA 4BGDA 1RXIA 3E9RA 3QVGA 3RIGA 2P9EA 3U7EB 1CIVA 5FX2A 4OJNA 2J4FA 1V25A 3GH1A 4ZZ2A 3RIXA 4FX5A 1B7GO 3A6FA 3OKAA 3RM3A 1N78A 1B8OA 2IOQA 4KPEC 2C5HA 3AVQA 2BOVA 4UU7A 1C4OA 1Z5NA 1CY8A 3CRNA 5D3KA 1U7ZA 1JSRA 1YB2A 4OQEA 5T4BA 2VBFA 4C7BA 2DR3A 4BEVA 1SEPA 2DBZA 4X8MA 3M49A 1ODFA 4I55F 3A1DA 1ZVQA 1WHTB 2R5NA 2CXUA 3RYTC 4C22A 3NUQA 2JFNA 4CDGA 2IYXA 4IG4A 4ECAA 3L8ZA 2XMBA 13PKA 1T3HA 1R4MB 2OLEA 3CO0S 3IRUA 3JZIA 3QNMA 3S8EA 2XZLA 4PGAA 3UJ3X 3WAJA 5JCJD 3QLUA 1IJKA 2UVQA 4NPHA 4J1SA 4NBNA 3NBKA 4NQZA 4GGPA 4W9RA 4RC9A 4E46A 2H1FA 2CKMA 4KZKA 4FC7A 1MQ8B 3OCCA 1E6LA 2RH4A 3ETCA 3R5JA 4Q1EA 1Z5UA 3WOHA 2OBFA 4BFXA 1VDZA 3BXGA 4D8VA 4EJSB 3QLVC 2MYUA 3QF4B 3BL5A 2UAGA 3GGSA 4EQ6B 4ZGWA 5TMPA 1NNSA 4JJAA 3BGIA 5AK3A 5F9FA 4D4MA 1EEXB 2WJAA 1QMGA 3M5DA 1I7LA 1PEKE 4NABA 4REQA 2CDCA 3LRTA 4CLHA 2XB4A 3ITEA 5LR6A 4NXNB 3SR3A 2P5UA 5AH0A 2DSNA 1OX6A 4AYWA 2DH6A 1BO6A 2A57A 1QBKC 1P2TA 1GZSA 3RYHB 5GTDA 2P41A 4L3WA 4ZEMA 4ZOAA 2V7WA 1AGYA 3DXFA 3PE3A 4R9UC 4EDFA 3DE1X 4Z99A 2E5WA 3N6RA 3FGPA 1HKHA 3P20A 5KJFA 2FPPB 5HZKA 3GLGA 4X6LA 2P6PA 1L9KA 4PC7A 4WOCA 1BYIA 3MPOA 4PAOA 1JG4A 1S4QA 4RH3A 3DC7A 4CU2A 3AERA 5FIUA 1S4MA 3VSAA 1I3MA 3TIGA 1C41A 2D06A 5BN3A 1NU8A 5EUCA 4NOMA 4KIFA 4JP2A 1JKJA 2WNIA 2REBA 3C4QA 2BPOA 4XLLA 1FLVA 1SVWA 1R0RE 5B30A 2IEBA 1ZEMA 3H65A 1M1NA 3FMFA 2OM6A 1QO7A 3GGDA 3EGXA 5H9VA 1IZ7A 1ODSA 2IZ1A 3KOOA 2PGAA 4J1NA 3X1MA 2XR1A 1Z7WA 5KTYA 3O8NA 4R81A 5E0OA 5CD1A 2ZRDA 5EJMA 5LYJB 3D3EA 3LBHA 5GINE 2Q5JA 3U7QB 1GUFA 2VP6A 1Y4DE 5C5EA 3RB8A 3AYXB 2DPHA 4EGAA 3D4LA 5DIFA 3WAKA 1M2GA 3KAJA 1AUOA 3SC2B 3DULA 4WBNA 1Z5PA 1ECLA 3QHAA 3BJMA 3DLAA 3W8RA 4WXHA 1QP8A 2VVTA 3NHAA 2FXIA 3DGEC 4DLKA 3WYCA 3D3QA 1E69A 1GQYA 2F55A 2GKGA 7ADHA 1A71A 4DEYA 2D5CA 2NU6A 4I4CA 4EGQA 3VV2A 5FLXA 2QGNA 4A36A 1H0HA 2XYVA 3ABQB 4N54A 5THXA 4LFCB 1DWQA 5EMHA 3OD5A 5FNZA 5J47A 1Q16A 4FEEA 3ESCA 3JAKA 2DFVA 3HCBA 1VBFA 5D3QA 1SD5A 4CEJA 4N40A 3TBHA 2F7SA 2ZSFA 4QU5A 3N8HA 4OHBA 3O91A 2BUAA 4CWAA 3AR4A 4FOLA 4HQFA 4D3YA 5BRAA 1ESMA 4EPYA 1VE1A 4DLVA 2UYHA 4RWEA 3BE6A 2ZJ8A 2Q5HA 4BTVA 2G77B 4DIKA 1BRTA 1WXDA 3R0IA 5JAHA 1RKVA 3AR8A 5LDGA 3K0EA 5JNUA 1X87A 2A59A 1KQFA 2ZBQA 1NVUQ 4A26A 4GP6A 1HG0A 3H2GA 5EQFA 3DF7A 3Q2OA 1NULA 2H16A 2ZJZA 4FTWA 1EM6A 1I4OA 1MZPA 5TQJA 3LQYA 5KC9A 3KOXA 5DSXA 2W98A 1YTLA 4A1FA 1BW9B 1T10A 1BMFD 2D5AA 4GLBA 5FTWA 1I7DA 4J49A 1OKKD 3JZFA 4OJQA 2LW7A 5DYYA 2P6NA 4F7WA 5C8VA 2PGNA 3GZJA 2JFZA 1JU3A 5JZ9A 2C88A 2CLOB 1A96A 4ID3A 1OR8A 2YINC 2GXAA 2J9YB 2MMGA 3CB2A 4KW7A 1KIMA 1T2DA 3W5IA 3I8SA 3EJWA 1CZHA 1WY7A 2HK7A 5K09A 2X9QA 1BFKA 5KX5B 1N5IA 4XR4A 5EJGA 2XQJA 5CHYA 4E0BA 2GA8A 1JSLA 1TKRA 3HCAA 4PYQA 5DBGA 2EGHA 4HDSA 5KDLA 2CHVA 3UXMA 1ZOIA 2JPDA 4LMRA 1GGVA 5IFKA 1Y9DA 1GYRA 1VMAA 1SC4A 2XE7A 2BM0A 2CL5A 4DG5A 1AZSC 4LRQA 4XB1A 5AI9A 4DVGA 4PLTA 4RJIA 1DG9A 1UQRA 2X58A 3FHOA 1I94B 2QBYB 3RYFA 3O8BA 2BUCA 1E99A 2Q1XA 3HP1A 4N65A 3RRBA 3PEEA 4BVKA 4MXDA 3KE8A 1Z4JA 3MUFA 2ZQYA 3F4KA 4N0EA 3RV3A 2P1ZA 1LPPA 4HSEA 1OLUB 3K72B 4IH9A 1ML4A 4NBKA 5JLJA 4M87A 1T1JA 4RD6A 3WRYC 3G5UA 4MTCA 3M4YA 2JJQA 3DKRA 4CV1A 3M6WA 1Z0FA 1DI0A 3Q88A 4PSAA 3FWPA 1HDZA 1WAMA 2Y1KA 3H1TA 2HWUA 4FDTA 4AF7A 1QSGA 4KPGA 3VM6A 1DBPA 3EWIA 8GPBA 2D5LA 5K99A 1Z6YA 2AUNA 5A7HA 3ZD7A 3W7AA 2OYCA 4MV8A 2ISSD 2Q6VA 3CZRA 3N8GA 1DJMA 3WMRA 2IYRA 4B33A 4B0PA 3CKYA 3BAZA 1XDUA 3LLMA 1AG9A 3ELUA 5JXHA 1V6CA 3VBCA 2HT6A 2CE7A 4X60A 4CIDA 1M2JA 4JOCA 1I1OA 1B0ZA 4TX1A 5E3IA 4MDEA 3LCCA 2ODBA 1RCUA 1XRSB 5A5GA 1T35A 1DG3A 1M3SA 2HJSA 5DHSA 4BKQA 1B26A 5NULA 1W5BA 3KR9A 1G8MA 5IC4A 2K7FA 4JL5A 3AY0A 5HFJA 5F5XA 3T35A 1E79A 2VBCA 2ZDGA 1ZK1A 1ZN2A 3GFGA 5DF1A 5ICFA 3P2YA 4YIHA 2X0JA 4RY0A 3BDVA 1XYGA 4FGUA 1QGUB 5EN4A 1A9PA 3KAKA 1L5NA 1YOVA 5HCNA 1C0PA 2X13A 2G6BA 4MP8A 1YZTA 4E13A 5A9RA 4HAYA 1YDGA 3GR6A 1VIYA 5TMDA 1DJLA 1ZZGA 3ANMA 1VHDA 2DPMA 2WWFA 4GXRA 4R7ZA 4PSDA 4RV9A 1YRAA 3D8UA 3ME5A 1M2VB 4DIBA 1FX0A 2ORVA 2O59A 2CFIA 4L8GA 4QXMA 3D6TB 2BGIA 2EFGA 4HFNA 4IXDA 4L4YA 4UBJA 3NT4A 2CNKA 3CYFA 5ES3A 1CG6A 2AIRA 4D82A 1NYQA 3ZHQA 3DBHA 1VIDA 2BONA 1RADA 5CW1A 4YGYA 4LJKA 3T8YA 3KQVA 3GJZA 3PRKE 4GD3Q 1PW5A 4DCGA 3BORA 4MULA 2I3DA 4PNPA 3Q6IA 3UUWA 4IXMA 3FETA 2CHUA 1VPWA 2AWNA 3RK0A 2A5LA 1OBCA 3LO5A 2QL9A 2X76A 3CZ4A 2HLDA 4H0FA 1QYIA 1Z15A 5CDFE 1L7MA 4G07A 1M7GA 4W5HA 5E0KB 4N18A 4JLDA 1HR0B 2I4IA 3NDJA 3R7SA 2P9TA 3KPJA 3BIXA 5K8IA 3RVSA 4DRXA 1RW4A 4LF4B 2OORA 2B78A 3L01A 1D8AA 2FZGA 2GBFA 4J0DA 1XMSA 2NO9A 1YU9A 1R0XA 4QTYA 2C5SA 1KF0A 1Y48E 1YJAA 1QNFA 4KYVA 4WK6A 4F93B 5KYYA 1DKPA 1CIPA 1S3FA 2GCOB 3EDOA 4EAAA 4PO9A 1Q0PA 3SKYA 3TEMA 3UCEA 1PWEA 1VJ0A 1B42A 1H8EA 1O87A 3NLLA 4KNWA 4KVZA 4DVJA 3TDMA 1WZEA 1JEOA 1E3LA 4GEGA 2QRNA 1EX6A 3JWIA 2VHXA 1R0BA 3W8DA 2CF6A 2BGGA 1PGPA 5G1PA 3B85A 1T4CB 5LQNA 2WG0A 1WTAA 4GMHA 3ZQJA 2HF2A 5K8CA 2NMVA 1YR9A 1IL0A 4H16A 1I6MA 4FB5A 1K3TA 2O8VA 3SC4A 2POCA 3CZ9A 2PCLA 3HLKA 4HZUA 4M8SA 2Z5FA 4WACA 4DHEA 5AOAA 1JG1A 1ZIXA 4L4ZA 4ZKEA 2IYUA 2JASA 4FHDA 1GXSA 2RK4A 1B6GA 3RASA 3D3WB 4QM7A 3GD5A 5SZHB 4K9MA 3SG0A 1N5OX 1YWGO 4G8DA 3KQKA 1BS1A 5BV7A 1EDDA 3BL6A 2WP8J 4UQOA 4ZO9A 4CDNA 2BWJA 3NWJA 4N3NA 5BSTA 1Q3TA 2QJRA 2VYNA 1WEKA 4BEBA 1NFFA 1UKAA 2AFHB 3C6KA 5GV7A 5TQ2A 3STYA 1XKLA 4WAUA 4XD7A 2X42A 1OKKA 2PMKA 1A9SA 3ETDA 3KEMA 3N8IA 4ZPXA 1D1SA 2A35A 3GP5A 5D7BA 1I5RA 3GEHA 4Z8YA 5DM4A 2GEDA 4IH1A 4RSHA 4R2WA 1Y3FE 4ZVPA 4IDQA 1UBRS 2J0UB 4EG5A 3VC7A 4WPGA 3HB7A 4PVDA 3BXOA 3W2FA 5CLLA 3T0GA 1WO8A 5BPFA 2PZBA 2IKSA 5AKYA 5FAKA 4JX9A 5LM3A 3A9SA 4YCSA 3OX1A 1WVIA 3VX3A 3GMSA 4OQPA 3PF9A 5AM4A 3L05A 4UKDA 5A3JA 5BSUA 2ZSKA 1HDEA 2FJPA 3WWDA 1FZTA 2I87A 1RM0A 1XTUA 2ECFA 4YBZA 4NYIQ 3CSUA 2VP9A 4N8SA 4JLKA 3BZWA 3BD8A 1W1WA 4O4HA 1NJ8A 1R0KA 1HYEA 1VECA 3OTGA 3A2LA 3T4UA 2WTAA 1S8FA 1PQPA 3R9XA 2VTBA 2FPIB 1C3XA 4BMVA 3QV1A 4LHYA 1MJ5A 2G9QA 4WCFC 1QCZA 2AJDA 3RU7A 1L4GA 1ZGGA 3ZV4A 2ZXFA 4BBPA 4CCYA 3ZKWB 2GAFA 1Q1EA 5AW9A 4DKJA 2CSUA 3FGOA 4LRXA 2V7QD 1QVRA 2XMDA 3RRYA 1OZ0A 2OD2A 1JAYA 2GXSA 4ER7A 4C6HA 4EEZA 5A62A 2W43A 2MSNA 3BYZA 5YASA 4I6GA 4MR7B 2D6FA 3FLEA 1QQ5A 4BNIA 3WDLA 4X94A 2W93A 1P9NA 1DQPA 3J7TA 4DJAA 4GBJA 2YIDA 1QE0A 4DLPA 3RRXA 1CRWG 3GGOA 3B1VA 4UE6A 3VGPA 1N9GB 1EK1A 3BCUA 3W7BA 1KOJA 1KP2A 4HCJA 5T8KC 1R27A 4IJWA 1SCUA 1DLJA 1QQTA 4J2HA 4QC2A 5LN1A 3I5YA 1EBUA 1D5WA 1TMYA 3IODA 3M4JA 3FUCA 4CIWA 4LI3X 3QLVA 1XLTC 4GBMA 3SYNA 1M74A 4Y2HA 5GQSA 3SPXA 5ALRA 2JHFA 2VJKA 3IAUA 3WHIA 1D2NA 3WIBA 3FYCA 1UJ4A 4FPXA 1H2YA 2QQFA 4WFQA 4WNYA 2C4TA 1V7ZA 2COEA 4DLTA 1X9HA 3A6JA 3D3JA 3ZHCA 1KQGA 3CC8A 3GFTA 2HEIA 3TN7A 2HU5A 1VLMA 3WZ2A 1LNZA 3EPJA 2VHEA 4N7MA 4FT4A 1WLYA 2HQSA 2OCBA 1ZI6A 1QAMA 1BU8A 3KV3O 1U0SY 4NJOA 2AN9A 1P4JA 3VZSA 4PICA 1C8BA 1YIAA 3VZPA 5IZCC 1LQ2A 1L5WA 2JLVA 3UF0A 3T3OA 8ADHA 5JUWA 5ADWA 1U4OA 4L73A 1XD2B 2ZYRA 2H6EA 1UKEA 2NVOA 3EIQA 1WVMA 4MJ3A 3HJNA 4Q3KA 2OO3A 4X3OA 3O1LA 5CDYA 2VJNA 4O4LA 2WQ7A 5JZMA 4A1OA 3ZD6A 3AKCA 4EFLA 5JI2E 1TYAE 2R8OA 2ZE8A 4RIEA 2BFCA 3VR3A 2Y8EA 4IGKA 4GW3A 1AQIA 1TKBA 2ZWVA 2ZYHA 3TIIA 4C01A 1ISFA 4F9EA 5K8LA 3THYB 4RKYA 5ESWA 4LHWA 4IIJF 3SJCA 1EGQA 4O3MA 4KAJA 1Z4KA 3QEJA 2J33A 2Y0EA 3JQRA 4LMPA 5AESA 3QVOA 1G20B 2HSZA 3AI7A 1ABFA 1UJ6A 2I55A 3QXGA 2R62A 2JI7A 3BIJA 5DH9A 5TV2A 1F17A 9LDBA 2CV0A 2X8LA 3D2CA 3HTXA 1YBHA 3EODA 5C1IA 1VE7A 2C2WA 4L4SA 2IHTA 2MT9A 3ZH9B 1UDWA 1Y3BE 2XMPA 5J43A 2HBRA 4RO0A 4IO0A 1S2DA 4JEIA 4RKFA 2NYAA 1OAAA 1JHDA 4NK4A 3B3AA 2NZYA 4G1EB 1QGOA 2ZT5A 1E63A 3EXFB 1RMYA 5LBIA 5I4IA 1C4WA 5JCZA 1LC0A 3G88A 5A5DA 3K8OE 5ICGA 2WHQA 5BSGA 2C3OA 2PL5A 1FB5A 4NY1A 3WMXA 1YDWA 3K2EA 2CCGA 2JFOA 1IMOA 1ZW1A 3DVQX 1XHFA 3W2IA 4P0TA 3MWGA 5E6RA 1OIXA 1MFZA 1QOZA 4IVNA 1NPYA 2Y2UA 1A3CA 1RJEA 2OC4A 3HKEA 1LZKA 1QX3A 1XZDA 2QVCA 4J2OA 2HMAA 5IH7A 3COPA 3KDAA 4JT9A 5BOSA 4AKSA 4U7PB 1AZWA 1LA2A 2PSJA 4WKGA 4LJ6A 2IUTA 1GCIA 4Q9DA 3CX8A 4MVWA 4Z9AA 3N2KB 3GVXA 4OBWA 1WSWA 2I6UA 2RK3A 3UV7A 5KWSA 3F47A 1EXVA 1V8OA 3IUYA 5BWBA 2RFLA 1SULA 1LK5A 1KVUA 3WJ7A 4OK5A 1BE0A 2CCJA 2ZIWB 4KJZA 4K9OA 3V4FA 3VJRA 1DO8A 4RADA 3KZVA 2OBXA 3O4IA 3WYDA 3EPHA 1E9AA 2DUWA 1ZJ5A 1Y6GA 3F98A 1HLGA 2V3CC 1GGJA 1GNRA 4K1XA 1QG6A 4XR9A 5ED0A 5ALZA 1LBIA 4UZSA 1BXKA 2H2HA 2PH5A 1RAGA 4RMNA 2NUAB 4IL5A 2EKLA 1I3KA 4ZD6A 3I30X 3KOUA 2GA9A 1DB3A 2ZDQA 1T6ZA 4YEDA 5IP5A 2B0CA 4BLSA 3AETB 4PYMA 3D2LA 2HK9A 1J20A 2R8PA 3AOEC 4DA7A 5DULA 4K3UA 5TRTA 1K7EB 1HLFA 1XWFA 4OYYA 4DTIA 1NJ5A 4X44A 3MWKA 5AKHA 1N2EA 1URPA 4PLVA 3BA6A 3FM9A 4QUIA 4IZIA 4EKNB 1RWOA 1IOVA 4FFDA 4HI0E 1SZPA 1F0YA 1NVVR 2OOSA 1HC7A 1BXZA 1B93A 2FEKA 4B7ZA 1T9KA 4LKRA 5CEJA 2Q28A 2ORWA 1YCDA 2HU8A 1SR8A 4PRZA 1KYIA 2JBAA 2PA3A 2QDXA 2X7HA 3DEFA 4P93A 1O6FA 4B6RA 1T5HX 3SF0A 1E9DA 1YRLA 5E1OA 2QNIA 2B36A 4FBGA 1H1LA 4Y6PA 3QEAZ 2C3MA 1ZM3A 4CLRA 1A9TA 1LDNA 3O82A 4CLOB 3TL2A 4EZBA 3G2LA 3VNVA 3UJNA 3QEKA 2YMPA 5DSTA 4AMVA 1SVSA 2HBYA 5FPQA 4DC0A 1E2HA 5A06A 1Z5OA 3MTBA 1MCZA 4PYRA 4CV0A 5HKBA 2WUFA 4Q37A 3RUHA 2F3UA 2JLAA 3OURA 4QG7A 4V1CI 3TEFA 1VSBA 5SYAA 4Q7LA 3WHPA 4C7MA 1TK3A 2AZ4A 3D6HA 2ZKIA 3QLTA 1HT1E 1TUBA 3WRYA 4CKCA 2VTVA 2PUFA 1NWCA 1GNQA 1WUTA 2H65A 3BUSA 2UZ0A 1O4WA 3CNLA 3EVAA 3HO6A 3P96A 3PNKA 2OAEA 4PNHA 3WFIA 3EZ7A 1G7TA 3TW4A 4LCBA 1EZZA 1CCWA 2J9GA 2Y1FA 1NXVA 4I4TB 1W59A 2NVBA 1SPBS 4O8CA 4FJ2A 4UHJA 4UZFA 1CIJA 4ZOLA 4KQWA 2OGSA 3PUJA 3CLSD 3PC2A 5DDIP 2COKA 1E2LA 3B70A 1GPLA 4IJUA 1DKQA 5AW3A 1T4GA 2FSFA 4R54A 3OLYA 4OBXA 1JIXA 1V1RB 5EZYF 3IAS6 1I36A 3HLYA 2A9PA 1YV9A 3ZWBA 4LJSA 2KHZA 3BB4A 4N3CA 2Q0HA 3NV7A 3L7YA 5CBPB 4RCYA 4L8VA 3W9YA 2YZ2A 1GHTA 4HDCA 1JBEA 3AX6A 3AXSA 2NXWA 3P9ZA 1SQFA 5JY1A 1VKHA 1Q17A 1GNVA 2JFBA 3P26A 3ZX4A 3X2EA 4P92A 1U31A 1ZRMA 4PO3X 3UH0A 1DZIA 2XWQA 2ZWPA 5BN4A 1SIBE 3G5TA 2AV6A 3A4NA 3EG5A 3TX6A 1PL0A 5LQUA 2R1TB 1RRMA 3VC3A 2EDAA 2QZJA 5T64A 3T5CA 1ZJWA 1EA7A 2XYRA 1LQTA 3VFDA 1NVWQ 2EJWA 1NBME 3AVOA 5FBZA 3K31A 2VJMA 3SIPA 2OHJA 5J5CA 3M3HA 2DTDA 4NE7A 4TOIA 5LQSA 3AVVA 4WRRA 2V7BA 1XU4A 4RA9A 4D74A 4DV4B 2ZOSA 5G0UA 3DKPA 3CTMA 4YI3A 1CRPA 3GWZA 4GMXA 4GP7A 4HX5A 1LB1B 4EG3A 4R9SA 2XCQA 1U94A 1PWHA 4DLSA 1MIOA 3C39A 2CLEB 3GDWA 2CLHB 3OIGA 5MDHA 2ZK7A 2W6NA 4RGQA 5B1DA 1Q14A 3Q3GE 4JYZA 1GYQA 1SCDA 4XZ3A 2X5KO 3NWOA 4XVUA 5MFZA 1PZNA 1YRYE 4EDHA 3TINA 3NAMA 2C94A 1Y6ZA 3DE5X 3FPHA 3T7DA 4YV1A 1NRWA 4O1IA 1WEHA 2XODA 3B9PA 3ZOKA 4YAFA 2NXJA 2PQMA 2WIAA 3I2HA 4J16C 2JEYA 4QT4A 3WRVA 2A0FA 3C3CA 3D59A 3UKOA 1L5HB 1WTCA 1ZIPA 4IO1A 4G81A 2VPQA 4U8GA 2PM8A 3NNDA 2NZ8A 4ILKA 4QYIB 1BEZA 1R8YA 4PAGA 1C9YA 2B20A 2VJOA 2VSOA 4MO2A 3RVLA 3TRFA 3AUUA 3I2JA 1PLKA 2V9ZA 5LOVB 1TO6A 3G1WA 3A37A 2XXJA 1ML3A 2RGNC 4XM0A 3N3AC 1LBEA 2HQRA 3L0IB 5DJ5A 1UBLS 1XWWA 3EVNA 5EJAA 3KZCA 2W83A 2PS1A 3DEYX 3AZQA 2JLXA 3D4IA 2QWXA 2IF2A 4PQRA 4DNPA 3OKPA 2XVYA 3KT8A 3F1LA 5C1PA 4HNAA 3ZEIA 2QQ0A 4I1OA 2ZRIA 4OI0A 1P9RA 4NZNA 3ESYA 4DMGA 4NMLA 4RMGA 2VOJA 2ZITA 2GZMA 4ZEWA 1ZGAA 4Q1BA 3ZJYA 2QTGA 2JJ2D 4EJSC 2G0AA 4YMWA 1Q7TA 6LDHA 3G5MA 4NEGA 1TEZA 4B31A 4EW6A 1EDBA 3EEBA 4MLZA 2BFAA 3EHEA 2ZAGA 3R7WA 3FW1A 1TMOA 3MJRA 3OIVA 1EWTA 5CX1B 1OFTA 1BYUA 2AYYA 3BEOA 5GP1A 4C5AA 2DBRA 3GDGA 1R8JA 3VJLA 1G20E 1QVWA 1R8QA 3NTXA 1A8QA 3D7RA 1PDWA 2B4YA 3PC7A 4X63A 3GAMA 3CTPA 3PYXA 4K6MA 2RHRA 5TJHA 3SDBA 3FTPA 4E07A 5BMVA 2EFYA 1VCIA 2IZ5A 1E2IA 3DW3X 5FPKA 3IMGA 4INJA 1RYEA 4NS4A 3DWIA 3WLQA 4IKOA 1CNEA 2GNOA 2MYTA 1MQ9A 4L1KA 4R2XA 2YWHA 3IAFA 5AIBA 4FYWA 2IX3A 4D0GA 2FZKA 4OI1A 2EVWX 1JHUA 4GZMA 3H9BA 2XWSA 1JLSA 1DC6A 2EEZA 2GTPA 4JB8A 4JI3B 3TRKA 4F8YA 1P1IA 4FU0A 8LDHA 1CUZA 2FSSA 4IDHA 3I6BA 4MWZA 5I5GA 5C8YF 1NLYA 3WLKX 1AY0A 1NUHA 4LOHA 4XIYA 3W8EA 3M9WA 2O3RA 4XEUA 1GM5A 2AD5A 4ETIA 1D03A 3VUFA 5I7FA 6GPBA 1XEWY 1GO2A 5FWXB 4DOMA 4M89A 2H0RA 3N9IA 4ZAWA 3QKWA 2B21A 2I8LA 4E88A 1J5EB 1H85A 4BQIA 4I0WB 3H9CA 2A0WA 2OO7A 3E8SA 2QVXX 3WB9A 2NVUA 3MG9A 3OUZA 4GPIB 3O83A 2WDPA 5KVAA 3TCXB 4W5QA 1SXJE 5KQSA 3GJXC 4U3JB 5B55A 4ZVMA 1P61B 5B7NA 1T2UA 4MUMA 2JEZA 3WQQA 5KUTA 2X8BA 3IQHX 4MB2A 2ZUBA 3MMSA 5ILGA 1UZAA 4PYKA 1Y9AA 1DC7A 4BP3A 3HO1A 1C30A 1RHQA 3TG2A 2PLWA 3DAPA 1U4NA 1I2CA 4RJ2A 4BWVA 4PYJA 3SYMA 4E2WA 3P5BA 3PFIA 3BL8A 4GNKA 1ZDMA 3O3OB 2GASA 1SBIA 3L41A 2XOXA 1VKNA 2ZUWA 5CYGA 3FOFC 1IZ9A 5FUMA 1NSFA 2JCYA 3A4IA 1AMOA 5C7IO 1ZS9A 5HS6A 1OPRA 2H5EA 4MUKA 1A5BB 5T8KA 3SC6A 1C1YA 1E3QA 3UHAA 3SQOA 4BQQA 2R48A 4MWDA 3UWPA 3IBCA 1EP2B 4Z3DA 1XOIA 1EWYA 1P5FA 2AN3A 3UKJA 3G0OA 1XLTA 4GSYA 2XB6A 5JNTA 3EVFA 4LQLA 1V0JA 4YDHB 1Z6ZA 2QSZA 5CB4A 2CMFA 2BSXA 4F4UA 3B1KA 4K1LA 3MHTA 3II6X 4KXMA 5A5FA 1AKRA 2FV8A 5L7TA 2WIBA 3HFJA 3HO8A 4NHOA 1YAHA 4QSHA 2OHHA 3E22A 2W2VA 1HQCA 1J7KA 1RI5A 5EJ7A 4GOND 5F64A 3SQMA 1GPYA 3DNPA 2FPMA 3I6YA 4OH1A 5K4HA 4GLJA 4CNBA 3UAWA 1NJGA 3E9CA 1PX0A 2FGKA 2PTHA 5IZCA 5KB3A 3R7BA 4PYOA 4D26A 4MJXA 1CJCA 1SURA 4Q3NA 5G0VA 4DNQA 1LJUA 2G7ZA 3A1NA 1AGPA 3TUJC 4R1TA 1JQAA 1WPRA 2FVYA 2C7OA 1T3SA 1KI2A 1CQIA 2DHCA 1R3DA 1ZPDA 2Q4TA 5GWXA 6YASA 5HQ3B 2O8FB 1K6MA 1PJ2A 2OAP1 1M2WA 2HA6A 3ESZA 3QU5A 1V11A 3WHKA 1T3TA 1PFWA 1U1GA 3EXIA 5CH5A 5C9ZA 2BFBB 5KYNA 1MAUA 4OUKX 4MUXA 5IKXA 3COYA 4G1UC 4LDZA 3R3ZA 1P1RA 2CUZA 3KO8A 3IKJA 4CKEA 3AH8A 3DEIA 4QTZA 3HJTA 1KYQA 3ELBA 4MZXA 4IDBA 4D4KA 3CT4A 2VKQA 5FL7A 1FVOA 3WYEA 4IIVA 4EJ2A 4LSWA 4HNVA 3TECE 1E9BA 1SVMA 5JD4A 3OOSA 2Q3LA 4MV9A 2E49A 3PNLA 1NVDA 2QJTA 4A03A 4WNIA 3DMRA 1YQDA 1YKSA 5IKMA 4ALIA 5K2OA 3KYCB 1U04A 4N0DA 4J4BA 2IUUA 4DXAA 4CCWA 1WA5A 1WMAA 2O0LA 1SUPA 4L76A 1SIWA 4PZ9A 3K1AA 1VE6A 1E9RA 3PXEA 1TF7A 4N01A 4RORA 4TKUA 3H0CA 4EJMA 4WJLA 4UDNA 1YS4A 2IIVA 1OV4A 3OLQA 1K88A 3P0JA 4KN5A 5JD5A 2C4UA 2ZETA 3NOXA 4IIHA 2HRRA 3HBAA 1TNDA 3NHYA 5IT4A 1SA0A 3EYAA 4EHBA 1QFYA 4MKFA 1IE3A 1QIHA 5A5EA 4IBOA 3AM1A 5D86A 4L16A 2LUOA 4LHZA 3TNYA 1G19A 3FNHA 4MLCA 4O4JA 1ESCA 1TQDA 4HDRA 5B1IA 4DUYB 3QA3E 4KR2A 2BGRA 3EA5A 3RV4A 1NYRA 3CZPA 4EHFA 1J8YF 1R6XA 2Z2IA 3JQ8A 3SS7X 4ZYTA 4ZZ3A 5FBVB 2IEGA 3PUYA 4M0KA 3UBTA 4RPJA 3FRIA 3HB9A 2B1RA 5JECA 5H59A 4UUMA 4EL0A 5BUQA 7MHTA 3LDGA 3I04A 2HRDA 2OB1A 3GDFA 1NR1A 1MC5A 3WFJA 4N4AA 1H4TA 2GF9A 5JYCA 1JDSA 5BNZA 4LZNA 2ASEA 4JQZA 4ZWNA 1KZ9A 2YWCA 1R4NB 3BTSA 2PO7A 3C4JA 4MQLA 1J5XA 1IOWA 4KPFC 4KR7A 2Q3MA 3OT4A 1EE9A 3U19A 2PUWA 1P5JA 2W8BB 1Q95A 2XJ9A 4NU8X 4PC6A 3ES9A 5T6BA 1TFUA 1V43A 2CL7X 4WY5A 5IJ9A 2Q4BA 5IBRA 4B1FA 3DAHA 1KO8A 1RZ3A 3KYJB 4D3ZA 4YPFA 3BD9A 4RH1A 1XEXB 3BG5A 3VBEA 1T1RA 2QLBA 5KSPA 1C1DA 4GRIA 3FWKA 3TS1A 1X7YB 4A23A 4GOLD 2BMVA 1W88A 3PBKA 5EE0A 4NOLA 4X97A 1VMEA 4ZAFA 2GD1O 2G83A 1X7ZB 1EMDA 2AOTB 2QN7A 3ZGLA 4QTUB 2QPTA 4EVRA 3C24A 4KN9S 2PMDA 3PUIA 1VFNA 2XNCA 1QNLA 3I9V6 3MCWA 5LQRA 4NMHA 3FKQA 2VATA 1L7DA 3AV0B 4W5OA 3DMDA 5IDYA 4AS1A 5TT1A 3HUUA 3OZAA 4HQNA 5KNCA 3FCCA 2VQ3A 4PE5B 1WY5A 3MRTA 4WA7A 3Q3CA 1NVGA 121PA 2KWIA 2VHVA 1NGSA 3E7PA 3O8QB 4KCGA 4NBWA 5FQNA 4HVCA 5HZGA 3B1ZA 1U0FA 3CKMA 3L04A 1MOQA 3ZTTA 3KALA 1KZ1A 3AEKB 3L9XA 3NBAA 4UHFA 3MMNA 1A77A 4CFYA 4DCOA 1HL7A 2WSBA 2ZZMA 3D0OA 3OAAA 1BMTA 2J8ZA 3SS9X 2EOAA 3KK0A 2GCGA 3ZNPA 4C4XA 5FORA 2FPLA 3W3ZB 1Q0QA 2HSWA 5FPPA 1F5NA 2F9MA 3E6AA 4TS1A 4RY8A 1M2NA 4Q0MA 2HH9A 3FPEA 1T2CA 3TLGB 4JH0A 5COQA 4W6QA 4H7HA 4L15A 2FAXA 3VZDA 2CXTA 1YS2X 1YB1A 3WP1B 3NPMA 4DAEA 1KYWA 2Y1LA 3RAGA 1VL0A 3B7GA 3L7CA 3C3PA 1C7RA 3RRZA 3DR5A 1NTOA 4I6JA 3RROA 3L1UA 5AKXA 4BEWA 1YQQA 3RW9A 3H5IA