2C4WA

Type ii dehydroquinase from h. pylori in complex with ah9095
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
168
structure length
168
Chain Sequence
b'AGLVPRGSHMKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSEYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
publication title Crystal Structures of Helicobacter Pylori Type II Dehydroquinase Inhibitor Complexes: New Directions for Inhibitor Design.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
total genus 61
structure length 168
sequence length 168
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2005-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2c4wA00
3N59A 5WRFA 4KIWA 1GU1A 1GU0A 4CKWB 3N86A 4ZC1A 3N87A 3N76A 1J2YA 2CJFA 2C4WA 2WKSA 4RC9A 1GQOA 4B6SA 4CIVA 4V0SA 4CL0A 4CKYA 2XD9A 4KIJA 4KIUA 4B6OA 2Y71A 1H0SA 4L8LA 2XB9A 2UYGA 2DHQA 2XDAA 4CKXA 1UQRA 3U80A 4B6PA 1H0RA 3KIPA 3N8NA 2Y77A 4CKWA 4B6QA 1H05A 2C4VA 2XB8A 1D0IA 2Y76A 3N8KA 4CIWA 3N7AA 4RHCA 4CIYA 4B6RA 4CKZA 2C57A 2BT4A 4CIXA 4KI7A 1GTZA 5B6PA 3LWZA 1V1JA
chains in the Genus database with same CATH superfamily
2F6RA 4QXOA 2QN2A 3CSUA 2A9PA 2QGNA 2B6HA 4NS4A 3E0XA 4D2IA 4J0EA 3ZDDA 3F2IA 5I47A 4H35A 1EHCA 1KS9A 2FV8A 2L19A 2QRNA 3FTNA 4WN9A 3BA6A 3PUJA 4BWVA 4Z8XA 1RWBA 3ZCQA 2FP3A 2A5JA 2OM6A 2X6TA 2DFNA 4CR8A 3F7MA 2QUZA 1X7XB 2PA0A 3QEJA 4OAOA 3WSVA 4DC9A 3VDRA 5JAZA 2GB4A 2ID7A 3NFRA 4WKOA 2Z0MA 3QSYA 1SGWA 3T6KA 1CJSA 4PANA 2EJBA 3AZQA 3TBFA 2YVAA 2W83A 2ZSJA 4JL6A 2G7MC 1KE2A 4ZDIA 1ULZA 4PIMA 1KPIA 1CUAA 5DYWA 1I3CA 4HOYA 3IPAA 2H4FA 2ZRGA 3JWEA 1E18A 2I7VA 4IXDA 4MP8A 4BAZA 4EG4A 1E7QA 3EFHA 3U26A 4BX0A 4ER5A 5C7LO 2UXDB 4PO9A 2HXGA 4KQXA 3PPWA 4CV0A 1SRRA 2O1WA 1NW4A 2HREA 2XUAA 1YDEA 1RZ3A 3IAUA 2J41A 3P9IA 3PEUA 1K7CA 4IIFA 2YBEA 4DLUA 1EMDA 1RU3A 3CZ9A 1NQVA 2IELA 3LDFA 4MB0A 2QMZA 3CF6R 4Q4JB 4ZEMA 4LYDA 4ZVUA 1PI3A 4WZBB 2HCFA 1RE1A 2GGSA 3VPXA 2Q29A 3UK2A 4Z7OB 2ZU6A 4OU4A 1HF3A 1OJLA 1LPOA 2DHRA 2VYNA 2XF8A 5IDYA 4ENVA 3EA0A 1MU0A 3PFKA 2VKTA 1JR3E 3EQ7A 5GY7A 4D45A 1TJ4A 1UFVA 1GCGA 2EGGA 4LDZA 5ENVA 2BI8A 5TMBA 1YQQA 3WNDA 4EDFA 3H4IA 3PL5A 1RWVA 1DT3A 3JASB 3KQOA 4RY2A 2AFHA 4F86A 4W9NC 1EA5A 1NASA 1GZ5A 1KJWA 1Z08A 2ZKLA 1VKNA 2IXTA 5I45A 3FOAA 2QU8A 3IRUA 3C15C 4HZUB 4A8JC 4NIMA 1O0CA 3K6SB 2ZJ2A 1NQUA 2X86A 1GTVA 4MYSA 2G9NA 1W73A 2VH1A 1N2IA 2WWFA 3OIWA 4WACA 3UAOA 5BW4A 5L4LA 5KYWB 3CUYA 1J2TA 2R4TA 2X7HA 2BGLA 2LZ0A 4LQCA 2KJQA 4QSHA 5LYJA 3K1AB 3VPBA 2ADFA 1GRRA 3QUQA 1I2CA 2Q2QA 1WLSA 3ZHQA 4DIUA 2X19A 3VBEA 1P74A 2GLUA 3VGJA 1N3LA 4FC6A 4ZCMA 1XLTC 4GOLD 3OTWA 7YASA 4DDWA 2RIRA 1UM9A 2XBLA 4WBSA 4FQ8A 4YONB 3WWZA 3ZWQA 4GRAA 3C97A 3HCRA 4I6GA 5ELMA 3T7TA 5JEEA 1VL0A 3OFNA 3LCCA 4LI0A 4QPDA 3DH0A 1KO7A 1DXQA 2EAUA 2EU8A 2FGJA 2XE7A 2XSZD 2BONA 2QSJA 2R5NA 4M76B 4JAVC 5BPFA 2YDXA 4G41A 5K09A 4UXJA 3SJZA 4FDVA 5I9LA 2VAMA 5JS6A 1A95A 1U2TA 1M2KA 1T4MA 1PFUA 1NXVA 1W52X 2VHJA 3EF3A 3LHSA 4N5IX 3UAWA 4Q1CA 3DJFA 5CPFA 3VKVA 2VDPB 5E0OA 1VE9A 2FK7A 1TVCA 2G5TA 2XUIA 1Y5NA 2ZITA 3NANA 4OHXA 4JWKA 3HCFA 2PJZA 4IINA 3QE4A 3TN7A 3I0NA 2GI4A 1HH4A 1SOMA 4GT1A 1R74A 2C59A 2H1RA 3L7MA 4Y98A 1BNCA 1XEWX 4N0MA 2QE6A 3RS0A 1VJ5A 3ZNOA 4KITB 5IYZA 1SBTA 3QV2A 1DIOB 4X0EA 2VP5A 1T3SA 3OJLA 5LMNB 3RIHA 1FJ2A 3FUCA 2FJUA 2BSQA 2CHUA 5E2AA 4YQYA 1ZG3A 3OZGA 4G9GA 3SAJA 4CLRB 3KQPA 4LNUA 5FNVA 2WFLA 2PQ0A 3PXDA 2CXQA 4J0QA 2J9XB 2PKCA 4X6YA 4Z9YA 2ZOSA 3RFCA 8ATCA 3VNAA 3IR7A 4HATA 4FLFA 2RJ3A 1KETA 3GFFA 4R1NA 3VHXB 3WYGA 4JB0A 4F4FA 3KJFA 1UC9A 5H9VA 3LDUA 4JI0B 1THTA 4MWEA 2VHWA 4GKBA 3WK6A 1I3NA 1N1MA 3UC5A 2X0KA 4MR7A 2A92A 4CIWA 1RW4A 3SDBA 1NBIA 3UWPA 4QUBA 2WHPA 2NQ8A 3H7AA 2YV4A 2GH1A 5FHQA 2YICA 3STHA 1QH1A 2WF5A 3UUEA 4EYSA 5KSYA 1RWPA 4XOUA 1KJ8A 3MGGA 4UBOA 4EG1A 3I9V6 3I32A 9MHTA 2HT1A 4RXUA 3KYJB 1PLJA 3TBHA 4A0SA 4QYIA 1U1CA 1GZ3A 4S1OA 3KWLA 4ODIA 4DV2B 3KZXA 1ABFA 2A5FA 3OEEA 5CK5A 3PT9A 1CQJA 1JHYA 2OXRA 2DBZA 3F3MA 3K2QA 3MRXA 5HFJA 2GF2A 1QM5A 2GAIA 2QTFA 4EW6A 1PT8A 4TPKA 1C30B 2D1TA 2J7PD 5HX7A 3AKYA 3BCHA 1YL7A 1W19A 2DY1A 4UD6A 2LCQA 2WU8A 2XYGA 1NUSA 1M66A 5ERGB 3MCAA 1UBKS 4PSDA 1H0KA 3THXA 1ZICA 1DKOA 1UMCA 3JPWA 1QVWA 3NHMA 4JQYA 4R1SA 2AE2A 4GLLA 2ZRQA 2WU3A 4KZPA 1CTQA 2JEZA 2ZIXB 3E8SA 1K5HA 4PAGA 3S5JA 4MINA 5AKYA 1VXRA 2YHIB 2C78A 3EWNA 4IFBA 1YV9A 1W36B 2XXAB 3KZOA 3T7DA 2PUFA 4H08A 4UZFA 1JQKA 3TLGB 2PKRA 5BR1A 1JFSA 1Q1BA 1O9HA 2ZXEA 1L8XA 4HRXA 4GSYA 3CG0A 1U99A 3D4OA 3UAYA 4B3DA 4RKFA 4L4UA 5AW0A 1JPNA 3KFXA 1VHLA 5E4TA 3SR3A 3U48A 3G0HA 5CFNA 1YRLA 2JLAA 2SKDA 2P62A 3AEQA 2C58A 5CDYA 5JECA 3PPVA 4QWWA 1C4KA 4HPJB 4JMLA 5A02A 5TV2A 4LFBB 2HXSA 5A6SA 4G67A 4A9AA 1QJCA 5EWMA 1T9ZA 4DSAA 1S1MA 1U2ZA 1YOVB 2IF2A 4OB8A 1ZIOA 2X1HA 4WH0A 2D59A 3K5IA 1CQIB 2FW8A 1J2EA 4B31A 3UJCA 2HSZA 4JVLA 3WB0A 4Z2AA 5TDHA 4MKGA 3QHPA 1N78A 4KKXB 3RK4A 4F5DA 1QC5A 1Z6GA 2ZUCA 3I83A 3IKVA 1L9KA 4CEJB 3DMYA 3FH0A 2O8FB 4X7PA 4ETNA 4WVFA 2JBHA 4K6OA 1GPJA 3DHVA 5TR9A 3A1NA 4B34A 4DM3A 2GKSA 3IQZA 5E4YA 4ZOQI 3BIWA 1QGUA 5CA1F 2BFCB 1XDBA 3C3MA 5JALA 2DWOA 4BVLA 3SGLA 3HCDA 2BUAA 4XGNA 3ES9A 1W8IA 4NOKA 3MXTA 4BXOA 3ZWVA 4DVGA 1EFTA 2A3NA 1U2DC 3ESBA 3LOUA 2YZGA 2Z6AA 3E84A 4W8OA 3QKTA 4L7QA 3N0TA 2YYSA 3BN3A 2YWBA 3RSZA 2HQ1A 1ESNA 1R0YA 3GB9A 5KKCA 4BFCA 5K3FA 3F74A 4UU1A 2MSEB 1MQSA 2C2MA 4MIEA 2C4MA 2NADA 4JP8A 1ZOIA 1RQ2A 4H6VA 3E3OA 4MZDA 2XAAA 3CXRA 2VXYA 3RS3A 3ONEA 1YU6A 5ARBA 3S4YA 3S0JA 1Z4LA 4KDEA 3PDUA 2DUWA 2IK8A 4ACBA 1OYOA 1JPVA 3KEFA 3PUXA 5LA6A 4RSMA 5I5EA 2J46A 4LGCA 1AK9A 1FYEA 1Q0PA 3D4BA 3QA3E 4XCQA 1VJRA 4HYQA 1AA9A 1QK3A 3SCZA 3JARB 1G5RA 1HYBA 1POWA 2EP7A 2FSHA 3LP8A 4JB2A 4RA6A 4MI3A 3TGWA 1SIWA 2R5WA 2SKCA 4HNAA 4AVYA 2OCLA 4XWAA 4YDHB 1A8PA 3T9BA 4BMVA 5EP1A 2TRSB 1G2QA 1JPJA 5CT9A 3R74A 1VA4A 2IV7A 2C9OA 3QBVA 1VIDA 2BV3A 4S0ZA 2LCFA 1L1EA 3UAZA 2D8MA 2R00C 3B3AA 4HWSA 1L8QA 3HCAA 2GNAA 3FPHA 1ZNYA 3INYA 3G5UA 3SM3A 3F5QA 2IYSA 2CW5A 2F7SA 1CRQA 3JW8A 4G2TA 4DR5B 1UQUA 4FGJA 1E9EA 3HJHA 3LWBA 4CYMA 4X20A 4NVRA 1KYVA 2CVFA 2ZPAA 5JNRA 5IAGA 1J56A 2XA2A 1A9XA 2XNKA 3QFRA 2C9DA 4XGKA 3ZHXA 2EQ5A 1GQSA 1PQUA 4LV8B 4I1PA 4MWTA 2G17A 1CUGA 4BQQA 4Z3KA 3G59A 4CETA 2FYTA 5E6RB 5EA2A 1BGVA 4EHFA 5KKNB 3U56A 1EJBA 2F43A 1W6UA 2REQB 2XMZA 1CVRA 2EC5A 3D02A 3OIYA 4CT5A 4FOPA 3ZOZA 2HFKA 4J0CA 3DFUA 2DX7A 4M0UA 3DWGA 1ISFA 2RB4A 3FVWA 5EYPB 4BX2A 5I7UA 1UKVY 5ALKA 4F71A 4KQWA 4KBFA 4YRSA 3TLBA 2VQ3A 5BYKA 1MOSA 2P2CA 1JEAA 3M9LA 3KVYA 3DE3X 4OMFG 2UVPA 1LZLA 1RYMA 1ZW6A 2CLCX 2DBYA 4QEKA 1ECGA 1R0LA 2C5LA 3WVNA 2CXHA 2IGBA 3R3XA 1T8RA 4GI1A 4OXYA 1CY1A 4Y9SA 1QQBA 2IOFK 4YAJA 1SC4A 5DSZA 4IIHA 4E30A 5IANA 1Y1PA 2HOQA 4NH0A 4RKWA 4W5WA 3BRQA 3V97A 1K89A 1UOOA 1Z2EA 4KXXA 1X39A 3EUEA 4CE6A 5BN1A 5DLYA 3MFQA 3SPXA 2NXNA 5FUXA 3I2KA 3PHJA 1ZK4A 3R3SA 2P0AA 4LJ9A 1XXLA 4H4CA 4JCCA 4MVJH 4PTLA 5ERXA 4JYBA 2FUNB 3MINA 1NVTA 5HIIA 5A4MS 5KNCH 4H0FA 1KJIA 4GE0A 4PAQA 2IS2A 1W34A 1YB1A 4Y2GA 4MKZA 1BSVA 1WY7A 4JR1A 3P32A 4ZZIA 1QWOA 2IC5A 3AF0A 3C8HA 2QLNA 3MBKA 4B9EA 5ADHA 5EWJB 2BFFA 3ELYA 2LE0A 1DMRA 2WOJA 5KSWB 1HV8A 1WU8A 1ZD2P 2WP0A 3IBSA 3PX3A 2HK7A 1ULHA 1G9XA 1VMEA 3P2MA 1CEYA 4Q4DA 2O20A 2OHFA 1SVSA 4OYLA 2JF0A 1Y8ZA 1BH6A 4KSYA 4TYWA 3WMFA 3PFIA 1RQRA 4RGYA 4YJ3F 2I2AA 2WTEA 4PBRA 5LYYA 4YRAA 1TYDE 1ZCFA 4GNRA 2CEKA 2GF9A 2H5JA 3Q9LA 1Y34E 2W4MA 3VYTB 2FB9A 3IOEA 4B8ZA 2BH2A 4E46A 2A94A 1HFWA 4JS0A 3WS7A 1NIJA 2EBUA 4RMGA 3WIBA 3E18A 3WJ7A 4DC1A 4I5IA 1CBUA 2ZDQA 4PBSA 1KI1A 1RAHA 2BGGA 3T1TA 4U2EA 5K0BA 3WKEA 3S5UA 2JGFA 3WGKA 1UEIA 2WUDA 3IURA 4FDMA 4KMSA 4WESA 1TKBA 1UPTA 1XYVA 4YMWA 1U2QA 2R97A 3BGIA 4AJ1A 1TZBA 3AUSA 2WPDA 3KJNA 3SYTA 3PC8C 2DB3A 4X61A 2QDKA 2Q4BA 2WLSA 3JAWB 4LS3A 2IX3A 3KQWA 2A0WA 2AG1A 3EEOA 2XT6A 3VX3A 1ACLA 1Q16A 1TRKA 2QSZA 4MRRA 4QYWA 5EEGA 3BDVA 5LM3A 2GCGA 1NULA 4XX0B 1NUUA 3FG9A 4AN1A 2C7VA 4H1UA 3I04M 1LPMA 2HLPA 4UARA 4G0MA 3F3KA 3ZC3A 1OFTA 5FWXA 4Q4CA 3FNFA 2WNHA 4PEVA 3CWZA 2B0CA 2WD7A 4FFNA 5AKKA 3H65A 4IGEA 4RGBA 4B46A 2CHEA 2HIHA 3S1AB 5P8WA 3G3EA 3H5NA 4AJNA 1U02A 2ZRAA 5TS3A 1ZOOA 4QT4A 1Z18A 1KEPA 2AJBA 1GGJA 1T0HB 2PH5A 2X5KO 4MV1A 1JLRA 1YVPA 1AF7A 3RI3A 3H0EA 1WB4A 4NE2A 1EBBA 1GDHA 3I04A 4IIJA 1XC7A 5K2MA 3EIQA 3CINA 4RPKA 1IBMB 1BD3A 4LNAA 1HZZC 2XVAA 2KE5A 1ISSA 1NY6A 4FNGA 4ZOLA 3QNUA 3T99A 4P93A 4KMRA 3TVYA 5HGXA 4LJ5A 4Z7QB 3NBZC 3OZVA 1Q1EA 1N8NA 1C7RA 4ROTA 1TQDA 2H4JA 3QMMA 1SK8A 2J5BA 1AZTA 2P65A 4Z0TA 1FXUA 3O8QA 3AL0C 4LXIA 4I55B 4AXBA 4F3KA 1IZ7A 1V6SA 1E9AA 5DCYA 2OXFA 4YCNA 5L53A 1W59A 1W36C 3UJHA 5K0CA 1S9HA 1KK3A 1MC1A 4JI4B 2OCKA 4QQFA 1JECA 2PUHA 4RA9A 4XLLA 1Y8CA 3WA7A 1SU6A 1SD1A 4YIHA 2BCJQ 4BB0A 5J43A 1NF3A 4QJIA 1ONOA 4B7ZA 3WKBA 1JIQA 4U5QA 3CLHA 1ZGBA 4FCCA 4XYGA 3CJQA 3HLKA 5HIKA 1DQZA 3GIDA 4PONA 3RDPA 3HFJA 2D1QA 3G2LA 3OU2A 4XCVA 4AS3A 2R7NA 2XV1A 3S8YA 1ISHA 4FCTA 3M34A 3IT2A 2CWWA 1J5EB 2F1IA 4HAZA 3BH6A 1GQYA 1N2CB 5AYVA 3NIDB 3ZWOA 5LP6F 1P0CA 1EWVA 2Y1EA 2DFVA 4X1IB 3Q6NA 5GVRA 5HG0A 3HKDA 3S2ZA 3VSCA 4DJEC 1PFYA 1YB4A 4DV7B 5LZ5A 1AKTA 1L2TA 1NMYA 1ZGJA 1E3TA 3JQAD 4PLGA 2Q4DA 1JIXA 3EGDB 5KYVA 1OKKD 5JZMA 2OD2A 2Q1WA 3UQZA 1C9NA 3MUOA 4QYSA 5CTAA 1AKRA 2PMWB 5BSKA 5IT4A 5JD5A 2QPOA 4YFYA 3RSCA 4PO1A 1TYCA 2Y99A 5LJIA 3CVJA 2JLUA 2CUKA 4EPTA 1HK7A 4RADA 3MRVA 2J0QA 3AI7A 1QH0A 1Q7GA 1CE8B 1T5IA 4QM6A 5E2IA 1EG7A 1PG0A 3KXDA 4S35A 2QD3A 3O90A 4EH1A 4NBKA 2P27A 4HXEB 4EHAA 4MS3A 2P4QA 5AVSA 1NLMA 4JVSB 1F6WA 3OURA 2XKJE 2C96A 5CGZA 3CYFA 5DK6A 5A05A 4EGAA 1NN5A 1JLKA 3EIEA 5IZ4A 3OQ1A 4RHYA 5FOQA 3X1DA 2IITA 4FHZA 3KSRA 3C5WP 1NF2A 2JIZA 5EFZA 3ZTWA 4C05A 3MWDB 2ID4A 2V5VA 3VPGA 3PQEA 1KAHA 1H9BA 1HLGA 3IUSA 1MW8X 3ROXA 5ALJA 4E1VA 4JL5A 2ISSD 1R4NA 5KBYA 2WE8A 2Q7OE 4KG7A 5JQGA 2WYHA 1U0BB 1QAQA 5AW1A 1TGYA 4QOJA 1H22A 4KAXA 2FMFA 2H92A 3C48A 2EARA 3DXYA 2GD2A 3KJZA 4GXTA 2BCGY 3VC2A 1DO0A 4ZCRA 1Q0UA 2I2FA 4LJKA 2Y1CA 3BE6A 4NZYA 4YN3A 2C2YA 2YS6A 1K92A 3HCNA 5ES4B 1EXVA 2J3MA 1YA4A 4FE3A 1EQ2A 4HYTA 5DKFA 1G55A 3ZGNA 4IM7A 2X7JA 3GZNB 3E9ZA 2UZ0A 2JIPA 4WDRA 1IXKA 1EVZA 2J85A 5KINB 5FPHA 5GZ6A 1GPH1 3JQ6A 1ES9A 3LK7A 4FX5A 1JXAA 1JSXA 1I7NA 3B2EA 5GV7A 4QQNA 2BR5A 4BNZA 3OIVA 1QJ4A 4ITVA 2FRDA 5T3YA 1GUYA 1D7OA 1RJ9B 2IUTA 4ZYVA 4JEMA 1EVLA 2JHGA 2Z2IA 2D8AA 3U7RA 5IBCA 1AU9A 1OYYA 1PV1A 3A1CA 1Z34A 4TROA 2QLTA 5IT0A 3IQEA 5SICE 3NAQA 2BD0A 4ND3A 1JVNA 2WIDA 1TYZA 4OI1A 5J58A 2FFQA 3C5VA 2VPPA 2IXGA 1T2AA 2B4RO 1DS6A 1S89A 3CE6A 2DQKA 3GP5A 3PFNA 5DMXA 3L0OA 3IVMA 3P9ZA 2CKDA 2PS1A 2C8KA 1KZHA 5H82A 3C3BA 1H8HA 2QUKA 1OROA 3HLYA 1N32B 1VSVA 2G5GX 1P2SA 2P4EA 4DV3B 3MJRA 4FFSA 1FRNA 2V6GA 2XRYA 5H70A 5IARA 5A4DA 1GU0A 1LI5A 1N9GA 4UJ3A 2CE2X 3I6YA 1QSGA 3IAHA 3EIHA 3K9NA 3NTXA 4K6KA 5GINE 1R8JA 3L8MA 3QFSA 3ZBUA 2FVYA 2OMEA 3GBVA 4IG9A 1F2UB 1F0KA 3GHHA 4YRZA 1T0IA 4UUNA 1WU7A 3T3NA 3TTVA 4L4SA 3HS3A 3OT1A 4IXNA 1XXHE 2A0FA 3DZDA 3D54D 2N3ZA 3FOFC 1YR6A 2JZCA 4FXOA 3VZBA 3ETGA 2XCTB 4HFMA 2KYRA 3PNBA 2R5FA 1QBGA 5AVJA 3K70D 4E4TA 3K9FC 4RTJA 3N0WA 4CEHB 3PXEA 1IJEA 4OJKA 1G8AA 2B1GA 2WFMA 3W8EA 1UBNA 2ZJBA 1WCYA 1WBDA 1TD1A 1O6GA 2BSAA 4F4CA 4U4AA 4MB2A 4UTPA 4QM7A 3PHGA 1FXSA 5FXMA 1NUQA 1TAUA 4FU0A 3ED5A 1H42A 4HJXA 4OGWA 3D8SA 4Y67A 5IAAA 2AZMA 1KMNA 2VZ9A 1PEKE 2BUBA 4HUJA 4O02B 4MKIA 4QBGB 3KCNA 4R0NA 4BCDA 4EJ0A 5CB4F 4HMPA 3V8BA 2OK7A 1O94A 1IB6A 1R6VA 4PWYA 4A8PA 3MJHA 1RYYA 1SIBE 1ULUA 5CXQA 5EIHA 3UYKA 1SVMA 5JATA 4ER3A 1L7RA 4DV6B 1J5PA 1I1QB 2R1VA 1SH7A 4AKTA 4AK9A 2B34A 1TVKB 3LBFA 4JIMA 4PSKA 5F9HA 1R4MB 2YY6A 1ISMA 1SC3A 2YS7A 2HDNB 4DTIA 4X94A 4C88A 5TT0A 2NACA 5FOSA 2WHYA 1N3YA 5BWNA 5JD4A 1OE0A 1IJKA 2HY7A 1L3IA 1UDBA 3DMGA 1G17A 4IAOA 3ZS9A 4E12A 1YJXA 3MJSA 3RROA 4UDNA 4TWAA 3LWDA 5FBRB 1KXJA 1OFHA 1P5HA 1U1EA 2C9MA 3GVHA 3WBFA 4JLMA 2CHVA 3FI0A 4QOIA 2XWQA 3VYSB 4F5ZA 1PR2A 3WLQA 1NN0A 2QLBA 4E2FA 2QQGA 5CDHA 1FSSA 4IIEA 2GD6A 4ECEA 4OAQA 4N0QA 4DWOA 3HM9A 2BHTA 4HDKA 5JAQA 2GJ9A 1E2QA 3N59A 1Z4IA 2UUOA 3MRTA 3E22A 5DTQA 2GJ8A 1XZNA 3O1IC 4IJMA 5EPUA 5EWLB 2AG8A 3SC2A 3VR0A 2QE7A 4RDXA 1K8YB 4ZO4A 1LK0A 1UUFA 3OM0A 1CRWG 5JDIC 1T36A 1Z26A 4TVOA 2A88A 3N74A 1YQUA 1JT9A 2JGKA 4OQQA 4WERA 3WV4A 1M7BA 3NQ41 4IZHA 2QK4A 4GNKA 1F5NA 4KO2S 5KTTA 4H7FA 2HF9A 5D6OA 4WCFB 1WUIS 5BQFA 2YMQA 1KH1A 4TKZA 5FBVB 1JU9A 5ICMA 3PPXA 3CW9A 4J0IA 2HR1A 2BM1A 3PCXA 4X1YB 3K4QA 1KHHA 4YT4A 3IH5A 1D04A 3EC2A 2O6LA 1C0EA 4F04A 4PAWA 2I99A 3H2KA 2C9CA 4OHVA 3MJTA 1PJZA 5ESDA 1J70A 4B82A 4TV8F 1FMCA 1ODLA 4NHEA 5J5AA 1KDOA 3A36A 4M99A 3DOCA 1J7KA 5LKRA 5DRTA 1EFRA 2Z2ZA 4PSVA 6GPBA 2JRLA 1S3GA 5B3JA 3W8NA 3MAGA 1X3LA 2ZSUA 2IDKA 1ZNQO 3GJYA 4CL3A 5KJ6A 3MCVA 3MCTA 2FUEA 3LVQE 1G5PA 3IHWA 3L8HA 4M38A 4ASUD 1KFEB 1X9HA 4AP6A 2OTCA 2RGRA 4Q48A 1MIHA 1P39A 3H3FA 4KIWA 4ZVQA 3OZBA 4D9GA 2XH8A 2A33A 2FMTA 2P69A 4EVRA 1XDWA 5AVVA 1XZFA 3FOBA 1SXIA 2I4TA 4G0OA 3BPSA 4LOAA 1JEOA 1Z0AA 3GAMA 3GMDA 1FMFA 4JL8A 3RUDA 1XRNA 4G3XA 4RGQA 5KYNA 2NN3C 2JGNA 4NYMR 4WNYA 3TLYA 3ZCUA 4K9DA 4LHSA 4PC3A 3KYBA 4UM9B 2D2IA 5DULA 3T1VA 5HKOA 1OC2A 3IBYA 1XAJA 3QNMA 5ESRA 2P2DA 4IIVA 3W3AH 3G8CA 3P4XA 5EJMA 1QZUA 2BFBA 2BMJA 1XAIA 3TB4A 3THWB 4F1KA 2CK3D 1DLJA 1HNXB 1QFXA 4DG8A 1YA6A 3R7WA 2F4VB 3EVZA 2EOAA 2IU4A 1V8PA 2PCLA 1TM7E 3KAQA 3HP4A 5ED0A 3HI4A 1AQJA 1C1DB 2GEKA 4M9QA 2ZM5A 2W70A 3OHMA 4MB6A 4N6GA 1DV2A 4JJAA 1MW9X 2E9SA 2BP7B 3Q1LA 2QV7A 1N7IA 2O0HA 3GRZA 2G8LA 3HKCA 3PEVA 4MO9A 1HEUA 2HEGA 2IU0A 5JJIA 1T4CA 3OIDA 4XM2A 6AT1A 1FNBA 3O21A 3L1VA 1LQ2A 1ZFNA 1WNFA 1FUYB 4GWGA 3NTVA 4KUGA 5E4JA 1ML4A 2BE7A 1CJCA 2V7PA 4X8OA 2OT3B 1ZMOA 3LSYA 3QKUA 1HQDA 1M5TA 1OZHA 3I42A 2PYDA 3PFWO 4CZ2A 2NZXA 3B13B 4MQ4A 1NXSA 4DIDA 2IS6A 4U7FA 4PZEA 1KVUA 3EB9A 3BG5A 5FAXA 3PNLA 4V38A 5LP1A 3L82B 3C5EA 1GL6A 4IO0A 3DOHA 3OQPA 1B3BA 1FTGA 1JQJC 2ZJOA 4LDPA 4MCHA 4NV3A 5ADUS 1F9AA 4OK6A 2QJTA 2F3UA 4CV2A 3TG8A 1K5PA 1QGOA 4XX1A 1JR3A 4G26A 3U3ZA 1B26A 4DHWA 4Q19A 2Z5LA 2J31A 3H3XA 1IMOA 4UATA 1JN0A 2PSHA 3DNPA 3HGTA 3KS9A 4LRYA 3O8NA 4DAOA 1D0VA 2WJ3A 3IAEA 3KG2A 4XIIA 4NV1A 4U9HS 2XGGA 4HKTA 3WRVA 1G20E 1YS6A 7REQA 1A88A 1Q3HA 1LPNA 1V8ZA 5BV8A 2HU8A 2VBFA 1DPGA 3B36A 2O05A 5I3ZA 3JQAB 3R8FA 2COKA 3HA2A 5DK4A 2PX6A 3NAGA 3C0KA 1R8QA 1VGRA 2IF0A 1HT1E 4GLBA 3VYWA 3EZ6A 4C0XA 4ZQIA 3DAHA 4XXHA 1TA9A 3L4BC 2JBAB 4GZ5A 2HIAA 4Z99A 2ORIA 1V1MB 3UC9A 4C6HA 1TEZA 1UF9A 2IUSA 3SQNA 2XUJA 3DEAA 3HMKA 4WD3A 3SOZA 2V8OA 2DSTA 3DPSA 3JATA 2XODA 4E2YA 1AMNA 1XMIA 4N3CA 4OQNA 3UOWA 1QYWA 2YBDA 5FIUA 4DA9A 2IYRA 3O8OB 3ZEAA 2VH2A 1XZQA 4F3CA 1HDXA 3K0AB 4YJKA 1GZUA 1H2AS 1WXFA 3H8WA 3IODA 1ZVQA 3N53A 3ROFA 1OBFO 2ZQYA 2GHIA 1EK2A 5CCXA 2DUNA 1YQGA 1RQLA 3FFTA 4BAUA 3ETNA 1IBLB 4CL2A 3P2IA 3M6LA 4WFJA 1E2BA 4HNQA 3QSGA 3EH2A 3BWVA 2G9RA 3O91A 4AXXA 3E8MA 4XTRA 4JIGA 4MDHA 3S70A 1H2HA 1SKBA 2Q1UA 3W9BA 4F4DA 4IPTA 3ZD6A 3HKEB 1KY3A 2BGTA 2GZRA 4QZVA 4B6PA 5JJKA 1IH8A 1GA4A 1FNSA 2W8BB 2XQVA 3NO4A 421PA 2X0RA 2ADOA 5CA0B 2OHGA 2RBKA 2G6TA 3ONNA 4PVCA 4BO1A 5DNCA 3H8VA 5LQJA 1U8UA 1UANA 2ZB3A 3OCWA 4ZHQB 1N2EA 5GONA 2PEZA 1WCWA 4QFDA 1F3OA 2WJHA 3BSSA 3FCCA 4ZU3A 4LF9B 3GFTA 2BJHA 1CUFA 2Q1SA 4KQFA 3V3TA 4ZVRA 3VH2A 3VR5D 1MB3A 1QHHB 2IZZA 3GLKA 5LZ2A 2FW6A 3CH4B 1LA2A 3DT8A 2WIFA 5JD6A 2AQ8A 3JQ7A 3PSAA 3EDMA 2X0JA 4FMCB 4KIJA 4Y2RA 3DV0A 1FQOA 2QPTA 3E9DA 1VMIA 2ZAMA 5GPBA 2QUAA 4EMBA 4R9NA 1MAWA 4Y9DA 3FR7A 1USKA 1QAOA 3B1VA 3BBLA 2UAGA 3IALA 4FBMA 4TKLA 3BMCB 2UZIR 4JU8A 1ZISA 4F9FA 4QWMA 3Q7RA 4AG3A 2REQA 3ZX5A 3FZYA 5BNZA 4R1OA 1J9ZA 2DHDA 4G6ZA 1SUDA 1UWKA 3IMKA 3KB1A 4ZVLA 3GNTA 1F7VA 4KGXA 4MW5A 1D8TA 3NU1A 1DQYA 2ODPA 2PS0A 1BGXT 2YZ7A 3QUAA 4I3GA 2CDCA 4FYYA 2CNLA 2B20A 4O2RA 1OI2A 3H5WA 4R51A 5C1OA 2LGJA 4FP9A 3C3KA 5KX5B 2JFYA 1SQ6A 4JJEA 3CR8A 4MUIA 3QVKA 1JHVA 5JO9A 1A9QA 2JCGA 1F2TB 1XZLA 4R0MA 3ADBA 1KBZA 5H68A 2ZPTX 5KQGA 2ZW9A 4GPD1 5AW3A 1GZDA 3GJ0A 5CDFE 4NMLA 4BMYA 4D9BA 4G85A 1CVIA 3BSYA 5G4LA 2QQEA 1JFRA 1YCFA 1KH3A 2Y9MB 1H1DA 3D4LA 2ZG6A 3GRYA 1V3VA 4MUYA 4WN3A 4C7BA 4LJ8A 5KDDA 5IF3A 2HBZA 3EXIA 3V42A 1JXMA 5TVKA 3JZAA 4KMMA 3ICCA 3GFRA 1DKRA 3X1YA 2UZ4A 3LDHA 2BH9A 3FIUA 4KXVA 2R48A 4MLZA 5K0GA 1L1QA 4TL9A 4DCSA 3ZZUA 1YKSA 3TTYA 3T3EA 3K70B 3L7BA 1KR5A 3N87A 5CB6A 4EAAA 3PFCA 4MIKA 1TO1E 1L5NA 1WBBA 5G3YA 1CS0A 1MHPA 3TUJC 3AHEA 2V9ZA 3G89A 3MTEA 3ELUA 1SR8A 4JBGA 5EVJA 1SBHA 1T8TA 3KKMA 3MWGA 3PGKA 3K5PA 4TRNA 3VUFA 4DLPA 3U5ZB 3CNBA 3EODA 4AKHA 4GZLA 2J3DA 1TA0A 3ABRB 3JCZA 4UOZA 3ABOB 1O94D 5DWVA 5E95A 1Y9AA 1ULBA 2Q0XA 4KQ9A 4YI3A 4OJMX 3QLEA 5CVDA 2IOFA 3LDAA 1BXGA 1M1YE 1QE3A 1QIIA 4EQ6B 2H1CA 2JW5A 4G1CA 3SM9A 4REMA 3KOMA 1RT9A 5B3LA 2VPIA 2V7GA 3P9QA 3PWKA 2VNJA 2ZYVX 1K5DA 1EU1A 1QQ5A 3OEWA 1C50A 5IAKA 4O4LF 4OHFA 1NLZA 3OICA 3K0FA 4M4SA 1NNEA 3JAWA 4OCZA 1UPAA 4KWHA 4AZ3A 2WSBA 1CR1A 3U2QA 3AT1A 3SFZA 3HRIA 2XZOA 4J94A 3IEMA 3DULA 2ATEA 4OG2A 1UPCA 2LNDA 3GVCA 3SYLA 1F1BA 1QDLB 1O6CA 2OB2A 4NG5A 1P8AA 3I52A 4FZ3A 3LBYA 3KDPA 1W85A 1MOZA 5GM2A 3ZHRA 5MGBA 4MUHA 3TTSA 4HEJA 3WDKA 4IGIA 3W1WA 1WOYA 2K2QB 3AI3A 1VJTA 3UW3A 2P9FA 4YMSA 4FB4A 4HN9A 1EEHA 1DPFA 5GWXA 2O19A 3A2LA 4B75A 3IP3A 2VQDA 3M6WA 4NFSA 3JX9A 2ZCJA 4ENUA 4QOHA 2VXCA 3GRUA 3AESB 4IUYA 1CC1S 3V7FA 4EWLA 2QMEA 4G5SA 3R9XA 2DEUA 2JD1A 5F1KA 4CUJA 1JH8A 3FXAA 1E20A 2XCOA 3I6QA 3OUTA 3ECSA 3Q88A 3ZVLA 2BFWA 3AHIA 1P7WA 3EFBA 1S8FA 5F2KA 4EYOA 1SQ5A 1IVYA 4R69A 4YIKA 2AF3C 2IHZA 5FOTA 3F8TA 2F64A 1B73A 2X9NA 2EYUA 5K8UA 3G13A 5CJPA 2ORYA 2JFFA 3FFWA 3AY6A 3P7MA 3VJKA 1OLSB 1X7ZB 4ZICA 1QQ6A 3MQ4A 4MCJA 4DF3A 1HDRA 2EKZA 3DMPA 5DT2A 3KDSE 2WJJA 2FKNA 4GU5A 5U4QA 2YHUA 3FNQA 2OD9A 2MINA 3BD7A 3W34A 2ZYRA 1P4AA 4K6CA 1L4EA 5COBA 2VN8A 1D2MA 3T7IA 1EFUA 1LF5A 2IZ7A 3GCZA 2QORA 3K9GA 4D4MA 3RNOA 1YQWA 4B3JA 4C08A 2RHHA 2ZKIA 2HPAA 3OCUA 3UAXA 5KO2A 3QFCA 4V0OA 3DDCA 2H9IA 2PGDA 2GK6A 1ZJ6A 2QBYA 3F6YA 1Y1TA 3O2JA 1N2CA 4GOMD 3LO5A 4ARZB 2NLOA 1FCJA 1PTJC 3D6TB 5I4KA 1S2IA 2WKSA 4ZVSA 5AKHA 1LLFA 3FMGA 1AHHA 5B53A 1JQLB 4EHKA 3UA3A 4KU4A 4UVIA 4ZI7F 4L5AA 5EZ5A 2X4IA 4FFVA 1JLLA 3WZ2A 2GEDA 2QN8A 2WNSA 4LJ4A 4R8RA 3M6MD 3SVLA 3WGIA 4UCFA 4IFIA 2VG8A 1ZAKA 4H7EA 4CM5A 3VSDA 4N39A 2H2WA 4HAYA 2NZ8A 5JAHA 1OLUB 1QYXA 4MVJG 3UJAA 3A3OA 4BVBA 4DVJA 4ID9A 2IYXA 3X3HA 3QQPA 4FPXA 1ZC3A 4FGSA 3R6LA 4UE3S 2ZI4A 5FR1A 2YUTA 4L6AA 4OHZA 1E9RA 4YRBA 5DI3B 2YQ4A 5C4MA 1WRBA 2PMFA 4JQCA 3W06A 1NVAA 4Z1OA 1MT0A 2QJWA 2GASA 1MG5A 3QWIA 3WNQA 5EKTA 1J8YF 4J49A 4JP1A 4O5OA 2L82A 4ZT2A 4AKSA 4L0CA 2BUCA 1T3HA 3NC4A 3OU7A 2H4HA 5TB5A 2YXPX 5TS2A 4XSVA 3O94A 3DEFA 2PH7A 3JWIA 4CMEA 1AJEA 1KMQA 3A4NA 1AV6A 3AG6A 3KSDO 1IY8A 5A7FA 3C3WA 2RGBA 1J9GA 2LXNA 4OP2A 4K9PA 2D5CA 1M74A 2FZEA 4X65B 4HF7A 3C3DA 4YR7A 1S8AA 2G71A 3WWCA 3R09A 3AERB 4K1LA 1UPBA 2YDYA 2JFVA 3P9XA 1K68A 1N5LA 1SA0A 2FPGB 2VDLB 1II8B 3D5TA 3EDYA 3WGOA 3BHIA 3VPSA 1EGQA 3KL4A 4BVFA 1KF0A 2GKGA 4UQOA 3SHOA 1MO2A 1IXSB 4NAHA 3AF4A 1E9FA 2WP8J 4NMHA 1BHSA 1M34B 3BERA 3QBJA 3ZCPA 5L3SB 2KLHA 1WW8A 2J7KA 3C45A 5HK9A 3PHCA 1EDEA 2X5XA 3QUCA 4GW3A 1GPNA 1SBQA 3C6MA 3IPXA 1JR3D 1U3CA 3OEYA 4NYIR 1JAYA 5BN3B 4FYKA 1U5CA 3GEIA 2IEYA 2RHWA 3G7SA 2ASEA 2ZUUA 1EFLA 2J9FB 3K96A 5E7MA 1MZVA 3E61A 3ILXA 4TTVA 3TCNA 3ZKWA 4C4XA 2NVUB 2DLDA 4GM4A 1Q20A 2JJ2D 2WSMA 4M0FA 3CV3A 4FOSA 4QPPA 2HMVA 4R3NA 2QYTA 5C5EA 2IFTA 4NL4H 1V6CA 2ZJYA 3UBTA 1JJIA 4DDKA 2P75A 1EXNA 1MO4A 1T24A 4IWNA 5CB0A 1AXRA 3JVVA 5BNWA 2PN1A 3HBLA 2ZP1A 4MVJF 3UCFA 5LNK1 1EFHA 2A4MA 5KVCA 1T2NA 4PX5A 1VLHA 1YU9A 1DUSA 2YASA 3KQMA 4OB7A 4F7WA 1Z4KA 3PNQA 3NH9A 1DAOA 3OLXA 4OEHA 3NJ8A 1DQSA 2C94A 1O03A 4EM6A 4ED9A 1CYEA 2WHQA 1DBIA 2H59A 4MPDA 5EQDA 2HA2A 5B57C 3TE7A 5IBRA 4PNEA 1XE3A 5MN5A 2FPRA 4MV5A 5MFZA 2FWPA 3L6EA 3PKIA 2O48X 3O3MB 4BTVA 4D26A 4QOGA 3FMIA 3PXCX 3W2FA 4XA8A 3ONDA 4PC6A 5EJEA 1OPRA 3A9CA 1Y8RB 5JMPA 3WLMA 4ENRA 4F2PA 3K70C 4GECA 3EAFA 3D4IA 5DMHA 1A7UA 2YC4C 4OP3A 1EA7A 2PKWA 2WTXA 4FFOA 1I7DA 2FLWA 4PZAA 3WYFA 5JBIA 4WSOA 4QEDA 2IKSA 2ZYIA 4O1IA 5AVWA 4C4OA 1GUAA 1T3TA 2Y93A 5JCPA 2G40A 2A7XA 1Z8DA 1CUEA 2OGUA 4KGDA 4KZKA 3IE1A 2I8LA 4ANFA 2CVHA 5KTSA 1D1TA 3QVWA 3HE3A 3UXMA 3ZW9A 1JT2A 3BXOA 1XTSA 1QXSA 3MUNA 4BZWA 5AW9A 2P7IA 4OLBA 1TAHA 4DLRA 4N5NA 1T8UA 2QD2A 4LOHA 4C4PA 2ZBPA 4GQAA 3M6FA 4LMPA 5ALDA 1DJNA 2RHLA 4K6HA 4LA4A 5H59A 4ABYA 1K6XA 1TI7A 2ZJ0A 4FONA 4L95C 4OH1A 2ZUWA 4AUMA 4IJKA 4RGVA 2JKYA 3PQ4A 4JQSA 3NYWA 1XMQB 2IIVA 2O3RA 3K0CA 1U8FO 5C8YA 2JJ1A 1LNQA 3A04A 4MYCA 4BKQA 2XVYA 4U2CA 2BTQA 2UXBB 3LLMA 2GCOA 1R5JA 2JAQA 2HO4A 3BF8A 4I4CA 4M0EA 3UWDA 1U2RA 1N33B 1Y3FE 1RJWA 4IHJF 3UJPA 3RUFA 2P1DA 1CUDA 3WWPA 4YV7A 5C4IA 1CQPA 3FTDA 2C4TA 4WLNA 1HDCA 3M0EA 4EHIA 5KYYB 3KT0A 4C21A 5CEJA 3GEGA 1ACMA 4LBZA 4FSDA 5CT8A 1SEPA 5F7JA 2EWVA 4K9NA 4Y6PA 3TOZA 3WSWA 5LWQA 1A8QA 4QRHA 1WTAA 1ZR4A 1G0OA 4RABA 5EL0A 7ADHA 1O4VA 1IHPA 3B3JA 3CF0A 3PE3A 2QTHA 2Q27A 4GOJA 4G07A 4S0XA 4EZBA 4DBZA 1C1YA 2IHBA 3UB3A 2QYSA 3MS2A 2CXNA 4EGQA 4F8EA 1KFJB 1W9HA 1CHNA 1E3LA 1J42A 1E1MA 1KVSA 2EFEB 5FWDA 1PDVA 2R7AA 4O2AA 3LZ6A 3Q4GA 1M2GA 2I87A 5F3RA 2MT9A 3HA3A 1DHTA 3IIMA 5AVOA 5EJ8A 2BYTA 4N76A 1U1GA 4BWYA 1DTSA 4IEEA 1T10A 4IJQA 2DQ4A 1Z2OX 5IPFA 3TQTA 2X1MA 4KGZA 4DV4B 2Q0QA 1MC5A 4KTVE 4M1ZA 2I4MA 3WLKX 3S40A 5FQNA 5CDTA 4DCMA 4IV0A 2Z57A 1Z74A 5A7HA 3LX5A 3DMRA 3I64A 2D00A 1RHQA 4DPKA 3LVFO 1N57A 2I8AA 1N2JA 2MYPA 3IDSA 4PZDA 5D00A 3H7IA 4AIIA 5DB4A 1MQ8B 2FRVA 5BWCA 2FZCA 3KL2A 1VIYA 1YI1A 1ECBA 4MAAA 5J1TB 1WXWA 3VZSA 1EIZA 5CFQA 5DNYB 4E5DA 2F2TA 2H0AA 1XPOA 3M5CA 1QDEA 1I0ZA 1ZXLA 3H1AA 3Q8XB 4P7FA 1Q1GA 1R50A 3EZGA 4EPRA 3ZY4A 4BYMA 2UYHA 4L15A 4ALLA 2A59A 4N6OA 1X1AA 2GD1O 3WV5A 2FXVA 1T9BA 2CMHA 3I2YX 4R31A 3WLFA 5EMJA 3EOAI 1E4EB 4XFDA 4CKBA 3PHHA 1EM6A 4FFRA 2Q9UA 1X1EA 4JOSA 4F4JA 5ICEA 4ZCSA 4HNUA 2ZE5A 4HTFA 3Q7EA 3KZCA 1OWPA 1IM5A 3JTMA 2OD7A 3CSDA 4JC5A 4R9SA 4RTLA 4HRAA 4FS8A 2HADA 2NUAA 3HUTA 3KUKA 4LWPA 4M8SA 4KODA 2NO5A 4WY8A 3SMVA 3VNVA 3DR5A 2G4LA 1DO8A 1OU4A 3LUCA 1WMDA 3ZKAA 2R4QA 3H9JA 2P0YA 5D7BA 5IJ0B 1W1UA 3LH5A 1IEWA 1YASA 2BEUB 2JEOA 2P41A 1Q3KA 1X38A 2A1TR 3ZQUA 5BVGB 1Z7YA 1N25A 1VGVA 2CXSA 2UKDA 3C6QA 2ZBDA 3WWOA 2V0GA 4P3PA 4S3MA 3UK0A 3AFHA 2V55B 5BQPA 1GT91 4BE7B 2ZJAA 1OZFA 2J0SA 2KI5A 1D03A 4MP3A 1C7EA 2QHXA 3HGMA 3EVBA 3HJCA 4KE8A 1XXHA 4MQFB 4BVKA 1QIJA 4GIBA 2WF7A 4W5RA 2ZJ3A 4FN5A 4LIPD 5LOVF 4KACA 3SX2A 4YO8A 1KQPA 1LWOA 3C6YA 3RRJA 2FJ0A 3EZ7A 3OLCX 3L4SO 4Y1FA 3RC1A 2JHPA 2Z9CA 5F7XA 5A9TA 3DHNA 4ZAGA 5LIRA 2JNWA 1IM8A 2DY0A 1CYDA 5CIQA 2ODAA 5BN5B 5HVNA 2BZSA 3RVOA 3KDAA 2QRUA 2I2XB 4I50F 5AOVA 4YXFA 3O82A 1DJPA 3HCEA 1IHYA 2OO7A 2VZ8A 4AROA 2CVPA 5SYNA 2VDQB 3IJ5A 4DIFA 1SKYE 4DMGA 4OXKA 4WX2B 5LBUA 4IYJA 4M55A 1QORA 4A36A 1FDRA 5JJ5A 3MAAC 4PYOA 4EY3A 1K3TA 2DRIA 2QZ9A 3H3JA 3OVMA 2PFGA 1KMMA 2B37A 4HH4A 1ZWLA 2BFOA 5T6MA 5DU2A 4GWKA 1J90A 4WBNA 3PKZA 4X64B 3AFMA 2ONYA 3OZFA 4NENB 4RS3A 4E33A 2VDWB 3F9RA 4KQGA 2DQSA 1EZ1A 4G1UC 4PRLA 2XQKA 3WIDA 2PD4A 5JAUA 2RGCA 1G8SA 5JYCA 1HFJA 2C20A 2QTLA 3FYSA 1H1TA 1HOTA 1LLUA 2QDXA 3USCS 3B3GA 2ZYDA 1SQSA 1ELOA 3NM6B 5JZ9A 4URHA 2QA5A 2J0VA 4IFTA 3E1KA 1WF6A 3QVJA 4QJ4A 5SYMA 3GD5A 3IUBA 1JFFB 1TT5A 1V5IA 3GNLA 1MMFB 4PRZA 2XT9A 3ZW7A 4FI3C 2EEZA 4IIXA 1SUSA 2RKOA 3WO1A 1E2EA 1Y8QB 5GVSA 2O6HA 4R0VA 1FDUA 2OSBA 4F5WA 2I4LA 3BMNB 1PDOA 1O08A 4D9JA 4YY3B 4JI2B 1RP1A 3B89A 1F12A 1KDPA 2Q8NA 1G98A 4K9RA 1NVVR 3A6LA 2IBMA 5IDWA 7MDHA 1JXQA 1YVEI 1HLFA 1DQNA 2HNAA 2OHHA 1YQEA 2QNRA 3FJOA 3I3SR 4P32A 4B7UA 5JC1A 1V1MA 3IR6A 2VP4A 1FQJA 2POQX 3I58A 2Y68A 4GI5A 4Q3DA 2FWMX 5C5DA 1ZGZA 1Q57A 5DOVA 3T1HB 5IH3A 2CNWA 4XCXA 3VISA 2UZ3A 3JQFA 2XQGA 3VR4A 4DYHA 3M81A 4GH5A 2HJVA 5EXDA 5EJIA 2O4CA 1J0XO 1QCCA 1MJ5A 3I6BA 4OFXA 4TZ0A 3IDZA 1PFGA 1RZRA 2C0PA 1N77A 2V6MA 3DWEX 3M7IA 3OBBA 3PG5A 3PNMA 4L4ZA 4U2KA 2MCFA 1T0BA 3BCSA 3WDLA 1M6VB 1IXRC 1XQ6A 1XQXA 5EMHA 1C9YA 1E0DA 3JVDA 2HXYA 3A9VA 2AJ8A 5C7YA 5JHGB 5JZBA 1E96A 2H1HA 2V7XA 4CGYA 2HV8A 4XGQA 1E5VA 5J2TF 2WVGA 4TS1A 3K8QA 4CQMD 1X94A 1N3BA 5BUSA 2OORA 3HUUA 3IXMA 2JGAA 2M2IA 1QTIA 1ENZA 2IL1A 3PUWA 4KYIB 3LS2A 3HEMA 4QJ5A 1D2NA 1RBMA 3QTBA 4PNPA 2R6DA 1G6KA 4R7ZA 3E9QA 5DDIP 4JUFA 5JH7A 2PAFA 1WWKA 3LX4A 2C00A 3KU1A 2ZS9A 4D81A 1OTHA 4DLBA 3DDHA 4UTRA 2QMHA 3I9FA 5F7ZA 2E4WA 2NU6B 4RW0A 4HAUA 4TKVB 5BW6B 3MMNA 4EP1A 1OASA 3HP7A 1F51E 4BBAA 1ZI6A 3ENQA 3EW7A 1UBFA 3F9IA 1FU8A 3O74A 3ONVA 4NEHB 4BQOA 3DW3X 2DJ5A 1VE7A 3KOXA 4HVCA 1Y4ZA 3RVKA 4BFVA 1OOEA 4JYMA 4UNSA 2PXAA 2JVIA 3NWEA 1DQRA 1FJGB 5D85A 3IQWA 2JGEA 2DYKA 4X8HA 4ES6A 4F6RA 4EJ2A 4MDEA 2OSVA 4H7PA 1HQKA 4U2BA 3JWPA 3EZLA 4L5JA 1GN8A 5AI4A 3IERA 1KEVA 5PGMA 3TMYA 2X40A 2OL4A 3UYLA 4J0JA 4RFLA 3BFVA 3NHYA 4CNQA 1E2MA 1Y5LA 5SY4A 4J0GA 1V3UA 2Q6KA 3TMAA 5CFOA 3M1YA 2OPBA 3OZCA 3PX2A 3BZUA 1DE0A 1OXTA 4NMXB 3PXXA 2AN4A 3NBUA 1Z17A 1FPMA 3CN9A 2UUBB 1KERA 3EXG2 1QKKA 1GZ7A 4MYHA 1AV7A 2VLIA 1UZMA 4EX7A 2F1HA 4JOCA 3QYFA 5D86A 5BORA 2FSUA 2VJPA 3CVYA 4J1QA 3ZGLA 2NP7A 4DNFA 3SQLA 2XYRA 3FCAA 1MEJA 2XUGA 4REQB 4YHBA 521PA 3L6UA 4J0FA 1NXQA 5DM0A 2HDWA 4YP1A 2B83A 1KORA 2GEUA 1IIBA 1NSFA 5AQEA 4F9TA 4NICA 3WK9A 2Z4RA 3GLFB 4CKEA 1LDGA 2EQAA 4J16A 5GV8A 1EK1A 1TKCA 4PG7A 2EGHA 1UQTA 3OE5A 4FLEA 3V1KA 3WXMA 1A9TA 721PA 2P11A 1E5LA 1KZ9A 1NVKA 2JH3A 2VSXA 2QL6A 4TQGA 2VTBA 1M6NA 3BKWA 1FFXA 2B94A 2PZFA 3F67A 3H5AA 1WW3A 1ZN7A 1Z36A 2QTMA 2FWRA 4J3FA 4BKPA 1FMTA 5J47A 3OZRA 2Z4TA 3HKBA 4XQGA 1KQNA 3ZNQA 2JLZA 1RIIA 5JD3A 3FWYA 4V2UA 5C53B 2O0MA 3C5CA 1SVKA 4JT2A 4N9QA 1ORDA 2J4DA 2YCLA 1EGHA 1W30A 1O94C 3VPHA 4QNNA 2YQZA 4M87A 3LT5A 5H80A 4UULA 5AIAA 4BC0A 5C9ZA 3TOSA 5CM8B 2XCSB 2CL6X 3ABIA 2BMWA 3ECCA 3U4DA 4LMRA 1ZM2A 2IXBA 5G1NA 4F2DA 3HJNA 1Y9EA 3Q9SA 3Q15C 1F38A 4GQBA 2GPTA 3GLVA 4C6SA 4G5HA 4G4GA 4IQ8A 4YAKA 2H7CA 1MKYA 3JQQA 5G4KB 1WUKS 1SNYA 2FQYA 3N2YA 1E0AA 2C0QA 4C7VA 1YDWA 2AYYA 2ZWOA 1VPEA 4EB3A 4P4UA 3G7UA 3Q11A 4TS4A 1O0SA 1Y8AA 1FA9A 3FLMA 3KQKA 5G53C 1V7PC 2R3SA 1M6WA 2E7ZA 2PXXA 3E3AA 3TNJA 4AMYA 2RI1A 4O4JB 4OX9B 4CNBA 1DEXA 1KP3A 1SPXA 1T5DX 3DXFA 4NJMA 1N8KA 2R8OA 4OHUA 2MSWA 2YIJA 5H9WA 3OJEA 2QNIA 1MTOA 2RHDA 4RTNA 4M8IA 1N2OA 4BZXA 3JSXA 4F1WA 3P9KA 3G6KA 2ZK7A 4MUGA 3GH1A 4GOND 4OJTA 3GRCA 1IE3A 4DCUA 4MQMA 4TV9F 2WUGA 2XQJA 1KQ3A 1YE5A 1L4YA 9ABPA 1MEOA 5FUMA 2C04A 3UMMA 1DCKA 1RRKA 3CEAA 4KPFC 4CM9D 3WJ2A 2PRIA 4YA6A 2Q3DA 4HB4A 4IGKA 1ZJJA 5AW6A 1Y4SA 2A5GA 1C3LA 1SCDA 2A78A 3KE9A 4AKEA 2PUCA 3FB1A 3WR5A 1WQ3A 4KI0A 2D54A 4L3WA 1YRHA 5EUCA 5JR3A 3MTJA 5K3CA 1BAPA 1V1RA 4DA4A 3R7NA 1GCIA 2GBCA 4EB0A 3NFYA 4P33A 3AL3A 1W25A 3FHJA 3FKQA 4LQDA 4O1HA 2O2ZA 2XHEA 4UVEA 5DHFA 3TFQA 1JYSA 5B2EA 3AEYA 2AZDA 3KPYA 4D8UA 4HS9A 3T3PB 1CUUA 2HQOA 2QAIA 2XYHA 4K6MA 4FWTA 1XD9A 2ZYSA 1Z8NA 4KWTA 3WGJA 1I0LA 3JZMA 4ESEA 4ENTA 1VB5A 4AUNA 1A96A 1UKAA 2OZVA 2QYOA 3JWJA 1B4DA 1ZSYA 3KVRA 3AM3A 4YJDA 1E2DA 2P2YA 2W9XA 1L5OA 2D0PB 5JAPA 5IXSA 1VCHA 4L27A 3B1WA 1BU5A 3TL6A 4F4HA 1C81A 2RG7A 3HWRA 2A1TS 1PLKA 1D6JA 4HDAA 5C18A 4G5GA 2RGNC 2WW8A 4MVCA 2CJXA 3RVLA 3BD6A 3UNXA 1J2JA 1NXOA 2MU1A 4BIIA 1EP9A 1O0BA 4J7AA 1OLOA 2YWFA 3FPCA 2QLMA 4I9HA 4HVTA 5IVPA 5ECYA 5CVEA 5JUWA 2CNKA 1LI4A 1BX0A 1WHSB 4RJ2A 5DGXA 5A3SA 3Q85A 3VM6A 4GR4A 5CVTA 4EW3A 4IUBS 4L8GA 4RYDA 4WLFA 1LBEA 2P0EA 3BULA 4LJLA 3OAAD 3OMLA 3P8ZA 1BHQ1 5KDLA 4A3SA 4F60A 3G88A 5JVDA 5DBEX 1JDTA 4NC9A 1WSWA 4R2MA 3LBIA 3AF2A 4YFVA 5AKXA 5IWAB 3ON5A 2CLEB 3TSZA 1JEDA 4GMKA 1B93A 5D3ZA 3BL8A 5CDFA 2XAUA 2A9FA 4MYTA 5DI3A 3MYRA 3U4IA 4BMOB 1JHXA 4L07A 1AQNA 1CUVA 1I7SB 4ISBA 2NU8B 5JCJD 1UBHS 1R2QA 4PQRA 5ANRB 4NZNA 3U44A 1R6AA 4JNKA 1U6KA 3FTQA 4W1SA 4KR0A 4FFMA 1X19A 2B2XA 4G4SO 2JA1A 7ABPA 5EC8A 2Q4OA 3CUKA 2IP2A 4CG2A 3OKAA 6ABPA 4F4IA 3BIFA 4E6EA 2AG6A 4KDFA 4IDGA 1G8PA 1PSWA 4EBFA 4UHJA 3MSCA 1BXRB 4I1OA 3ENVA 5B5SA 3QEAZ 4M0MA 3VR5H 1AB6A 1VI6A 1XKXA 2UVQA 2Y6VA 2QVGA 3AUYA 1FYVA 1M5RA 1FX0A 2CFTA 3DHWC 2HMTA 4YDQA 1CUHA 3TL3A 4D7AA 4R3UC 3OP4A 2ZIUB 3PLNA 3QPWA 2QI9F 4GMFA 4XIJA 3QKSA 1UC5B 3COWA 1Z4QA 2ISQA 2XB8A 4ITUA 3VMMA 4UFPA 2AH5A 3A70A 2WFAA 1HY3A 2BWJA 1Q0LA 1U4OA 3TLCA 2VXBA 1TLFA 2I3AA 2FF5A 5AVKA 3VH3A 4A91A 4DS3A 2BKVA 2JJQA 2SNIE 2V9CA 3OT5A 4U6SA 1M1YA 4WINA 4FUTA 5EJ2A 3WYEA 2A9QA 4US1R 4WNAA 1FZQA 1TQ6A 3UQYS 1F8XA 2DBVO 2IDMA 4XKJA 3RE1A 2JDIA 2RH9B 3GDFA 5U4XA 1HKUA 1T5TA 3D1LA 3NOQA 2G09A 5LMUB 1OI4A 1DC7A 3OKPA 2TYSB 3SHTA 5FPTA 3H2HA 2J59A 2PAAA 1ZA2A 2I3GA 1SCBA 3DHEA 4G09A 5C4GB 2C5EA 2FEXA 2X8LA 1JG2A 3NYQA 1Y81A 2VHVA 1KIFA 2ZJ6A 4IH1A 4B6JA 1E9CA 2JGDB 3TRKA 2HBYA 3RYHA 3V8MA 3MJ4A 1CF4A 2QTWB 2X6QA 1VI2A 1O96A 2J8ZA 4PSAA 4XASA 4KO3S 4YI5A 4P4TA 2QPLA 4WXHA 1KP9A 1YBVA 1G41A 2HJGA 4KB5A 1TO2E 2NP6A 5G0UA 2OK8A 3KTFA 1BCRB 4BKUA 5KOHA 1XNRB 1K2WA 5LQMA 2PWBA 4F2GA 4YRTA 2YY7A 4UM5A 5LL6P 1CDOA 2YWCA 5F98A 2FUG1 1CNFA 1A2BA 2FKAA 3FDJA 3DAFA 4EECA 3A3KA 3MIZA 5AMXA 5KVVA 2QT9A 1FFEA 5DVZA 1H0SA 1OVMA 3F6EX 2BRUA 4HO1X 1E2UA 1E61A 1O5IA 1EK0A 1ORVA 2GAJA 4LY9A 4KYTA 3NAZA 4GL4A 1LLQA 3L0DA 2PUBA 3DVLA 3GW8A 3EW9A 1I36A 1I9GA 1RKVA 1RVDA 2J6BA 1ZCJA 2OP0A 2PVCA 2VH5R 3MWYW 3R3JA 4FIDA 4KNWA 2JASA 4JD5A 4NNPA 2C2XA 3K9CA 1YRAA 4JELA 4UTZA 5I8ZA 2O8EA 4IQGA 5ALZA 5IJ9A 3RAJA 1AN9A 3OOWA 3RRNA 1MX1A 5HUHA 1HE5A 3HA7A 3VI3B 1WOMA 3QVLA 1YOBA 1C0PA 2BE9A 4Q9NA 4UMDA 2XUQA 4EW2A 4B47A 3R7DA 1JIIA 4F72A 3KSAC 1M1ZA 2PRKA 4GPAA 5I48A 5I8WA 2YXNA 3CPEA 1ZRHA 2VDOB 1ZIXA 4MV0A 2CJWA 5A0FA 3TK1A 3VNSA 2OBXA 4D8TA 4UXIA 1DIHA 2H85A 2Z3WA 1HKHA 5CT6A 1M2OA 2BGIA 2PBZA 1JA9A 2WKWA 4BNVA 4WY5A 3LLCA 3KM0A 3R7AA 2EWWA 1TTHA 3JWHA 2QJOA 4Q4HB 1LU9A 2YV3A 4TLLB 1FVHA 1UMDA 4M0CA 3V46A 1XUOA 4Q4AB 5H8WA 1H93A 1E2PA 1NRJB 4DYVA 4PYRA 4E15A 3KQLA 2OLKA 3A1UA 2WMOB 5LXTF 1OMOA 3P2KA 4S2EA 4YAOA 3WBBA 4BFZA 3K4PA 1MIOB 4KR3A 1FP4B 5IUKC 3TOXA 2ZUEA 3DFKA 2ZROA 3MGAA 3T7SA 2YW9A 4ZZ1A 2BFEA 4EG6A 2A35A 3KT8A 3AETB 1G42A 1RJEA 1F4VA 2AD5A 2Q41A 3AL2A 5BQXA 1RI1A 5I5GA 4CV1A 3DE4X 2X3YA 3NVAA 3C3PA 4JKYA 1QO9A 4IVQA 5BV7A 4M60A 2FX2A 4XD2A 3WKAA 3L5KA 1GG5A 5LU9A 2DSNA 3PPYA 2G4CA 5ALLA 4ZU1X 3U0VA 1WNTA 2XY4A 2O3QA 4BNJA 4CGZA 1WUJS 3RHFA 5E9JA 1VSTA 3GCGA 3QMVA 2JFXA 3FRHA 1U5BA 3X2SA 1ML3A 3OBIA 3T4XA 4XWGA 3ZE7A 4F3NA 2NPIA 2V9PA 2WRZA 3KKLA 5FI5A 5AFSA 5K03A 3OFSA 1JBEA 1MQAA 3I5AA 3D2AA 2GVZC 5G3ZA 1BVYF 3A2MA 4O8ZA 2W43A 3FAZA 2IEDA 1QIHA 4DQXA 2PWZA 2VC2B 1A9ZA 4JSYA 2Z8YA 2OCAA 2HJ9A 1OXVA 2ZJ8A 3MLEA 2O5EA 5L7YA 1GG8A 1TMYA 1FVFA 1K3FA 2ZTUA 4DR4B 2V03A 3FUUA 3IOYA 3LFHA 1EFPB 3QFHA 3L8FA 2G07A 3S2FA 1QVZA 2IRWA 1XNGA 2WJAA 3E27A 4CTOA 4PICA 1XA3A 1WABA 1PE0A 3Q12A 3ZY6A 4FHFA 1FBNA 4B0OA 1JEQB 3SDZA 4B76A 4AQYB 1NV8A 4K5QA 2ZLBA 2MSLA 4ZXFA 1A7AA 4EFDA 1Y6FA 2IEZA 2AEEA 3OPYB 4IDBA 3EOZA 3SR4A 3QVMA 5HUQA 1RAFA 3H11B 3NVDA 3L04A 1NMEA 1PUXA 4G1BA 4C7JA 3G0GA 4KDRA 2F3TA 1GYQA 2WB4A 1V41E 3EUFA 4XJSA 4EPYA 1KZ6A 1YZVA 1NBWB 2OLJA 1ZOPA 2FJPA 3T0FA 1NRXA 3AK4A 3FHLA 4UUAA 4UM7A 5D01A 5F73A 3WGNA 3ANXA 4G25A 3WLSA 3PTAA 4Y7DA 3C7TA 4NESA 1RXUA 4WK2B 5BRAA 1QFMA 2OBFA 4EKGA 5K2OA 4XAQA 3WYDA 4LTNA 3LTNC 2DZDA 1RMTA 1T8PA 2IU3A 2NTVA 2QQFA 4FE4A 4PW0A 2CLSA 4QUJA 3AM1A 5HJ2A 1PZXA 4MAFA 3LF1A 4H1TA 2P91A 3ROPA 2B4KA 3RF6A 2C2OA 3EQ2A 3C8ZA 3QI7A 4B9AA 3GGJA 5IJ0A 3FDFA 4OQZA 3UICA 3U9SA 3TVTA 1XF9A 3C3XA 4AG6A 1YMUA 4JVMA 3Q3JB 4PYIA 5FV7A 3SKXA 4FOTA 3KKOA 1S2GA 3WYNA 4DCOA 1M2VB 3ACCA 3LKBA 3PA6A 2H9YA 1OY1A 3MERA 5KB3A 3V7WA 2VJMA 1TVMA 1XU4A 2NYAA 2RGEA 5JCZA 1W44A 2OWEA 3TZHA 4I6EA 1CVLA 1GILA 3ND5A 4HUQA 3DUWA 3IQXA 4DUZB 4PGGA 1TADA 1FNNA 2BKLA 3L43A 3PGJA 4E7OA 4B5LA 3OZUA 3PQ5A 4QFBA 3AR9A 3ZUGA 2JRCA 1H5NA 3V4LA 1KFKB 1Z2AA 4A15A 2A6PA 4YROA 5ALIA 5LB4A 1FEZA 3W6PA 2LDBA 3H0CA 3DVQX 1YDMA 1KYYA 1SVUA 1D07A 2VRCA 3T7RA 3COJA 3TDKA 4YQFA 4B44A 5JARA 3P94A 2OO5A 4YK7A 3OWHA 1C2TA 2AG5A 3I09A 3TEMA 3T34A 3D8RA 3KD3A 3CEJA 1RHJA 4JP3A 4XM0A 4EY7A 1Q19A 4PGAA 2FDCA 2D1SA 1XTRA 4WJZA 4D3ZA 4CCYA 4DJTA 1CY6A 2D0IA 1MFPA 5JZSA 2F62A 2AOVA 1UOEA 2YYYA 1Q44A 4CBVA 4TRRA 1V8BA 2Y71A 2Z5VA 1EUCA 4HN4B 5IVIA 4YRQA 2GM5A 3PWZA 1RKBA 3OA0A 2D13A 1VKJA 4CLOB 1XWWA 1U8XX 4MQUA 4NDZA 5JY1A 2DQZA 3FZQA 1E59A 2IUYA 5T4BA 3VA7A 1KEEB 2ZRDA 4TQUS 1EM8B 4CTJA 2B36A 1JKJB 4NP6A 2WSIA 1AGYA 1XA0A 5IFLA 3CO5A 3ORFA 1IQUA 1MH1A 3R20A 2XKKA 1NKTA 3PVCA 4C4TA 3ZNPA 2WWGA 5CBPB 4ZCLA 3DG9A 3SJUA 1F2DA 1CCWA 1NMQA 3WLTA 4CKYA 3JQGA 3NG1A 4X90A 4FKZA 3I23A 1RIFA 1GFWA 2A1UB 1C0IA 2WIJA 4M6WB 3EXEB 4P34A 4CIAA 1G8MA 1KDYA 3ICEA 2NZWA 3LXXA 5A3RA 4NCXA 3PXGA 4C7OB 4IH9A 4DLWA 5TVGA 1RADA 2XE8A 2PWAA 3MMSA 4G24A 3W4KA 4FGWA 5FCDA 3KYIB 4BEWA 3PQCA 4JLJA 1GGKA 1SUWA 4XYBA 2Z1MA 4HS4A 3SIWA 3KQVA 2QMQA 3PNKA 3KK0A 1L7AA 4HLUC 4OQXA 4YBZA 5LQSA 2OYCA 4E7PA 4EZIA 3AUFA 1Z5NA 2FHSA 1NM5A 4JLPA 2JCSA 2IY7A 3WTBA 1X92A 4YRMA 1FNDA 2QSUA 1ATIA 1ZJYA 1YH3A 1T9GR 3JVUA 4GBJA 2BOVA 3BBPA 2H4ZA 3ZIAD 1KJNA 1M3SA 3ET4A 4MQLA 2I66A 4YAFA 4BMDA 4EFKA 1KWGA 1T4DA 1TF7A 5T64A 1RBYA 2ISCA 5EP4A 4ZJZA 3MCUA 3KAKA 5KU1A 4ZWNA 1HC7A 5ABPA 2OY0A 3LWNA 1BX3A 3C43A 2YZ2A 3WGMA 3ZCXA 1S2DA 2LV8A 3BB3A 3IV7A 5BXQC 2X5OA 2WUWE 2Q1XA 2NSYA 3R5FA 3DVAA 1EB8A 2EJUA 5FTMA 4AJEA 1O77A 5TMPA 3AVUA 1SOAA 2FPLA 4JBNA 1RYZA 1R37A 1QCYA 3L8DA 1L5ZA 2QJRA 4O5AA 2OFFA 2OKCA 2P9YA 5KMGB 4QD3A 4L0QA 3ITDA 3G0OA 1E9VA 1N1EA 4J4BA 3HDGA 4B2PA 4E5MA 4OM7A 1XLVA 2WT9A 1IFXA 1VCOA 1XP8A 1HYHA 3U62A 1M0EA 5KWIA 1VZ2A 1I7LA 2C8VA 3NALA 3A6PC 2PEYA 2ZQZA 4OLFA 1SK9A 2H8KA 1HR0B 3OE7A 2VDKB 3PF9A 5AM4A 4ARUA 1FS6A 3D81A 1RRMA 4L2IA 2E1PA 4KLZA 3IUMA 1KY2A 4DIBA 4P98A 4I1UA 2GPYA 1LJUA 1WDLA 3E9YA 5TQ2B 4DQUA 2X9QA 4TUYA 2ZR8A 2GMWA 2OUKA 1D2EA 1W8DA 1O3YA 2HNBA 4OA5A 2CDBA 2OQ2A 4C89A 1WB9A 2VUHB 3JQDA 4OHRA 4K2AA 1E69A 3U4GA 1G5QA 3S3TA 4EF5A 2OG2A 3AONB 4UEQA 1RXYA 1X7HA 1Y1QA 1SD5A 3CVXA 4PLVA 4QDZA 1FTQA 5IVDA 4M9XA 3FAKA 3K3PA 4ENPA 4AZ0B 1H1LA 2FQ1A 5LNK6 1YS1X 3VVLA 3ME5A 4G5FA 4M89A 5NLLA 3R7LA 3OTOB 2RGGA 2VP3A 1XRPA 3A9TA 3LL7A 3SF8A 2W6NA 3RTGA 2EW8A 3KKNA 2AOUA 4KR6A 4CF6A 5FLYA 2W2KA 3PR3A 1YD7A 4OUDA 5DNAA 4MUAA 5FNVF 3B20A 4BRSA 4UCQA 4PLCA 3F9CA 3R23A 2FA9A 2N0SA 3WDSA 2I7CA 4YCBA 2JJYA 4JYPA 4U2DA 2XTJA 2Z3VA 2IQ5A 2CFOA 3DGFC 3F7NA 3OP1A 2L2QA 4H60A 4HWOA 2C3PA 1Z0JA 3PDHA 1PSZA 3SIPA 2VCHA 4B3RB 2ZB8A 2ET6A 3GI1A 1JHQA 3KXLA 2J1LA 4WY2A 1GGFA 1WULS 3X0DA 3AUTA 5IFKA 2AUTA 3IPRA 2P2SA 2QR3A 1QCDA 2XYPA 5AKJA 4B6FA 1GRCA 3PHIA 5KCZA 1N5IA 4DUPA 3WLJA 2ZT5A 2EBHX 2Z4SA 3MJEA 1FFDA 5JU6A 1QU3A 5C1BA 4XE5A 3HZHA 5CD1A 4JP5A 4HL6A 2DE0X 4KFSA 5HE9A 4LYFA 3H5OA 3C3YA 2VSFA 3IJRA 4Z0PA 4BNIA 1AKUA 1GYPA 3OOHA 4ND8A 2XMSA 1VKHA 4Y1GA 1J1IA 5DYNA 4KQJA 1OB2A 1A8UA 5AUQA 4L9SA 3UHAA 3O7WA 4DUYB 1FQKA 3MPOA 4DZTA 1LDNA 4E2XA 4MMYB 4Q01A 5KOJA 3NT2A 3V48A 2FZ5A 5C5IA 4XR9A 3GIWA 2PYIA 4LOIA 3U39A 2JI4A 2EF1A 3QU7A 1CQWA 4IH4A 4R16A 2ID9A 2WJGA 5EJ5A 5D5HA 1EE2A 1NC1A 4YYEA 1P9LA 5BSHA 3FUVA 4JYAB 1B8NA 1E4VA 3HUFA 4DM4A 1P1JA 3SG0A 3PXBA 1Y5IA 3BWBA 1AGRA 3BSWA 1Q17A 1DIAA 5JSKA 4O4JA 2JAHA 4AY2A 5AUOB 3B6MA 3ESYA 2AI1A 2EX1A 3PNOA 2NU7A 4HAWA 4PPNA 1BKYA 3R4CA 5IZCA 2ZRNA 4HPXB 1T2EA 1WXGA 2FW9A 3DEHA 4ZVMA 1BU8A 1K6MA 5BT9A 4QYMA 2ZCUA 2XEDA 4JBXA 3GUVA 4LEIA 1JG3A 3PYMA 2R8RA 1TEHA 4UASA 3RF7A 2FUCA 3TNLA 3S55A 3ZWYA 4YPVA 1AQ6A 1I4LD 2W2TA 3MWEA 4N8DA 4U39A 4WT7A 1NT4A 1G4UR 3J7AC 4L85A 1W581 4MRVA 1PQWA 1M72A 5MN4A 3S6JA 5JLAA 4J7CA 2AF4C 1BQEA 3WMWA 4FT2A 3LWZA 5FTLA 3LY8A 3MBOA 2A86A 1GAWA 4RTRA 4J6EA 1O57A 2G36A 3DD1A 4F8YA 1GQQA 1N6HA 2MMGA 3EVEA 4FFBA 4PYMA 2AFRA 1GT6A 5FI0B 2M6KA 4E13A 2V65A 3IC5A 3O7MA 3F73A 1KMHA 3AGPA 5JS1A 1XQVA 5JOQA 3FTCA 3T12A 1LNSA 2QTBA 3QPAA 4YUWA 1JKXA 2JIBA 4NYJQ 1VHWA 1UKEA 2H08A 1DDGA 4PC2A 2GXAA 3CPJB 3DLCA 3IIJA 4WCDA 2YZNA 4WRRA 4RANA 3ZDCA 4S1TA 1G16A 4XQ0A 4QVIA 3F71A 2BBWA 2XWJI 4P7BA 2VK8A 5HBGA 1X80A 3BUSA 4PG6A 3B38A 1KZYC 1JDBB 3KZMA 4YJ2A 1V26A 2WI8A 1NNLA 4XVUA 1W93A 4D6PA 4TVSA 4YPFA 5K0TA 5LA6F 3D3WB 1LS6A 1Z5WA 1OZ0A 3MQFA 4I9UA 3HJRA 1SVLA 1SHKA 4KRFA 4BV3A 3PC3A 2AWOA 4BV2A 4YJGB 4C0KA 2BKAA 1KK1A 1W48A 3BXZA 2ZEJA 3ZU6A 2B78A 3V2UA 3KX2A 4M7PA 4FHCA 1WR8A 3B5IA 5M5BA 1D8AA 1PP4A 4DMCA 3GPBA 3ZDFA 1Z4NA 3CRVA 5CNIA 1SU4A 3AFIA 4JU9A 1IIRA 1DQPA 1Z82A 2PK3A 3BK2A 3N5KA 4RF2A 3MJCA 5KREA 821PA 1C7FA 4Q82A 1ILWA 1DC5A 3IP8A 2JCYA 3VR3A 2MYNA 4OHBA 5ALRA 2WJ6A 4BNKA 1VPWA 4CMHA 2H63A 4RM2A 3IVXA 5FH9A 1EWQA 2XDWA 3TNYA 4CL8A 4GPTA 2XOEA 5CVVA 4TYYA 2H57A 3KC2A 1HTBA 1QIKA 3ZZNA 1Y7PA 5A3VA 4YJ3B 4URZR 2QB5A 1D2CA 3AXTA 4IX9A 1T8WA 4TTJA 1AC5A 2EBWA 3PE6A 4G4JA 4ZOBA 3GK3A 1W94A 4Z4CA 4G84A 3C3CA 3A4LA 5HTOA 1L5SA 3BMOA 2VDVE 2VRCD 3IOMA 4X45A 1W87A 3QX7A 3WWYA 4Q7QA 5JNTA 4B3MB 2V97A 4RQAA 1K0UA 4P92A 1U3GA 4QBIA 2J0UB 1PJ3A 2NTNA 2FHPA 3P19A 5ITVA 1W76A 5SV2A 1NIPA 3OPMA 1L8AA 3WL4A 1H4QA 3UIEA 4BZPA 2AT1A 3AOEA 1CK4A 1KL7A 2IYZA 4RVNA 3RC2A 5I8PA 5J5VA 3O47A 2HA0A 2F8TA 2I65A 2ZBFA 5EQTA 1VHQA 3RC9A 1XEWY 2C7QA 3WRYC 4Q66C 5EZ6B 4HV4A 4MV4A 5EFOA 4ZYYA 3V7YA 4IKPA 1KOGA 3A8TA 3PITA 4KFCA 3GLGB 1FVOA 1JQDA 5HP4A 3OQBA 3JD0A 3WK5A 4KBGA 2ECFA 4FNMA 4X3PA 3VV2A 1BC5A 2IH5A 2WD9A 2J32A 2JFWA 3HSSA 3PUHA 3G2KA 3LT0A 1L5RA 4L76A 4H6WA 1PR9A 5JYBA 5KVAA 2D1FA 3KZVA 1E7MA 4MR9B 4Z4IA 3G02A 5D87A 3CN7A 3LYUA 3UF0A 4LG1A 4M1KA 4U0KA 1XYGA 3MMXA 4CLHA 1P0MA 4FFPA 2P2LA 4XYEA 1DFHA 2V6FA 2VJDA 5JCOC 3ZK7A 1SCKA 3CQ9A 1I4DD 4MS1A 3B9BA 5EIWA 3M5PA 1NMXA 5F7OA 3UMJA 4MR8B 1E2FA 1E2HA 2OV6A 2PZAA 4NSNA 3H83A 1W88B 3CSSA 4J0KA 5IP5A 4QUKA 1Y37A 2FAXA 4GXNA 4F06A 2PQMA 1S6YA 4JFAA 3BQMB 1TL7C 2AOTB 2VP2A 4LGVA 2I5PO 3EH1A 3CPHA 4XYMA 1O8BA 1ODFA 1P18A 1T9GS 3ZE2B 5F35A 3KSBC 2EGUA 1MXHA 2FI1A 2OM2A 2FSSA 2XYVA 2UYCA 1JZSA 1U28A 2PX3A 4C0HA 2ABWA 4TWIA 4XIGS 4R1LA 4CV3A 3IEVA 3N2KB 4BB9A 4E70A 4YGXB 5BMVA 1Y6ZA 2R87A 1R6DA 2ZGVA 1WLYA 3W7BA 3TSAA 5K45A 4S04A 3LLVA 2AKEA 3RAGA 1FP2A 4N40A 5CT4A 2E4UA 3MM4A 2R47A 3S27A 1AGXA 2HA3A 1UBCA 3AIMA 3NHKA 4PZCA 2EFCB 2VP9A 1Z2CA 3L05A 3N8GA 1DG3A 4TT8A 5J4YA 1X7YB 2A9KA 2DXIA 2NSLA 2CXOA 2QXUA 3LUKA 4K03A 1YB5A 2Y1OA 1OFUX 1XTVA 4CDRA 2NT4A 2NTYC 4GMXA 3VZDA 3FHCB 1CZRA 3EGWA 2G67A 3EDCA 3LHFA 5GIPE 3A2NA 5IABA 5C8DA 4ZI3A 2HCRA 2H4WA 1JQ3A 3H84A 4H16A 4Q12A 4LF6B 4G1EB 3CWCA 3JYLA 1KY5A 1TYAE 3P9CA 3R0VA 2OORC 2O4UX 4JASB 4Z9FA 1ULAA 2N1MA 1A4XA 5LP6B 1VECA 3VJRA 1NQXA 1IHXA 4DSZA 5B58C 4YCSA 3GAAA 1PF7E 2MMCA 3FTEA 4CLDA 2ZRCA 2G76A 2KB0A 1WCIB 4WLUA 2XDAA 2DH6A 2G1AA 4M86A 4OHPA 3GNQA 3CO0S 3I92A 5KJCA 2O5RA 1P0IA 3HCPA 4IIJF 3CX3A 3OE7D 3JV7A 3QPUA 1UBJS 4ESOA 1QG4A 4AJIA 3OMWA 5L6MB 1UBSB 4BP8A 4ZOLF 2AVDA 3NOXA 4M46A 5FNZA 1N5OX 3U13A 2XGOA 4IMPA 3BX1A 3IB6A 4X41A 3Q5DA 4KXMA 3D6VA 4B33A 1NBHA 3K31A 2JFZA 2EX4A 2IH2A 1BDHA 3GRRA 3MB8A 1BKSB 4D0NA 1T9HA 4HX5A 4OLHA 4ROSA 1ICIA 4JN6B 4R8MA 2GUGA 1PS8A 3AETA 4CQNA 1G5FA 4UNQA 1OXMA 2J5QA 3IQGX 3QZUA 3V2GA 2GF0A 3FPSA 1J24A 1XVLA 1XMOB 4EEKA 3ISJA 1TK9A 3G0DA 1X8JA 1W4RA 3KLMX 2ZTSA 2JI9A 4UW9A 4XVQA 3TGLA 2XPCA 3IKLA 2M9MA 4RD1A 3UXEA 1A4UA 1T6ZA 4LWZA 4BVJA 4IYRA 2AEJA 1L5WA 4B5KA 2QL5A 1PTKA 5IT9A 2X8JA 5IVHA 1PNOA 3BD9A 2QP4A 1HE2A 1PR3A 4NOMA 3U3KA 4PHFA 3I9V1 3E48A 2QRVB 4OFBA 1SU8A 3DMDA 4DY4A 5D2CA 5B3KA 4I1YA 5A1TA 1V95A 5CHEA 4LGYA 1QQTA 3UHFA 5ENDA 1KRWA 1WDWB 4FI3F 2O3UA 2LVBA 4UQPA 5DJ5A 5E3IA 1TEVA 5M3BA 1A5TA 2OCXA 4RKYA 4B8WA 3SS7X 4CM4A 3OWXA 1XJQA 2BJVA 2W2MA 2W6JA 1LVUA 3I8XA 2BEJA 3MPUA 1MF7A 3WIOA 3LV8A 1W2HA 1NW3A 2VSQA 1QMPA 2XCQA 2ZSAA 3AHDA 3D3NA 3KLPX 3OTQA 4E14A 2YKGA 4H4DA 1JEQA 2V3VA 3OLVA 1ZX1A 3O0TA 2XOXA 1UXKA 2JI6A 3H42B 1W96A 2IYQA 2NV2B 3A1FA 4QOEA 4UDYX 3VU8A 3GLRA 3UAGA 4X7MA 2G0AA 3W77A 4A0HA 1RE0A 5AVRA 3FSGA 5BNIA 4BQNA 2CLMB 3T35A 3WYAA 2CN1A 3WGLA 3TS1A 4IHJA 2HWXA 3RV3A 3TRIA 4A0QA 1E1QD 2AQHA 4DY6A 4Y6LA 4OREX 2CXPA 5K1ZA 3CNQS 4Q39A 4E51A 1NBEA 2ZIZA 1JDBC 1YRWA 2C4UA 3JQRA 1GDTA 2PUGA 1BH2A 1B41A 1XVTA 3AMVA 5DTRA 4QUAA 3R9IA 3OUUA 4ZODA 1UBTS 2AWNA 1X7DA 1B76A 3IBCA 4TXJA 1RHRA 1KSJA 4DNXA 4P0TA 4V02A 1YKFA 3E58A 5JXWA 2P5TB 1EFVB 2L0XA 2NSDA 4KO8A 3F78A 3KLBA 2NVBA 4IEFB 4JT9A 2ZXUA 3UMYA 4LKOA 1O87A 3JALA 3HFRA 1CR4A 1UZNA 4FGUA 4IMIB 5BV1A 4MV6A 4C01A 1IN5A 1EQUA 1FJHA 1N5MA 2G80A 3DT9A 2WAYA 1RRVA 1R12A 4YUVA 4X91A 2FEWB 2OV3A 4QHYA 3YASA 2VNSA 4BO9A 5IC4A 1C9DB 2P2GA 1T3GA 2AFIB 3ONFA 1E63A 5ALGA 3PDWA 2PKEA 4ENSA 1GARA 3D43A 4UHKA 4LHWA 5FLEX 2VHUA 5FTNA 4BFWA 5DSTA 2GK7A 1CDDA 1CR2A 1CY0A 2B1RA 3DAPA 5H3HA 5IRCD 2UZ1A 1YC5A 1ZIPA 3DCNA 1K4MA 4I14A 3GNSA 4IY1A 5J59A 4FN4A 2J6CA 4NCHA 3U7QA 3LXUX 5F64A 4DCNA 4KN8A 1A4RA 1PJLA 3TB6A 3DL2A 3PRJA 5BYBA 4UUBA 2RH4A 1UBUS 1IBCA 3UFXB 2FOLA 4MIOA 4U6QA 3FSJX 3ORHA 4UPDA 1CNMA 5J4HA 5TF0A 4NOJA 2D0DA 5K3BA 4PINA 4N8EA 2K5UA 3TCKA 2QVZX 1LLCA 3ZE0B 5JNWA 1I6KA 2F3PA 4UBJA 1S01A 1ZU5A 1GUFA 3GA5A 3ONWA 3HY3A 1RXEA 3R5JA 2AOXA 2FSPA 2Y1WA 3G1TA 4PZZA 4R1MA 4Z51A 1X1CA 1Z2PX 4PNHA 4CLXA 1QO7A 1D4ZA 1NOIA 3D6FA 1Z12A 1T1SA 3G79A 4WZAB 4DIEA 4RTQA 4KWCA 3K5WA 1MB0A 3UEOA 2B6NA 4W7HA 4XI9A 3U4HA 2B1JA 3ZE9A 4IICA 1M6EX 1SURA 2I4IA 4IEIA 1Y3DE 3FPBA 1GNQA 1Z38A 3GN1A 1EVJA 1P73A 5DTEA 3GELA