2C57A

H.pylori type ii dehydroquinase in complex with fa1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
171
structure length
164
Chain Sequence
GSSHHHHHHSSSHMKILVIQGPNLNMLGGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Helicobacter Pylori Type II Dehydroquinase Inhibitor Complexes: New Directions for Inhibitor Design.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Lyase
molecule keywords 3-DEHYDROQUINATE DEHYDRATASE
total genus 51
structure length 164
sequence length 171
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2005-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 2c57A00
2XDAA 3N86A 3N8NA 1UQRA 4CKWB 4KIUA 2Y71A 4KIJA 2Y76A 4B6RA 4CIVA 5B6PA 4CKWA 4CL0A 3N8KA 4KIWA 2C57A 4B6OA 4CIYA 4B6SA 1H0SA 2CJFA 2XB9A 2XD9A 4V0SA 4L8LA 1H0RA 4KI7A 2XB8A 4RHCA 3LWZA 4ZC1A 3KIPA 3N59A 1H05A 5WRFA 3N87A 1D0IA 2DHQA 4B6QA 4CIWA 1GQOA 1GU0A 2Y77A 3N7AA 4CKZA 3N76A 3U80A 1GU1A 4CIXA 2C4VA 2WKSA 1V1JA 4B6PA 2UYGA 2C4WA 1GTZA 4CKYA 4CKXA 4RC9A 2BT4A 1J2YA
chains in the Genus database with same CATH superfamily
3L0OA 5TVKA 4YHBA 3A04A 4ZVTA 1BU5A 3FSGA 2LIPA 3LYLA 2YS6A 4L72A 3OHSX 4AG3A 5IXJA 1QO7A 3ROXA 3TI7A 1EFCA 1FBNA 2R48A 3FWPA 3HGMA 5JOQA 1PQWA 1M2GA 3ABZA 3CVUA 1UEXC 3UHPA 4DA7A 1GCAA 1TM5E 4GKVA 4GVXA 2WJZB 4LYGA 2F4NA 4KK4A 3U3MA 2GBPA 3I5AA 1EFDN 1U7PA 4LHWA 4HP8A 1XPJA 1P7YA 1KGDA 1GUBA 2PYIA 1EFAA 4XQ0A 1VE5A 1SD5A 2ODPA 2CCKA 3C85A 2FH5B 1X3LA 1K92A 2QU8A 4TTAA 2VJBA 3K1TA 1SC3A 1Z4IA 5CXSA 4ZN6A 5JARA 5KYYA 1DEAA 2G83A 3DF7A 3JQ7B 4FYVA 4OQ4A 4S1PA 4PW0A 5EJ7A 2CFOA 3K15A 4CUZA 4W5QA 1C3LA 5DU2A 2PUAA 1L9XA 1OI2A 3OOSA 5JSKA 3PFNA 3NWOA 4E1BA 5KYGA 3F90A 2O0HA 1YTUA 5CVJA 4E1VA 3ASUA 3HLTA 1MJHA 5AESA 1P60A 4ZQGA 4UUBA 4HEA6 4QL3A 3QTBA 5EZ5A 1UOEA 3I2KA 2ZVQX 1Z37A 3H97A 4FUTA 4ZIRB 2Q5LA 2VYNA 4PYMA 2IUFA 1LFAA 5LYJB 4PZAA 3FNBA 2JD0A 4BO4A 1EDOA 4X6LA 4X00A 1NQWA 2V7GA 1L5ZA 1ZGBA 1ESMA 1HDOA 4EY8A 1QIJA 4G0MA 3TW4A 3UK1A 5JMWA 4H3HB 4LRUA 1TKCA 2ZR0A 2R6JA 4MUYA 4GOJA 4MP6A 3I09A 4R81A 5HKKA 4CKYA 2W6JA 2RAPA 1K8QA 1JQ5A 3L0ZA 4WKPA 1WABA 4BQEA 1DCTA 2VL7A 4U7GA 2JLYA 1MKYA 4GGPA 3VR5H 3M1YA 3Q3JB 1VRVA 1ULHA 2HPAA 4ETMA 5IF9A 2IZZA 3WZMA 3I6YA 2WWFA 2ZTLA 2JJ8A 3HABA 3MCAA 3OECA 5JD5A 3HCWA 1WZUA 2MIIA 1SEPA 5F1PA 3SCZA 5F1OA 1YTLA 5EWMA 2HV8A 4G0XA 1H9AA 4GVPA 4XFJA 5C7YA 2F1IA 2YXNA 4P81A 5H9VA 3BTUA 2CV0A 1QDUA 4BUCA 2UXCB 2FPIA 1TCAA 2AD1A 4IV8A 3V1LA 4ZDKA 5JS1A 3KOMA 2B82A 1CFJA 1U4SA 3VH2A 2OWEA 4Z4QA 5E9JA 1FRZA 3HMQA 2A94A 4RD4A 3P19A 5E4YA 3EF3A 2Q6OA 3IKLA 3TS1A 4EFDA 3U7HB 4M60A 2FMKA 4ZI2A 1W36D 3ENZA 2QXYA 1UWLA 4Z0TA 4HQFA 3FOBA 5JSZA 5CGQB 5BR7A 2H1SA 5K7SA 6ABPA 2FUG1 1STOA 5H80A 3SJAA 4AURA 6YASA 1R6TA 1MB3A 3ICVA 1KBOA 5GVRA 3HA5A 1L5VA 5JH7A 3VNUA 1R5BA 3O3MB 5F33A 1NP6A 2FPKA 3R3SA 4NPCA 4S35A 2VUIB 2HSDA 1EGVB 1L5MA 3M89A 3ND9A 3P9NA 3THYB 2VRNA 4HLDA 3QVUA 1Q1EA 4NFYA 4DQKA 2BPOA 2X77A 1C3OB 2PX8A 5AYVA 3Q8KA 5D5PA 3FNEA 1DWPA 1LV7A 1P0FA 2LCIA 2OHXA 1CUIA 3KFLA 3I6QA 3GDFA 5FYDA 3A06A 1AQLA 1TEHA 4P80A 1AD2A 1DQSA 3DEIA 3GAAA 5K0JA 1TW3A 2QTGA 1CS0B 4Y6RA 4KREA 1RJWA 2QQGA 2GDJA 3N8HA 4LWOA 5FOVA 2P4SA 3ZHXA 4ZMBA 1C1DB 1NVMB 1KGSA 2Q2OA 2R8XA 3IT0A 1E1CA 4IO1A 4EY3A 4XM1A 5C4IA 4MWEA 5J1SB 2ZUEA 4IXDA 5KDLA 2COKA 2X1HA 4LDZA 2RMKA 4BJ6A 1L5KA 1G8YA 1G16A 5J4HA 5AKXA 5LBIA 4MS4A 1H2ZA 3VPBA 2HPVA 1SXPA 1FXWA 1A8PA 1MTOA 2M98A 5ELLA 2G4CA 3WNCA 2ECQA 2KSQA 1RZRA 1Z6GA 1I0LA 4MPDA 3KKPA 1A98A 4GX5A 3TQIA 2EP5A 4AJOA 4H3SA 2V0NA 1ORHA 4YAWA 1UFQA 1KA9H 1ZKMA 1U2SA 2FX5A 5IFKA 2H92A 2NUPB 3UPTA 4I6JA 3IAEA 3GH1A 3KT6A 2JBAB 1K88A 3GLRA 4E31A 5KOHB 1CUBA 2HIAA 3KKEA 3SBDA 4CIDA 4UFOA 4MJ7A 5BSTA 1QE5A 3TM4A 2HF8A 4MWSA 1Z2DA 3DC2A 5JYCA 2CZCA 4NABA 4EOGA 5L40A 4MH0R 1RHRA 1K06A 1G3QA 3EIHA 5C52B 2E82A 2I78A 3GFTA 3W3AH 2DUMA 2P6OA 4TRRA 2WJ6A 3PGKA 4KKXB 1KJ8A 3V4PB 4LDPA 5J2TF 3WGJA 4WCFA 1E2HA 2ZPAA 1IQRA 2P65A 4HUQA 4O25A 3Q9SA 5HF8A 4I50F 2LGJA 4EO7A 2O2DA 3G5LA 1DTSA 3G2MA 3R2JA 4FWIB 3IEPA 5FPTA 4GI3A 4COKA 4D4JA 2Z9BA 3LVRE 4EKDA 1I1NA 1KZ6A 2YC4C 3C6QA 4MIKA 4MGKR 3ZHCA 3VQTA 3SXPA 4O4LF 4Y6PA 1KBZA 2M2IA 3EGEA 5DP1A 1TGYA 4ARUA 4RQBA 1GTMA 3DUFA 2A5GA 2X9VA 1TCUA 1DQPA 3FW1A 4QWWA 3TKAA 4MWGA 4MRRA 4D3XA 4DMMA 4EO4A 4HOYA 4M0MA 4BVBA 1NJ2A 2NVUB 2FSFA 2RSLA 1AZSC 1M7GA 1QZTA 4HNSA 4Y1RB 1VA4A 2XDYA 1GKYA 2GA9A 1XZMA 2PXXA 4Y2GA 3B6ZA 4I5EA 3HPQA 3RSLA 4WK0B 1HXHA 1R0YA 3GWGA 4FMBB 4PO3X 2ZE6A 3DZDA 2ZIAA 2LP4Y 2QRQA 4KVAA 1G17A 1N1EA 4L2IB 4WZAB 3C5WP 1QHXA 3IUYA 3U4HA 4KR3A 3FAKA 3WA7A 4BAUA 1A04A 5EJ6A 1DARA 1G21A 1Y3IA 2RK6A 4F4DA 2DLNA 2VQ6A 5JZ9A 5ILOA 1PUXA 1VYTA 1MB9A 3W6ZA 1Q84A 2AI3A 2O2SA 4TV8F 2IXDA 2KLBA 4W5NA 2IHKA 1BC5A 1N2ZA 4LYYA 4NK4A 2B4QA 1W4CA 3K4QA 3K5IA 2DFLA 1T25A 1QJ4A 1ZCZA 1GAQA 2WBLC 3P2MA 2V59A 5SZKB 3QX3A 2PHZA 2WDZA 3EVDA 4QJIA 1QH0A 2X7XA 3DDCA 1M34A 3KYJB 3OFVA 1VLHA 3LLCA 3QFRA 2YN0A 3L4EA 1GNVA 3RU3A 1TADA 1K9SA 3HBFA 4QIHA 4AUNA 4UEQA 1VCHA 2NVUA 4E4RA 3KE8A 3GEIA 1V41E 3MLBA 2Y1KA 3DT8A 5CJPA 4OA8A 5GADl 1M8PA 3D31A 3LSTA 2AL7A 3WR5A 1T10A 3EZFA 4PC7A 3UAZA 5HR5A 3ND8A 2IY9A 1OH5A 4MHTA 1E5TA 3ELDA 2REOA 1SCQA 2WNSA 2CYAA 1P17A 1TT5A 2HF9A 2J3DA 3L7MA 3C24A 1G60A 2GM5A 4EYOA 4BBJA 3K1YA 2QRJA 4S05A 2IYLD 5LQAA 3ZK8A 5JADA 2RAUA 1XHEA 3VI4B 1QG4A 4UFPA 1XZAA 4KBGA 2PRZA 2Q3LA 2ZZKA 4JLBA 4N49A 4PZCA 1VBMA 2VP4A 2OL4A 2X8AA 2WYVA 2EBHX 1E0DA 2WM3A 1MGOA 4V0QA 4YAEA 2OFPA 3V3TA 2QLJA 4NATA 4CLXA 2EX1A 3E48A 4XSHA 3GJTA 4ZVKA 5KMGB 3PQ8A 4G4JA 4UNNA 4Q4AB 4LPKA 5B58T 1N0IA 3GFBA 1MG0A 5IS2A 4DJ5X 5FR1A 3TCKA 4AMZA 1IXKA 1G7TA 2H11A 5IYZF 3ZWBA 4AROA 1JFSA 1BGVA 1Y1KE 1ETHA 2BMVA 2V0CA 4AMVA 2VQEB 4BQQA 3UHOA 3ODGA 4ZZ0A 3U3XA 2BISA 3L1UA 4IWYA 3ZLTA 3BGSA 3LCJA 4DM7A 3LY9A 3L0PA 2GCOA 1RWBA 1OFTA 1L3BA 2VF4X 5ALOA 3EAGA 1N3LA 2OWDA 1UBFA 4GICA 4H7IA 4HBGA 1YE3A 4BX8A 5BNZA 1Z34A 2FW1A 3DEFA 5FBRB 4IICA 2C95A 2ZXUA 2Q3CA 4UE3S 2JFUA 4IJWA 3H86A 2JL1A 4QPNA 5T6MA 3CO0S 1T9BA 3EVFA 3I37X 4N5DA 3IKMB 1HT2E 3G8AA 2NLOA 4JA0A 5FTKA 4WOCA 3D8NA 1EZ4A 3HN7A 4B82A 1S8FA 1LWNA 1TXGA 3GHHA 4X0EA 3LXMA 3HXTA 3OWXA 3BJMA 1R74A 1Y33E 3R7SA 4D0SA 4O2RA 3GG2A 2A58A 1D4OA 3MT0A 3M9LA 4QGGA 5JDCC 1DIHA 1KMHA 1C3VA 1SVNA 3ZWVA 3SZRA 4A03A 1EWTA 2I3BA 2PSHA 2Q1XA 4MYUA 3IR7A 3O26A 4TS4A 2RC6A 2IZ7A 1IWOA 4YUVA 1BYUA 3NBZC 4PTLA 2IUUA 1JJVA 1G2QA 2CXXA 4YMUA 1D04A 1XTIA 2VTBA 1T0UA 1FYDA 3D4OA 1IHPA 3B5JA 1J2EA 3UAYA 3PGXA 5SY4A 3IEXA 3IULA 4JLWA 5JTUA 2A9OA 1JHMA 3GUVA 2BFFB 2M1XA 1YJQA 2OCPA 2AFIE 2G25A 3BF8A 2B8WA 2CL0X 2NX2A 4RK4A 3LDHA 4DTCA 2X14A 1YDFA 1MP0A 1EHCA 3DZ8A 4ZK2A 1CQXA 1OQAA 2VG8A 5ED0A 1YRYE 3AL0C 3BMNA 3E8SA 2Z43A 1JIUA 3FPFA 4JENA 4DDMA 3U4CA 3E3AA 3RC9A 1CRLA 3OCYA 2D3WA 3N53A 3QU9A 4IDEA 4K5QA 3VZCA 5IKOA 3ZBUA 2RC5A 5LA6B 5JNSA 1E5VA 1ENPA 3N2ZB 1PNQA 4JQYA 5JSFA 1OU0A 2H51A 2X4LA 3JYPA 1N6RA 8AT1A 3COWA 2BV3A 1XE3A 5EKXA 3U6BA 5LKRA 3KHKA 4XPIB 2GZSA 3L92A 2J9RA 4LXXA 1ZZEA 2P9BA 3CF6R 5K6AC 1CV2A 4BMVA 4TL9A 1QU2A 5KMGA 5C51B 2BMJA 2ZI3A 3DSRA 3IOEA 4I4TB 2R0QC 1S2DA 4KXMA 1JIVA 1WKCA 1XKLA 4UBMA 1W5BA 3Q3EA 2VLBA 3RODA 4UTZA 5K6AA 2PANA 3ZNQA 1VPEA 1SN7A 4Q24A 3GGGA 4G8CA 2I9PA 4WCVA 2A9RA 4B32A 2O8EB 4KXYA 4OHXA 2R4QA 3EIEA 4AY3A 3PE3A 3PIRA 1MQ9A 4RKWA 5LQNA 2CMHA 1J5EB 2VC2B 4NV1A 4XIGS 3AR7A 3D8RA 3E2PA 2C83A 5JDIA 1DG1G 3BHNA 1WPXA 1RPJA 1RXEA 3N0XA 5D01A 1WPQA 2Z56A 1H85A 4RHUA 5IC4A 1NLUA 4IRUB 2YOHA 1WY5A 2CMGA 2AYYA 2P0AA 1O6BA 3KYIB 3KTFA 3I5UA 3QJGA 2I4TA 3LGXA 4C6HA 2MMGA 4PFJA 4OGGA 2R65A 2P5TB 3OEEA 4U2KA 2YW9A 3EZ9A 2QA5A 2ZUDA 4KO1S 4YRRA 4MUFA 3KQTA 5FH9A 4BV9A 1ATZA 1S7GA 1AXGA 1XD9A 3E7XA 3QVWA 4JJAA 4MXDA 4MVJP 3A11A 4Q3KA 4XD7D 5J40A 3KL2A 1CZKA 4L78A 3ANYB 4FWTA 4ZRDA 2PH7A 2NW6A 2X8LA 4KZPA 1UXIA 1I3CA 4QPPA 5ALIA 3WGOA 3IT2A 4XFDA 3SC2B 2BJVA 3UGTA 2C3MA 4LXHA 1KI6A 2AUMA 5BN3A 1PGJA 2I80A 3KQOA 1ZVJA 4QYIB 2BGJA 1NURA 4HXGA 3UA3A 4WV3A 1I2BA 4PPFA 5DLQC 2ZRMA 1I01A 2A88A 1UJBA 1O97C 3HWRA 2GTPA 1E8MA 1IOVA 3CUSA 1ZH8A 3HJAA 1KS9A 2E87A 3LC0A 3LL7A 1YRAA 1UBHS 4BV3A 1KDPA 3PV0A 3RROA 3RSZA 3SEAA 1RHKA 4LGYA 1ZH2A 2CUZA 2XNDA 2EL9A 2J4FA 5ERXA 4KMRA 1WXQA 3P5BA 3DBHA 3I58A 5FPPA 2PUCA 5IK2D 3VPHA 1KAGA 3X0DA 2Z0MA 3A6ZA 1QV9A 3KPUA 2FOXA 1VL5A 5DH9A 4Q7EA 4MR9A 2CLMB 3SF8B 1PDWA 3SYMA 4LTNA 2O14A 4HQLA 4RH0A 2QL7A 2VSFA 4OXXA 2DCUA 4M1QA 5C81A 1AZTA 1L7DA 2IGTA 4DSOA 4F92B 1E61A 2PL9A 2I6XA 2XT9A 3EVZA 3L1JA 3MGAA 4JC5A 1GDTA 5B55A 2QLLA 3OFNA 4ZU1X 5CB4F 1JFRA 3GFFA 3QVGA 4R54A 4NZMA 4HDNB 4RZXA 4L8FA 4Q6BA 2WD9A 3C5CA 4FR5A 4R2IA 3IAS6 5DYIA 4HTAA 2JHPA 5BSFA 2D1QA 1X70A 4BN0A 3IP5A 3JALA 3JRNA 2FPPB 2W2XA 2JGIA 4FOTA 4MGIR 4Z9YA 1AGNA 3J7TA 3ZI4A 3Q87B 5A02A 2E5WA 5ALXA 1E9VA 1NYRA 2P69A 3MD9A 3CWQA 3NIWA 1TYBE 4NONA 4RGYA 4ABTA 1H2XA 4LPSA 4C21A 4RXTA 2O8EA 4I66A 1EH5A 5GPBA 3CVYA 1Y7PA 3NCTA 5GAJA 4OP3A 3RK4A 3ZI7A 1P7VA 4LBYA 4K28A 3EF1A 4JV5B 2HBYA 1KAQA 1O94D 3I3OA 4DV1B 3R5FA 4NBSA 3K70C 3IC5A 3FMIA 1TUBB 3B70A 3LXRA 4EBFA 4C78A 4YLYA 4JI3B 1QHEA 4E21A 3MYRA 3PENA 3BWBA 4UPVA 1GADO 3OP1A 2VJQA 1TAGA 3C48A 4E13A 5C8DA 4M4SA 1N5KA 1S2MA 4DLVA 1U0BB 5BOSB 1UKZA 1C81A 2PX2A 3ICCA 5EJ8A 3A25A 3Q8MA 1ORRA 2OHIA 3ZCUA 1RI2A 4EJ2A 5B7PA 4Y67A 3LV8A 1FW8A 3MS4A 4JJKA 5HUQA 5JNLA 1DAIA 3RBZA 4F8YA 6REQB 4L3WA 2I03A 3NXKA 1QANA 4MUMA 4PG8A 1MMFB 1VL6A 1ZRMA 2X0FA 4XQ9A 2HU7A 2R6HA 3S1AA 3OZGA 4JBIA 3C8MA 1ZHOA 1MC4A 2BGMA 5L45A 1UFRA 4CQNA 2OXCA 3PI7A 1X7XA 1YRBA 1Z3IX 4WE3A 5EHIA 5JZVA 3ID6C 4XJXA 1E7SA 4EKEA 2JLVA 3SVLA 2QX6A 3LAWA 3OEWA 3OE7A 2BBWA 2VT6A 3KJNA 2IHYA 3IJEB 5F5XA 1MVOA 4AC9A 1P72A 1YGYA 3ILSA 4TSKA 3M3DA 4BWFB 4ND3A 4FB5A 3GLFE 2HXSA 3DB2A 3KT3A 4L5AA 2C8LA 2GYYA 4LNUB 1TO2E 2X76A 4EHBA 2WJ3A 3JSXA 1I9GA 3EUWA 1FBTA 3BDIA 4DCOA 2V98A 3PDWA 1Q7CA 3WY9A 4N0QA 1ISHA 4YWHA 4MR9B 2XY4A 1VCIA 4PLCA 2WE8A 3R74A 5K3FB 3ZHYA 4B73A 2HXGA 2DYKA 2CXQA 1XRQA 2Y0BA 3M5WA 2DSTA 1YU9A 2VK8A 3P9SA 4K88A 4Y9DA 1G8AA 3LF1A 4H6WA 4WY5A 2P35A 5CM9C 4HAUA 3GHYA 4QEKA 1YASA 1V95A 3T12A 1BHSA 4J76A 3VPSA 4BVFA 1SZJG 4HGYA 4WA8A 1QTQA 1XQ9A 2FN3A 2YJZA 1E2EA 1ADCA 1H3FA 1T4GA 3IVXA 2NU6A 4KWHA 4WL0A 1PZNA 1WJGA 3CO5A 2ZS7A 3WB1A 5BVGB 1BXZA 2BELA 4K6CA 2P2NA 4DWWA 5KWEA 2AT1A 2RHOA 1X7XB 4MGEA 5D2CA 3KPVA 3OCCA 2GF0A 3OUTA 4QLBA 2YJTD 2Q29A 3GLFA 4HD8A 1UPTA 3HEMA 2Q07A 5IABA 4YAOA 3GLHA 1PAUA 2O2HA 2HK7A 3KV1A 4F04A 1I0IA 4H59A 2J0UB 2Q3HA 2GSDA 2R85A 4B8ZA 1JXQA 5A03A 3SHOA 1Z8DA 3E5RA 3FKSA 3Q6NA 4I55A 1NN5A 3RIYA 5DI9A 1K5PA 3R9WA 4BNNA 1XNHA 2GUWA 2BY4A 3H99A 3LX6A 5KJ6A 4JOCA 4QPDA 2HA2A 4GRAA 1R16A 1VXOA 1Y3FE 2GF9A 4UDXX 3SYTA 1K7YA 2C8KA 1YC5A 3EWIA 1S6YA 3WO1A 3IDQA 3I62A 4MMYB 2HMSA 4G01B 5HHTA 3IBGA 1E3MA 2PGIA 1QP8A 5LB4A 4Q3EA 2GEJA 5BOSA 3JQGA 4BVHA 1NWCA 4D26A 1IG3A 1WR8A 2VBFA 3OZDA 3BGOS 3IVCA 5CX4A 4EZIA 2YRWA 4FYMA 1WB4A 2GZHA 3TZCA 3ZXSA 4QG3A 5F2EA 3T3OA 3VU0A 1UINA 2BAGA 3BZWA 4IQ4A 1ZW1A 2O3QA 2FGJA 2ORVA 4OP1A 1A9ZA 5DBGA 3PJRA 2C4HA 1SMKA 1ZOSA 1NVWQ 2CL6X 3L3BA 3RVMA 2Z57A 5FUVA 2EERA 4ARZB 1YXMA 4ZQHA 2NTJA 4L51A 1AV7A 1G6OA 1SVSA 1UJ6A 1BWRA 1N75A 2GAFA 2QRUA 2SKCA 3N5CA 5IANA 5ITZA 2XCTB 2EX0A 2J32A 3N8NA 2QN6A 1ZD3A 2JIPA 1UBSB 2HGZA 4L0DA 4L3OA 4NCHA 4WNAB 3ITKA 2VKTA 1D6NA 4WLVA 3OUUA 1X39A 2V5AA 2VS1A 3OJCA 5JEDA 2R8OA 3KEFA 2Q5OA 2H59A 4XE5A 2PZFA 4YRAA 3BSYA 3A9SA 4XDZA 1SUBA 4MV1A 1XQWA 2DVMA 1PIWA 3RYFA 3KHTA 5IKPA 4HPXB 3CQ9A 1K98A 3RVNA 4GPBA 3TXAA 5ALPA 1YR9A 1M2OB 1ZICA 1QCDA 3RV3A 4HDRA 4EATA 2C42A 4YLEA 2X1LA 4ZQCB 3WJ7A 5B2ZA 3AG5A 2FRDC 2EOAA 3AY0A 3OLXA 3RNLA 2DTXA 3KPWA 1UF9A 1Y81A 4C5CA 2BKLA 4CYMA 1TO1E 4EHKA 1QFXA 3GJ5A 1AU9A 4UZFA 2R1VA 3MT9A 1G9TA 4FDUA 3X1JA 5IASA 4K9LA 4Y2YA 3SZGA 3U48A 1KU0A 1NXOA 1SOMA 1QWSA 2O1EA 1HEUA 5I5GA 1RBQA 3D2CA 5H3HA 4BZQA 2M6KA 1B00A 4JI5B 1O97D 4RZQA 3R5JA 2YHIB 3E9NA 3IPXA 1X7WB 1G8SA 2GH1A 2JCGA 1QB7A 1X7ZB 4Z99A 1M1YA 5LUAA 2O5VA 2VBIA 3OU6A 3SS9X 2OQRA 4Q21A 5C7IO 1NJGA 1AHIA 2J7PD 4ZVVA 3JAMA 1GNLA 3TAUA 3EDOA 1GG9A 1M1NA 5KO2A 4I1IA 5JNVA 4MR7A 4MUNA 5AKEA 3ORSA 3T5MA 2EJCA 1P3DA 2HRZA 2C2XA 3RQSA 1AUPA 4F8EA 4FKZA 4HLUC 2Z04A 1U02A 2LV8A 2QQ5A 4I4CA 2HHAA 4NMWA 3WBBA 1E9SA 3BXXA 5JNWA 1ZMRA 1IONA 3TKYA 3CH7A 4LWPA 3PZRA 2FLKA 3AC0A 3JCZA 2Q3MA 4I5GA 2XV1A 1KMCA 2BM8A 3HO6A 3L06A 4ZAVA 3ZZNA 1OBOA 2Y68A 2J3MA 2QTRA 3GELA 4OK6A 1YJXA 5HK8A 4ASUD 3DEKA 3MMNA 4RVFA 3PPWA 3TR6A 3DDOA 1V9LA 1Z2CA 2VWQA 4LECA 4ZODA 5BYAA 4YT5A 5TB5A 2HCBA 4DFDA 4DIEA 5FI5A 3KHUA 4PCAA 2H85A 4AM8A 1L9KA 3ZKAA 3E7WA 1QHFA 2CXRA 4RV9A 2O7SA 3EHDA 2XE7A 4B79A 5B36A 4KJXA 4YP7A 1SR8A 2ZYAA 1AHNA 3TQHA 1T2CA 3QU7A 4A92A 3X1XA 1UFVA 4EUFA 5BWMA 1IWPB 3EMBA 1RXYA 3A31A 4X61A 3H9CA 3NHWA 1TZJA 2AG6A 1HY3A 3I4FA 3LPMA 3SQDA 2G0NA 4M8IA 3ZXIA 1OTYA 4B34A 4DLPA 1H2BA 3ZHQA 1YUBA 5M2QA 2G07A 4IDOA 3IV6A 4F56A 2FWBA 4J1TA 2QORA 4B40A 3K70D 3U3DA 1ZUD1 5FV7A 3SYKA 3UMRA 3U3KA 4HH0A 5BV2P 3GLTA 1P6QA 3BMNB 4PO8A 5AI5A 4JCOA 5IYZA 5JDIC 3RF6A 5TEWA 2O3UA 5IVKA 2HA5A 1H2YA 1XUOA 1GSHA 3E3NA 4FILA 3GG9A 1JB9A 3B6IA 1VFNA 3ND5A 4FINA 4C0WA 1F06A 2GBFA 2BBSA 1RYYA 2QPAA 4XLTA 1BO6A 4MEAA 1QDEA 3MUNA 7MHTA 1TK3A 3BMCA 4L75A 3OPYA 2JLBA 2PT7A 2GM9A 1H8EA 4G41A 5IM4A 2BSQA 3AVWA 3TJRA 3ZDDA 3FJYA 5L7WA 3GFQA 4MWOA 2VPTA 4J4TA 4NDAA 4WERA 3MBOA 3BWMA 4PX5A 4A8JB 4YCAA 3FHTA 1T8UA 1W29A 3A1SA 5ALMA 4EF5A 2R7NA 1IB6A 2IX3A 3FXAA 3JZFA 3B1YA 1Y4SA 1N9ZA 2VHYA 3IQDB 3ZNPA 5C1DA 4JLKA 3LHIA 3AR4A 3GDHA 4J2TA 5E7JA 5I7AA 1C41A 3IAAA 2BT4A 3CN9A 5BWCA 4J0GA 3S99A 5SYAA 4UD2A 2KBEA 3H5VA 4FMCF 5BMVB 1B8NA 2PZAA 3DULA 4EI8A 1GDHA 3NR2A 3OH8A 2AQKA 3CUWA 3PNMA 2A9QA 2CXTA 2WIJA 1E64A 2ZI5A 3OBIA 4X7BA 4ANFA 4CM8A 2CVZA 2YX1A 4K8OA 1E9BA 1T1SA 2ZIFA 5T41A 3GA0A 3NDJA 5SZJA 2JI8A 3AYZB 4GVLA 5HNKA 4QM7A 1IDOA 2QVBA 5I45A 2MR5A 2WY2D 5I9BA 2QMYA 4HY3A 1JEOA 4LHZA 3DVRX 1AIPA 3OETA 1SUAA 3ZVKA 5FUQA 4R98A 4BB5A 2Z6UA 3AFIA 4FJ2A 5HMMA 3GYBA 1I3MA 1UM9A 4J1NA 3N86A 4JR2A 1RZVA 2HT1A 3D4IA 3OZVA 3PVSA 4XOUA 4CKWA 3VUEA 2J41A 5KQLA 4GMHA 1XEXB 3GV0A 4LRYA 1H9BA 1JLMA 3C3CA 3GH3A 4JK3A 2IL1A 3PDJA 1Y37A 3VV3A 2DX7A 3D2AA 4NCKA 2V4UA 4OIMA 4XKJA 3Q72A 1HH4A 4UAGA 4YUWA 3I2YX 1WXIA 1COWA 3NTVA 4FOLA 1AB6A 3MTBA 4BBZA 4CJXA 4X65B 1K4KA 4C0BA 2YKGA 3C14C 4F38A 1T26A 4IF6A 4JYMA 3T9DA 1AKEA 3MUFA 3Q40A 4I99A 4IJ5A 4DLSA 4DYVA 4K05A 4LOHA 4F4IA 2ODEA 1E59A 1M2KA 3AIMA 3R7BA 3TIGA 2XUGA 3P9CA 1MOQA 5HZKA 1UBMS 3QK7A 4JQSA 2IPLA 1BEEA 3DHNA 3S7TA 1B3RA 2CBXA 2QN7A 3X1DA 1NSYA 3D3WA 2X4DA 3VMFA 1DCMA 3WKCA 1XMOB 2JLWA 2ECKA 3OF5A 3ZQ6A 4PX2A 2NTEA 1RYNA 4PTZA 1N2GA 2F9LA 4RTOA 2H3EA 5AW9A 4D3YA 1EUDB 1RMYA 3H5LA 3L04A 1ZG3A 4TVBA 3DDHA 3Q6MA 4YJGA 3QGMA 3PE6A 1R6XA 3I8XA 1RZRD 5DGHA 2PLRA 3AI2A 2C3UA 1NUTA 4GKAA 2O06A 2PGOA 2Q6VA 3ISTA 4G3XA 4U2DA 3UM9A 3AESA 3LUHA 4OYYA 5FXMA 4D02A 5IEJA 1TC1A 3J80A 2OMEA 1HDRA 5TF0A 5JCOC 4OXYA 1IE3A 2PT9A 1DRUA 2JBHA 4KLCA 1O4VA 4GX2A 5A3VA 1E60A 2YBDA 3EPRA 1LLFA 5AO9A 4ER5A 5BMVA 2BKXA 1T5IA 3AI1A 3FZGA 1J8MF 2NPIA 3CZAA 1F48A 3R4VA 4BB6A 1RAAA 2R68A 2BEUA 1TZ2A 2B25A 3Q4GA 5LIRA 4GYJA 1OD6A 5FKJA 1GG5A 2E37A 4HB0A 4QXRA 3Q1KA 4IV5A 1X80B 5C8YA 2JI6A 4QVGA 2V7WA 4YAGA 4FOSA 4WMLA 3VNAA 3VR0A 1NZDA 4XTCS 4BU1A 1AQNA 4S04A 2XTZA 1KSGA 2J9GA 1LBIA 4YJ3A 2VHTA 5HQJA 3DHVA 3FPAA 1P9OA 4OU4A 5JC1A 2AQIA 3ESDA 4OYRA 5IARA 3V7UA 2WUEA 2IPAB 1EK1A 2HHCA 3G89A 3PQ3A 4M1ZA 4PLHA 4Q34A 4CF3A 1JG7A 3CV3A 4L8YA 5JIBA 3RLFA 1BMDA 4UD6A 1F5SA 5ELMA 5FBLB 3W8FA 1FOEB 1YFZA 2IZ5A 3GLHE 4MQFB 4V0SA 3SQMA 3DQQA 2BDEA 2WWRA 4DDKA 1NNI1 4NZPA 3GLVA 5HVNA 4D6YA 5EIEA 5KVAA 1IQUA 2Y8EA 3AUFA 2PTHA 3BFKA 1X1TA 3OQPA 4I9HA 3IOBA 2YJGA 1KFCB 2V65A 2AZTA 2P2DA 3VDNB 1DCFA 1Y6FA 2YV2A 3H65A 4XWOA 2ZPUA 1RXVA 4JQCA 1GGMA 4YCDA 5JO9A 5ILQA 2AW3A 3S2YA 2QNBA 3MJVA 1JSRA 2O20A 2EFJA 4KBYA 1AGRA 1ZCFA 4LOAA 5GV7A 4MCHA 1W96A 4V0MA 1Q7EA 3MBKA 3UQYS 5KWVA 2BI4A 4ZEOA 4OXNA 3GCDA 3NNDA 2FF7A 2FE4A 2XWJI 5T4HA 3ZGYA 4JJIA 2XB2A 1QQ5A 3UUWA 4Q48A 3IHTA 5C1PA 2EKPA 4EGSA 3NIDB 3OIGA 2R11A 1M7BA 3UMCA 2HHHB 3RH0A 2C9YA 1C7IA 1KI9A 4WKNA 3TMAA 4BIMA 4D3DA 2ATXA 5BSRA 4BIIA 3CVWA 2VDRB 2NUTA 1GTVA 3EIUA 2O7VA 3MTGA 4OGWA 4WLUA 4EYQA 3E3MA 2R6CA 4JJZA 4KTVE 3C6YA 1MVNA 2PR2A 3BPSA 1GQQA 1DC6A 2VAWA 3RC1A 5ICEA 3DE7X 4HAIA 3OJ0A 3AZOA 3GLGE 1KP3A 4X1IB 4HAWA 1GY8A 3IEKA 2V6BA 3KKOA 1HX7A 4RA9A 2CLKB 5E7MA 4O5AA 4JLUA 2BMFA 1U0JA 4G9EA 1JN0A 1SVIA 2JARA 1SBIA 3BCUA 1CTQA 3DDSA 4GAEA 1JLHA 1LSUA 2R97A 1Z6TA 3TD9A 2HW8A 1H8HD 4ZAGA 1CRQA 2WTBA 3K72B 4CM6A 3SHFA 4LMPA 1QG6A 5AHWA 4X92A 1ZEMA 5K51A 1NY5A 4O2AB 4WDRA 1XMXA 2AE1A 4PX9A 3QLUC 4ID9A 3DXXA 1KE2A 1E1DA 2PM8A 1CJUC 3F6EX 3MWEA 5KTPA 4CV1A 1FQKA 3BUSA 2XB4A 1T5SA 1E7MA 1M2VB 1NASA 2I6GA 3GUUA 4P53A 2E3JA 1M8KA 2AXPA 2PG3A 3I2GA 1COWD 3BMOA 4FB4A 2PLWA 1ACMA 3AFMA 2DR2A 2VR1A 1ZR2A 2J85A 3KKKA 1SCUB 2CLFB 4YJ3B 3HY6A 1C0PA 3KU4A 2JAXA 3OT1B 3UYKA 3EDQA 3B78A 1DO8A 2A84A 2WD7A 1QO0D 1UJNA 3BULA 4JYAB 2UYYA 1LDMA 1QIMA 1UMCA 2JKYA 3JQAA 4QUDA 2O8BB 4RKEA 1C80A 1QFSA 1KU6A 2HF2A 5JG7A 3DPIA 3EHEA 5CITA 1GYQA 5CDTA 2BHNA 1BXGA 1EFLA 1HQKA 1D0IA 4O3FA 2IYWA 3WRWA 4GZLA 1KXZA 1KJJA 2EGHA 2PRIA 4IS3A 3T15A 2C31A 3BORA 1Q11A 3U7EB 3ICOA 2P30A 4GC9A 4LI0A 1X7YA 3ROQA 2ZK7A 3RFCA 4PZYA 1Z5UA 4QBTA 3EBOA 3NUQA 4IOMA 3B3JA 4A0RA 4HQKA 4Q7JB 3AB7A 1F5NA 1UK8A 1Z0ZA 3VISA 3CZPA 4OTZA 4BBPA 5DHRA 2FEMA 1KJNA 1UBRS 4OXKA 1VG9B 2QLBA 3OLQA 4BJ3A 2R1TB 2Y05A 3FWKA 1L1EA 3NAGA 5AQ1A 5CG1A 2B35A 2OBFA 3TOXA 1PVDA 2GGSA 1E94E 2FVYA 3IBFA 1CNEA 3L0CA 2GK3A 5CFLA 1DRVA 3H42B 4TX1A 2WIGA 1ISMA 2PMDA 1XQ1A 1NDHA 2ZRHA 1OIWA 4HXEB 4NQRA 2UVPA 4ZAWA 1KY5A 3TZBA 3FDXA 2R5WA 4LHEA 3O03A 3KWFA 2CMDA 3W3ZB 1NQ5A 2P0YA 4MUKA 1YZHA 2WSIA 1D2EA 1ECGA 1HORA 4DARA 4GE0A 4F3YA 4ZCLA 2IHNA 3R1IA 4KAXA 2OQVA 1TK2A 2YNMC 2HWUA 3OTHA 4U8HA 5F7JA 1CY6A 5KEIA 2VZEA 2PX3A 1GN8A 4AIRA 1B0AA 4YJDA 3HZOA 3SIPA 1CD5A 4AN1A 2GLXA 3Q5GA 2LPMA 3DT9A 3LX4A 1PGQA 1W59A 1UP4A 4ZJZA 1TYAE 4KYUA 3G68A 3OQ1A 3TQTA 4IMIB 4C04A 2YUIA 2CWWA 1JEQB 4XB1A 3LBIA 1X7ZA 3BBLA 2Y0PA 1LBSA 2A0KA 1DMRA 1NJSA 1TC2A 2I7CA 5MFZA 3F3MA 5JCOA 4YPVA 1Y7HA 2PXAA 4N03A 3ORFA 4NYIR 4BX2A 2NNLD 2HB6A 2QBYB 1S2NA 2D1YA 4K1XA 4EENA 2ZUUA 4M88A 3WWYA 3ZWCA 4QA9A 2HM7A 5G4LA 1G8PA 2ZRAA 1A4IA 2YRFA 4Y2JA 3BL5A 3DE5X 2DHCA 1WW8A 3HGQA 4MRPA 3IPYA 3JAKA 1QVWA 4N8DA 1ZOLA 1K27A 1SU4A 4PAMA 3TB4A 3GFVA 2CHQA 1JYSA 1EE1A 4QICA 1F0PA 2H54A 2PMBA 2IRWA 1USUA 3BQNB 3MRXA 4GM0A 4CL2A 5G3ZA 1EX6A 4TT3D 4OHMA 2K6GA 4TLEA 1LRJA 1F0KA 4K86A 4LA4A 4F5DA 4M7OA 3BL8A 4PBTA 4AK9A 1D2RA 2AC2A 2BKAA 4D8VA 2KYRA 4RIEA 3UMGA 3KALA 2IYFA 2OM2A 4LXQA 3GXBA 1P4SA 2PZBA 2R3SA 3OZXA 4HRAA 3K8YA 4O1IA 3HL0A 4UEJA 5FO0A 3ZDRA 4A16A 5FUMA 2XWSA 4GKJB 3FKJA 4YV0A 3ZIAA 1M1ZA 4JR1A 5EESA 3THYA 1GYPA 4EHIA 3SR3A 4KPEC 1H0RA 4HSGA 2ZOSA 4C3UA 3K5HA 2XVXA 2DOKA 2EZ8A 1Z29A 2YZMA 3K8OE 1ZJ4A 4NWIA 5EWLA 1ZL2A 4X7RA 1ZGJA 2DULA 3E53A 3HSSA 2ZJFA 1T2VA 2I62A 4MI9A 3BM5A 4V02A 4DIOA 2QJTA 4PPQA 1UOQA 1GFWA 3H1AA 2AXEA 2D3TA 4DW8A 5BN3B 2IUSA 5AFSA 4IIJB 4H7FA 5FNVB 2W11A 4DCGA 4NOKA 4O02B 2J7PA 4TRJA 5HGJA 1ZISA 3GUCA 4R8RA 1U6KA 1ZN7A 4OGKA 4FX2A 4UXIA 4Z49A 3FZEA 4YRSA 3CPEA 3IIKA 4D8TA 2WINI 3G5AA 3NJ4A 4OMUA 4TM8A 4HWTA 2WFLA 3ZHVA 2X5XA 1KOJA 2IIQA 3KLNA 3CFYA 5LR6A 1PQ4A 4AWAA 3HM9A 3A0UA 3KQMA 3S1SA 2ZB8A 4L85A 4DL9A 2Q50A 5ALTA 3W6UA 4TGLA 3EGCA 3MCTA 4QTTB 5KJFA 1N7JA 1W2WB 2J0EA 2C2HA 4OQQA 4HDKB 2JK0A 3DZBA 4X93A 1U6IA 3OP4A 3QLVA 4HFMA 4XAQA 2OB1A 2CNDA 2C7RA 3K9NA 2RGDA 2J6CA 3L8HA 4O2BA 2RKWA 3RB8A 4DLBA 3IEUA 4WKBA 5CYOA 1QYRA 4X62B 4ITRC 4R1LA 3EEOA 3KOYA 2JANA 4IQ0A 3QVKA 5TIIA 4B85A 1R0SA 4CPDA 1Z0AA 5AP9A 2NO0A 5K0LA 3ZDXB 1GEEA 5J5VA 1YQ9A 4M7PA 4GPZA 2RCYA 1I4OA 1NW8A 4H4DA 4GGOA 1OB5A 3DBRB 4IEFB 5SICE 4RPHA 5JO0A 1JXMA 1YZKA 1MRNA 4D4KA 4G1VA 2I6QA 4ZIRA 3KSMA 2JFQA 1P2GA 5CLIA 1YVRA 3C3WA 3CISA 3EW7A 4GPD1 3UKDA 3H8JA 2JIQA 3EVGA 3N07A 2NVWA 3KM0A 2WSLA 2R84A 3PDCA 2G9UA 3T61A 1MH9A 1LSJA 1N2HA 3QMWA 1QB8A 3CURA 3ECSA 5CVVA 4NCNA 4YS6A 4HK4A 2QT1A 2R7LA 4HAXA 1U3UA 4I50A 1XZJA 3ETJA 1EHIA 2YWGA 2CUKA 1T36B 3UBTA 2QE6A 1DV1A 5INTA 4TQGA 1R0XA 2P2CA 2VZLA 2OLKA 3URKA 1JWLA 2MSDB 1IOWA 3RUAA 3TDNA 2COEA 5GOZA 2CSXA 5CX1B 4PC3A 3M4XA 4KXUA 3LZCA 2P11A 4I3HA 4FIDA 5J43A 2GZDA 5D51S 2HO4A 4GGMX 1OVGA 1WKVA 4YK7A 4EJMA 3SFVA 5JAHA 4AQDA 4AS2A 3T5PA 1DFIA 2XUKA 3W5VA 1Z6AA 4AN0A 4AKHA 4U1RA 3CNQS 4INAA 4JBHA 4OQDA 3EXG2 1TAUA 3B36A 3HTXA 1UKEA 4UUPA 3RSHA 4N7MA 4RTMA 3WMEA 1TLFA 1E3SA 1NDUA 1XL0A 2H9AA 1VKHA 1WBJB 2W2TA 4MI3A 5D7NA 2X0DA 4D5GA 5IAOA 2C5SA 3D5TA 1OZAA 2EZUA 2YJNA 3ZK7A 1Y1RA 2O7QA 3FCUB 4IBOA 3BK2A 1OY1A 2WYIA 3FPSA 1T9AA 3IKVA 2XMBA 3JQFA 1PNOA 4GRIA 4YXWA 2Z8YM 3IUNA 4GBJA 1PJBA 2XMPA 4HPJB 5D86A 1VSTA 3O82A 4OFZA 1G20B 1RWKA 3JQ9A 3UOAB 4FT4A 3G0IA 5GIOE 1XA3A 3TLGA 2YDXA 4UDNA 2QE7A 5FR2A 2EQBA 4RAQA 2BFDA 2F59A 3HBAA 4LJ5A 3HUTA 3M2TA 1XU9A 3GDWA 4RADA 4WZBA 5E95A 5CBKA 4V0ME 1UT5A 2RJ3A 2XPCA 3GROA 1CQIB 1RI1A 1EI9A 1W5TA 3QOYA 4NPAA 3T3IA 5JATA 4P0QB 2UDPA 5BW6B 5F73A 1NVXQ 2DP4E 2ZWOA 2AKAB 2XUJA 3AHJA 4A0FA 1VPWA 3A1VA 3TIIA 1V8BA 3P7MA 3TGWA 4DSAA 3FN4A 5KTRA 3IDAA 3QI7A 2VRCD 4R2LA 4LQCA 2W2VA 4YASA 5DGXA 4UQPA 1T29A 3KJHA 4MA5A 1S7CA 4P2GA 4PLPA 1ORDA 2OHVA 3V32A 1X80A 4LSMA 4YCCA 2C2KA 3IOCA 4C43A 3JZMA 3FOCA 1P2DA 5AVKA 1J06A 3RR2A 1CUXA 1BE8A 3QKIA 3ZDFA 4BBAA 5JQGA 3FYUC 2AA3A 3SM3A 4ERXA 1MJ5A 4I1RA 4QUAA 3GMTA 4RPKA 1UXOA 2VDQB 4P22A 4AKSA 5I4IA 3QQ5A 4HAZA 1ZR4A 2NWQA 2CT8A 1BMFD 4IDGA 3CHYA 3TKLA 1WSAA 2W2QA 2XTMA 2H1OA 1YL5A 3CGWA 4NXMB 2YNMD 3ZIAD 3H11B 1Q7GA 5JNUA 1D07A 2E4ZA 3U4IA 5HF5A 2XXAA 5AJWA 3UB3A 2WTNA 1ILWA 2WPDD 3E9YA 5AI9A 4AJ4A 5EVCA 1C7ZA 2ADMA 3VZRA 3VU1A 1JHOA 2KHZA 1DJMA 3NCHA 3JQGB 2I4NA 1VE7A 1OROA 1WXFA 4JP8A 1FNCA 3HJUA 4CLRB 3L1IA 3S55A 1A5BB 3QWHA 4F2GA 3WLEA 3QPBA 5K8TA 3BEDA 2EARA 1HV8A 1EM6A 2OAP1 2QD5A 4AN4A 1K63A 1KRXA 1FX0B 4BMOB 1AHHA 1K86A 4RZ3A 4O8CA 2TMGA 4TLDA 3UTDA 1Z88A 1Z39A 3SNHA 5A0TA 1O5IA 3HP7A 3LKBA 4XYMA 4HQ0A 1T2AA 1SC9A 1CDZA 1XAJA 3IERA 1ZGAA 2BW0A 3NBFA 4FGJA 2TMYA 4X41A 1N0VC 3WNDA 3T3EA 1BWPA 4OEHA 3NTXA 4Y6QA 1K0FA 1I1OA 3D59A 3DCNA 3E22B 5FP0A 5J4LA 3R6LA 5AUQA 2QG9A 3TMKA 1YZFA 3UV3A 1VP3A 1X19A 1DKMA 1Z0JA 1SXGA 2BFFA 4OVKA 3FTNA 4U2BA 1DIAA 3RVDA 1GLGA 4CV3A 3M6IA 4F9GA 1UEIA 2H1IA 3OZSA 4N3BA 1JR4A 2R6AA 1ZBQA 3KT8A 4IZHA 4ZVRA 5B6PA 1KXJA 1ZLXA 1XTQA 2C4KA 6CHYA 1ONPA 5M3BA 5JXJA 3WAKA 3I28A 4P0PB 2VRBA 3AW8A 1V96A 4K6FA 3AHCA 3R7WB 3UC5A 3D8BA 2V4MA 3HG7A 1BVYF 3QPDA 1KERA 4Y0VA 3W7VA 3WL7A 2G9NA 1G38A 1UXKA 4Z4FA 3KKNA 1GPLA 2F3TA 1OYWA 3O2NA 5CPBA 3NOXA 5TJHA 3VJKA 4RSGA 5CCDA 4E7OA 4KXNA 4B76A 3TYXA 2WWTA 2YVQA 2ZS8A 3QPCA 4BP9A 2Q5QA 2F8TA 4ARIA 3FGPA 1A9SA 3DCYA 1KHHA 1W93A 1BIFA 4N6OA 3G2NA 1GZVA 1U7HA 3AIOA 4FT2A 1KMQA 4PSKA 3BMOB 4B33A 5K3EA 2YMLA 1XC7A 2JVKA 2SCUA 4GMGA 1L4UA 3BGVA 5JHGB 4S12A 4LGMA 2BGRA 2WKQA 2ZYVX 1CPYA 4MPRA 3DBIA 1U2TA 1JNXX 1U94A 4YYEA 2ZEJA 2G77B 1H4SA 5TNXA 4FE7A 1XLWA 2YRXA 5BN1A 2ZI9A 1U2DC 4Y2HA 3SSMA 1M1NB 2R6ZA 4GL4A 4W7HA 1HNZB 3OPMA 4ZCTA 3FTFA 3DFZA 1A27A 3D6UA 1FNDA 1T3SA 1Y5NA 1VGVA 5EP2A 2I6SA 1Z83A 1TAHA 4YUXA 3R3ZA 1U28C 2P6UA 2WA1A 3PUJA 4E07A 4R01A 1ZOOA 3L6OO 2PLFA 2WSSA 2X1VA 3I0MA 5ALVA 3V8MA 1ZONA 3H5IA 4CDNA 4KGVA 4NH0A 3MCWA 4X3CA 4J75A 5LQSA 3WADA 1TEZA 1YB6A 1W2HA 1A0OA 5CURA 2C77A 2R66A 3RCBA 4DLNA 3OKFA 1BDMA 3P2YA 4X1KA 3HACA 5EEHA 4KITB 3R09A 1UPAA 2VF5X 2WUVA 3JQ9C 3NTLA 3HFJA 4JU8A 2ALJA 5EYPB 4HNUA 1ZSNA 1Q16A 2DHRA 2V7UA 4WNYA 5DULA 1JDVA 4OB8A 4UHCA 4F71A 3FE2A 5DXJA 4E30A 4HFRA 4REMA 3BGWA 1JUDA 2HMYB 1EK6A 2DFDA 2E55A 1LU9A 3AB8A 1HLPA 1H6CA 2R8RA 3VR1A 1I2MA 1QK4A 1Z7YA 3ZIUA 2CB0A 1MB2A 5KQSA 2Y9PB 4ZDIA 2P8JA 3S8EA 4BB0A 3F6CA 1UK6A 3LUKA 4RDCA 1PUIA 3VHRA 4RK7A 1E3IA 1J7JA 4OKNA 3WP0A 4Q9IA 4TZTA 4PYOA 5TS3A 1U2GA 4WA7A 4QGSA 2HL6A 4LDRA 1TMOA 3WGZA 4C0QC 4JNCA 3STTA 3EZXA 4O6VA 5E2BA 5BURA 1SHKA 4L5CA 4IVQA 3T3DA 4KNVA 3ZU4A 3SQWA 3T3GA 2ZSJA 4BL5A 1V35A 3UTCA 5DEOA 2B8JA 4QBKA 1ADFA 2W6ID 8OHMA 1I9CA 1LC0A 4D1YA 1JRLA 1PJSA 5AKIA 4D9MA 1LTHR 3HKBA 4P4GA 4DNFA 5B7QA 1OYOA 2ZIWB 1KYWA 3H75A 4OQYA 1M2EA 5KJEA 3QOXA 1KYQA 1NONA 5JCXA 2QBYA 1DRWA 1V7PC 3LPAA 4B6RA 1KY3A 4YUYA 1VMEA 2NOAA 4HN2A 2WABA 3MTQA 2OUKA 1R9MA 2G5PA 4LMBA 3T06B 3WV4A 3ZNOA 3PRJA 1A9PA 4CG0A 7ABPA 1SBYA 2V58A 3KWJA 4LJ6A 1E2QA 1WDMA 3GVPA 3C6MA 1QCCA 3TL3A 3SZ3A 3P2KA 2W2MA 5DIZA 3A6DA 1L5LA 1UT6A 1JFVA 1YMVA 3FMVA 3T1OA 3IL2A 4R7ZA 4XVRA 4ZT3A 2D2IA 2I65A 2QMQA 3DLBA 3I64A 4B6GA 4KXQA 2GAIA 1US8A 1VCNA 5HP4A 1J1ZA 2B98A 4PIVA 4KDCA 1B7GO 2JLAA 2BGUA 3AUXA 3V3KA 2RGXA 3OQVA 3CTPA 1YJAA 2ID8A 3HCDA 5D85A 2IHJA 4JLJA 1P7CA 4KW7A 4JHLA 4RXUA 3QPWA 4C4RA 2WAXA 2YWJA 3QYFA 3VXKA 1TLLA 4IAOA 4Y9TA 1GAWA 1JYEA 5D1HA 2I66A 5KKCA 3BWYA 3GB9A 1E3TA 2P9GA 3HVJA 3L2OB 3LIPA 3UUEA 1S2LA 4RHFA 1ZNWA 1H4QA 2JHFA 3ADDA 5JFTA 3D8SA 2WU4A 3PXEA 4FYWA 2FWPA 3S4YA 4M1KA 4CGZA 3CJTA 2O4UX 3LOUA 4P86A 4WRRA 1XWIA 3DYBA 3LXUX 3COZA 1G1MA 1LDBA 1M6VA 3W2IA 4BKPA 1U81A 1V25A 3RYHB 1X8KA 3UV6A 5LDHA 3C15C 4WJKB 3RHZA 1ZBDA 1GCUA 3P1JA 3AEQA 1OREA 2IVZA 1GZHB 1H6AA 4G25A 4TM7A 4ZU3A 5TR9A 1JG1A 4JVLA 4MRVA 1A8QA 5A62A 1KEVA 5HCUA 3G1WA 4KQWA 4XWYA 3AL3A 4UMEA 4E1AA 1SRQA 1LF5A 1G64A 3JQEA 4M38A 8ABPA 1PSZA 3C0KA 3BBPA 4B7XA 3SSAA 3I4LA 2X2FA 2IYYA 1KEUA 1N7GA 1HZZC 2Q2QA 4CQMD 1YJBA 4YV2A 3U44A 1DQYA 2DQKA 3R9XB 3T38A 3EXIB 3TNDA 1BZYA 5JAPA 1NF8A 1JT2A 2HQ1A 1XPUA 1E9DA 1W19A 5A7GA 5A4AA 3GLGB 5K8LA 3K0HA 5C4MA 1EVZA 2FSPA 2P2ZA 1J8QA 3QU4A 5IBPA 4XVCA 1T5TA 2ZI6A 1RI4A 1YJCA 2EZ9A 4M1SA 3B8HA 3SSNA 4J1TC 3KP1A 3ZS8A 5LA6A 3EXFB 7YASA 1FSPA 5H4HA 3ZWQA 1GGFA 5ICGA 1OFGA 1H5QA 1M1XB 1YZUA 1F60A 1QAQA 1QHGA 2IY7A 3PL1A 2H7XA 2PRSA 1BHQ1 4QE3A 3DMHA 1NVUQ 1MIOB 3TNFA 1XALA 3L93A 4R7TA 4TV9B 1MXHA 4Q15A 1WTCA 4E88A 1PS9A 3TGPA 4RNDB 1SUCA 1NVVR 1UZNA 1YS7A 1VQ1A 3TI9A 1I4EB 1P2TA 3QBDA 4OX9B 3BB3A 3MWYW 3OLYA 2AHOA 4J6EA 4ZT4A 2VP6A 4KO8A 4W1QA 2ICAA 1TF5A 1JHZA 2XOKD 4M76B 2WUWE 4P35A 5DIFA 4R2MA 1ZP6A 4FE3A 2EHJA 2NADA 3KUDA 4D4GA 1L3IA 3NLLA 3O6VA 4I50B 2H1WA 4RZSA 4V0KA 4FZ5A 1Q12A 2QQFA 3FZYA 3SOZA 2E4VA 3EJWA 2FK8A 1GFSA 1ZI8A 1CCWA 2LDBA 3QY9A 1PFKA 1OZHA 4GS5A 3RK1A 1RFLA 3NHRA 4WGGA 5BWBA 4KX3A 3UIEA 3MRVA 3NM4A 1SOUA 1JS1X 5E3IA 2EC5A 2GBGA 1U7WA 2SBTA 1U0RA 5CX1A 1TQDA 1WA5A 4XIIA 1VI5A 3HEAA 4X91A 4B7UA 1FFCA 3KS9A 2WKSA 1F8GA 5CIWA 1WUYA 2X58A 4KLNA 3I9V6 4C7BA 1PX2A 4IXWA 4AZSA 1KAMA 2VOJA 3LRPA 4KN6A 2WG1A 1YGPA 1KI6B 2PS1A 5CT5A 2VYCA 3K0CA 3Q7EA 1YDEA 2FSVC 5EIXA 2LIVA 3E23A 1QH1B 1Y9AA 3EEBA 1ZITA 4RPLA 3NOVA 2GEDA 5JS7A 2ZSEA 1YIAA 1LXCA 2KS6A 1E9AA 4L57A 1G9XA 1J42A 1QTIA 2PA3A 3MMPA 1PEDA 1EDBA 2W90A 2DLDA 2HC9A 2VJMA 2MYUA 2UZIR 4S24A 2OBXA 1E2FA 4YJ2B 1C9EA 3BH7A 3EZLA 4KN5A 1K7EB 1EZZA 4BYGA 3A37A 2HRRA 3LW7A 4N5MA 4QXOA 4YQEA 3LYAA 2PRJA 5JRZA 2BFEB 3JPWA 1PP4A 2FJPA 5KYVA 3TF5A 3HA7A 1H23A 4EZEA 4MJLA 4RU1A 4HXYA 3OQMA 4Q1DA 3ZZ1A 2R6R1 4F9TA 3ZBQA 1U2PA 3DKRA 4X90A 1VYUA 3AXSA 5EXSA 1CBUA 5KWSA 2Q4TA 5LOVA 2G88A 2RGNC 4I9FA 2BUCA 2OKCA 2PKQO 2NZ8A 3FRJA 4FDAA 4B6EA 3S1AB 4WK6A 2MYNA 3ZD6A 4B45A 4DNPA 2C2YA 1QRUA 2IXAA 3RU2A 4UTVA 4P0TA 2H4WA 3R3UA 3OPYI 3UN1A 1QYXA 2JK1A 2Q4RA 2Q27A 1FLDA 2VUSA 4LKRA 2FMTA 4YXWD 1FFWA 3L4BA 3CF0A 4GEKA 3UUGA 2W4IA 2OBYA 5KNLA 1L4GA 2V0GA 3ZE9A 3GJ8A 4CKBB 4CW7A 3PC2A 5I9SA 1E9CA 3PR3A 2P2GA 3VKHA 3PUXA 4AZVA 2B6NA 4DR2B 4CCWA 4EY7A 2DQYA 1N5DA 2AV6A 3SGLA 4CMAA 3UK0A 1THTA 1ZK3A 3HB0A 1GNTA 1N7HA 1OIXA 1V39A 2OP0A 3H1EA 5L51A 1NQAO 1Q3KA 2WF8A 2YVUA 4U7FA 3TB6A 4LF8B 2X0EA 4DGQA 1GPYA 1YMUA 2WUDA 3BWDD 4EIWA 2XXAB 4Q16A 3ML1A 3DLAA 5M34A 3NGXA 4U7HA 1CIPA 4C6TB 3SZLA 4LF7B 4FXPA 5ENVA 1HE3A 1M34E 1QHHB 1OKKA 3H1TA 3PEWA 3VR4H 3ER6A 2GLTA 2C00A 3RO7A 2BR3A 3JVDA 1U7DA 3UCXA 5JI3E 4B7AA 5E1BA 3V9PA 5IG2A 2XITA 3HK2A 4GR9A 1DWUA 1RPNA 1KJWA 1E1YA 2GVNA 4WOKA 2ZWPA 1ZH6A 3LJKA 8GPBA 1XAIA 3BREA 1GO2A 1RLMA 4PHCA 4RORA 1AV6A 3PWZA 2YCLA 1GQ2A 1BQ3A 5FL7D 3WIBA 2Z1NA 4CWAA 4OHPA 3ZC3A 1WU7A 4EHJA 4PVDA 4RFSA 2G36A 5B53A 1FTNA 4DC1A 4IVPA 4UTNA 3DL4A 4JOQA 3FNFA 1QYVA 4UU0A 4BFVA 3H4VA 4BO5A 5C5CA 4NBTA 1PT8A 3AJAA 1ZK2A 3RHFA 3GEGA 4GP6A 2QR5A 3N2EA 3VU9A 1NF3A 2ISQA 1S96A 3B51X 2H4YA 4IDFA 4NHOA 4DLKA 1DVRA 3FWYA 2BM9A 5KYKA 2R1TA 4BNWA 3A4NA 5IC5A 1CUEA 3D0QA 4LE2A 3HJCA 3W7AA 3KJFA 2QJFA 3V8BA 1ZM7A 2VJYA 2JA1A 3HKDB 3THXA 3KLMX 1Y63A 2CEKA 2IW3A 2P5SA 4EI2A 5LMUB 4F72A 2PWPA 3LO5A 1LPOA 2CVFA 4LCBA 5I7SA 4RZ2A 5AVVA 3E9RA 2D59A 4H1VA 4QUJA 5A6SB 9ATCA 4PZZA 3DONA 4JVNA 1H6DA 3EXHA 3LBAA 4FSXA 4CLDA 1RYZA 2DFKB 2ZE8A 1N6NA 4WNIA 4H0CA 1REQA 2Q21A 3B3AA 3MF4A 4ZVQA 4G8DA 1AX9A 3UCFA 1Z4KA 2IYPA 5BRJA 4PZEA 2AMJA 4Z7QB 1E4YA 3I45A 4X45A 4Q7KA 3GAFA 2OLEA 2Z2JA 4FGLA 4ALKA 4DV5B 2AR7A 4FDVA 5TRTA 1Q1ZA 4M1TA 4YMLA 1GL6A 3LI2A 4OA5A 5JPDA 1FP1D 4Y2VA 1P2SA 3UFXA 3AWIA 3QV1A 1J97A 4FK8A 2HRQA 5IJXA 1SCKA 2RK4A 1RM4A 4U9IS 1JFFB 1DC7A 3KZMA 4NY1A 3THXB 5H16A 4CN8A 4M9RA 4C87A 4NBNA 4UBOA 1KBQA 4JLSA 4MPJA 2NTYC 2B8TA 1GPH1 2ECFA 5E7QA 3IR6A 3R0XA 4PLFA 4E15A 1JJ7A 2JIMA 5DNDA 5CB0A 4QXQA 3ND7A 2I2AA 5EP1A 4D9NA 4MO9A 5A6SA 1Y8AA 3HB5X 4TMTA 3V5NA 4ARSA 3CUUA 3O0TA 3OZEA 4URWR 2VP3A 3I6MA 2Y99A 3A0RB 4TLAA 1CX9B 2D13A 2DERA 4ZA2A 5CNMA 4JBWA 3OEHA 3AUKA 1RE1A 1CY7A 1HDCA 2QZSA 4ESEA 1V6SA 1WHTA 4ZCPA 4REOA 1Z4LA 2VDOB 3JXEA 3QE2A 4FGWA 5B1YA 4NENA 4LSWA 4BQNA 2VH1A 3TXXA 1YS9A 5BXQC 4RFLA 5EZ6B 4E6EA 1X7WA 1R10A 3JQBA 2CHGA 4J94A 5HJ2A 1T6BY 4V3BA 5EP3A 4KR0A 3VH3A 2R62A 4IZ6A 4KQFA 5FUYA 1TD9A 5DXFA 1TFRA 4C3OB 2VZ8A 1G3UA 1P9WA 2EW2A 1EFRD 1UXJA 4FOPA 1X1QA 2V6GA 3JAWB 2UAGA 1GRNA 2RJOA 4N6NA 1KP2A 2B2NA 3K0FB 4JLOA 4QXPA 2DXIA 4B4OA 2XZDA 1NT4A 3VKUA 4YRKA 3I34X 4KQJA 5KPJA 3L0DA 1LBQA 1BDJA 2E4XA 2H9YA 1U3VA 5B12A 5KVCA 1ZJZA 1Z6YA 5KWJA 1KWGA 4MGYR 2YC2C 3BQ9A 3OURA 3I8OA 1YS6A 4OH7A 5H7XA 3WQRA 3S44A 3EARA 1PK7A 1J2UA 3QNMA 3EZ7A 2PPVA 7REQB 2B2XA 3K1AA 5E0OA 5K5EA 2VNSA 4F7DA 2FOLA 1T24A 5HBRA 4QU8A 3RS9A 5A3JA 1DBPA 4F1WA 3HPRA 4EL0A 4AU1A 3EXHB 1NXVA 5J2UF 2IYRA 4JLDA 3WHPA 4K87A 1QGYA 3KZVA 3KR1A 1A2OA 2GERA 4Q00A 4UHEA 5ALJA 5DNEA 3O1HB 2Q5FA 1ZRSA 1EGAA 1U1CA 3JYOA 2VHCA 4BZWA 3O4GA 4DR7B 3LLMA 1FDVA 2ENUA 4LOJA 4UBNA 1YR8A 1P8AA 5HJEA 5KHLB 2I3GA 3UT0A 5KTTA 3DGEC 2QAJA 4FZ3A 4XRGA 1N5IA 2FB9A 3W3AA 1PYGA 4D99A 1J24A 1U5BA 4JA2A 3K0FA 1OZGA 1WSDA 4R0VA 2A0UA 2J1LA 4DLUA 5BSHA 1ZHHA 4YO8A 5G2OA 1DL5A 4NMHA 1WAMA 4D9FA 4ENSA 2D1FA 3ESCA 1LQUA 2FA9A 1OXVA 3B8EA 3M8KA 1D03A 1FS6A 2POCA 5C46F 9LDTA 4M53A 5EJMA 1M5TA 2YTZA 2FW7A 2VATA 1IZ0A 2FSIA 3V1TC 2C0QA 2HPHA 2OB2A 1GJRA 4EPXA 5AW6A 4TYNA 1OH7A 5FWYA 3HUDA 5A5GA 4D56A 4GR4A 4B3IA 5ALKA 1W6UA 4DCVA 2M6RA 1SG0A 1KSJA 3VR4D 1M8JA 1CDOA 4XFKA 1ZOIA 3GVHA 2B0CA 4KYTA 2H4HA 3NWJA 4Q47A 4M8LA 4WUVA 3VKVA 4B47A 2JDIA 3M6MD 2WRZA 4IXTA 2GT1A 3BE5A 2P4QA 3FCOA 4C6SA 4F84A 4H15A 5EZSA 1DKOA 2NUBA 1UAAA 4NZOA 1T36A 1FUIA 3AUJB 4JQZA 4BVKA 2PQMA 4K7JA 2FHSA 3O3OB 2POQX 1FL9A 4RL6A 1HOXA 3R7FA 4UPEA 1CR6A 3C7CB 1GPAA 3KX2A 3R3VA 4FGSA 3FF1A 3H9BA 4ZRMA 3BHMA 5HGXA 1IM8A 1SD2A 1KY2A 5CNKA 4UUOA 1O94A 3N7UA 2Z4RA 1TVCA 4X60A 3VX3A 2QTMA 1NGSA 2ZT5A 3AM4A 4R3UC 5B57C 5BSKA 2PS9A 1JE0A 4HN4B 1EJBA 2A86A 2F8SA 2EFDB 1FEZA 1FSSA 4BNDA 1XSEA 2ODWA 1Z7GA 1IBKB 3AI7A 1JL3A 2NGRA 2WHYA 2PEZA 1ML3A 4N12A 5CH3A 4G5XA 1ABFA 1DBWA 3DR3A 1C1DA 2G5CA 3O3NB 2I29A 3HV2A 4FS8A 4N6GA 3H5AA 1M33A 1IL0A 2PKXA 4MQ4A 3RYCA 1UM9B 1Z07A 4AJHA 1CZNA 3OPQA 4F93B 2HBZA 1SNYA 4G1UC 1OT3A 1G55A 1JLKA 1SB8A 3KSDO 4PZPA 4CR8A 2QMZA 4F2PA 5CA0B 1AKMA 4LYDA 1CUZA 3GNLA 2XBUA 2D8AA 3LBHA 5FQNA 3S7ZA 3TD6A 3AG6A 3TZEA 1KVTA 1IDN1 2H1CA 3R0ZA 5G0TA 3N0RA 3GGCA 4LG1A 5IBRA 1PUJA 1CS4C 2GKOA 3BCSA 1A7JA 3AT1A 4FMDF 5D8DA 1YVPA 2Y1LA 3QF7A 1KI8A 1NPDA 3DZIA 4MVJA 2DKNA 1JPNA 2G9RA 4YI5A 2AKEA 3KD2A 4Q93A 3LW8A 3Q9NA 1LUAA 4R3NA 4Y2PA 2B7CA 1R00A 1P7PA 2RKOA 1OMOA 5DCYA 1NKVA 1TYDE 3BFXA 5AK6A 3EUFA 1Q17A 5F23A 1GVHA 1J23A 4BE9A 3RYTC 3ZWKA 2XHZA 1T9DA 1XZFA 2ZYHA 3Q85A 1XTKA 3NUGA 3GGJA 1XXHE 2H6EA 3LDGA 3OOHA 3PQ2A 4WIAA 3RIMA 4H3VA 3WGYA 5FV4A 3UMYA 2AK2A 3TFWA 1I3OA 2V5VA 1JBQA 5E38A 3RWOA 3TLXA 3U6KA 4HUQB 2ZZMA 3OU7A 4QWMA 1V6AA 2EFCB 2G4VA 3TPCA 1TQHA 5ETJA 5F9MA 1CLEA 2I4MA 3V8NA 4CG1A 3T94A 4JSTA 4BJ5A 4TLCA 4HZIA 5HRAA 2CNLA 5LYJA 3BF7A 2AFIB 2OVFA 4MZXA 1TVMA 3AX6A 1E8DA 5DK4A 3TIXB 4CMBA 5KVVA 3FOFC 5G0SA 1Z06A 1TKBA 4EPVA 1J0EA 1YA4A 2WVHA 3LFUA 4ZCSA 1TW2A 4X24A 1NZFA 4RUKA 3QE4A 2WAMA 4FFOA 1CJKC 2P5YA 4HT3B 2FTKE 3QITA 1G66A 1PW5A 1GZ5A 2PX5A 2REXB 1POXA 2PA0A 4UE6A 1Q15A 5CFQA 4FLEA 1QH1A 2VPXA 4XASA 1FTGA 1X7YB 2D1RA 2HQOA 3FDJA 2QMOA 3ZWMA 4DMUB 4E2FA 1ILEA 1O5OA 4C05A 1LJLA 1WBDA 1TF2A 2X23A 4V0NA 2W2PA 1Q77A 2XSZA 3A3KA 1VJTA 2QRVB 2VAMA 3SBEA 2ZRIA 5BV7A 2LW7A 1F0YA 3K2BA 5IJAA 3PGJA 3JD2A 3UZUA 3W2EA 1SQSA 1H1DA 4DV4B 4MW1A 4H1TA 3U3RA 3LQ1A 1LNZA 1RYBA 2CHEA 1L7QA 2Z5LA 3AY7A 3IUQA 1C30B 1U8AA 4MUBA 4NZZA 4FHZA 2Y6VA 5EWJA 3SXJA 1AJEA 4TMWA 2YQZA 5EPEA 2IITA 2WT8A 3VH1A 3PC4A 4BVEA 3SIWA 1Y9ZA 1N57A 2Q3DA 2UUPA 4IGEA 1T3GA 1DS6A 3INGA 5KAPA 3I6IA 1XMIA 2Q62A 1ZK1A 3IA2A 5F1KA 2C5BA 2F62A 3NBKA 4XB6B 2XI4A 3ROKA 2H08A 2Z95A 3CNEA 4DG8A 2D6FA 3GZJA 1ZC4A 3E81A 4ITVA 5LWQA 2O48X 3NEAA 5M04A 4ER3A 1DEHA 5HCIA 4HUJA 3BXPA 2CLDX 3NH6A 2QTVA 5JH7B 2WHRA 3EVNA 3Q3IA 1ORWA 5BQFA 1A95A 2CLHB 3MS2A 1KZHA 3FPGA 1KEZA 1KHTA 3JARA 4EVIA 3JPYA 3HP4A 1CP3A 4F3KA 1YC2A 3NJRA 4OFXA 1VLZA 5DYGA 3RW9A 5LQCA 4DA8A 4DRXA 5EZYA 1QWOA 3JQDA 4EELA 4GC5A 3WI7A 1GQFA 4GOND 2OORA 5CB8A 4LHSA 3WSVA 3AUYA 1I1HA 5DEIA 1E2NA 4KAFA 4MPTA 1C30A 3CN7A 3VOTA 1EXNA 4UTPA 2X13A 3TM5A 1JDJA 5CYGA 3Q9UA 2FSVA 5B1DA 3TSWA 2CDAA 4P98A 3TEJA 4M86A 1PD1A 2UV8A 1E4VA 3RIXA 4LY3A 5JWRA 1EZ1A 3MXOA 5A4DA 1PDVA 3G82C 2BN4A 3F6BX 4CIBA 3FWZA 5FPHA 4O59O 2RHBA 2AX4A 5CXXA 1UPXA 5CM2Z 5GVSA 3IMKA 3DEHA 3L0BA 3P9KA 4JS0A 1PR2A 3EZYA 2FMFA 4KVZA 4Y0AA 5DN9A 4F5EA 1T9CA 1KZYC 4ZXPA 3N8KA 4IX1A 3QBJA 2CJFA 2GTIA 1A5AB 1TECE 2IY8A 5TV2A 4M8NE 3G2QA 2WIKA 5GY7A 3H2BA 4MQEA 2QPTA 1P39A 1U0GA 1LB1B 4M0DA 3HRIA 2BL4A 4POOA 1U04A 3CBGA 3PLRA 4Y2UA 2I9KA 1MJFA 4D0RA 4A6PA 1CQJA 1NIPA 3O3CA 1Z62A 4UU8A 1XZDA 1Z0DA 1OC4A 3UK2A 1YR7A 4D9BA 4E0BA 2ZBFA 3DA8A 3ORQA 4ENVA 4D44A 5ALYA 1LTKA 4G26A 4DJJA 4G5RA 1R7RA 1YQUA 1RDFA 3WV5A 4BLSA 3IUSA 2JRLA 5F3RA 4FFWA 3ZU2A 1ICEA 5DE3A 2Q4EA 2Y1EA 3HXOA 2OCXA 3PC6A 2F9FA 3DFIA 3RIEA 3V4RA 5JSYA 1Y1QA 2FR8A 3F3KA 1X1AA 2I1WA 4HKTA 5EWJB 4DV7B 2A8YA 3DE0X 1QFJA 3L0YA 2PV7A 5K0ZA 1V9CA 3QKSA 1TU4A 1BH2A 4X84A 5TPZA 1ISPA 4ZTUB 1XZNA 1YVEI 3D6NB 3PIIA 4MUJA 4TTSA 3UHFA 4ENPA 8ADHA 4F06A 1H3NA 1HK7A 1YVUA 3DZKA 4Y6GB 3UXYA 2X5OA 2RIRA 1Z56C 1XB2A 2Z2ZA 3BDAA 2IU4A 3R6TA 4DLTA 3TZLA 1TQ6A 4BVJA 5KNBA 3PKIA 2OK8A 1DJPA 1N2BA 4INZA 5HIJA 3LC2O 3SR4A 2XD4A 4HGQA 2AJCA 3PUZA 1QNFA 1D4FA 4X6YA 3JZAA 3UQZA 4MVJI 4PCVA 4RJ2A 4FWBA 4F4JA 2XQKA 2XB8A 3GPDG 2CHVA 2MU1A 3JRWA 3NNNA 1JPJA 2P3LA 4AUKA 1G5RA 1QG0A 3RVBA 1RJFA 2G1KA 1M9NA 3KYDA 3ZG6A 4A6EA 1GT91 4ZAZA 3I1FA 3B1ZA 2L2QA 2JB9A 1UBCA 2WWYA 4HEHA 2FYTA 1D1PA 4L9SA 4S0XA 4O2BB 4UCFA 1KIMA 4LWZA 4RENA 5FPSA 3VUFA 3WYFA 4R05A 1WXHA 1P6UA 4GM1A 4GUDA 4QUIA 3W5UA 3E15A 4C7OA 2H1FA 4H1HA 4MYRA 1CJSA 3STHA 5JCZA 5KUTA 2N0SA 4RVGA 1EGMB 2C1EA 2RI1A 4UCXA 5IM5A 2NZYA 5FBHA 1G98A 4UVDA 3ZE1B 1FC0A 3HEBA 1AQJA 3R44A 4AZTA 3UGJA 2ZCVA 1HFJA 5HTKA 1RYEA 3PNSA 4TWZA 3IAS1 4G0PA 3X2EA 4A23A 5IPFA 5TY0A 5COQA 1FZQA 4HH1A 3PFIA 3AVTA 1VHTA 4GQBA 1Z5PA 2AVDA 4Y18A 1OXMA 4GP9A 1BN6A 1XZ8A 4RTJA 2EF0A 2ZQYA 4HSEA 1FDUA 2QPLA 3SX0A 4DR1B 4D80A 1AQ6A 1UMCB 2O8BA 2R60A 2G1JA 2MYPA 2J3IA 4F86A 2CJPA 5LVAA 3FBWA 4TQ9A 1GGEA 3EMDA 2B5WA 4DQXA 3K2IA 4YY3B 5FHRA 3DXYA 3O9MA 3FCCA 2C5FA 3QOWA 4D9CA 3PCRB 3DEZA 1E5QA 1L5OA 1E32A 1GA1A 4JFAA 4UM5A 4K0KB 2G17A 2HI0A 4IDPA 1PGOA 4HRXA 1G7SA 1YL6A 1TLTA 1VJDA 2HCRA 3E9EA 4KO4S 4O4HB 2H1RA 4RKYA 4TXMA 4URZR 5AI0A 5CLQA 4LX8A 1KPHA 4JKOA 3K9HA 1LQ2A 3GU3A 3OQBA 3UJ8A 4ZVNA 3W1VA 2R5NA 2QI9F 1JHVA 2RBEA 2C5AA 2IYVA 2FUEA 3FUXA 1L1FA 5EKTA 3K70B 4RABA 2HJ9A 3W5SA 1FF9A 4CRWB 1NBEA 4IUCS 2PUEA 5K8CA 1XDBA 3VR6D 1YR1A 4JJEA 4MS1B 2JGDA 2BIFA 5LMZA 1XVLA 2LE0A 4N5LA 1QZZA 1RADA 3VNSA 5DM60 2JLXA 2CL5A 2YMMA 4G81A 1Y9DA 4DUYB 1HDYA 3ELBA 3B60A 3PFWO 5EJEA 1AHPA 2RDMA 1QTRA 2XMZA 2BTOA 3H2YA 3Q0EA 2FMXA 4NR0A 4HNAA 5K1ZA 3K8ZA 1TMKA 3MG9A 3F8WA 3S2FA 2PQ6A 1R88A 1MORA 1GSIA 4NAUA 1G6Q1 3BTSA 2HGSA 3H9GA 4OU5A 5IF3A 3KQLA 1CR0A 1DU4A 2PXHA 1DPGA 4ZCIA 3N8DA 3K16A 3NPMA 4R6WA 4WBNA 3PEFA 3MIZA 1G20A 2YZKA 2QSUA 4RVUA 5EQDA 1E3WB 2J46A 3E27A 3H3FA 4Q82A 1FJXA 3GDOA 4K26A 1QFYA 5I9TA 3RJZA 1HQDA 1KOLA 2PYZA 4DR5B 2WWWA 1I33A 4I5DA 1PZFA 5A5VA 1O0BA 1XYVA 3NHJA 3NEYA 4FVTA 2HD4A 3NC1C 5FB3A 2O59A 1MENA 3VOAA 3BG5A 2GJ9A 3KOWA 1VM6A 2HCTA 3NHZA 2O3TA 4MR8A 2BE9A 3O8BA 1F8YA 1U2GC 4NNPA 4G86A 1R0BA 3V33A 2ZIXA 4JQOA 4H17A 1PI3A 4UZSA 4JVSB 3RTAA 3NX4A 4FP9A 4C5BA 2B30A 3UWOA 4A6DA 5ENDA 3TZ6A 5DNCA 3P96A 1YBMA 3PWSA 3QUCA 5MN5A 5IXYA 4BU0A 4L8WB 5JU6A 2QGFA 2W43A 2D0DA 1YR6A 1T5HX 2I6UA 2C7BA 1K8ZB 3FETA 2X7JA 4D5EA 1Q7TA 1VFPA 2DFPA 3E7PA 3M5PA 2YHAA 3W2TA 1DJNA 3QVJA 1FRNA 3HC7A 2ATIA 3WRYC 3PEEA 4LZAA 1MBZA 1GN9A 1Y1LA 2L82A 3H7IA 3G6KA 4WBNB 3VRHA 2H8KA 2EIHA 2QF7A 3CRZA 2IEDA 1R9GA 1JPVA 3TVDA 3IGFA 2GPTA 1KZ9A 4ZT7A 5FOXA 1G5FA 4H35A 3EAQA 1TUBA 4KQ9A 1W30A 3CLRC 5DGIA 3RLIA 3FY4A 1T5DX 5E4FA 4A91A 4IEIA 1ODSA 4L73A 3T7CA 2H2AA 4QYMA 3D4NA 3TUZC 2R8BA 2JZNA 3DDNA 3MQ2A 4NK5A 2JFXA 2P9HA 2PCLA 1LJ8A 1L8XA 2ZRPA 3DWFA 3TTTA 4GF5A 5FI3A 1LDEA 5GGXA 3HMKA 4C2TA 4UATA 3K8QA 3FYUB 2J45A 4R3WA 5E3JA 4Z9FA 3BWXA 3U80A 4JI0B 1KI7A 1YS4A 4I4TA 4CIXA 3DBRA 5ESDA 5IP5A 1TI7A 2SKDA 3JQRA 1G3IA 1DI0A 4QT0A 1UBEA 5HQ3A 1NY6A 4P4NA 4PAQA 1G4AE 3FTDA 2ZJ2A 3HS3A 5IBQA 1SAYA 2JLSA 2Q8QA 4FEAA 2FQWA 3MJCA 4W5HA 4M83A 1PJAA 2EATA 3EWSA 5AVZA 2BFMA 5ITSA 2CF6A 3AF4A 2WAAA 4RF4A 5JAQA 2PD3A 2IIVA 2G67A 2HBQA 3C16C 3JD0A 3K32A 4O2AF 2AOVA 4IO0A 4DHWA 4NS4A 4ESHA 2AZDA 4HQNA 3RIGA 1A7KA 2O2XA 4YIKA 4CETA 3M6UA 3X1MA 2QTWB 2PYDA 4KO2S 2WWGA 5K4GA 3D4BA 2V55B 4LZOA 4DMKA 5TF4A 5SY6A 2OO7A 2R7MA 4JN6B 1F3LA 2A78A 4RMJA 4RXMA 3RABA 3ZDEA 2VJKA 3OZRA 3R76A 2GKSA 3DBOB 3B5IA 1YB5A 1NVDA 1Y1SA 3WHKA 2OHGA 1K97A 3LUAA 3UMSA 2IBTA 1YMQA 2I3ZA 4LYJA 4W9RA 3KR0A 3W9YA 1EFVB 2VJAA 1P9NA 1GUDA 1EXWA 1Q21A 3HKCB 1F1JA 4JLVA 4MCIA 4NZ9A 1I2AA 3MCVA 2FDRA 3WGNA 5ECWA 1I4LD 1SBZA 1VLVA 2VYND 4BNGA 4MKRA 1K6MA 3M81A 5ITVA 4GBMA 4AJPA 1RAHA 4HDMA 1IUKA 2OAGA 4FYJA 3LOPA 3C4JA 1EBBA 4P4SB 4KLAA 5EJGA 4JT4A 3JU3A 4CEHB 1YT5A 4RIIA 5DX0A 4C89A 5ABPA 1PW7A 1VP9A 2K2QB 2FZ4A 2ZKLA 3AUTA 1F6BA 1JAZA 4HLQB 2MINB 1XTBA 3CA8A 4KDFA 1T6YA 1M7HA 1H2WA 5FYQA 3O1IC 3M6AA 4QO7A 4ENRA 2XX3A 4B4KA 4FYKA 2VA9A 2DBVO 3MEQA 1LPNA 5DOZA 5DXAA 1ZNQO 4BJHB 2IYXA 3K0AB 4YTEA 4L50A 1BE0A 1EB9A 4YVFA 1RHUA 1OR8A 1UMDB 3GARA 4D8XA 2FFJA 2OQIA 1OFIA 4NBVA 1FUUA 1YUNA 4WY8A 4C4SA 2YXPX 3O8CA 2WJHA 1JQEA 1KJ9A 3LRTA 3TQFA 3ZOKA 4NOLA 4AJJA 3MJDA 3HY4A 1Y3HA 1OFUA 1K7XB 4XQGA 2UYQA 4MQMA 2FKNA 1NI3A 1RWNA 4XUCA 1F7UA 4WFIA 1SKQA 3A1EA 3AJ8A 3H5TA 1ZGGA 2Y77A 4YRMA 2YN2A 3UJPA 4HFNA 2ZRBA 2IEIA 3MMXA 4JI7B 1YONA 3P4YA 1RXWA 1VSBA 3H18A 5BW4A 4RGQA 4CODB 4WCFB 4OQLA 1NP7A 2V45A 1U9JA 2CWDA 1USGA 3M9XA 4JJ6A 4JUBA 2GHRA 2VFAA 3T1YB 3NETA 1NLFA 4MCJA 2IYUA 2C2WA 2IGBA 2O9JA 2XQFA 4FJ1A 4Z5XA 3CZ9A 4LJSA 5AW4A 3T0FA 2NMVA 3UCEA 2CXNA 3AR5A 2RHLA 5DTIA 2W6CX 5IDXA 3OM9A 1PJ2A 3BMQA 5TQJA 5CD9A 4NXNB 3LNCA 2XZTA 3IEMA 3OU2A 2XBMA 3ER9A 2XVYA 1PDOA 1DKLA 1JF8A 2ZTMA 2PS3A 4RLSA 4FCCA 2YWXA 1E4OA 3G2KA 4L4ZA 4BLWA 1GZ7A 4QHTA 1AE1A 2JGLA 2OCKA 3VR3D 3PP8A 1S3GA 4LBZA 5TMEA 1T9KA 4Z51A 4YHHB 2WIFA 5TGZA 4XWGA 2DBZA 2NU7A 3ISJA 4XQEA 5F2OA 5T6BA 2ZVJA 1MJNA 4BP8A 3ANSA 1U2ZA 1P73A 5G53C 4L4RA 4L76A 2ZYGA 4JUFA 1OAOA 1Z5OA 4KYIB 2R5FA 1XDDA 4HGZA 4L2IA 4U2FA 4TTJA 1O1YA 2OKGA 4M36A 4RMGA 4ZICA 2BH2A 3VJRA 3B1WA 3I12A 2PRKA 5EWMB 2H2IA 4GLFA 10MHA 2VJNA 2J9YB 2HHLA 2H1HA 3ELWA 5EE3A 3ESZA 4AT1A 1XRJA 4QOGA 3H2GA 4C1BA 2Y1OA 3PUKA 4FMDB 1CF4A 1NBMA 4QU5A 1OX4A 4U5QA 1ZJ5A 1Z8NA 2ENWA 3HCOA 1QE0A 3KR9A 4TWIA 1CZUA 1A2QA 4NMXB 4BGVA 2IH2A 3RJ9A 2P9QA 2NU8A 4P4SA 3ZCSA 2HQRA 3GZTB 3QBTA 4B84A 3F4KA 2J09A 5E0KB 3KWMA 1PGNA 3QX8A 5EQFA 1ODTC 1QIGA 1ONBA 4KXVA 3WKBA 3DJYA 3D0RA 4XX0A 4NEQA 3VNVA 4MKXA 1GGHA 1NP3A 3TLJA 2SNIE 4UM9B 2H63A 4CHTA 1AN0A 3I5YA 5CA1F 2X42A 1ZRNA 1ESEA 3PWTA 1O95C 1EJ0A 1FMJA 3COSA 1B1AA 2A9KA 3W9SA 1HRDA 1Z33A 1V8PA 2RIPA 3TL2A 3ELYA 3BX1A 1EHYA 1RLOA 2V7QA 3GFPA 4HWKA 1FFGA 1X1CA 2NSLA 1KO5A 3OTWA 4PLYA 5SZIA 1X74A 1AUXA 1DDOA 1AUOA 1NOJA 2FUG6 3F78A 3H1PA 1U3DA 2O19A 1JJIA 3ETHA 4J91A 2WLTA 4C7VA 4D9HA 5GINE 3UXHA 1QLJA 3KTOA 1DEKA 3NB0A 3BMXA 4RZHA 1VJGA 2SKEA 3EVAA 3I1JA 5BN4A 3K53A 3LT1A 3MCUA 1RW4A 5D00A 1T8SA 2AC7A 3EZ6A 3TFOA 1ZS9A 4MAAA 3GLFB 5TXGA 3I3SR 4JI4B 4I9GA 4OQXA 3SEQA 1AKVA 3W2FA 2H57A 1HDXA 4AIIA 4QGFA 4PS0A