2C5CA

Shiga-like toxin 1 b subunit complexed with a bivalent inhibitor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA-LIKE TOXIN 1 B SUBUNIT
publication title Extensive Cross-Linking of the Shiga-Like Toxin 1 B Subunit by a Bivalent Ligand
rcsb
source organism Bacteriophage h30
molecule tags Toxin
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2005-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2c5cA00
1BOSA 4P2CB 1CZWA 1R4QB 1R4PB 1CZGA 1DM0B 1CQFA 1QOHA 4ULLA 2XSCA 1D1KA 3MXGA 1C4QA 2GA4B 1C48A 1QNUA 2BOSA 4M1UB 1D1IA 2C5CA
chains in the Genus database with same CATH superfamily
1HFGA 3CRLC 1I50B 4A3DB 1G51A 3ND8A 1UUPA 1RJTA 5IYCG 4LF6Q 1EQTA 4AIMA 4C3HH 1XNQQ 5IT9c 1EY8A 4A4IA 1H9KA 3EIVA 5JEAJ 1SMYC 2R92H 1HA6A 1C9OA 3DXJC 2RSOA 3RR5A 4X3UA 5ELOA 3BZCA 3HS0C 4P75A 4C2MB 2IX0A 2DY8A 1V1PA 2Q2HA 1HUNA 5IGDA 3LWUA 5LL6S 3HOWH 3JAMc 4DNIA 2VB3X 1X32A 3GTGB 3NWTA 4X3KA 2F0HA 4JI4Q 3DMUA 3OSOA 1XMOQ 2PZWA 3L7ZC 4L5SA 1H9MA 2XN9C 3EN2A 4ID6A 3I4MB 2B8FA 5NUCA 3EQLC 5M3FG 1STNA 1X55A 1GUSA 4FO2A 3DHQA 5J1ZA 2FMMA 3HFZB 4LF5L 4IFDJ 4DPGA 4YY3L 1HZCA 3FEWX 3EVQA 3NWSA 5JJZA 3HOUG 1HTPA 2KJXA 2RCFA 4TRDA 5JVH3 1V9PA 5FO9B 2UUBQ 3O13A 4A3CG 5HGQA 4LWCA 3QJYA 4X64Q 3G6JB 3LX0A 1LTBD 3CP0A 2VUMH 3TMEA 2A68D 4K8JA 1DOMA 4OX9L 2B39A 1VQIA 3S1MB 4GKJL 2B2WC 4C3IB 1TWFH 2CW0D 3P1HA 1TWAH 3G48A 5AJ3L 1KDBA 1HR0L 3MC0B 4DV5Q 3CPFA 3G4SA 4RG1A 1L2FA 1G6ZA 2JEAI 5CC4A 1W2BA 1Z6HA 3KOJA 2EIFA 1MJCA 1WTRA 2N55A 5FLMH 3U58A 1PH5A 1MSHA 5M9OA 3SEBA 5H1SE 2Z0SA 1SDFA 5J22A 3AFPA 1XPRA 3PCOB 1EOVA 3S17H 3JAML 2CKZB 5TSSA 4JI1Q 1SROA 3X3NA 3I4NG 2WP8J 2PI2E 2RDFA 4LFAL 3L2PA 3NTHA 1MBYA 2WKDA 5GQOA 2XIWA 4RA8A 4C3JG 3VYRA 5CV6A 3OTOL 2EJMA 1XPUA 2XWBB 1IXRA 1E0BA 1SYDA 2VZAA 5D14A 1ML0D 2X6GA 1D5XC 2CWAA 3S16H 1AE2A 3VYTA 4DAPA 3K5OA 4UPAA 3OOCA 2EJGC 2EZVA 1HRJA 2G9DA 3AQQA 1YI2A 3FKIB 3NK9A 1E24A 2N78A 3OWEB 3BDCA 1YBYA 2JK8A 2UXDQ 3IL8A 2E2JB 4GNXC 5EPLA 1ICFB 5ELNA 4GS3A 4NMZA 4DV4L 1JQYD 1DGSA 2B3GA 4LF4L 5JOBA 2A6HC 1E2WA 4KJNA 2MO0A 3SK8A 2B2YC 2WINB 2CQOA 4JG2A 1TY0A 3M4OH 4XQNA 2Z9HA 3A8JE 3T1HL 2R7ZB 3J7YW 2BDOA 3M4QA 2XRQD 3R8BA 1PDQA 2JA5H 1G6PA 1WTQA 3S1RH 4JBWA 4A3JH 3FPPA 4OEMB 4NXML 1VQJA 5IGFA 2K5DA 4A76A 5I9PA 3HGBA 3ONAB 4A3MH 4JI0Q 1W6KA 3I4MG 1LT4D 1E1OA 3E5SA 2RKSA 4KI0A 4Y7NH 4ZUIA 1FGBD 1Q1EA 4YWMA 2JP1A 3TP8A 3MXPA 3S2DH 2NB0A 4JI2L 5LMUL 4RKLA 4A93H 2PW5A 1WJJA 3MEFA 2YTYA 1EEID 1M4VA 4QL5A 1VQGA 5KIXA 2B2VC 4OGQC 4AYBE 4A3GB 2XWJB 1SYGA 2NTTA 1YNND 4X65Q 3CQZB 3EA6A 3GD7A 1WTVA 3Q0AA 1XMQQ 2OQKA 4IUTA 1P16A 2M2LA 4UDUC 3KDFA 3TREA 3GTOB 2E2IH 2L15A 1PRTF 3AFQA 1FL0A 3R2IA 1PFSA 3MFYA 4IUUA 3PUYA 4K6LA 4JI3L 4R8IA 1X6OA 1N32Q 5IYCH 2KENA 1CFMA 1TR5A 1YHQA 2ICEC 1TWHH 4XQJA 1KL9A 4TQUS 1EIGA 1LTSD 1D1IA 3K7UC 3I55A 3AMUA 1Q7YC 3KLWA 1I6HH 1TS5A 2A68C 2AQ1B 3EJIA 1KLUD 3RLFA 2G9HD 3HOXB 2Q8RE 2KEEA 4A3KG 1N34L 1S5BD 1N36L 3LNNA 2CW0C 4PMCA 4I7AA 5G3LD 1PTOH 1SAPA 2N8NA 4Z9CB 3GTKH 4KHVA 4LK1C 4BY7H 3ERQA 1K8MA 1G2TA 4GOPB 1U0LA 4OHJA 1DONA 4HN7A 1PZID 3GTQB 4XT1B 2KCTA 2IX1A 2Y0SB 4QMGA 1STYA 5C5MA 1S72A 2LFNA 2EYJA 3FKIG 2UUCL 3CRKC 2MO1A 3RZOH 3GV3A 2V1CC 3NHHA 1ESRA 4IPGA 2JN4A 5C4XH 3GTJB 3I8ZA 3WOFA 4HIKA 5IYBG 1F9QA 1SFOH 5I2XA 5C44H 2PW7A 4BXXG 3HOYB 1TS4A 4QY7A 2E2DC 1RIPA 2PQAB 4YCVA 2PMZE 5M3MH 4IQZA 4R1JA 1CQFA 2OTLA 2FXQA 4CKBA 4DAYB 2B63H 2R7ZG 3H0GB 2IHFA 2YU9B 4IURA 2Q8IB 2NZOA 1Y1VB 3HOVB 5DEHA 5C4JB 2DNCA 1K73C 2E2HH 2CHBD 5DLQE 3UDGA 2WACA 2A1AA 1PHJA 1X3GA 4KTAA 1A8VA 2K75A 3OIQA 3T56B 3K80C 3H3VH 1O78A 3OIPA 1VDZA 1VQ9A 1FR3A 3A74A 2F3VA 3S14H 2HCCA 3VYUA 4DAVA 1QVFA 2UUBL 1LV9A 2KECA 1AH9A 4RGTA 1VQ7A 3UE0A 4X64L 3SK6A 4FYDA 3M4PA 4OL7A 5FLXE 4GOPA 4IZ8A 4ILWA 4O0AA 4HJ9A 1I3QH 3D4WA 3K0YA 4O42A 5IY0A 2WAQE 4MZ9A 2K6AA 1D6EC 5M5XB 4C3JH 4A3GG 1FD7D 4ULLA 4C1NK 2NVYH 2DGYA 1H95A 2LXJA 3H3VI 2H5XA 4DV5L 1STGA 1Z47A 4J15A 3U4VA 4H7BA 4HJ8A 4A3LG 2F0QA 3S24A 3S2HH 4MTKA 1I4GA 1MSGA 2LSSA 1K83B 2EOTA 4DV2L 5LL6X 2OF1A 2DJFC 1SXTA 2HHHQ 2BE5C 1I50H 2AUKA 1LABA 4A3DH 4BBSB 1HZBA 4CDFC 4U68A 4PZ6A 2Z8LA 1QE6A 3CKIB 4YCWA 4DAYA 2SNSA 4BS9A 4RCOA 1VQBA 3RZDH 1MJEA 4DR4Q 1B1ZA 5A35A 5BR8L 2PQEA 1RDPD 1HXYD 1GUOA 1XWEA 1NE3A 1WD1A 4JI5Q 3HOXG 4DR5L 1E2VA 5ELEA 1WD0A 1QVCA 5M5WB 1F9RA 3STBC 2JXMB 1SNMA 1UE6A 3H6MA 3C1FA 3HKZB 3PV0A 1A62A 1IBMQ 5EKLA 1R9TH 1LACA 3BVMA 1C48A 3KF8B 3OMGA 4HIDA 1IW7D 2Y0SG 4IUPA 3H91A 1EUJA 3T16A 2VQFQ 2QA4A 3CPWA 2VNUD 3UI2A 4A3EB 1L1OB 1C8CA 1QWYA 4AQYL 1FNWA 2EY5A 3H94A 2IJ0A 2WIIB 5M3FB 3IAYA 4LF7Q 1TWCH 1PZKD 3MA2B 5ELDA 1L0WA 2JA8H 4IFDG 1OXVA 3PUWA 4LFBL 4R8NA 1BNZA 3BDOA 4NKLA 4ZQ3A 4QIWB 1BO0A 3NBHB 1L1OC 4LF9Q 3GV6A 1BQQT 4RH6A 2J0TD 3BS1A 3BJUA 2RQXA 1C7YA 4H0LC 5DM63 4JI0L 3H0GG 4B3RQ 2A69D 2PZUA 3PO3B 4KY5A 2R6GA 3S1MH 2N3SA 3NP8A 4C3IH 3HOVG 4HEDA 2ZT9C 4YWKA 4A3BG 3Q24A 2O2LD 1UE7A 3C1EA 2E74C 2NBFA 4DUYL 2K33A 1NMGA 1XNRL 4NPSA 3Q23A 4GZYC 2A5HA 4DNRB 2MNAA 3J80L 3GTPB 2VQEL 5JJLA 2WB1G 2XVSA 3K7AB 1JC7A 3RNUA 2HIXA 4RKBA 5C0XH 1WCMB 5IIFA 4WRDA 1V1PB 1CQVA 4X62Q 3J81c 1GXDC 4O2DA 5CORA 1V1OA 1IYJB 4PQXA 3CCLA 5JJKA 1KNEA 1SNQA 2XTIA 1VQPA 2QILA 3K57A 2NTSA 3A0JA 2EJFC 1FNUA 4FF1A 3U4ZA 3KJOA 1STEA 2UXCQ 2K04A 2L5TA 1VQ8A 1AW7A 4BA1I 1G8ZD 4XT3B 4UY8C 3A56A 4DNTB 2E5LL 5E7NA 2L1BA 3HG9A 4POFA 4PMWA 3VR4A 3MXUA 1B7YB 5IT9E 3FKIH 3GTLB 3H09A 1KDAA 1LO5D 1BCPD 2R3ZA 3T4AC 1IBLQ 1XTCD 2K50A 2B2UA 3FPUB 5I6WA 4JBKA 4TVAB 5EKKA 4LMQD 4DXFA 3JAMi 2JA6B 1ZKOA 1HFNA 4XIGS 4O1NA 2L9HA 2YYZA 2OTJA 1DOLA 2IPKD 2ZJRA 3Q6SA 3ULPA 2SEBD 3T1YQ 3FRPB 2F0JA 2B29A 1A15A 2LY7A 3DEOA 2YV5A 3PIOA 1X9NA 5IP7G 3HKZG 2EYMA 3F1ZA 2OCEA 4IO9A 4BBRB 3I4OA 2K4KA 3J81j 5KEEA 1SLJA 3TP5A 2OQ0A 1HPCA 1U4LA 3DLLA 5FO7B 2KCCA 3DUZA 1XPOA 4EX5A 1N8RC 4OWWB 1UNSA 4A3EG 5BN4A 4YIJA 2EDGA 1YJWA 3HZXA 3J81L 1Q81C 4A3IB 3KFUA 5GADC 2Z6KA 1CTMA 3LWEA 1RD9D 1O80A 2F3WA 4LW1A 2A73B 1SYCA 2F0MA 4R4TA 4FXDA 1D7QA 2IWHA 1YNJD 4KKTA 4HR7B 5IWAL 1Y1WH 1FJGL 3S1NH 2K5WA 1Q90A 2L4NA 4BY1B 3Q22A 1IW7C 1KHIA 1KAWA 3OHXC 2K1BA 5EQ0A 1JR0D 1GD7A 5EBCA 3CQZH 3PO3G 1OXTA 1QNUA 2I5MX 3HEJA 3K5LA 5JPNC 4DGZA 4X3TA 4IALA 3VA5A 4JV5L 3D0FA 3K59A 1CHQD 1SNPA 5GAHC 2JA9A 5CR3A 2XSCA 2F0EA 4OELB 3CXCA 4NB3A 2K05A 2DUDA 1EEFD 4DR7L 1KDCA 1MD2D 2L12A 2AMCB 2CH4W 4OXPA 3BVGA 4DV0L 1PMRA 3CF5A 3GP7A 1WCMG 3IRBA 5IGBA 3HOZH 1GOZA 5EAYA 1X3PA 3K81C 3A8IE 2A69C 3MTSA 2HQLA 3MWYW 4LFCL 1K8AC 4G4KA 1CT1D 3RN5A 1XYIA 4BWGB 5DM73 4G7HC 2KQ3A 3E9IA 4B3TL 4K5XA 4GKKQ 3C3LA 1S3OA 3URYA 2TMPA 1C4QA 1XTDA 2SNMA 1KRSA 4K6DA 3WDNA 2ICIA 1B9MA 4A3KB 2IY5B 3SVMA 1Q12A 1A3VA 5IP9G 1IKMA 2F0LA 4LF8Q 1HQRD 1JWUD 5C3EB 1UWVA 1WTXA 3CAMA 1LTLA 2R93B 1BBWA 4OO1H 1DD2A 2L55A 4FF4A 3E0JA 5IYDG 1PTOF 3CCEA 4JI5L 4ME5A 2KUMA 1FVIA 1PH1A 1TVXA 2PI2A 5J39A 3VR6A 2E8GA 1NUCA 1X65A 1JORA 1I4PA 4CDDC 3HOYH 2AWNA 3RUZA 1BCPB 3D8GA 2JA6G 1ONLA 1HNWQ 3ERSX 4KY6A 4DU9A 2YU9H 1DM0B 3KDFB 2I46A 1PH8A 2XRSD 4ABNA 1HR0W 4WJ3M 4AYBB 3UDFA 3UE1A 2O5JC 1EY9A 1Y1VH 1IYVA 1IYUA 1U5KA 4BBRG 2F1MA 1BCPC 3S1QB 4OO1I 2ZXOA 1IL2A 5ELFA 2JJQA 1CKNA 1NJIC 4LF7L 2MUYA 1VQOA 1B9NA 1Y8NB 3K8AA 5KRUA 5T1GA 1KABA 4GLXA 1XJVA 4JPBW 4A3IG 2F0OA 3IFTA 4HCEA 4X6AH 4C3HB 1I94Q 1QILA 1PFMA 1WOCA 1I4HA 4B3RL 2R92B 4DK0A 3CCJA 3PIPA 3I72A 1EY0A 4JI8Q 2C5CA 2K7VA 5FO8B 1KIXA 5DAUA 5FJ8H 3EFXD 1JB7A 5M5YH 2LXKA 5CBEE 4K5VA 3TBIB 1W6JA 4M8AA 1SE2A 4BY1G 3M7NA 2D2CC 1HNXQ 3HOWB 3TDQA 4ALPA 3CCSA 2PPBC 1K0RA 4DR6Q 1S5ED 4DV6L 1GO3E 3JC66 4DV1L 2SDFA 1Q82C 2F0NA 1RTNA 4JK1C 3PO2G 2ZM6L 4JI7Q 5EKIA 3NPPA 2EYPA 1EWHA 2RBMA 3NTIA 4BBSH 5ELBA 4EQOA 3I70A 4QF4A 1KC8C 3OYYA 4RHSA 1Y14B 4CBVA 1LT5D 4Q0FA 1YNJC 2EY2A 2F0WA 1R4QB 5LMNL 3UDIA 2KCNA 2Q2UA 4YWLA 1QUQA 3VR5A 1QNKA 2A6ED 1SR3A 1S5CD 1IBKQ 1N33L 1QJOA 2KHIA 5C3XA 2JQOA 4I65A 4B3SQ 3KLRA 4WORA 3VA7A 2UUAQ 5K36G 1F2MA 4HTHA 1STHA 3J7AF 1UE1A 2ZXRA 1VQ4A 1YITA 2CFMA 4V0BA 5M5WH 2RHQB 4DR2Q 5I6YA 2MHVA 1T9HA 5I9OA 1ILQA 2Q2TA 4KY7A 4A3FG 3V96A 2E76C 3SGIA 2P5ZX 4PNYA 1RF2D 4IPHA 2IL8A 4ZK9B 1ZEQX 4B3MQ 3QOJA 1YNXA 4Y52H 2NVXH 4EQPA 3J7ZC 1WTOA 1TWFB 1ICWA 1TWGH 1S40A 3G6EA 2B8GA 1TWAB 5C3EG 1SSOA 4IPDA 1TIID 2R93G 3RD4A 2NN6G 3M3YH 4F87A 4LF6L 3VR3A 5M3FH 1XNQL 4IUNA 1G91A 4L5TA 4DK6C 2C35B 2MFIA 2R7FA 3CC2A 2F0GA 3QOLA 3RLNA 1J8IA 2QDLA 4GOPC 2HIVA 2E75C 4CHTB 2K14A 2KA7A 3L9AX 1STBA 3S17B 2BH8A 4NXNQ 1WTWA 1V8QA 2AQ3B 2DY7A 2KVMA 2RSNA 3HOUH 3M4YA 1L0XB 1HA5A 4JI4L 4CJ1B 4AYBG 3M9BA 1XMOL 4A3CH 5EPKA 4JC0A 2O5IC 1AP0A 4HJ7A 4DF7A 2HD3A 1ZXTA 1VQFA 3GTMB 1G291 1JICA 5LHY1 2JA7G 4ZKCB 2ZTEA 3SR1A 3S16B 4KLKA 2F4IA 1FNVA 5CV8A 1OXSC 2YTXA 4A3BB 1CSQA 2H1EA 2K52A 5I2YA 4DUZQ 5A2QE 4RCNA 1WTPA 2EPBA 4C3HG 2NWGA 1CZGA 1Q8IA 4BA2I 2R92G 1OXUA 4IN3A 1JJCB 2RCNA 1E7ZA 2PCFB 2EYLA 4IUVA 2WB1B 3P20A 1BBXC 2LKVA 2JYOA 4N8FA 3U9OA 4G7OC 3BZKA 2XNAC 1DCZA 1F2ZA 1X54A 1ZYRD 4LF5Q 1D5MC 3M4OB 3M85A 3ULLA 3S15H 3T53B 1MGSA 3HOWG 1CKOA 4DN4M 2JA5B 3CMAA 1WTHA 3W1BA 3I4NH 2UU9Q 2Y0SE 4A3JB 3TRZA 4QGUA 3D6WA 3E0EA 1NAPA 2KHSA 3CU7A 3PQIA 4YHHQ 3MFGA 4XXEA 3CCQA 4Y7NB 4C56C 2K5VA 2X69A 5EBDA 1YHAA 4FF3A 4FDBA 3ER0A 4P71A 1SMXA 5AJ3Q 1EOTA 3DWAA 3PMFA 2J4XA 2XGTA 2KEDA 4GLVB 4PZ7A 4R4OA 3S9WA 4KMUC 3CCRA 2X6LA 4RWSC 1PRTD 2VW9A 1KRTA 2ZXPA 4JI1L 3W3AA 4TKOB 3J80c 2BA0A 1Y8PB 5JEAG 2HDMA 4LUOA 4LNQA 4LF8L 3E6ZX 4K8IA 1PFNA 2ATWA 1KAAA 1YNNC 2QKIC 3BYYB 3E3XA 1S5FD 4XDXA 5C6AA 1WVLA 4DK3C 2VUMG 1LTRD 4C2MH 4TSSA 3TEHB 3DWPA 1EYDA 1RHPA 1Q86C 4R4CA 3GTGH 1SYFA 1EZ8A 4RAUC 4HSPA 4RFBA 1FYCA 1ET9A 3OPOA 4HMJA 3AEVA 2E2IB 2D5DA 3HP3A 4F8MA 1EWIA 2QF7A 5EPJA 3OTOQ 3KK7A 2VL6A 1HZ9A 5KYLA 3RLOA 4V190 3I4MH 4DFAA 2UXDL 3K5NA 4UP8A 1TWHB 1E22A 5FLMG 5C0XJ 1RCVD 3HKSA 4IOCA 4DXGA 4DK1A 4HIMA 1H9SB 4KN7C 1I6HB 4MHEA 3SK5A 2IW3A 4JOIA 1VQEA 1IHZA 1EYGA 1VQNA 2K03A 5IGGA 4A75A 2IX3A 1MHWC 4NP5A 1TS3A 3C46A 3D31A 1LTAD 4G57A 1KD1C 4JBJA 3F2CA 1ENCA 5ISRA 4LF4Q 1MI2A 2WAQG 4H44C 1SN8A 4HMIA 4BY7B 1HTLD 5CBAE 1B3AA 3QR8A 4R4IA 4MNOA 5KGUA 1HUMA 3GQBA 3T1HQ 4MTNA 1VQ5A 3DM3A 2N49A 2WKCA 1CZWA 4N9PA 4ZUJA 1O7LA 5E4WC 1ESFA 4JI8L 3J81i 2B2TA 4IUQA 1A2UA 3AU7A 4NXMQ 2EY1A 5D3IB 3RZOB 1EQVA 2NVTB 1JJ2A 1K3BC 3CW2C 4EVOA 1HNZQ 1SE8A 2B2UC 2TSSA 4AH6A 4OONA 1VQHA 5FLXL 4DR6L 4ZCKA 2D0OA 4OWXB 1BOSA 4JI2Q 1EU4A 2AWOA 1SEBD 2J7ZA 3HKZE 4J1MA 1VQDA 4B08A 2B63B 3NXWA 1JOOA 4X65L 1A2TA 4A3KH 1XMQL 2JA5G 1DJRD 1II3A 1CKMA 4JI6Q 2Z6BA 1D8LA 2I0QA 3GO5A 4A3JG 1LLRD 1TS2A 1VF5C 2E2HB 1CI3M 1IL8A 1L0YB 3D4RA 4A3MG 3QWNA 1H9SA 1IBKL 1B2TA 1Q46A 1X3FA 4WJ4A 1I4RA 3J7AV 1Q8KA 4K5WA 5GAEC 1N32L 1NR2A 1JJGA 4N8X1 1PZJD 4J8QA 1D1KA 3G71A 2F4VQ 1T5XD 2F0IA 4DR2L 1ZYRC 5EJWA 3I91A 4NW2A 5D65A 4A93G 2M00A 1NCVA 3BU2A 2I07B 2Z6KC 3SHLA 3DWQA 1RODA 1LUZA 2PNRC 3F2DA 4JI3Q 3TN2A 3OW7A 1A3TA 4B3ML 2E2JH 1I3QB 4DAMA 1KTKA 4HAEA 1JCKB 4L8JA 4X66Q 4CJ2C 5IYBH 1HH2P 4EGVA 4BXXH 1PA6A 3JAME 3AB9A 3X3MA 1NTGA 2NVQB 3EROA 1PRTB 2NVYB 4UP7A 5BN5A 3TS2A 3SXHA 3PGZA 1BF4A 5L37A 3RN2A 3S1QH 2R7ZH 4C1NI 1E3PA 2QEJC 4ZRZA 4CGYB 1QG7A 1JWSD 4GLAC 3ND9A 2YTVA 1K8OA 3FMCA 1A3UA 1X3QA 1PRTC 2SOBA 2F0TA 2VY3A 2D0PA 4NXNL 4L5QA 1J9OA 3FVQA 2EVBA 2NZHA 3RZDB 4HCSA 5COYA 2OWOA 1HCZA 2UUCQ 3I2ZA 1SNCA 1PFBA 2H4OA 3KLSA 1I4QA 1YJNA 4R9WA 3WWVA 1F2LA 3CMEA 1ENFA 1SBBB 1BXTA 1PH4A 5JJIA 2GVAA 4DR1Q 4BY7G 4L63B 3J7A5 4P73A 1IKLA 1HZAA 2QEXA 1RKNA 4DUZL 4A3GH 5C4HA 1R9TB 1VCIA 5ELCA 3I56A 2Z4IA 5C5LA 4F88A 2K5NA 3KUPA 3MHBA 4FP5D 2HT1A 5E4XA 1C0AA 4A3LH 1YZ6A 1K0SA 1SJED 4CKEA 3GTOH 3PO2B 1F77A 3D4DA 1JT8A 1R4PB 2K32A 1TWCB 2VXWA 2JA8B 1F9PA 3CD6A 4JVZA 5C4XG 2GA4B 5HY6A 3F8TA 2D9UA 1PH7A 1Q3LA 1PV4A 2WV6D 1GUTA 5C44G 2UU9L 3F2BA 4RMFA 2ID0A 5JEAH 4FVMA 1NBWA 1A6XA 2KOLA 5M3MG 3NSWA 1CKNB 1O7YA 1KLGD 2B63G 4YHHL 2NZ1D 3HOXH 1JB3A 4P72A 1EIHA 3VR2A 2K5QA 4WJWA 1AZPA 5AFWA 5FOBB 3IFDA 4A3FB 1WYDA 2CQAA 2F52A 3BYTB 5EGTA 5C4ZA 4DV3Q 1QVGA 4XQQA 3GDEA 1S5DD 2BDNA 4R4QA 2DJGC 2HHHL 5T1IA 1NNXA 2F0VA 3G7LA 1EFID 4JYAQ 4U673 3GTQH 2MP1A 4KJOA 5IT9L 4QB4A 1M90C 2RDGA 2OEOA 1M8AA 4DR4L 4QCLA 1U4PA 4DV2Q 1GUWA 4KHPQ 3T51B 1HHVA 4RGOS 5G3LF 1LTTD 3TSSA 3I7FA 4CJ0B 3MAQA 1PH3A 3PF5A 1VQLA 4IFDH 1EYAA 1YIJA 4K2KA 2RDHA 5FKAC 1PLFA 3GTJH 1QCBD 3TQYA 4EQ5A 3QB3A 4MN3A 3A8KE 5GAGC 5CMDA 5BR8Q 1XXGA 2NUCA 1LT6D 2QGQA 2IT1A 1UEAB 1IBML 1VQ6A 2RVLA 4DR5Q 2RF4A 4FF2A 3H0GH 2JEBI 4GNXB 3GTMH 3PF4A 1LYLA 1QUQB 5D3DA 4P74A 2VQFL 1KQSA 1B4OA 3HOVH 2UXBQ 2B2WA 1FGUA 4GN3B 5C4JH 2AUJD 4A3BH 4A3DG 4DR3Q 1EY7A 2ALYB 3L0OA 4IFDI 2JA7B 1ASYA 1WFQA 2R7DA 3DM1A 5C3WA 3V05A 3KF6B 2AKWB 3NE5B 3TP7A 1ASZA 1K3RA 4GN5A 4LF9L 3WOEA 4AQYQ 3E9HA 2MJ8A 3IKJA 3QG1A 1XX8A 2NYZD 2CWPA 4QQBX 1G2SA 1VF7A 3PUXA 4LFBQ 2C9OA 1U4MA 2ZTDA 1QZGA 5KNCA 2V4DA 4QUFA 3N6RA 3W5OA 1GVPA 1PXUA 2DN8A 4QJFA 4UHVA 2F0SA 4XTCS 1CM9A 2RA4A 5M5XH 1V1QA 3A7AB 2L0CA 1HNZL 3EBEA 3NQIA 2EE1A 3D6CA 1IZ6A 4G7ZC 1N9WA 4LJZC 1DYQA 4KKSA 1PVOA 1JOKA 4IJLA 1SE4A 1K83H 4KV6A 2PZTA 4DUYQ 3QIAA 2O4XA 2M9VA 3KLSX 4X62L 4HSVA 1XNRQ 2JA8G 2BE5D 2F0DA 4IPCA 5FK9C 5HGTA 3KJPA 1J5EQ 4K0KQ 2VQEQ 1PYBA 1JE4A 4GNXA 4JI6L 2K01A 1Y1WB 3S1NB 4K2LA 1B8AA 1JWMD 3PIO3 2RHSB 4J6HA 1SNOA 1TKWB 2CVRA 2EYFA 3UDXA 1M1KC 3R93A 2UXCL 1E1TA 2PYKA 2B2YA 2FMCA 3ZJYC 3PSIA 2HDLA 1AE3A 4UAIA 1PH2A 3NQTA 5KYIA 1JMCA 4KHZA 2DNEA 4C3IG 2F3IA 2F4VL 3KF6A 3STBD 1CK1A 1QZHA 3CC4A 1Y69U 2MPMA 2PMZB 5IP7H 5IOCA 2VUMB 4PG3A 1J6QA 4OIJA 1I5FA 3MXGA 4CKCA 4ZAIA 1GKHA 1Z9FA 4APVA 3TP6A 1IBLL 3ITPA 4X66L 3K6OA 4ME3A 2E5LQ 1CUKA 2G5DA 3Q8DA 1B53A 3R2TA 5C0XG 1Z7TA 4A3EH 3HOZB 2WFWA 1A0IA 1OO9B 4H02A 2QDBA 2PNHA 4DV7Q 4JW0A 3CC7A 2EY6A 1VQKA 1GHJA 4EQNA 2GN5A 3FP9A 1B3QA 1EYCA 1PTOD 2KBNA 1YJ9A 1QB5D 4LAAA 1UAPA 2BH2A 3T1YL 2QW7A 1BKBA 2Z1CA 1B70B 2B2VA 4LUVA 1MIUA 4Q5VA 3U50C 1KXLA 5E3FA 4DA2A 2K5HA 5LMNW 1VQCA 1K8GA 3ULJA 4IOAA 3KYHC 3K5MA 3PO3H 3N52A 5JPMC 4WFN3 2WAQB 1K9MC 1NY4A 2ZTCA 4IJHA 4B9WA 5IGCA 3OW2A 1F2YA 1NMFA 2PO4A 1OXXK 2A19A 3TZDA 4L5RC 1SNDA 3D3RA 4FNFA 1GM5A 1D5ZC 3SE0A 2NVTH 1EFWA 1VQMA 2HQEA 1AEXA 3W1GA 5CV4A 4E6IA 3GTPH 2JE6I 2QCPX 4LUZA 2Z4HA 3L3OC 3KBGA 4DR1L 4FXGC 3K7AH 3CCMA 2KCMA 1UE5A 1KNAA 1WCMH 5J3BA 3NUCA 4JCVE 2LMCB 5GROA 3BZDB 1NSNS 2ENBA 2F0KA 3A54A 2JSOA 3VYSA 1TXYA 4MIUA 5IWAQ 3A5UA 2L11A 1FJGQ 1EIFA 3FHWA 1AN8A 4RHRA 4YY3Q 2AQ2B 4KD4A 2F0UA 1EY4A 3SK4A 1JOQA 4B9XA 3I4LA 3B6YA 4S3SA 2N88A 1X56A 3S1RB 5IP9H 3OWFA 1PYSB 3R3OA 4JV5Q 1CHPD 5I4DA 2FHTA 4RGMA 5CYUA 1WI5A 4KK7A 1GUNA 4DKAC 4A3MB 3J80E 1LTGD 1EU3A 4QUCA 1SE3A 3J80i 3GTLH 1LM0A 4OX9Q 5IYDH 5IGEA 4GKJQ 3BDLA 4ZLTF 5DNFA 3I3CA 4DR7Q 1ENAA 3OMCA 3S2DB 4GKKL 4DV0Q 1EY5A 1Y1WG 1EWCA 4KD3A 1CA6A 1TQOA 4A93B 4JOIC 5M5YB 1A63A 1HR0Q 3MEHA 1TY2A 4DV3L 4N9TA 1YVCA 3PUZA 2NVQH 1VQAA 2EXDA 4LFCQ 3SDZA 3VDYA 1STAA 4JYAL 2JA6H 3MVVA 4PV1C 3LGJA 2GVBA 1S4ZA 3K0XA 3NTKA 4B3TQ 3BVZA 5FLXc 1AZQA 3MXNB 1CA5A 1B50A 1SMYD 4UP9A 5F2DA 3I73A 5E1FA 4ZYSA 2FFKB 5K5PA 4KN4C 4KHPL 1BCPF 4BBRH 3P75A 5JVG3 1W3SA 1VMPA 1ET6A 2EXZA 5HURA 1GJXA 1PYWD 2PQAA 1TU2B 4LFAQ 1SRUA 2B2TC 3PIP3 4OIKA 1BBUA 2A6EC 1MKHA 2EYOA 1O7IA 3TS0A 2ASBA 1DXMA 3HOZG 2OT2A 2WB1E 1T5EA 3C2PA 4PMBA 1LT3D 3W2DA 3TZUA 4A3IH 1U4RA 5JAVA 2F0FA 4X3SA 2BOSA 2BCOA 3QO2A 5KNDA 1HNWL 1BVSA 3M7GA 4KKUA 1PH9A 5CV9A 1AFPA 4XYOA 4P2CB 1BDOA 3DEPA 2F03A 2ZJQA 1EZ6A 2UXBL 1DZ1A 1QOHA 2A74C 4FXKC 4BY1H 2R61A 2NVXB 3ICEA 1PTOB 4DR3L 4H13C 3GTKB 4DV4Q 1TWGB 2VS1A 3H15A 4YCUA 1H9JA 4M1UB 1DOKA 1VS0A 1X3EA 2Q8TA 1BR9A 3PO2H 4OO1G 3M3YB 4OWTB 3NELA 4PZ8A 3PUVA 1NR4A 3CCUA 1BUVT 1PTOC 1HJPA 1I94L 1CSPA 2LS01 5A2QL 3NBIA 4JBMA 3J81E 2CCZA 2CH4A 1P8LA 3MXNA 1EL0A 3A5ZB 1I4XA 3HOYG 2MGSA 4HIOA 1EY6A 4RGNA 3NEMA 3P7JA 5C4XB 1U9RA 1EQQA 3HOUB 1HNXL 2HUGA 5K36H 4F7XA 1SFOB 4CDCC 5C44B 1D2BA 2I5LX 4HJ5A 1VMCA 1E2ZA 1F9SA 1Y1VG 1Y8OB 2IHEA 5LMUQ 4A3FH 5M3MB 2F0PA 5CGKA 2ZJPA 4JI7L 4XYQA 3CCVA 2I5HA 2EQSA 1TT2A 1JE5A 3AYHB 4I7ZC 1GHKA 1B44D 2OXPA 3FDTA 3I90A 2D62A 4L6TB 4ZKBB 1J5EL 4K0KL 4DV6Q 1YEZA 5IE8A 2KHJA 4DV1Q 3K58A 1HQMC 3T13A 3V2TA 5BN3A 5C3EH 3A7LA 3BG3A 1EIYB 2ZM6Q 1I6VC 1OTCA 2R93H 2NN6H 4B3SL 2UUAL 3S14B 5IODA 1RTOA 2AHOB 3KBXA 3KF8A 2HCIA 1YHBA 2FJ2A 4HJAA 5LMNQ 1O7ZA 5FJ8G 1GUGA 1SYEA 4QIWE 3A55A 1Q1BA 4ODGA 3MZ5A 3H3VC 1N33Q 1L1OA 3ZYYX 1LTID 4K14A 3S15B 3CHBD 1K28A 4GN4B 4POGA 1V43A 2EYHA 1PH6A 5KNBA 4NDXA 1UEBA 3I4NB 1SYBA 2ES2A 2BA1A 2A8VA 5CV5A 1H9RA 2VB2X 1ILPA 4C3JB 3U9SA 2FINB 2MQHA 5CV7A 1EQRA 1RL2A 3NBHA 2A6HD 5C0XI 2Q2IA 3HRZC 3F2UA 4BBSG 1N34Q 1N36Q 2NN6I 4DV7L 2K28A 3NENA 3RMHA 2JA7H 3S2HB 1SJHD 4CDEC
chains in the Genus database with same CATH topology
1HFGA 3CRLC 1I50B 4A3DB 3ND8A 1UUPA 1RJTA 1EQTA 1EY8A 1H9KA 5JEAJ 1SMYC 1HA6A 3DXJC 2RSOA 4X3UA 3HS0C 4C2MB 2IX0A 2DY8A 1V1PA 1HUNA 5IGDA 3LWUA 5LL6S 2VB3X 1X32A 3GTGB 3NWTA 4X3KA 2F0HA 3DMUA 3OSOA 2PZWA 3L7ZC 1H9MA 2XN9C 4ID6A 3I4MB 2B8FA 5NUCA 3EQLC 1STNA 1GUSA 4FO2A 3DHQA 5J1ZA 2FMMA 4IFDJ 3FEWX 3EVQA 3NWSA 5JJZA 1HTPA 2KJXA 4TRDA 5JVH3 5FO9B 3O13A 3QJYA 3G6JB 3LX0A 1LTBD 3TMEA 2A68D 4K8JA 1DOMA 2B39A 3S1MB 2B2WC 4C3IB 2CW0D 3P1HA 1KDBA 3MC0B 1G6ZA 2JEAI 5CC4A 1Z6HA 1WTRA 2N55A 1MSHA 5M9OA 3SEBA 1SDFA 5J22A 3JAML 5TSSA 3X3NA 2WP8J 2RDFA 3NTHA 1MBYA 2WKDA 2XIWA 4RA8A 4C3JG 3VYRA 5CV6A 2EJMA 2XWBB 1E0BA 1SYDA 5D14A 1ML0D 2X6GA 1D5XC 3VYTA 4DAPA 3K5OA 3OOCA 2EJGC 2EZVA 1HRJA 2G9DA 3FKIB 3NK9A 3OWEB 3BDCA 3IL8A 2E2JB 5EPLA 4NMZA 1JQYD 5JOBA 2A6HC 1E2WA 4KJNA 3SK8A 2B2YC 2WINB 1TY0A 4XQNA 3A8JE 2R7ZB 3J7YW 2BDOA 2XRQD 3R8BA 1PDQA 1WTQA 4JBWA 3FPPA 5IGFA 2K5DA 5I9PA 3HGBA 3ONAB 1W6KA 1LT4D 3E5SA 2RKSA 4KI0A 4ZUIA 1FGBD 1Q1EA 2JP1A 3TP8A 3MXPA 2NB0A 4RKLA 2PW5A 1EEID 1M4VA 5KIXA 2B2VC 4OGQC 4A3GB 2XWJB 1SYGA 2NTTA 1YNND 3CQZB 3EA6A 3GD7A 1WTVA 3Q0AA 4IUTA 2M2LA 4UDUC 3GTOB 1PRTF 3R2IA 3MFYA 4IUUA 3PUYA 4K6LA 4R8IA 1CFMA 1TR5A 2ICEC 4XQJA 4TQUS 1EIGA 1LTSD 1D1IA 3AMUA 1TS5A 2A68C 2AQ1B 3EJIA 1KLUD 3RLFA 2G9HD 3HOXB 2Q8RE 2KEEA 1S5BD 3LNNA 2CW0C 4PMCA 5G3LD 1PTOH 1SAPA 4Z9CB 4KHVA 4LK1C 3ERQA 1K8MA 1G2TA 4OHJA 1DONA 4HN7A 1PZID 3GTQB 4XT1B 2IX1A 2Y0SB 4QMGA 1STYA 5C5MA 2LFNA 2EYJA 3CRKC 3GV3A 3NHHA 1ESRA 3GTJB 3I8ZA 3WOFA 1F9QA 5I2XA 2PW7A 3HOYB 1TS4A 2E2DC 4IQZA 1CQFA 4CKBA 3H0GB 2YU9B 4IURA 2Q8IB 1Y1VB 3HOVB 5DEHA 5C4JB 2DNCA 2CHBD 2WACA 4KTAA 3OIQA 3T56B 1O78A 3OIPA 1VDZA 1FR3A 2F3VA 2HCCA 3VYUA 4DAVA 1LV9A 2KECA 4RGTA 3SK6A 4FYDA 4OL7A 5FLXE 4IZ8A 4ILWA 3D4WA 3K0YA 4O42A 2K6AA 1D6EC 5M5XB 1FD7D 4ULLA 4C1NK 1STGA 1Z47A 4H7BA 2F0QA 1I4GA 1MSGA 1K83B 2EOTA 5LL6X 2OF1A 1SXTA 2BE5C 2AUKA 1LABA 4BBSB 4U68A 2Z8LA 1QE6A 3CKIB 4DAYA 2SNSA 4BS9A 4RCOA 1B1ZA 5A35A 2PQEA 1RDPD 1HXYD 1GUOA 1XWEA 1WD1A 1E2VA 5ELEA 1WD0A 5M5WB 1F9RA 2JXMB 1SNMA 3H6MA 3C1FA 3HKZB 3PV0A 5EKLA 1LACA 3BVMA 1C48A 3OMGA 1IW7D 4IUPA 3H91A 3T16A 2VNUD 3UI2A 4A3EB 1C8CA 1QWYA 1FNWA 2EY5A 3H94A 2IJ0A 2WIIB 5M3FB 3IAYA 4IFDG 3MA2B 1PZKD 5ELDA 1OXVA 3PUWA 4R8NA 1BNZA 3BDOA 4NKLA 4ZQ3A 4QIWB 1BO0A 3GV6A 1BQQT 4RH6A 2J0TD 3BS1A 2RQXA 4H0LC 5DM63 2A69D 2PZUA 3PO3B 4KY5A 2R6GA 3NP8A 4HEDA 2ZT9C 3Q24A 2O2LD 3C1EA 2E74C 2NBFA 2K33A 3Q23A 4GZYC 2A5HA 4DNRB 3J80L 3GTPB 2XVSA 3K7AB 1JC7A 4RKBA 5C0XH 1WCMB 5IIFA 4WRDA 1V1PB 1CQVA 1GXDC 5CORA 1V1OA 4PQXA 1KNEA 1SNQA 2QILA 3K57A 2NTSA 2EJFC 1FNUA 4FF1A 1STEA 2K04A 2L5TA 1AW7A 4BA1I 1G8ZD 4XT3B 3A56A 4DNTB 2L1BA 3HG9A 4PMWA 3VR4A 3MXUA 5IT9E 3GTLB 3H09A 1KDAA 1LO5D 1BCPD 2R3ZA 3T4AC 1XTCD 2B2UA 3FPUB 5I6WA 5EKKA 4LMQD 4DXFA 2JA6B 1ZKOA 1HFNA 4XIGS 4O1NA 2L9HA 2YYZA 1DOLA 2IPKD 3Q6SA 2SEBD 3FRPB 2F0JA 2LY7A 1A15A 3DEOA 2EYMA 4BBRB 5KEEA 3TP5A 1HPCA 1U4LA 5FO7B 2KCCA 3DUZA 1UNSA 5BN4A 4YIJA 2EDGA 3HZXA 3J81L 4A3IB 3LWEA 1CTMA 1RD9D 1O80A 2F3WA 2A73B 1SYCA 2F0MA 4FXDA 2IWHA 1YNJD 4KKTA 4HR7B 2K5WA 1Q90A 2L4NA 4BY1B 3Q22A 1IW7C 3OHXC 2K1BA 5EQ0A 1JR0D 5EBCA 1OXTA 1QNUA 3HEJA 3K5LA 5JPNC 4DGZA 4X3TA 4IALA 3VA5A 3K59A 1CHQD 1SNPA 5CR3A 2XSCA 2F0EA 2K05A 1EEFD 1KDCA 1MD2D 2L12A 3BVGA 1PMRA 3GP7A 5IGBA 1GOZA 1X3PA 3A8IE 2A69C 3MTSA 3MWYW 4G4KA 1CT1D 1XYIA 4BWGB 5DM73 4G7HC 2KQ3A 4K5XA 3C3LA 3URYA 2TMPA 1C4QA 2SNMA 4K6DA 3WDNA 2ICIA 1B9MA 4A3KB 3SVMA 1Q12A 1A3VA 1IKMA 2F0LA 1HQRD 1JWUD 5C3EB 1WTXA 2R93B 4OO1H 1DD2A 2L55A 4FF4A 3E0JA 1PTOF 4ME5A 2KUMA 1TVXA 5J39A 3VR6A 1NUCA 1JORA 1I4PA 2AWNA 3RUZA 1BCPB 3D8GA 1ONLA 4KY6A 4DU9A 1DM0B 2I46A 2XRSD 4ABNA 4AYBB 2O5JC 1EY9A 1IYVA 1IYUA 2F1MA 1BCPC 3S1QB 4OO1I 2ZXOA 5ELFA 2MUYA 1B9NA 1Y8NB 5KRUA 5T1GA 1KABA 2F0OA 3IFTA 4HCEA 4C3HB 1QILA 1PFMA 1I4HA 2R92B 4DK0A 3I72A 1EY0A 2C5CA 2K7VA 5FO8B 5DAUA 3EFXD 5CBEE 4K5VA 3TBIB 1W6JA 4M8AA 1SE2A 3M7NA 2D2CC 3HOWB 3TDQA 2PPBC 1S5ED 2SDFA 2F0NA 1RTNA 4JK1C 5EKIA 3NPPA 2EYPA 1EWHA 2RBMA 3NTIA 5ELBA 4EQOA 3I70A 4QF4A 4RHSA 4CBVA 1LT5D 4Q0FA 1YNJC 2EY2A 2F0WA 1R4QB 2KCNA 3VR5A 1QNKA 2A6ED 1S5CD 1QJOA 5C3XA 4I65A 3KLRA 4WORA 3VA7A 5K36G 4HTHA 1F2MA 1STHA 3J7AF 2ZXRA 4V0BA 5I6YA 2MHVA 5I9OA 1ILQA 4KY7A 3V96A 2E76C 4PNYA 1RF2D 2IL8A 4ZK9B 1ZEQX 3QOJA 4EQPA 1WTOA 1TWFB 1ICWA 2B8GA 1TWAB 1SSOA 1TIID 3RD4A 2NN6G 4F87A 3VR3A 4IUNA 1G91A 2F0GA 3QOLA 1J8IA 2E75C 4CHTB 2KA7A 3L9AX 1STBA 3S17B 1WTWA 1V8QA 2AQ3B 2DY7A 2KVMA 2RSNA 3M4YA 1L0XB 1HA5A 4CJ1B 5EPKA 2O5IC 1AP0A 4DF7A 1ZXTA 3GTMB 1G291 1JICA 5LHY1 4ZKCB 3S16B 3SR1A 2F4IA 1FNVA 5CV8A 1OXSC 4A3BB 2H1EA 5I2YA 5A2QE 4RCNA 1WTPA 2EPBA 4C3HG 2NWGA 1CZGA 1Q8IA 4BA2I 1OXUA 4IN3A 2PCFB 2EYLA 4IUVA 2WB1B 3P20A 1BBXC 2LKVA 2JYOA 3U9OA 4G7OC 2XNAC 1DCZA 1F2ZA 1ZYRD 1D5MC 3M4OB 3M85A 3T53B 1MGSA 4DN4M 2JA5B 4A3JB 3D6WA 1NAPA 2KHSA 3CU7A 3MFGA 4XXEA 4Y7NB 4C56C 2X69A 5EBDA 4FF3A 1EOTA 3DWAA 3PMFA 2J4XA 2KEDA 3S9WA 4KMUC 2X6LA 4RWSC 1PRTD 2ZXPA 3W3AA 4TKOB 2BA0A 1Y8PB 5JEAG 2HDMA 3E6ZX 4K8IA 1PFNA 1KAAA 1YNNC 2QKIC 3BYYB 4XDXA 1S5FD 5C6AA 1WVLA 1LTRD 4TSSA 3DWPA 1EYDA 1RHPA 1SYFA 1EZ8A 4RAUC 4HSPA 4RFBA 1FYCA 1ET9A 3OPOA 4HMJA 2E2IB 2D5DA 3HP3A 4F8MA 2QF7A 5EPJA 3KK7A 5KYLA 4V190 4DFAA 3K5NA 1TWHB 5C0XJ 1RCVD 4DXGA 4DK1A 1H9SB 4KN7C 1I6HB 4MHEA 3SK5A 2IW3A 1IHZA 2K03A 5IGGA 2IX3A 4NP5A 1TS3A 3C46A 3D31A 1LTAD 4G57A 1ENCA 5ISRA 1MI2A 4H44C 4HMIA 4BY7B 1HTLD 5CBAE 1B3AA 5KGUA 1HUMA 3GQBA 2WKCA 1CZWA 4N9PA 4ZUJA 1O7LA 5E4WC 1ESFA 2B2TA 4IUQA 1A2UA 3AU7A 2EY1A 5D3IB 3RZOB 1EQVA 2NVTB 4EVOA 2B2UC 2TSSA 5FLXL 1BOSA 1EU4A 2AWOA 1SEBD 2J7ZA 4J1MA 4B08A 2B63B 3NXWA 1JOOA 1A2TA 1DJRD 1II3A 3GO5A 1LLRD 1TS2A 1VF5C 2E2HB 1CI3M 1IL8A 1L0YB 3D4RA 3QWNA 1H9SA 1B2TA 1I4RA 3J7AV 4K5WA 1NR2A 1PZJD 4J8QA 1D1KA 1T5XD 2F0IA 1ZYRC 5EJWA 3I91A 4NW2A 5D65A 2M00A 1NCVA 2I07B 3SHLA 3DWQA 1RODA 2PNRC 3TN2A 3OW7A 1A3TA 1I3QB 1KTKA 4HAEA 1JCKB 4L8JA 4CJ2C 4EGVA 3JAME 3AB9A 3X3MA 2NVQB 3EROA 1PRTB 2NVYB 5BN5A 3SXHA 1BF4A 4C1NI 4ZRZA 2QEJC 4CGYB 1QG7A 1JWSD 3ND9A 1K8OA 3FMCA 1A3UA 1X3QA 1PRTC 2SOBA 2F0TA 1J9OA 3FVQA 2EVBA 3RZDB 4HCSA 5COYA 1HCZA 1SNCA 1PFBA 2H4OA 3KLSA 1I4QA 4R9WA 1F2LA 1ENFA 1SBBB 1BXTA 4L63B 1IKLA 1RKNA 5C4HA 1R9TB 1VCIA 5ELCA 2Z4IA 5C5LA 4F88A 3KUPA 3MHBA 4FP5D 5E4XA 1SJED 4CKEA 3PO2B 1F77A 3D4DA 1R4PB 2K32A 1TWCB 2VXWA 2JA8B 1F9PA 2GA4B 2D9UA 1Q3LA 2WV6D 1GUTA 2ID0A 5JEAH 4FVMA 1A6XA 2KOLA 3NSWA 1O7YA 1KLGD 2NZ1D 1JB3A 1EIHA 3VR2A 2K5QA 4WJWA 1AZPA 5AFWA 5FOBB 3IFDA 4A3FB 2CQAA 5C4ZA 3BYTB 5EGTA 4XQQA 1S5DD 2BDNA 5T1IA 2F0VA 3G7LA 1EFID 4U673 2MP1A 4KJOA 5IT9L 4QB4A 2RDGA 2OEOA 1M8AA 4QCLA 1U4PA 1GUWA 3T51B 1HHVA 4RGOS 5G3LF 1LTTD 3TSSA 4CJ0B 3MAQA 4IFDH 1EYAA 4K2KA 2RDHA 5FKAC 1PLFA 1QCBD 3QB3A 4MN3A 3A8KE 5CMDA 1XXGA 2NUCA 1LT6D 2IT1A 1UEAB 2RVLA 4FF2A 2JEBI 5D3DA 1B4OA 2B2WA 2AUJD 1EY7A 4IFDI 2JA7B 3DM1A 5C3WA 3V05A 3NE5B 3TP7A 3WOEA 2MJ8A 3IKJA 3QG1A 1XX8A 2NYZD 1G2SA 1VF7A 3PUXA 2C9OA 1U4MA 5KNCA 2V4DA 4QUFA 3N6RA 1PXUA 2DN8A 2F0SA 4XTCS 1CM9A 2RA4A 3A7AB 2L0CA 3NQIA 2EE1A 3D6CA 4G7ZC 4LJZC 1DYQA 4KKSA 1JOKA 1SE4A 4KV6A 2PZTA 3QIAA 2O4XA 2M9VA 3KLSX 4HSVA 2BE5D 2F0DA 5FK9C 5HGTA 1JE4A 2K01A 1Y1WB 3S1NB 4K2LA 1JWMD 3PIO3 4J6HA 1SNOA 1TKWB 2CVRA 2EYFA 3R93A 2PYKA 2B2YA 2FMCA 2HDLA 4UAIA 3NQTA 5KYIA 4KHZA 2DNEA 4C3IG 1CK1A 1Y69U 2MPMA 2PMZB 5IOCA 2VUMB 4OIJA 3MXGA 4CKCA 4ZAIA 3TP6A 3ITPA 3K6OA 1B53A 3R2TA 5C0XG 1Z7TA 3HOZB 1OO9B 2QDBA 2EY6A 1GHJA 4EQNA 1EYCA 1PTOD 1QB5D 4LAAA 1UAPA 2Z1CA 2B2VA 4Q5VA 5E3FA 4DA2A 3K5MA 3N52A 5JPMC 4WFN3 2WAQB 4B9WA 5IGCA 1F2YA 2PO4A 1OXXK 3TZDA 1SNDA 3D3RA 4FNFA 1D5ZC 3SE0A 2HQEA 1AEXA 5CV4A 4E6IA 2JE6I 2QCPX 2Z4HA 3L3OC 3KBGA 4FXGC 1KNAA 3NUCA 2LMCB 3BZDB 1NSNS 2ENBA 2F0KA 3A54A 2JSOA 3VYSA 4MIUA 2L11A 1AN8A 4RHRA 2AQ2B 4KD4A 2F0UA 1EY4A 3SK4A 1JOQA 4B9XA 3I4LA 4S3SA 2N88A 3S1RB 3OWFA 3R3OA 1CHPD 5I4DA 2FHTA 4RGMA 5CYUA 4KK7A 4A3MB 1GUNA 3J80E 1LTGD 1EU3A 4QUCA 1SE3A 5IGEA 3BDLA 4ZLTF 5DNFA 3I3CA 1ENAA 3OMCA 3S2DB 1EY5A 1EWCA 4KD3A 1CA6A 1TQOA 4A93B 5M5YB 3MEHA 1TY2A 4N9TA 3PUZA 3SDZA 1STAA 4PV1C 3MVVA 1S4ZA 3NTKA 3BVZA 1AZQA 1CA5A 1B50A 1SMYD 5F2DA 3I73A 5E1FA 4ZYSA 2FFKB 5K5PA 4KN4C 1BCPF 5JVG3 3P75A 1VMPA 1ET6A 2EXZA 5HURA 1GJXA 1PYWD 1TU2B 2B2TC 3PIP3 4OIKA 2A6EC 2EYOA 1DXMA 2OT2A 1T5EA 3C2PA 4PMBA 1LT3D 3W2DA 3TZUA 1U4RA 5JAVA 2F0FA 4X3SA 2BOSA 2BCOA 3QO2A 5KNDA 3M7GA 4KKUA 5CV9A 1AFPA 4XYOA 4P2CB 1BDOA 3DEPA 2F03A 1EZ6A 1DZ1A 1QOHA 2A74C 4FXKC 2R61A 2NVXB 1PTOB 4H13C 3GTKB 1TWGB 1H9JA 4M1UB 1DOKA 2Q8TA 1BR9A 4OO1G 3M3YB 3PUVA 1NR4A 1BUVT 1PTOC 2LS01 5A2QL 3NBIA 3J81E 3MXNA 1EL0A 1I4XA 2MGSA 1EY6A 4RGNA 3P7JA 5C4XB 1U9RA 3HOUB 2HUGA 5K36H 4F7XA 1SFOB 5C44B 1D2BA 1VMCA 1E2ZA 1F9SA 1Y8OB 5M3MB 2F0PA 5CGKA 4XYQA 1TT2A 1GHKA 4I7ZC 1B44D 2OXPA 3FDTA 3I90A 2D62A 4L6TB 4ZKBB 3K58A 1HQMC 3T13A 3V2TA 5BN3A 3A7LA 3BG3A 1I6VC 2NN6H 3S14B 5IODA 1RTOA 2HCIA 3KBXA 3KF8A 2FJ2A 1O7ZA 1SYEA 1GUGA 4ODGA 1Q1BA 3A55A 3MZ5A 3H3VC 3ZYYX 1LTID 4K14A 3S15B 3CHBD 1V43A 2EYHA 5KNBA 4NDXA 3I4NB 1SYBA 2BA1A 5CV5A 1H9RA 2VB2X 1ILPA 4C3JB 3U9SA 2FINB 5CV7A 3NBHA 2A6HD 5C0XI 3HRZC 3F2UA 2NN6I 2K28A 3RMHA 3S2HB 1SJHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOS A;  4P2C B;  1CZW A;  1R4Q B;  1R4P B;  1CZG A;  1DM0 B;  1CQF A;  1QOH A;  4ULL A;  2XSC A;  1D1K A;  3MXG A;  1C4Q A;  2GA4 B;  1C48 A;  1QNU A;  2BOS A;  4M1U B;  1D1I A;  2C5C A; 
#chains in the Genus database with same CATH topology
 1HFG A;  3CRL C;  1I50 B;  4A3D B;  1G51 A;  3ND8 A;  1UUP A;  1RJT A;  5IYC G;  4LF6 Q;  1EQT A;  4AIM A;  4C3H H;  1XNQ Q;  5IT9 c;  1EY8 A;  4A4I A;  1H9K A;  3EIV A;  5JEA J;  1SMY C;  2R92 H;  1HA6 A;  1C9O A;  3DXJ C;  2RSO A;  3RR5 A;  4X3U A;  5ELO A;  3BZC A;  3HS0 C;  4P75 A;  4C2M B;  2IX0 A;  2DY8 A;  1V1P A;  2Q2H A;  1HUN A;  5IGD A;  3LWU A;  5LL6 S;  3HOW H;  3JAM c;  4DNI A;  2VB3 X;  1X32 A;  3GTG B;  3NWT A;  4X3K A;  2F0H A;  4JI4 Q;  3DMU A;  3OSO A;  1XMO Q;  2PZW A;  3L7Z C;  4L5S A;  1H9M A;  2XN9 C;  3EN2 A;  4ID6 A;  3I4M B;  2B8F A;  5NUC A;  3EQL C;  5M3F G;  1STN A;  1X55 A;  1GUS A;  4FO2 A;  3DHQ A;  5J1Z A;  2FMM A;  3HFZ B;  4LF5 L;  4IFD J;  4DPG A;  4YY3 L;  1HZC A;  3FEW X;  3EVQ A;  3NWS A;  5JJZ A;  3HOU G;  1HTP A;  2KJX A;  2RCF A;  4TRD A;  5JVH 3;  1V9P A;  5FO9 B;  2UUB Q;  3O13 A;  4A3C G;  5HGQ A;  4LWC A;  3QJY A;  4X64 Q;  3G6J B;  3LX0 A;  1LTB D;  3CP0 A;  2VUM H;  3TME A;  2A68 D;  4K8J A;  1DOM A;  4OX9 L;  2B39 A;  1VQI A;  3S1M B;  4GKJ L;  2B2W C;  4C3I B;  1TWF H;  2CW0 D;  3P1H A;  1TWA H;  3G48 A;  5AJ3 L;  1KDB A;  1HR0 L;  3MC0 B;  4DV5 Q;  3CPF A;  3G4S A;  4RG1 A;  1L2F A;  1G6Z A;  2JEA I;  5CC4 A;  1W2B A;  1Z6H A;  3KOJ A;  2EIF A;  1MJC A;  1WTR A;  2N55 A;  5FLM H;  3U58 A;  1PH5 A;  1MSH A;  5M9O A;  3SEB A;  5H1S E;  2Z0S A;  1SDF A;  5J22 A;  3AFP A;  1XPR A;  3PCO B;  1EOV A;  3S17 H;  3JAM L;  2CKZ B;  5TSS A;  4JI1 Q;  1SRO A;  3X3N A;  3I4N G;  2WP8 J;  2PI2 E;  2RDF A;  4LFA L;  3L2P A;  3NTH A;  1MBY A;  2WKD A;  5GQO A;  2XIW A;  4RA8 A;  4C3J G;  3VYR A;  5CV6 A;  3OTO L;  2EJM A;  1XPU A;  2XWB B;  1IXR A;  1E0B A;  1SYD A;  2VZA A;  5D14 A;  1ML0 D;  2X6G A;  1D5X C;  2CWA A;  3S16 H;  1AE2 A;  3VYT A;  4DAP A;  3K5O A;  4UPA A;  3OOC A;  2EJG C;  2EZV A;  1HRJ A;  2G9D A;  3AQQ A;  1YI2 A;  3FKI B;  3NK9 A;  1E24 A;  2N78 A;  3OWE B;  3BDC A;  1YBY A;  2JK8 A;  2UXD Q;  3IL8 A;  2E2J B;  4GNX C;  5EPL A;  1ICF B;  5ELN A;  4GS3 A;  4NMZ A;  4DV4 L;  1JQY D;  1DGS A;  2B3G A;  4LF4 L;  5JOB A;  2A6H C;  1E2W A;  4KJN A;  2MO0 A;  3SK8 A;  2B2Y C;  2WIN B;  2CQO A;  4JG2 A;  1TY0 A;  3M4O H;  4XQN A;  2Z9H A;  3A8J E;  3T1H L;  2R7Z B;  3J7Y W;  2BDO A;  3M4Q A;  2XRQ D;  3R8B A;  1PDQ A;  2JA5 H;  1G6P A;  1WTQ A;  3S1R H;  4JBW A;  4A3J H;  3FPP A;  4OEM B;  4NXM L;  1VQJ A;  5IGF A;  2K5D A;  4A76 A;  5I9P A;  3HGB A;  3ONA B;  4A3M H;  4JI0 Q;  1W6K A;  3I4M G;  1LT4 D;  1E1O A;  3E5S A;  2RKS A;  4KI0 A;  4Y7N H;  4ZUI A;  1FGB D;  1Q1E A;  4YWM A;  2JP1 A;  3TP8 A;  3MXP A;  3S2D H;  2NB0 A;  4JI2 L;  5LMU L;  4RKL A;  4A93 H;  2PW5 A;  1WJJ A;  3MEF A;  2YTY A;  1EEI D;  1M4V A;  4QL5 A;  1VQG A;  5KIX A;  2B2V C;  4OGQ C;  4AYB E;  4A3G B;  2XWJ B;  1SYG A;  2NTT A;  1YNN D;  4X65 Q;  3CQZ B;  3EA6 A;  3GD7 A;  1WTV A;  3Q0A A;  1XMQ Q;  2OQK A;  4IUT A;  1P16 A;  2M2L A;  4UDU C;  3KDF A;  3TRE A;  3GTO B;  2E2I H;  2L15 A;  1PRT F;  3AFQ A;  1FL0 A;  3R2I A;  1PFS A;  3MFY A;  4IUU A;  3PUY A;  4K6L A;  4JI3 L;  4R8I A;  1X6O A;  1N32 Q;  5IYC H;  2KEN A;  1CFM A;  1TR5 A;  1YHQ A;  2ICE C;  1TWH H;  4XQJ A;  1KL9 A;  4TQU S;  1EIG A;  1LTS D;  1D1I A;  3K7U C;  3I55 A;  3AMU A;  1Q7Y C;  3KLW A;  1I6H H;  1TS5 A;  2A68 C;  2AQ1 B;  3EJI A;  1KLU D;  3RLF A;  2G9H D;  3HOX B;  2Q8R E;  2KEE A;  4A3K G;  1N34 L;  1S5B D;  1N36 L;  3LNN A;  2CW0 C;  4PMC A;  4I7A A;  5G3L D;  1PTO H;  1SAP A;  2N8N A;  4Z9C B;  3GTK H;  4KHV A;  4LK1 C;  4BY7 H;  3ERQ A;  1K8M A;  1G2T A;  4GOP B;  1U0L A;  4OHJ A;  1DON A;  4HN7 A;  1PZI D;  3GTQ B;  4XT1 B;  2KCT A;  2IX1 A;  2Y0S B;  4QMG A;  1STY A;  5C5M A;  1S72 A;  2LFN A;  2EYJ A;  3FKI G;  2UUC L;  3CRK C;  2MO1 A;  3RZO H;  3GV3 A;  2V1C C;  3NHH A;  1ESR A;  4IPG A;  2JN4 A;  5C4X H;  3GTJ B;  3I8Z A;  3WOF A;  4HIK A;  5IYB G;  1F9Q A;  1SFO H;  5I2X A;  5C44 H;  2PW7 A;  4BXX G;  3HOY B;  1TS4 A;  4QY7 A;  2E2D C;  1RIP A;  2PQA B;  4YCV A;  2PMZ E;  5M3M H;  4IQZ A;  4R1J A;  1CQF A;  2OTL A;  2FXQ A;  4CKB A;  4DAY B;  2B63 H;  2R7Z G;  3H0G B;  2IHF A;  2YU9 B;  4IUR A;  2Q8I B;  2NZO A;  1Y1V B;  3HOV B;  5DEH A;  5C4J B;  2DNC A;  1K73 C;  2E2H H;  2CHB D;  5DLQ E;  3UDG A;  2WAC A;  2A1A A;  1PHJ A;  1X3G A;  4KTA A;  1A8V A;  2K75 A;  3OIQ A;  3T56 B;  3K80 C;  3H3V H;  1O78 A;  3OIP A;  1VDZ A;  1VQ9 A;  1FR3 A;  3A74 A;  2F3V A;  3S14 H;  2HCC A;  3VYU A;  4DAV A;  1QVF A;  2UUB L;  1LV9 A;  2KEC A;  1AH9 A;  4RGT A;  1VQ7 A;  3UE0 A;  4X64 L;  3SK6 A;  4FYD A;  3M4P A;  4OL7 A;  5FLX E;  4GOP A;  4IZ8 A;  4ILW A;  4O0A A;  4HJ9 A;  1I3Q H;  3D4W A;  3K0Y A;  4O42 A;  5IY0 A;  2WAQ E;  4MZ9 A;  2K6A A;  1D6E C;  5M5X B;  4C3J H;  4A3G G;  1FD7 D;  4ULL A;  4C1N K;  2NVY H;  2DGY A;  1H95 A;  2LXJ A;  3H3V I;  2H5X A;  4DV5 L;  1STG A;  1Z47 A;  4J15 A;  3U4V A;  4H7B A;  4HJ8 A;  4A3L G;  2F0Q A;  3S24 A;  3S2H H;  4MTK A;  1I4G A;  1MSG A;  2LSS A;  1K83 B;  2EOT A;  4DV2 L;  5LL6 X;  2OF1 A;  2DJF C;  1SXT A;  2HHH Q;  2BE5 C;  1I50 H;  2AUK A;  1LAB A;  4A3D H;  4BBS B;  1HZB A;  4CDF C;  4U68 A;  4PZ6 A;  2Z8L A;  1QE6 A;  3CKI B;  4YCW A;  4DAY A;  2SNS A;  4BS9 A;  4RCO A;  1VQB A;  3RZD H;  1MJE A;  4DR4 Q;  1B1Z A;  5A35 A;  5BR8 L;  2PQE A;  1RDP D;  1HXY D;  1GUO A;  1XWE A;  1NE3 A;  1WD1 A;  4JI5 Q;  3HOX G;  4DR5 L;  1E2V A;  5ELE A;  1WD0 A;  1QVC A;  5M5W B;  1F9R A;  3STB C;  2JXM B;  1SNM A;  1UE6 A;  3H6M A;  3C1F A;  3HKZ B;  3PV0 A;  1A62 A;  1IBM Q;  5EKL A;  1R9T H;  1LAC A;  3BVM A;  1C48 A;  3KF8 B;  3OMG A;  4HID A;  1IW7 D;  2Y0S G;  4IUP A;  3H91 A;  1EUJ A;  3T16 A;  2VQF Q;  2QA4 A;  3CPW A;  2VNU D;  3UI2 A;  4A3E B;  1L1O B;  1C8C A;  1QWY A;  4AQY L;  1FNW A;  2EY5 A;  3H94 A;  2IJ0 A;  2WII B;  5M3F B;  3IAY A;  4LF7 Q;  1TWC H;  1PZK D;  3MA2 B;  5ELD A;  1L0W A;  2JA8 H;  4IFD G;  1OXV A;  3PUW A;  4LFB L;  4R8N A;  1BNZ A;  3BDO A;  4NKL A;  4ZQ3 A;  4QIW B;  1BO0 A;  3NBH B;  1L1O C;  4LF9 Q;  3GV6 A;  1BQQ T;  4RH6 A;  2J0T D;  3BS1 A;  3BJU A;  2RQX A;  1C7Y A;  4H0L C;  5DM6 3;  4JI0 L;  3H0G G;  4B3R Q;  2A69 D;  2PZU A;  3PO3 B;  4KY5 A;  2R6G A;  3S1M H;  2N3S A;  3NP8 A;  4C3I H;  3HOV G;  4HED A;  2ZT9 C;  4YWK A;  4A3B G;  3Q24 A;  2O2L D;  1UE7 A;  3C1E A;  2E74 C;  2NBF A;  4DUY L;  2K33 A;  1NMG A;  1XNR L;  4NPS A;  3Q23 A;  4GZY C;  2A5H A;  4DNR B;  2MNA A;  3J80 L;  3GTP B;  2VQE L;  5JJL A;  2WB1 G;  2XVS A;  3K7A B;  1JC7 A;  3RNU A;  2HIX A;  4RKB A;  5C0X H;  1WCM B;  5IIF A;  4WRD A;  1V1P B;  1CQV A;  4X62 Q;  3J81 c;  1GXD C;  4O2D A;  5COR A;  1V1O A;  1IYJ B;  4PQX A;  3CCL A;  5JJK A;  1KNE A;  1SNQ A;  2XTI A;  1VQP A;  2QIL A;  3K57 A;  2NTS A;  3A0J A;  2EJF C;  1FNU A;  4FF1 A;  3U4Z A;  3KJO A;  1STE A;  2UXC Q;  2K04 A;  2L5T A;  1VQ8 A;  1AW7 A;  4BA1 I;  1G8Z D;  4XT3 B;  4UY8 C;  3A56 A;  4DNT B;  2E5L L;  5E7N A;  2L1B A;  3HG9 A;  4POF A;  4PMW A;  3VR4 A;  3MXU A;  1B7Y B;  5IT9 E;  3FKI H;  3GTL B;  3H09 A;  1KDA A;  1LO5 D;  1BCP D;  2R3Z A;  3T4A C;  1IBL Q;  1XTC D;  2K50 A;  2B2U A;  3FPU B;  5I6W A;  4JBK A;  4TVA B;  5EKK A;  4LMQ D;  4DXF A;  3JAM i;  2JA6 B;  1ZKO A;  1HFN A;  4XIG S;  4O1N A;  2L9H A;  2YYZ A;  2OTJ A;  1DOL A;  2IPK D;  2ZJR A;  3Q6S A;  3ULP A;  2SEB D;  3T1Y Q;  3FRP B;  2F0J A;  2B29 A;  1A15 A;  2LY7 A;  3DEO A;  2YV5 A;  3PIO A;  1X9N A;  5IP7 G;  3HKZ G;  2EYM A;  3F1Z A;  2OCE A;  4IO9 A;  4BBR B;  3I4O A;  2K4K A;  3J81 j;  5KEE A;  1SLJ A;  3TP5 A;  2OQ0 A;  1HPC A;  1U4L A;  3DLL A;  5FO7 B;  2KCC A;  3DUZ A;  1XPO A;  4EX5 A;  1N8R C;  4OWW B;  1UNS A;  4A3E G;  5BN4 A;  4YIJ A;  2EDG A;  1YJW A;  3HZX A;  3J81 L;  1Q81 C;  4A3I B;  3KFU A;  5GAD C;  2Z6K A;  1CTM A;  3LWE A;  1RD9 D;  1O80 A;  2F3W A;  4LW1 A;  2A73 B;  1SYC A;  2F0M A;  4R4T A;  4FXD A;  1D7Q A;  2IWH A;  1YNJ D;  4KKT A;  4HR7 B;  5IWA L;  1Y1W H;  1FJG L;  3S1N H;  2K5W A;  1Q90 A;  2L4N A;  4BY1 B;  3Q22 A;  1IW7 C;  1KHI A;  1KAW A;  3OHX C;  2K1B A;  5EQ0 A;  1JR0 D;  1GD7 A;  5EBC A;  3CQZ H;  3PO3 G;  1OXT A;  1QNU A;  2I5M X;  3HEJ A;  3K5L A;  5JPN C;  4DGZ A;  4X3T A;  4IAL A;  3VA5 A;  4JV5 L;  3D0F A;  3K59 A;  1CHQ D;  1SNP A;  5GAH C;  2JA9 A;  5CR3 A;  2XSC A;  2F0E A;  4OEL B;  3CXC A;  4NB3 A;  2K05 A;  2DUD A;  1EEF D;  4DR7 L;  1KDC A;  1MD2 D;  2L12 A;  2AMC B;  2CH4 W;  4OXP A;  3BVG A;  4DV0 L;  1PMR A;  3CF5 A;  3GP7 A;  1WCM G;  3IRB A;  5IGB A;  3HOZ H;  1GOZ A;  5EAY A;  1X3P A;  3K81 C;  3A8I E;  2A69 C;  3MTS A;  2HQL A;  3MWY W;  4LFC L;  1K8A C;  4G4K A;  1CT1 D;  3RN5 A;  1XYI A;  4BWG B;  5DM7 3;  4G7H C;  2KQ3 A;  3E9I A;  4B3T L;  4K5X A;  4GKK Q;  3C3L A;  1S3O A;  3URY A;  2TMP A;  1C4Q A;  1XTD A;  2SNM A;  1KRS A;  4K6D A;  3WDN A;  2ICI A;  1B9M A;  4A3K B;  2IY5 B;  3SVM A;  1Q12 A;  1A3V A;  5IP9 G;  1IKM A;  2F0L A;  4LF8 Q;  1HQR D;  1JWU D;  5C3E B;  1UWV A;  1WTX A;  3CAM A;  1LTL A;  2R93 B;  1BBW A;  4OO1 H;  1DD2 A;  2L55 A;  4FF4 A;  3E0J A;  5IYD G;  1PTO F;  3CCE A;  4JI5 L;  4ME5 A;  2KUM A;  1FVI A;  1PH1 A;  1TVX A;  2PI2 A;  5J39 A;  3VR6 A;  2E8G A;  1NUC A;  1X65 A;  1JOR A;  1I4P A;  4CDD C;  3HOY H;  2AWN A;  3RUZ A;  1BCP B;  3D8G A;  2JA6 G;  1ONL A;  1HNW Q;  3ERS X;  4KY6 A;  4DU9 A;  2YU9 H;  1DM0 B;  3KDF B;  2I46 A;  1PH8 A;  2XRS D;  4ABN A;  1HR0 W;  4WJ3 M;  4AYB B;  3UDF A;  3UE1 A;  2O5J C;  1EY9 A;  1Y1V H;  1IYV A;  1IYU A;  1U5K A;  4BBR G;  2F1M A;  1BCP C;  3S1Q B;  4OO1 I;  2ZXO A;  1IL2 A;  5ELF A;  2JJQ A;  1CKN A;  1NJI C;  4LF7 L;  2MUY A;  1VQO A;  1B9N A;  1Y8N B;  3K8A A;  5KRU A;  5T1G A;  1KAB A;  4GLX A;  1XJV A;  4JPB W;  4A3I G;  2F0O A;  3IFT A;  4HCE A;  4X6A H;  4C3H B;  1I94 Q;  1QIL A;  1PFM A;  1WOC A;  1I4H A;  4B3R L;  2R92 B;  4DK0 A;  3CCJ A;  3PIP A;  3I72 A;  1EY0 A;  4JI8 Q;  2C5C A;  2K7V A;  5FO8 B;  1KIX A;  5DAU A;  5FJ8 H;  3EFX D;  1JB7 A;  5M5Y H;  2LXK A;  5CBE E;  4K5V A;  3TBI B;  1W6J A;  4M8A A;  1SE2 A;  4BY1 G;  3M7N A;  2D2C C;  1HNX Q;  3HOW B;  3TDQ A;  4ALP A;  3CCS A;  2PPB C;  1K0R A;  4DR6 Q;  1S5E D;  4DV6 L;  1GO3 E;  3JC6 6;  4DV1 L;  2SDF A;  1Q82 C;  2F0N A;  1RTN A;  4JK1 C;  3PO2 G;  2ZM6 L;  4JI7 Q;  5EKI A;  3NPP A;  2EYP A;  1EWH A;  2RBM A;  3NTI A;  4BBS H;  5ELB A;  4EQO A;  3I70 A;  4QF4 A;  1KC8 C;  3OYY A;  4RHS A;  1Y14 B;  4CBV A;  1LT5 D;  4Q0F A;  1YNJ C;  2EY2 A;  2F0W A;  1R4Q B;  5LMN L;  3UDI A;  2KCN A;  2Q2U A;  4YWL A;  1QUQ A;  3VR5 A;  1QNK A;  2A6E D;  1SR3 A;  1S5C D;  1IBK Q;  1N33 L;  1QJO A;  2KHI A;  5C3X A;  2JQO A;  4I65 A;  4B3S Q;  3KLR A;  4WOR A;  3VA7 A;  2UUA Q;  5K36 G;  1F2M A;  4HTH A;  1STH A;  3J7A F;  1UE1 A;  2ZXR A;  1VQ4 A;  1YIT A;  2CFM A;  4V0B A;  5M5W H;  2RHQ B;  4DR2 Q;  5I6Y A;  2MHV A;  1T9H A;  5I9O A;  1ILQ A;  2Q2T A;  4KY7 A;  4A3F G;  3V96 A;  2E76 C;  3SGI A;  2P5Z X;  4PNY A;  1RF2 D;  4IPH A;  2IL8 A;  4ZK9 B;  1ZEQ X;  4B3M Q;  3QOJ A;  1YNX A;  4Y52 H;  2NVX H;  4EQP A;  3J7Z C;  1WTO A;  1TWF B;  1ICW A;  1TWG H;  1S40 A;  3G6E A;  2B8G A;  1TWA B;  5C3E G;  1SSO A;  4IPD A;  1TII D;  2R93 G;  3RD4 A;  2NN6 G;  3M3Y H;  4F87 A;  4LF6 L;  3VR3 A;  5M3F H;  1XNQ L;  4IUN A;  1G91 A;  4L5T A;  4DK6 C;  2C35 B;  2MFI A;  2R7F A;  3CC2 A;  2F0G A;  3QOL A;  3RLN A;  1J8I A;  2QDL A;  4GOP C;  2HIV A;  2E75 C;  4CHT B;  2K14 A;  2KA7 A;  3L9A X;  1STB A;  3S17 B;  2BH8 A;  4NXN Q;  1WTW A;  1V8Q A;  2AQ3 B;  2DY7 A;  2KVM A;  2RSN A;  3HOU H;  3M4Y A;  1L0X B;  1HA5 A;  4JI4 L;  4CJ1 B;  4AYB G;  3M9B A;  1XMO L;  4A3C H;  5EPK A;  4JC0 A;  2O5I C;  1AP0 A;  4HJ7 A;  4DF7 A;  2HD3 A;  1ZXT A;  1VQF A;  3GTM B;  1G29 1;  1JIC A;  5LHY 1;  2JA7 G;  4ZKC B;  2ZTE A;  3SR1 A;  3S16 B;  4KLK A;  2F4I A;  1FNV A;  5CV8 A;  1OXS C;  2YTX A;  4A3B B;  1CSQ A;  2H1E A;  2K52 A;  5I2Y A;  4DUZ Q;  5A2Q E;  4RCN A;  1WTP A;  2EPB A;  4C3H G;  2NWG A;  1CZG A;  1Q8I A;  4BA2 I;  2R92 G;  1OXU A;  4IN3 A;  1JJC B;  2RCN A;  1E7Z A;  2PCF B;  2EYL A;  4IUV A;  2WB1 B;  3P20 A;  1BBX C;  2LKV A;  2JYO A;  4N8F A;  3U9O A;  4G7O C;  3BZK A;  2XNA C;  1DCZ A;  1F2Z A;  1X54 A;  1ZYR D;  4LF5 Q;  1D5M C;  3M4O B;  3M85 A;  3ULL A;  3S15 H;  3T53 B;  1MGS A;  3HOW G;  1CKO A;  4DN4 M;  2JA5 B;  3CMA A;  1WTH A;  3W1B A;  3I4N H;  2UU9 Q;  2Y0S E;  4A3J B;  3TRZ A;  4QGU A;  3D6W A;  3E0E A;  1NAP A;  2KHS A;  3CU7 A;  3PQI A;  4YHH Q;  3MFG A;  4XXE A;  3CCQ A;  4Y7N B;  4C56 C;  2K5V A;  2X69 A;  5EBD A;  1YHA A;  4FF3 A;  4FDB A;  3ER0 A;  4P71 A;  1SMX A;  5AJ3 Q;  1EOT A;  3DWA A;  3PMF A;  2J4X A;  2XGT A;  2KED A;  4GLV B;  4PZ7 A;  4R4O A;  3S9W A;  4KMU C;  3CCR A;  2X6L A;  4RWS C;  1PRT D;  2VW9 A;  1KRT A;  2ZXP A;  4JI1 L;  3W3A A;  4TKO B;  3J80 c;  2BA0 A;  1Y8P B;  5JEA G;  2HDM A;  4LUO A;  4LNQ A;  4LF8 L;  3E6Z X;  4K8I A;  1PFN A;  2ATW A;  1KAA A;  1YNN C;  2QKI C;  3BYY B;  3E3X A;  1S5F D;  4XDX A;  5C6A A;  1WVL A;  4DK3 C;  2VUM G;  1LTR D;  4C2M H;  4TSS A;  3TEH B;  3DWP A;  1EYD A;  1RHP A;  1Q86 C;  4R4C A;  3GTG H;  1SYF A;  1EZ8 A;  4RAU C;  4HSP A;  4RFB A;  1FYC A;  1ET9 A;  3OPO A;  4HMJ A;  3AEV A;  2E2I B;  2D5D A;  3HP3 A;  4F8M A;  1EWI A;  2QF7 A;  5EPJ A;  3OTO Q;  3KK7 A;  2VL6 A;  1HZ9 A;  5KYL A;  3RLO A;  4V19 0;  3I4M H;  4DFA A;  2UXD L;  3K5N A;  4UP8 A;  1TWH B;  1E22 A;  5FLM G;  5C0X J;  1RCV D;  3HKS A;  4IOC A;  4DXG A;  4DK1 A;  4HIM A;  1H9S B;  4KN7 C;  1I6H B;  4MHE A;  3SK5 A;  2IW3 A;  4JOI A;  1VQE A;  1IHZ A;  1EYG A;  1VQN A;  2K03 A;  5IGG A;  4A75 A;  2IX3 A;  1MHW C;  4NP5 A;  1TS3 A;  3C46 A;  3D31 A;  1LTA D;  4G57 A;  1KD1 C;  4JBJ A;  3F2C A;  1ENC A;  5ISR A;  4LF4 Q;  1MI2 A;  2WAQ G;  4H44 C;  1SN8 A;  4HMI A;  4BY7 B;  1HTL D;  5CBA E;  1B3A A;  3QR8 A;  4R4I A;  4MNO A;  5KGU A;  1HUM A;  3GQB A;  3T1H Q;  4MTN A;  1VQ5 A;  3DM3 A;  2N49 A;  2WKC A;  1CZW A;  4N9P A;  4ZUJ A;  1O7L A;  5E4W C;  1ESF A;  4JI8 L;  3J81 i;  2B2T A;  4IUQ A;  1A2U A;  3AU7 A;  4NXM Q;  2EY1 A;  5D3I B;  3RZO B;  1EQV A;  2NVT B;  1JJ2 A;  1K3B C;  3CW2 C;  4EVO A;  1HNZ Q;  1SE8 A;  2B2U C;  2TSS A;  4AH6 A;  4OON A;  1VQH A;  5FLX L;  4DR6 L;  4ZCK A;  2D0O A;  4OWX B;  1BOS A;  4JI2 Q;  1EU4 A;  2AWO A;  1SEB D;  2J7Z A;  3HKZ E;  4J1M A;  1VQD A;  4B08 A;  2B63 B;  3NXW A;  1JOO A;  4X65 L;  1A2T A;  4A3K H;  1XMQ L;  2JA5 G;  1DJR D;  1II3 A;  1CKM A;  4JI6 Q;  2Z6B A;  1D8L A;  2I0Q A;  3GO5 A;  4A3J G;  1LLR D;  1TS2 A;  1VF5 C;  2E2H B;  1CI3 M;  1IL8 A;  1L0Y B;  3D4R A;  4A3M G;  3QWN A;  1H9S A;  1IBK L;  1B2T A;  1Q46 A;  1X3F A;  4WJ4 A;  1I4R A;  3J7A V;  1Q8K A;  4K5W A;  5GAE C;  1N32 L;  1NR2 A;  1JJG A;  4N8X 1;  1PZJ D;  4J8Q A;  1D1K A;  3G71 A;  2F4V Q;  1T5X D;  2F0I A;  4DR2 L;  1ZYR C;  5EJW A;  3I91 A;  4NW2 A;  5D65 A;  4A93 G;  2M00 A;  1NCV A;  3BU2 A;  2I07 B;  2Z6K C;  3SHL A;  3DWQ A;  1ROD A;  1LUZ A;  2PNR C;  3F2D A;  4JI3 Q;  3TN2 A;  3OW7 A;  1A3T A;  4B3M L;  2E2J H;  1I3Q B;  4DAM A;  1KTK A;  4HAE A;  1JCK B;  4L8J A;  4X66 Q;  4CJ2 C;  5IYB H;  1HH2 P;  4EGV A;  4BXX H;  1PA6 A;  3JAM E;  3AB9 A;  3X3M A;  1NTG A;  2NVQ B;  3ERO A;  1PRT B;  2NVY B;  4UP7 A;  5BN5 A;  3TS2 A;  3SXH A;  3PGZ A;  1BF4 A;  5L37 A;  3RN2 A;  3S1Q H;  2R7Z H;  4C1N I;  1E3P A;  2QEJ C;  4ZRZ A;  4CGY B;  1QG7 A;  1JWS D;  4GLA C;  3ND9 A;  2YTV A;  1K8O A;  3FMC A;  1A3U A;  1X3Q A;  1PRT C;  2SOB A;  2F0T A;  2VY3 A;  2D0P A;  4NXN L;  4L5Q A;  1J9O A;  3FVQ A;  2EVB A;  2NZH A;  3RZD B;  4HCS A;  5COY A;  2OWO A;  1HCZ A;  2UUC Q;  3I2Z A;  1SNC A;  1PFB A;  2H4O A;  3KLS A;  1I4Q A;  1YJN A;  4R9W A;  3WWV A;  1F2L A;  3CME A;  1ENF A;  1SBB B;  1BXT A;  1PH4 A;  5JJI A;  2GVA A;  4DR1 Q;  4BY7 G;  4L63 B;  3J7A 5;  4P73 A;  1IKL A;  1HZA A;  2QEX A;  1RKN A;  4DUZ L;  4A3G H;  5C4H A;  1R9T B;  1VCI A;  5ELC A;  3I56 A;  2Z4I A;  5C5L A;  4F88 A;  2K5N A;  3KUP A;  3MHB A;  4FP5 D;  2HT1 A;  5E4X A;  1C0A A;  4A3L H;  1YZ6 A;  1K0S A;  1SJE D;  4CKE A;  3GTO H;  3PO2 B;  1F77 A;  3D4D A;  1JT8 A;  1R4P B;  2K32 A;  1TWC B;  2VXW A;  2JA8 B;  1F9P A;  3CD6 A;  4JVZ A;  5C4X G;  2GA4 B;  5HY6 A;  3F8T A;  2D9U A;  1PH7 A;  1Q3L A;  1PV4 A;  2WV6 D;  1GUT A;  5C44 G;  2UU9 L;  3F2B A;  4RMF A;  2ID0 A;  5JEA H;  4FVM A;  1NBW A;  1A6X A;  2KOL A;  5M3M G;  3NSW A;  1CKN B;  1O7Y A;  1KLG D;  2B63 G;  4YHH L;  2NZ1 D;  3HOX H;  1JB3 A;  4P72 A;  1EIH A;  3VR2 A;  2K5Q A;  4WJW A;  1AZP A;  5AFW A;  5FOB B;  3IFD A;  4A3F B;  1WYD A;  2CQA A;  2F52 A;  3BYT B;  5EGT A;  5C4Z A;  4DV3 Q;  1QVG A;  4XQQ A;  3GDE A;  1S5D D;  2BDN A;  4R4Q A;  2DJG C;  2HHH L;  5T1I A;  1NNX A;  2F0V A;  3G7L A;  1EFI D;  4JYA Q;  4U67 3;  3GTQ H;  2MP1 A;  4KJO A;  5IT9 L;  4QB4 A;  1M90 C;  2RDG A;  2OEO A;  1M8A A;  4DR4 L;  4QCL A;  1U4P A;  4DV2 Q;  1GUW A;  4KHP Q;  3T51 B;  1HHV A;  4RGO S;  5G3L F;  1LTT D;  3TSS A;  3I7F A;  4CJ0 B;  3MAQ A;  1PH3 A;  3PF5 A;  1VQL A;  4IFD H;  1EYA A;  1YIJ A;  4K2K A;  2RDH A;  5FKA C;  1PLF A;  3GTJ H;  1QCB D;  3TQY A;  4EQ5 A;  3QB3 A;  4MN3 A;  3A8K E;  5GAG C;  5CMD A;  5BR8 Q;  1XXG A;  2NUC A;  1LT6 D;  2QGQ A;  2IT1 A;  1UEA B;  1IBM L;  1VQ6 A;  2RVL A;  4DR5 Q;  2RF4 A;  4FF2 A;  3H0G H;  2JEB I;  4GNX B;  3GTM H;  3PF4 A;  1LYL A;  1QUQ B;  5D3D A;  4P74 A;  2VQF L;  1KQS A;  1B4O A;  3HOV H;  2UXB Q;  2B2W A;  1FGU A;  4GN3 B;  5C4J H;  2AUJ D;  4A3B H;  4A3D G;  4DR3 Q;  1EY7 A;  2ALY B;  3L0O A;  4IFD I;  2JA7 B;  1ASY A;  1WFQ A;  2R7D A;  3DM1 A;  5C3W A;  3V05 A;  3KF6 B;  2AKW B;  3NE5 B;  3TP7 A;  1ASZ A;  1K3R A;  4GN5 A;  4LF9 L;  3WOE A;  4AQY Q;  3E9H A;  2MJ8 A;  3IKJ A;  3QG1 A;  1XX8 A;  2NYZ D;  2CWP A;  4QQB X;  1G2S A;  1VF7 A;  3PUX A;  4LFB Q;  2C9O A;  1U4M A;  2ZTD A;  1QZG A;  5KNC A;  2V4D A;  4QUF A;  3N6R A;  3W5O A;  1GVP A;  1PXU A;  2DN8 A;  4QJF A;  4UHV A;  2F0S A;  4XTC S;  1CM9 A;  2RA4 A;  5M5X H;  1V1Q A;  3A7A B;  2L0C A;  1HNZ L;  3EBE A;  3NQI A;  2EE1 A;  3D6C A;  1IZ6 A;  4G7Z C;  1N9W A;  4LJZ C;  1DYQ A;  4KKS A;  1PVO A;  1JOK A;  4IJL A;  1SE4 A;  1K83 H;  4KV6 A;  2PZT A;  4DUY Q;  3QIA A;  2O4X A;  2M9V A;  3KLS X;  4X62 L;  4HSV A;  1XNR Q;  2JA8 G;  2BE5 D;  2F0D A;  4IPC A;  5FK9 C;  5HGT A;  3KJP A;  1J5E Q;  4K0K Q;  2VQE Q;  1PYB A;  1JE4 A;  4GNX A;  4JI6 L;  2K01 A;  1Y1W B;  3S1N B;  4K2L A;  1B8A A;  1JWM D;  3PIO 3;  2RHS B;  4J6H A;  1SNO A;  1TKW B;  2CVR A;  2EYF A;  3UDX A;  1M1K C;  3R93 A;  2UXC L;  1E1T A;  2PYK A;  2B2Y A;  2FMC A;  3ZJY C;  3PSI A;  2HDL A;  1AE3 A;  4UAI A;  1PH2 A;  3NQT A;  5KYI A;  1JMC A;  4KHZ A;  2DNE A;  4C3I G;  2F3I A;  2F4V L;  3KF6 A;  3STB D;  1CK1 A;  1QZH A;  3CC4 A;  1Y69 U;  2MPM A;  2PMZ B;  5IP7 H;  5IOC A;  2VUM B;  4PG3 A;  1J6Q A;  4OIJ A;  1I5F A;  3MXG A;  4CKC A;  4ZAI A;  1GKH A;  1Z9F A;  4APV A;  3TP6 A;  1IBL L;  3ITP A;  4X66 L;  3K6O A;  4ME3 A;  2E5L Q;  1CUK A;  2G5D A;  3Q8D A;  1B53 A;  3R2T A;  5C0X G;  1Z7T A;  4A3E H;  3HOZ B;  2WFW A;  1A0I A;  1OO9 B;  4H02 A;  2QDB A;  2PNH A;  4DV7 Q;  4JW0 A;  3CC7 A;  2EY6 A;  1VQK A;  1GHJ A;  4EQN A;  2GN5 A;  3FP9 A;  1B3Q A;  1EYC A;  1PTO D;  2KBN A;  1YJ9 A;  1QB5 D;  4LAA A;  1UAP A;  2BH2 A;  3T1Y L;  2QW7 A;  1BKB A;  2Z1C A;  1B70 B;  2B2V A;  4LUV A;  1MIU A;  4Q5V A;  3U50 C;  1KXL A;  5E3F A;  4DA2 A;  2K5H A;  5LMN W;  1VQC A;  1K8G A;  3ULJ A;  4IOA A;  3KYH C;  3K5M A;  3PO3 H;  3N52 A;  5JPM C;  4WFN 3;  2WAQ B;  1K9M C;  1NY4 A;  2ZTC A;  4IJH A;  4B9W A;  5IGC A;  3OW2 A;  1F2Y A;  1NMF A;  2PO4 A;  1OXX K;  2A19 A;  3TZD A;  4L5R C;  1SND A;  3D3R A;  4FNF A;  1GM5 A;  1D5Z C;  3SE0 A;  2NVT H;  1EFW A;  1VQM A;  2HQE A;  1AEX A;  3W1G A;  5CV4 A;  4E6I A;  3GTP H;  2JE6 I;  2QCP X;  4LUZ A;  2Z4H A;  3L3O C;  3KBG A;  4DR1 L;  4FXG C;  3K7A H;  3CCM A;  2KCM A;  1UE5 A;  1KNA A;  1WCM H;  5J3B A;  3NUC A;  4JCV E;  2LMC B;  5GRO A;  3BZD B;  1NSN S;  2ENB A;  2F0K A;  3A54 A;  2JSO A;  3VYS A;  1TXY A;  4MIU A;  5IWA Q;  3A5U A;  2L11 A;  1FJG Q;  1EIF A;  3FHW A;  1AN8 A;  4RHR A;  4YY3 Q;  2AQ2 B;  4KD4 A;  2F0U A;  1EY4 A;  3SK4 A;  1JOQ A;  4B9X A;  3I4L A;  3B6Y A;  4S3S A;  2N88 A;  1X56 A;  3S1R B;  5IP9 H;  3OWF A;  1PYS B;  3R3O A;  4JV5 Q;  1CHP D;  5I4D A;  2FHT A;  4RGM A;  5CYU A;  1WI5 A;  4KK7 A;  1GUN A;  4DKA C;  4A3M B;  3J80 E;  1LTG D;  1EU3 A;  4QUC A;  1SE3 A;  3J80 i;  3GTL H;  1LM0 A;  4OX9 Q;  5IYD H;  5IGE A;  4GKJ Q;  3BDL A;  4ZLT F;  5DNF A;  3I3C A;  4DR7 Q;  1ENA A;  3OMC A;  3S2D B;  4GKK L;  4DV0 Q;  1EY5 A;  1Y1W G;  1EWC A;  4KD3 A;  1CA6 A;  1TQO A;  4A93 B;  4JOI C;  5M5Y B;  1A63 A;  1HR0 Q;  3MEH A;  1TY2 A;  4DV3 L;  4N9T A;  1YVC A;  3PUZ A;  2NVQ H;  1VQA A;  2EXD A;  4LFC Q;  3SDZ A;  3VDY A;  1STA A;  4JYA L;  2JA6 H;  3MVV A;  4PV1 C;  3LGJ A;  2GVB A;  1S4Z A;  3K0X A;  3NTK A;  4B3T Q;  3BVZ A;  5FLX c;  1AZQ A;  3MXN B;  1CA5 A;  1B50 A;  1SMY D;  4UP9 A;  5F2D A;  3I73 A;  5E1F A;  4ZYS A;  2FFK B;  5K5P A;  4KN4 C;  4KHP L;  1BCP F;  4BBR H;  3P75 A;  5JVG 3;  1W3S A;  1VMP A;  1ET6 A;  2EXZ A;  5HUR A;  1GJX A;  1PYW D;  2PQA A;  1TU2 B;  4LFA Q;  1SRU A;  2B2T C;  3PIP 3;  4OIK A;  1BBU A;  2A6E C;  1MKH A;  2EYO A;  1O7I A;  3TS0 A;  2ASB A;  1DXM A;  3HOZ G;  2OT2 A;  2WB1 E;  1T5E A;  3C2P A;  4PMB A;  1LT3 D;  3W2D A;  3TZU A;  4A3I H;  1U4R A;  5JAV A;  2F0F A;  4X3S A;  2BOS A;  2BCO A;  3QO2 A;  5KND A;  1HNW L;  1BVS A;  3M7G A;  4KKU A;  1PH9 A;  5CV9 A;  1AFP A;  4XYO A;  4P2C B;  1BDO A;  3DEP A;  2F03 A;  2ZJQ A;  1EZ6 A;  2UXB L;  1DZ1 A;  1QOH A;  2A74 C;  4FXK C;  4BY1 H;  2R61 A;  2NVX B;  3ICE A;  1PTO B;  4DR3 L;  4H13 C;  3GTK B;  4DV4 Q;  1TWG B;  2VS1 A;  3H15 A;  4YCU A;  1H9J A;  4M1U B;  1DOK A;  1VS0 A;  1X3E A;  2Q8T A;  1BR9 A;  3PO2 H;  4OO1 G;  3M3Y B;  4OWT B;  3NEL A;  4PZ8 A;  3PUV A;  1NR4 A;  3CCU A;  1BUV T;  1PTO C;  1HJP A;  1I94 L;  1CSP A;  2LS0 1;  5A2Q L;  3NBI A;  4JBM A;  3J81 E;  2CCZ A;  2CH4 A;  1P8L A;  3MXN A;  1EL0 A;  3A5Z B;  1I4X A;  3HOY G;  2MGS A;  4HIO A;  1EY6 A;  4RGN A;  3NEM A;  3P7J A;  5C4X B;  1U9R A;  1EQQ A;  3HOU B;  1HNX L;  2HUG A;  5K36 H;  4F7X A;  1SFO B;  4CDC C;  5C44 B;  1D2B A;  2I5L X;  4HJ5 A;  1VMC A;  1E2Z A;  1F9S A;  1Y1V G;  1Y8O B;  2IHE A;  5LMU Q;  4A3F H;  5M3M B;  2F0P A;  5CGK A;  2ZJP A;  4JI7 L;  4XYQ A;  3CCV A;  2I5H A;  2EQS A;  1TT2 A;  1JE5 A;  3AYH B;  4I7Z C;  1GHK A;  1B44 D;  2OXP A;  3FDT A;  3I90 A;  2D62 A;  4L6T B;  4ZKB B;  1J5E L;  4K0K L;  4DV6 Q;  1YEZ A;  5IE8 A;  2KHJ A;  4DV1 Q;  3K58 A;  1HQM C;  3T13 A;  3V2T A;  5BN3 A;  5C3E H;  3A7L A;  3BG3 A;  1EIY B;  2ZM6 Q;  1I6V C;  1OTC A;  2R93 H;  2NN6 H;  4B3S L;  2UUA L;  3S14 B;  5IOD A;  1RTO A;  2AHO B;  3KBX A;  3KF8 A;  2HCI A;  1YHB A;  2FJ2 A;  4HJA A;  5LMN Q;  1O7Z A;  5FJ8 G;  1GUG A;  1SYE A;  4QIW E;  3A55 A;  1Q1B A;  4ODG A;  3MZ5 A;  3H3V C;  1N33 Q;  1L1O A;  3ZYY X;  1LTI D;  4K14 A;  3S15 B;  3CHB D;  1K28 A;  4GN4 B;  4POG A;  1V43 A;  2EYH A;  1PH6 A;  5KNB A;  4NDX A;  1UEB A;  3I4N B;  1SYB A;  2ES2 A;  2BA1 A;  2A8V A;  5CV5 A;  1H9R A;  2VB2 X;  1ILP A;  4C3J B;  3U9S A;  2FIN B;  2MQH A;  5CV7 A;  1EQR A;  1RL2 A;  3NBH A;  2A6H D;  5C0X I;  2Q2I A;  3HRZ C;  3F2U A;  4BBS G;  1N34 Q;  1N36 Q;  2NN6 I;  4DV7 L;  2K28 A;  3NEN A;  3RMH A;  2JA7 H;  3S2H B;  1SJH D;  4CDE C; 
#chains in the Genus database with same CATH homology
 1HFG A;  3CRL C;  1I50 B;  4A3D B;  3ND8 A;  1UUP A;  1RJT A;  1EQT A;  1EY8 A;  1H9K A;  5JEA J;  1SMY C;  1HA6 A;  3DXJ C;  2RSO A;  4X3U A;  3HS0 C;  4C2M B;  2IX0 A;  2DY8 A;  1V1P A;  1HUN A;  5IGD A;  3LWU A;  5LL6 S;  2VB3 X;  1X32 A;  3GTG B;  3NWT A;  4X3K A;  2F0H A;  3DMU A;  3OSO A;  2PZW A;  3L7Z C;  1H9M A;  2XN9 C;  4ID6 A;  3I4M B;  2B8F A;  5NUC A;  3EQL C;  1STN A;  1GUS A;  4FO2 A;  3DHQ A;  5J1Z A;  2FMM A;  4IFD J;  3FEW X;  3EVQ A;  3NWS A;  5JJZ A;  1HTP A;  2KJX A;  4TRD A;  5JVH 3;  5FO9 B;  3O13 A;  3QJY A;  3G6J B;  3LX0 A;  1LTB D;  3TME A;  2A68 D;  4K8J A;  1DOM A;  2B39 A;  3S1M B;  2B2W C;  4C3I B;  2CW0 D;  3P1H A;  1KDB A;  3MC0 B;  1G6Z A;  2JEA I;  5CC4 A;  1Z6H A;  1WTR A;  2N55 A;  1MSH A;  5M9O A;  3SEB A;  1SDF A;  5J22 A;  3JAM L;  5TSS A;  3X3N A;  2WP8 J;  2RDF A;  3NTH A;  1MBY A;  2WKD A;  2XIW A;  4RA8 A;  4C3J G;  3VYR A;  5CV6 A;  2EJM A;  2XWB B;  1E0B A;  1SYD A;  5D14 A;  1ML0 D;  2X6G A;  1D5X C;  3VYT A;  4DAP A;  3K5O A;  3OOC A;  2EJG C;  2EZV A;  1HRJ A;  2G9D A;  3FKI B;  3NK9 A;  3OWE B;  3BDC A;  3IL8 A;  2E2J B;  5EPL A;  4NMZ A;  1JQY D;  5JOB A;  2A6H C;  1E2W A;  4KJN A;  3SK8 A;  2B2Y C;  2WIN B;  1TY0 A;  4XQN A;  3A8J E;  2R7Z B;  3J7Y W;  2BDO A;  2XRQ D;  3R8B A;  1PDQ A;  1WTQ A;  4JBW A;  3FPP A;  5IGF A;  2K5D A;  5I9P A;  3HGB A;  3ONA B;  1W6K A;  1LT4 D;  3E5S A;  2RKS A;  4KI0 A;  4ZUI A;  1FGB D;  1Q1E A;  2JP1 A;  3TP8 A;  3MXP A;  2NB0 A;  4RKL A;  2PW5 A;  1EEI D;  1M4V A;  5KIX A;  2B2V C;  4OGQ C;  4A3G B;  2XWJ B;  1SYG A;  2NTT A;  1YNN D;  3CQZ B;  3EA6 A;  3GD7 A;  1WTV A;  3Q0A A;  4IUT A;  2M2L A;  4UDU C;  3GTO B;  1PRT F;  3R2I A;  3MFY A;  4IUU A;  3PUY A;  4K6L A;  4R8I A;  1CFM A;  1TR5 A;  2ICE C;  4XQJ A;  4TQU S;  1EIG A;  1LTS D;  1D1I A;  3AMU A;  1TS5 A;  2A68 C;  2AQ1 B;  3EJI A;  1KLU D;  3RLF A;  2G9H D;  3HOX B;  2Q8R E;  2KEE A;  1S5B D;  3LNN A;  2CW0 C;  4PMC A;  5G3L D;  1PTO H;  1SAP A;  4Z9C B;  4KHV A;  4LK1 C;  3ERQ A;  1K8M A;  1G2T A;  4OHJ A;  1DON A;  4HN7 A;  1PZI D;  3GTQ B;  4XT1 B;  2IX1 A;  2Y0S B;  4QMG A;  1STY A;  5C5M A;  2LFN A;  2EYJ A;  3CRK C;  3GV3 A;  3NHH A;  1ESR A;  3GTJ B;  3I8Z A;  3WOF A;  1F9Q A;  5I2X A;  2PW7 A;  3HOY B;  1TS4 A;  2E2D C;  4IQZ A;  1CQF A;  4CKB A;  3H0G B;  2YU9 B;  4IUR A;  2Q8I B;  1Y1V B;  3HOV B;  5DEH A;  5C4J B;  2DNC A;  2CHB D;  2WAC A;  4KTA A;  3OIQ A;  3T56 B;  1O78 A;  3OIP A;  1VDZ A;  1FR3 A;  2F3V A;  2HCC A;  3VYU A;  4DAV A;  1LV9 A;  2KEC A;  4RGT A;  3SK6 A;  4FYD A;  4OL7 A;  5FLX E;  4IZ8 A;  4ILW A;  3D4W A;  3K0Y A;  4O42 A;  2K6A A;  1D6E C;  5M5X B;  1FD7 D;  4ULL A;  4C1N K;  1STG A;  1Z47 A;  4H7B A;  2F0Q A;  1I4G A;  1MSG A;  1K83 B;  2EOT A;  5LL6 X;  2OF1 A;  1SXT A;  2BE5 C;  2AUK A;  1LAB A;  4BBS B;  4U68 A;  2Z8L A;  1QE6 A;  3CKI B;  4DAY A;  2SNS A;  4BS9 A;  4RCO A;  1B1Z A;  5A35 A;  2PQE A;  1RDP D;  1HXY D;  1GUO A;  1XWE A;  1WD1 A;  1E2V A;  5ELE A;  1WD0 A;  5M5W B;  1F9R A;  2JXM B;  1SNM A;  3H6M A;  3C1F A;  3HKZ B;  3PV0 A;  5EKL A;  1LAC A;  3BVM A;  1C48 A;  3OMG A;  1IW7 D;  4IUP A;  3H91 A;  3T16 A;  2VNU D;  3UI2 A;  4A3E B;  1C8C A;  1QWY A;  1FNW A;  2EY5 A;  3H94 A;  2IJ0 A;  2WII B;  5M3F B;  3IAY A;  4IFD G;  3MA2 B;  1PZK D;  5ELD A;  1OXV A;  3PUW A;  4R8N A;  1BNZ A;  3BDO A;  4NKL A;  4ZQ3 A;  4QIW B;  1BO0 A;  3GV6 A;  1BQQ T;  4RH6 A;  2J0T D;  3BS1 A;  2RQX A;  4H0L C;  5DM6 3;  2A69 D;  2PZU A;  3PO3 B;  4KY5 A;  2R6G A;  3NP8 A;  4HED A;  2ZT9 C;  3Q24 A;  2O2L D;  3C1E A;  2E74 C;  2NBF A;  2K33 A;  3Q23 A;  4GZY C;  2A5H A;  4DNR B;  3J80 L;  3GTP B;  2XVS A;  3K7A B;  1JC7 A;  4RKB A;  5C0X H;  1WCM B;  5IIF A;  4WRD A;  1V1P B;  1CQV A;  1GXD C;  5COR A;  1V1O A;  4PQX A;  1KNE A;  1SNQ A;  2QIL A;  3K57 A;  2NTS A;  2EJF C;  1FNU A;  4FF1 A;  1STE A;  2K04 A;  2L5T A;  1AW7 A;  4BA1 I;  1G8Z D;  4XT3 B;  3A56 A;  4DNT B;  2L1B A;  3HG9 A;  4PMW A;  3VR4 A;  3MXU A;  5IT9 E;  3GTL B;  3H09 A;  1KDA A;  1LO5 D;  1BCP D;  2R3Z A;  3T4A C;  1XTC D;  2B2U A;  3FPU B;  5I6W A;  5EKK A;  4LMQ D;  4DXF A;  2JA6 B;  1ZKO A;  1HFN A;  4XIG S;  4O1N A;  2L9H A;  2YYZ A;  1DOL A;  2IPK D;  3Q6S A;  2SEB D;  3FRP B;  2F0J A;  2LY7 A;  1A15 A;  3DEO A;  2EYM A;  4BBR B;  5KEE A;  3TP5 A;  1HPC A;  1U4L A;  5FO7 B;  2KCC A;  3DUZ A;  1UNS A;  5BN4 A;  4YIJ A;  2EDG A;  3HZX A;  3J81 L;  4A3I B;  3LWE A;  1CTM A;  1RD9 D;  1O80 A;  2F3W A;  2A73 B;  1SYC A;  2F0M A;  4FXD A;  2IWH A;  1YNJ D;  4KKT A;  4HR7 B;  2K5W A;  1Q90 A;  2L4N A;  4BY1 B;  3Q22 A;  1IW7 C;  3OHX C;  2K1B A;  5EQ0 A;  1JR0 D;  5EBC A;  1OXT A;  1QNU A;  3HEJ A;  3K5L A;  5JPN C;  4DGZ A;  4X3T A;  4IAL A;  3VA5 A;  3K59 A;  1CHQ D;  1SNP A;  5CR3 A;  2XSC A;  2F0E A;  2K05 A;  1EEF D;  1KDC A;  1MD2 D;  2L12 A;  3BVG A;  1PMR A;  3GP7 A;  5IGB A;  1GOZ A;  1X3P A;  3A8I E;  2A69 C;  3MTS A;  3MWY W;  4G4K A;  1CT1 D;  1XYI A;  4BWG B;  5DM7 3;  4G7H C;  2KQ3 A;  4K5X A;  3C3L A;  3URY A;  2TMP A;  1C4Q A;  2SNM A;  4K6D A;  3WDN A;  2ICI A;  1B9M A;  4A3K B;  3SVM A;  1Q12 A;  1A3V A;  1IKM A;  2F0L A;  1HQR D;  1JWU D;  5C3E B;  1WTX A;  2R93 B;  4OO1 H;  1DD2 A;  2L55 A;  4FF4 A;  3E0J A;  1PTO F;  4ME5 A;  2KUM A;  1TVX A;  5J39 A;  3VR6 A;  1NUC A;  1JOR A;  1I4P A;  2AWN A;  3RUZ A;  1BCP B;  3D8G A;  1ONL A;  4KY6 A;  4DU9 A;  1DM0 B;  2I46 A;  2XRS D;  4ABN A;  4AYB B;  2O5J C;  1EY9 A;  1IYV A;  1IYU A;  2F1M A;  1BCP C;  3S1Q B;  4OO1 I;  2ZXO A;  5ELF A;  2MUY A;  1B9N A;  1Y8N B;  5KRU A;  5T1G A;  1KAB A;  2F0O A;  3IFT A;  4HCE A;  4C3H B;  1QIL A;  1PFM A;  1I4H A;  2R92 B;  4DK0 A;  3I72 A;  1EY0 A;  2C5C A;  2K7V A;  5FO8 B;  5DAU A;  3EFX D;  5CBE E;  4K5V A;  3TBI B;  1W6J A;  4M8A A;  1SE2 A;  3M7N A;  2D2C C;  3HOW B;  3TDQ A;  2PPB C;  1S5E D;  2SDF A;  2F0N A;  1RTN A;  4JK1 C;  5EKI A;  3NPP A;  2EYP A;  1EWH A;  2RBM A;  3NTI A;  5ELB A;  4EQO A;  3I70 A;  4QF4 A;  4RHS A;  4CBV A;  1LT5 D;  4Q0F A;  1YNJ C;  2EY2 A;  2F0W A;  1R4Q B;  2KCN A;  3VR5 A;  1QNK A;  2A6E D;  1S5C D;  1QJO A;  5C3X A;  4I65 A;  3KLR A;  4WOR A;  3VA7 A;  5K36 G;  4HTH A;  1F2M A;  1STH A;  3J7A F;  2ZXR A;  4V0B A;  5I6Y A;  2MHV A;  5I9O A;  1ILQ A;  4KY7 A;  3V96 A;  2E76 C;  4PNY A;  1RF2 D;  2IL8 A;  4ZK9 B;  1ZEQ X;  3QOJ A;  4EQP A;  1WTO A;  1TWF B;  1ICW A;  2B8G A;  1TWA B;  1SSO A;  1TII D;  3RD4 A;  2NN6 G;  4F87 A;  3VR3 A;  4IUN A;  1G91 A;  2F0G A;  3QOL A;  1J8I A;  2E75 C;  4CHT B;  2KA7 A;  3L9A X;  1STB A;  3S17 B;  1WTW A;  1V8Q A;  2AQ3 B;  2DY7 A;  2KVM A;  2RSN A;  3M4Y A;  1L0X B;  1HA5 A;  4CJ1 B;  5EPK A;  2O5I C;  1AP0 A;  4DF7 A;  1ZXT A;  3GTM B;  1G29 1;  1JIC A;  5LHY 1;  4ZKC B;  3S16 B;  3SR1 A;  2F4I A;  1FNV A;  5CV8 A;  1OXS C;  4A3B B;  2H1E A;  5I2Y A;  5A2Q E;  4RCN A;  1WTP A;  2EPB A;  4C3H G;  2NWG A;  1CZG A;  1Q8I A;  4BA2 I;  1OXU A;  4IN3 A;  2PCF B;  2EYL A;  4IUV A;  2WB1 B;  3P20 A;  1BBX C;  2LKV A;  2JYO A;  3U9O A;  4G7O C;  2XNA C;  1DCZ A;  1F2Z A;  1ZYR D;  1D5M C;  3M4O B;  3M85 A;  3T53 B;  1MGS A;  4DN4 M;  2JA5 B;  4A3J B;  3D6W A;  1NAP A;  2KHS A;  3CU7 A;  3MFG A;  4XXE A;  4Y7N B;  4C56 C;  2X69 A;  5EBD A;  4FF3 A;  1EOT A;  3DWA A;  3PMF A;  2J4X A;  2KED A;  3S9W A;  4KMU C;  2X6L A;  4RWS C;  1PRT D;  2ZXP A;  3W3A A;  4TKO B;  2BA0 A;  1Y8P B;  5JEA G;  2HDM A;  3E6Z X;  4K8I A;  1PFN A;  1KAA A;  1YNN C;  2QKI C;  3BYY B;  4XDX A;  1S5F D;  5C6A A;  1WVL A;  1LTR D;  4TSS A;  3DWP A;  1EYD A;  1RHP A;  1SYF A;  1EZ8 A;  4RAU C;  4HSP A;  4RFB A;  1FYC A;  1ET9 A;  3OPO A;  4HMJ A;  2E2I B;  2D5D A;  3HP3 A;  4F8M A;  2QF7 A;  5EPJ A;  3KK7 A;  5KYL A;  4V19 0;  4DFA A;  3K5N A;  1TWH B;  5C0X J;  1RCV D;  4DXG A;  4DK1 A;  1H9S B;  4KN7 C;  1I6H B;  4MHE A;  3SK5 A;  2IW3 A;  1IHZ A;  2K03 A;  5IGG A;  2IX3 A;  4NP5 A;  1TS3 A;  3C46 A;  3D31 A;  1LTA D;  4G57 A;  1ENC A;  5ISR A;  1MI2 A;  4H44 C;  4HMI A;  4BY7 B;  1HTL D;  5CBA E;  1B3A A;  5KGU A;  1HUM A;  3GQB A;  2WKC A;  1CZW A;  4N9P A;  4ZUJ A;  1O7L A;  5E4W C;  1ESF A;  2B2T A;  4IUQ A;  1A2U A;  3AU7 A;  2EY1 A;  5D3I B;  3RZO B;  1EQV A;  2NVT B;  4EVO A;  2B2U C;  2TSS A;  5FLX L;  1BOS A;  1EU4 A;  2AWO A;  1SEB D;  2J7Z A;  4J1M A;  4B08 A;  2B63 B;  3NXW A;  1JOO A;  1A2T A;  1DJR D;  1II3 A;  3GO5 A;  1LLR D;  1TS2 A;  1VF5 C;  2E2H B;  1CI3 M;  1IL8 A;  1L0Y B;  3D4R A;  3QWN A;  1H9S A;  1B2T A;  1I4R A;  3J7A V;  4K5W A;  1NR2 A;  1PZJ D;  4J8Q A;  1D1K A;  1T5X D;  2F0I A;  1ZYR C;  5EJW A;  3I91 A;  4NW2 A;  5D65 A;  2M00 A;  1NCV A;  2I07 B;  3SHL A;  3DWQ A;  1ROD A;  2PNR C;  3TN2 A;  3OW7 A;  1A3T A;  1I3Q B;  1KTK A;  4HAE A;  1JCK B;  4L8J A;  4CJ2 C;  4EGV A;  3JAM E;  3AB9 A;  3X3M A;  2NVQ B;  3ERO A;  1PRT B;  2NVY B;  5BN5 A;  3SXH A;  1BF4 A;  4C1N I;  4ZRZ A;  2QEJ C;  4CGY B;  1QG7 A;  1JWS D;  3ND9 A;  1K8O A;  3FMC A;  1A3U A;  1X3Q A;  1PRT C;  2SOB A;  2F0T A;  1J9O A;  3FVQ A;  2EVB A;  3RZD B;  4HCS A;  5COY A;  1HCZ A;  1SNC A;  1PFB A;  2H4O A;  3KLS A;  1I4Q A;  4R9W A;  1F2L A;  1ENF A;  1SBB B;  1BXT A;  4L63 B;  1IKL A;  1RKN A;  5C4H A;  1R9T B;  1VCI A;  5ELC A;  2Z4I A;  5C5L A;  4F88 A;  3KUP A;  3MHB A;  4FP5 D;  5E4X A;  1SJE D;  4CKE A;  3PO2 B;  1F77 A;  3D4D A;  1R4P B;  2K32 A;  1TWC B;  2VXW A;  2JA8 B;  1F9P A;  2GA4 B;  2D9U A;  1Q3L A;  2WV6 D;  1GUT A;  2ID0 A;  5JEA H;  4FVM A;  1A6X A;  2KOL A;  3NSW A;  1O7Y A;  1KLG D;  2NZ1 D;  1JB3 A;  1EIH A;  3VR2 A;  2K5Q A;  4WJW A;  1AZP A;  5AFW A;  5FOB B;  3IFD A;  4A3F B;  2CQA A;  5C4Z A;  3BYT B;  5EGT A;  4XQQ A;  1S5D D;  2BDN A;  5T1I A;  2F0V A;  3G7L A;  1EFI D;  4U67 3;  2MP1 A;  4KJO A;  5IT9 L;  4QB4 A;  2RDG A;  2OEO A;  1M8A A;  4QCL A;  1U4P A;  1GUW A;  3T51 B;  1HHV A;  4RGO S;  5G3L F;  1LTT D;  3TSS A;  4CJ0 B;  3MAQ A;  4IFD H;  1EYA A;  4K2K A;  2RDH A;  5FKA C;  1PLF A;  1QCB D;  3QB3 A;  4MN3 A;  3A8K E;  5CMD A;  1XXG A;  2NUC A;  1LT6 D;  2IT1 A;  1UEA B;  2RVL A;  4FF2 A;  2JEB I;  5D3D A;  1B4O A;  2B2W A;  2AUJ D;  1EY7 A;  4IFD I;  2JA7 B;  3DM1 A;  5C3W A;  3V05 A;  3NE5 B;  3TP7 A;  3WOE A;  2MJ8 A;  3IKJ A;  3QG1 A;  1XX8 A;  2NYZ D;  1G2S A;  1VF7 A;  3PUX A;  2C9O A;  1U4M A;  5KNC A;  2V4D A;  4QUF A;  3N6R A;  1PXU A;  2DN8 A;  2F0S A;  4XTC S;  1CM9 A;  2RA4 A;  3A7A B;  2L0C A;  3NQI A;  2EE1 A;  3D6C A;  4G7Z C;  4LJZ C;  1DYQ A;  4KKS A;  1JOK A;  1SE4 A;  4KV6 A;  2PZT A;  3QIA A;  2O4X A;  2M9V A;  3KLS X;  4HSV A;  2BE5 D;  2F0D A;  5FK9 C;  5HGT A;  1JE4 A;  2K01 A;  1Y1W B;  3S1N B;  4K2L A;  1JWM D;  3PIO 3;  4J6H A;  1SNO A;  1TKW B;  2CVR A;  2EYF A;  3R93 A;  2PYK A;  2B2Y A;  2FMC A;  2HDL A;  4UAI A;  3NQT A;  5KYI A;  4KHZ A;  2DNE A;  4C3I G;  1CK1 A;  1Y69 U;  2MPM A;  2PMZ B;  5IOC A;  2VUM B;  4OIJ A;  3MXG A;  4CKC A;  4ZAI A;  3TP6 A;  3ITP A;  3K6O A;  1B53 A;  3R2T A;  5C0X G;  1Z7T A;  3HOZ B;  1OO9 B;  2QDB A;  2EY6 A;  1GHJ A;  4EQN A;  1EYC A;  1PTO D;  1QB5 D;  4LAA A;  1UAP A;  2Z1C A;  2B2V A;  4Q5V A;  5E3F A;  4DA2 A;  3K5M A;  3N52 A;  5JPM C;  4WFN 3;  2WAQ B;  4B9W A;  5IGC A;  1F2Y A;  2PO4 A;  1OXX K;  3TZD A;  1SND A;  3D3R A;  4FNF A;  1D5Z C;  3SE0 A;  2HQE A;  1AEX A;  5CV4 A;  4E6I A;  2JE6 I;  2QCP X;  2Z4H A;  3L3O C;  3KBG A;  4FXG C;  1KNA A;  3NUC A;  2LMC B;  3BZD B;  1NSN S;  2ENB A;  2F0K A;  3A54 A;  2JSO A;  3VYS A;  4MIU A;  2L11 A;  1AN8 A;  4RHR A;  2AQ2 B;  4KD4 A;  2F0U A;  1EY4 A;  3SK4 A;  1JOQ A;  4B9X A;  3I4L A;  4S3S A;  2N88 A;  3S1R B;  3OWF A;  3R3O A;  1CHP D;  5I4D A;  2FHT A;  4RGM A;  5CYU A;  4KK7 A;  4A3M B;  1GUN A;  3J80 E;  1LTG D;  1EU3 A;  4QUC A;  1SE3 A;  5IGE A;  3BDL A;  4ZLT F;  5DNF A;  3I3C A;  1ENA A;  3OMC A;  3S2D B;  1EY5 A;  1EWC A;  4KD3 A;  1CA6 A;  1TQO A;  4A93 B;  5M5Y B;  3MEH A;  1TY2 A;  4N9T A;  3PUZ A;  3SDZ A;  1STA A;  4PV1 C;  3MVV A;  1S4Z A;  3NTK A;  3BVZ A;  1AZQ A;  1CA5 A;  1B50 A;  1SMY D;  5F2D A;  3I73 A;  5E1F A;  4ZYS A;  2FFK B;  5K5P A;  4KN4 C;  1BCP F;  5JVG 3;  3P75 A;  1VMP A;  1ET6 A;  2EXZ A;  5HUR A;  1GJX A;  1PYW D;  1TU2 B;  2B2T C;  3PIP 3;  4OIK A;  2A6E C;  2EYO A;  1DXM A;  2OT2 A;  1T5E A;  3C2P A;  4PMB A;  1LT3 D;  3W2D A;  3TZU A;  1U4R A;  5JAV A;  2F0F A;  4X3S A;  2BOS A;  2BCO A;  3QO2 A;  5KND A;  3M7G A;  4KKU A;  5CV9 A;  1AFP A;  4XYO A;  4P2C B;  1BDO A;  3DEP A;  2F03 A;  1EZ6 A;  1DZ1 A;  1QOH A;  2A74 C;  4FXK C;  2R61 A;  2NVX B;  1PTO B;  4H13 C;  3GTK B;  1TWG B;  1H9J A;  4M1U B;  1DOK A;  2Q8T A;  1BR9 A;  4OO1 G;  3M3Y B;  3PUV A;  1NR4 A;  1BUV T;  1PTO C;  2LS0 1;  5A2Q L;  3NBI A;  3J81 E;  3MXN A;  1EL0 A;  1I4X A;  2MGS A;  1EY6 A;  4RGN A;  3P7J A;  5C4X B;  1U9R A;  3HOU B;  2HUG A;  5K36 H;  4F7X A;  1SFO B;  5C44 B;  1D2B A;  1VMC A;  1E2Z A;  1F9S A;  1Y8O B;  5M3M B;  2F0P A;  5CGK A;  4XYQ A;  1TT2 A;  1GHK A;  4I7Z C;  1B44 D;  2OXP A;  3FDT A;  3I90 A;  2D62 A;  4L6T B;  4ZKB B;  3K58 A;  1HQM C;  3T13 A;  3V2T A;  5BN3 A;  3A7L A;  3BG3 A;  1I6V C;  2NN6 H;  3S14 B;  5IOD A;  1RTO A;  2HCI A;  3KBX A;  3KF8 A;  2FJ2 A;  1O7Z A;  1SYE A;  1GUG A;  4ODG A;  1Q1B A;  3A55 A;  3MZ5 A;  3H3V C;  3ZYY X;  1LTI D;  4K14 A;  3S15 B;  3CHB D;  1V43 A;  2EYH A;  5KNB A;  4NDX A;  3I4N B;  1SYB A;  2BA1 A;  5CV5 A;  1H9R A;  2VB2 X;  1ILP A;  4C3J B;  3U9S A;  2FIN B;  5CV7 A;  3NBH A;  2A6H D;  5C0X I;  3HRZ C;  3F2U A;  2NN6 I;  2K28 A;  3RMH A;  3S2H B;  1SJH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...