2C5LC

Structure of plc epsilon ras association domain with hras
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
97
Chain Sequence
EESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSLSILSNPNPSDYVLLEEVVKDKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPASE HRAS
total genus 26
structure length 97
sequence length 106
chains with identical sequence D
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c5lC01
4IC7B 3WA0A 1GG3A 2KTRA 2ZCBA 2JZ3B 1NBFC 3K9PB 2N7DA 3OJ4B 1V5OA 1V9JA 2KMCA 3JSVB 1WGYA 2JVCA 3PZDA 1Q5WB 4GSWA 3KUCB 1C3TA 2M4NA 4MSMB 5DPSA 4GGQA 2KQSA 1UELA 3Q3JA 4NNJB 3U8ZA 2DZKA 3PVLA 2MBOA 2V4LA 2ZVNA 2O2VA 3A9KB 1V6EA 5DPRA 3ZNGC 3AI5A 2KXJA 3B1LX 4LJPB 1A5RA 1I42A 5AEKB 1TGZB 4BKSD 1P3QU 3L54A 3V6CB 3WAMA 3PLUA 3ZIMA 1G6JA 4ANWA 1GUAB 3O65B 3KUDB 2W9NA 4WWOA 3L10B 3VUWA 2BYVE 3VHTC 1LQBA 1WJ4A 2LGXA 3APFA 4HLEA 3QWZB 2Y5BB 1WM2A 4TUUA 1XQQA 2C7MB 2BF8B 2G4SA 2KWCA 2JT4B 2M0XA 4W9FA 5JHBA 2GBRA 3A4RA 3NY5A 1ZGUB 5C23A 3TCAA 5E6PA 3ZRFA 2UYZB 4DBGA 5CTRC 2KNBA 1OQYA 3JVZX 4FBJB 2BGFA 1IYFA 3B0AA 3ZTCA 3PHXB 4EZKA 5J18A 3S2AA 1WH3A 1YIWA 2DYOA 3M95A 4G50A 1Y8RC 1C1YB 2XK5A 3NZUA 3ZDMC 2K6QA 4N9F4 2IY1B 4TQ1A 3QCAA 4DWFA 3VUYA 3GZNI 3H1UA 1J19A 3SU8X 2L0FA 2LWPA 2QHOA 2FCSA 2K1FA 2KC2A 3QX1A 4GXBA 3ZNZB 4CYEA 1WJNA 3CF6E 2G45B 1RFAA 2L7RA 3ALBA 3N3KB 4TKNA 4HCNB 4HPLB 5LLIA 1E8WA 2ZCCA 1TBEA 1Q1OA 2HD5B 3SHQA 2LVPA 4DDGD 1WZ0A 4FA6A 2J0KA 2REXA 4NPNA 3U30A 2LI5A 2D11A 3RCZA 3H6NA 1WFYA 1GC7A 2JF5A 4FADA 1RAXA 2KDEB 5D7GA 2RGFA 3JYUA 4M8MA 3LDZE 4I6NB 3M3JA 4MDKE 3UQBA 2Z0EB 2K25A 3UF8A 2I1KA 1R4MI 4FHKA 3ZLZA 2KDBA 1RLFA 2LRWA 2ZJDA 4BFRA 2VRRB 2N1WA 5JH5C 5D94A 5KHOA 3VH4B 4W9IA 1WJUA 2NS5A 1X1MA 2KDFB 3ENEA 3A9KA 2O2VB 3VAWA 4JGHB 2NBVB 4AOFA 2AL3A 1H4RA 2KQ7A 2RSUA 3DBHI 4RM9A 3QC8B 3OJ3A 2DENB 1OTRB 3QA8A 4GIVA 2BWES 1WIAA 4W9LA 3AU5A 4BKTA 1UH6A 3RD2A 1WGHA 3RYTA 3SD5A 1KM7A 2KLCA 4MGIE 4JLCA 1R4NI 1TTNA 3PV1A 2A5UA 3VFKA 3KUZA 2IBIB 2M8SA 2BYEA 4I6LB 4WJNA 3RZWC 2FIFA 3PPAA 3R3MA 4FLHA 1XT9B 2FCMA 4M8NA 4WJQA 3V6EB 1WGDA 1WY8A 4IM2A 1H8CA 3V61A 1J8CA 2YLMA 3T8MA 5EDSA 1BT0A 2WDTB 2FCNA 1V86A 1LXDA 3K9OB 4B95A 2PJHA 5D2MB 5TR5A 3UINB 4AP4C 1WE6A 3QIJA 2PPHA 3N30A 1TZ1A 3MJWA 4IM3A 2CR5A 3EFUA 1T0YA 3MHSD 4NY0A 3R7QA 2GOWA 2DYMA 3JSVA 1Z5SB 4G3XB 4JIOU 4JL9A 2JZZA 2KTRB 2N9XA 3A9JA 4IM0A 2IY0B 2LGYA 5L95C 2DAJA 4IW0A 3A4SC 2KX0A 3QJZA 3RULA 1AARA 3SDLC 1OGWA 1WX8A 2NCNA 1GJZA 2ZEQA 1L2NA 3DBSA 2N9EB 2EMTA 2KWUB 2Z0DB 3DVGX 4A3PA 1E7UA 2NBUA 5AZFA 1EO6A 3IHPC 2FUHB 1IP9A 2DZIA 4GB9A 4MM3A 2O6VD 4NAWA 4BVUC 4MH0E 1WM3A 4HJKA 3L08A 2BKFA 2LXAA 3WAPA 3A1QB 4W9HA 3V60A 2ZNVB 5IA7A 4MJSA 2LASA 2YVCA 4XX5A 2D3GA 2GBNA 2I1JA 3ZVVA 4F7ZA 4FJYA 2L05A 3DVNU 4OVUA 5J17A 2G3QB 3TBLD 3ML9A 4DHZB 3L0WB 3I3TB 3W1SC 1WX9A 2N4FA 2MP2A 4W9EA 1S3SG 2NBWB 5GMVA 2LUEA 4K7WA 1UGMA 4KIKA 3ZTDA 5JHAA 2JXXA 2PEAA 5C1ZA 2CKHB 1K8RB 4W9CA 3H7PB 3X0WA 3ZUNA 1GNUA 1WX7A 1WR6E 3A9JB 4RM8A 2KWVB 1P9DU 3ZW3A 3VTVA 4P7IA 3WALA 1OEYA 3RZFA 2JWZA 2J0JA 3NOBA 2BWFA 2CU1A 2R2OA 2C9WB 3PS6A 1WI0A 2G4DB 4AJWA 4HCPB 2ZPYA 2KVRA 3CMMB 3EECA 3HIZA 4FHJA 2O6VA 2A4ZA 2MBBB 3VH3B 2KFKB 2AYOB 2RR9A 4W9JA 2KN5A 4F1SA 1KJTA 4W9KA 4K1RB 4A20A 4BKSA 5KHQA 2IO1B 4WWPA 1V81A 1EUVB 3WAOA 3TMPB 3KVFB 3HK0A 4DK5A 4URKA 2ZNVC 3BY4B 3VTUA 3KH0A 3AXCA 2JUOA 2KFKA 4E74A 2KFJA 3UGBB 2ASQA 1P1AA 4HK2A 3PRMB 4GN1A 4BBNF 4KVGB 1I35A 2MCNB 4PS7A 4FJZA 1P0RA 4KDLB 2AEHA 2HE7A 2CHWA 1IPGA 1M94A 3DQVA 4ANVA 3ML8A 2LD9A 2DX5B 2DYBA 2L8JA 4WJOA 4KV2A 1E8YA 2MWSB 3QHTA 4FN2A 3U7DA 4ANUA 2LZ6A 1SIFA 2C5LC 2IO2B 2ZPNA 4G0NB 2JPHA 2L0TA 2O6VB 4ZRKA 3M62B 5E6OA 3H7PA 2KANA 4DXAB 4EKUA 4ZRJA 2L00B 1EF5A 4KIKB 3NHEB 3M63B 3AU4A 5G55A 1Q0WB 4EZLA 3IG3A 5D6JB 3VVWB 3JW0X 4HPMB 1FXTB 2KC1A 2BYFA 4BKGA 1JRUA 4GDKB 4ICUA 4BOZB 4EOYA 1SE9A 2GBJA 3Q3FA 3T9LA 2KHWB 4G11A 3PHWB 2OJRA 3IFWB 4MGZE 3H9DA 4DDID 1E90A 1UBQA 2GBKA 4GMVA 4II2B 1HE8A 4KZCA 4MEMA 1KOTA 2FNJB 3KYCD 3WANA 4LDTB 4TQ0A 1WRDB 1WZ3A 2KK8A 5HKHA 3QAQA 3DBRI 3B08A 1YD8U 4GDLB 4MJSB 2MSED 4X57B 2D2QA 5FR6A 3UIPB 2LVOA 1ZKHA 1D3ZA 5DPTA 4XC2A 4EEWA 2MQJA 3EC8A 2BKRB 1V5TA 2J7QB 3EHVA 2MBHA 4J6IA 3VTWA 2M17A 3QK0A 3APCA 1WXSA 4K7UA 3PTFC 2PE9A 4ZYNA 2Z59B 2ZVOA 1SGHA 2KKCA 3DCGA 4CO7A 2KJRA 5DPWA 3KYDD 1NI2A 1UD7A 4BOSC 2KDIA 2KJHB 2R2QA 1U4AA 2K39A 4BBNC 4FULA 2FCQA 2K6DB 3ECIA 4I6PA 2KX3A 2CS4A 2LGDA 3A33B 3R66C 4PYUA 1YQBA 1WYWB 2MBQA 3PGEA 2XBBC 4NQKE 2UWQA 3NZSA 4GU2A 4K7SA 2FIDA 4GDLA 1WR1A 2HJ8A 1S1QB 1J0GA 2C7NB 4JQWC 2KTFA 2KO3A 1RRBA 2JY6A 1YX5B 2KOXA 1E8XA 5IAAC 4AUQC 3ONSA 2MP2B 2GMIC 3OAWA 4DHJD 2RPQA 4CHKA 3DVNV 2CHZA 2HTHA 3VDZA 2FAZA 1NDDA 2LRUA 3DDCB 4YL8A 1YX6B 1E7VA 4HDQA 3ZDTA 2WX0A 1PQSA 1V49A 4GDKA 3RUIB 4II3B 4LCDE 2D10A 3BINA 5E6NA 1WJ6A 2IZVB 1WF9A 4WWNA 2DHZA 5AZGA 2LJ5A 2C60A 2LXCA 3GOEA 4W9GA 3DPDA 1LM8B 1WE7A 2IO0B 4HDOA 2K8HA 3HHMA 4MELA 3AULA 3D32A 1P98A 1WMHA 4EZJA 3CSTA 4LJOB 3ZRCA 1WXMA 4DHZE 4EUTA 1UZXB 4MGKE 4NJ7A 2KLGA 1WXAA 2K8BA 3WIMA 3L13A 3PLVA 3ZNID 3VXWA 4GOCA 1V80A 4ASWC 3H7SA 1CMXB 3PREA 4DHJB 4LDTD 3W1SA 5LXIB 3PRPB 4IUMB 4HWIB 4KSLC 3KW5B 4W9DA 2JRHA 1ISNA 5LXHA 3DBLI 2D07B 2JRIB 3ZKJC 2WWZA 2GBMA 2J0MA 3UQAA 2MRPA 4WJPA 2XK5B 1UBIA 1E5WA 3ZO5B 2N1VA 4KDIC 5G2NA 3A1QA 3L17A 2DAFA 2AWTA 4ICVA 4WAAA 5CHFA 3RT3B 4F8CB 3HM3A 4TV3A 4WQOB 1ZW7A 2BPSA 4RMAA 4AJYB 3MTNB 1Z2MA 3IBEA 4ANXA 5CX3A 1YJ1A 4NJ6A 4HVBA 1KLVA 3QQ8B 1EF1A 4OVVA 4IWQA 4E71A 3P2BA 4ZDVA 5AZHA 4XZ4A 4PS3A 2L76A 3TL5A 1F9JA 4EFOA 1MG8A 2EKEC 2NVUI 1WMHB 2AL6A 3LJ3A 4KSKC 4B6WA 2WYQA 4HXDA 4NQLB 5L83A 2L3ZA 2KJ6A 3DOWA 5J2RA 2MW5A 2KD0A 2M1MA 3UIOB 3L16A 1V2YA 2N9PC 2KZRA 4FJVB 2ZZPB 2NR2A 4PYZA 3NS8A 1L7YA 3HM6X 2V3SA 2LVQA 3PT2B 5JZEB 2MBEA 4IG7B 1WXVA 3QARA 4B9KA 2NPTA 4NAWB 3VUXA 2MA9B 3VQIA 2DZJA 2OOBB 1WGGA 2XEWA 3N32A 4MSQB 2WX1A 2V1YA 2DZMA 3C0RB 1WGRA 2EMSA 2IO3B 2MX2A 2MLBA 3TJPA 1LFDA 2NPTB 3CSFA 4MGYE 2K8CA 5CHWA 4KZ0A 1GC6A 1QZEA 3R7RA 3TIXA 2KMAA 3APDA 3OLMD 4AWJA 2IYDB 4A3OA 3V62A 1VD2A 5DCNA 2RD0A 1VCBA 4PS8A 3W1YA 2C7HA 4IWOA 4M0WB 1E8ZA 1XD3B 3ZNHB 3X23A 3PRZA 2CHXA 2PE6B 4K81A 5BO4B 2B3AA 3IVFA 5CHVC 1OEYJ 3DVGY 2N7EA 3PSEB 4IWPA 4ZRIA 4E3CA
chains in the Genus database with same CATH superfamily
3B9JA 3WA0A 3OJ4B 1IBXB 1V9JA 2WXRA 1LGRA 3MFGA 2M4NA 4MSMB 3U52E 2PVOD 5H92C 5IO9A 2BBCA 3KWLA 3U7ZA 1A70A 3PVLA 3BVGA 3A9KB 3AI5A 1TGZB 3SFEB 1GUAB 3O65B 2UU7A 4WWOA 3BVMA 3L10B 1C78A 3NRZA 1WM2A 4USAA 2KWCA 2M0XA 1ZGUB 5C23A 1I4XA 5CTRC 2KNBA 2BGFA 5G5HA 4EZKA 1L6UA 5J18A 3AE7B 2DYOA 3M95A 3RI7C 3ZDMC 4G50A 4N9F4 4L23A 3NZ3A 2VZKB 3SU8X 2LWPA 4GXBA 3ZNZB 2Y5CA 3CF6E 2G45B 4TKNA 2ZCCA 4REZA 2J52A 2LVPA 4XDCA 4US9A 1N61A 4YTPB 2LEKA 1I4QA 1TY2A 3H6NA 1WFYA 1SEBD 4FADA 1RAXA 4OVZA 2W82A 2M0AA 2RGFA 2INPE 5AUIA 4M8MA 2HDEA 1JWBD 1C4CA 3LDZE 4I6NB 4MDKE 1TS2A 2CJNA 3W5UB 3AE6B 5JH5C 1F2RC 3UI3A 2H88B 2NS5A 2QC8A 2XNAC 5MPOA 3B2GA 4RFBA 3VAWA 4JGHB 1B9RA 3GP7A 1WGKA 1TS3A 3QC8B 1OTRB 4GIVA 3GE3C 4LNKA 1WGHA 3SD5A 1KM7A 2H89B 1TTNA 3PV1A 2A5UA 3VFKA 4MM3B 4WJNA 3N9YC 4WIPA 4A6QA 4OZAA 3V6EB 1WGDA 3T8MA 1BT0A 2FCNA 1PGXA 1V86A 2N9KA 1ZE3D 4B95A 5TR5A 3N30A 4IM3A 4NY0A 3R7QA 2GOWA 2DYMA 2I38A 2JZZA 2N9XA 4N58A 2ON8A 2DAJA 2KX0A 1GJZA 3DHGC 1WX8A 2NCNA 4J3OD 1NI3A 1L2NA 1V97A 1ET6A 3P4QB 1E7UA 1VR9A 1AYFA 3IHPC 3IT6B 3V3XA 1D5ZC 2WXKA 2WXLA 1YN5A 1YMHE 4W9HA 2ZNVB 5J17A 1T0RC 2LGIA 4L2YA 1KLUD 2WXQA 1WX9A 2N4FA 4W9EA 1S3SG 2NBWB 2LUEA 4KIKA 3J9CA 1TKGA 4OZCA 2PEAA 5C1ZA 1K8RB 4W9CA 3H7PB 2BW2A 1WR6E 4RM8A 3AE9B 1P9DU 1ESFA 1KTKA 3NOBA 4IDIA 3RNAC 2CU1A 5HFYA 1HTOA 3NS1A 2G4DB 2KVRA 1OQQA 2KVZA 3HIZA 1L4ZB 2KN5A 1KJTA 5KHQA 4K1RB 4A20A 2IO1B 2AQ1B 3I63C 1EUVB 3NVVA 3TMPB 3KVFB 4DK5A 3AXCA 4E74A 1J7AA 2ASQA 4KDLB 1YQ3B 2AEHA 2CHWA 4ANVA 1TZOA 1EWYC 2DYBA 4WJOA 4H2AA 1R4MB 4ANUA 2LZ6A 4G0NB 3RNGC 2JPHA 4JPSA 2O6VB 1SF0A 3H7PA 4EKUA 1TKYA 4KIKB 3M63B 5G55A 4RH6A 4OW0A 4HPPA 4BKGA 4BOZB 4G11A 3N20C 3RMKC 2OJRA 3IFWB 5HI1A 4YTNB 2MHJA 4KZCA 4OZBA 1YN3A 1I4RA 3WANA 3AE1B 1WRDB 3SR6A 3V05A 3NVWA 5IOIA 3TEWA 4X57B 2D2QA 3P4SB 2CU3A 5DPTA 4XC2A 1PDXA 2BKRB 2MBHA 3VTWA 1L4DB 2SAKA 3LYYA 2ZVOA 3DCGA 1CZPA 2KKCA 2XN9C 1UD7A 2QJLA 2KDIA 2R2QA 2K39A 2FCQA 3ECIA 2LGDA 3R66C 4PYUA 2MBQA 1WYWB 1EU3A 2XBBC 3NZSA 2FIDA 2WLBA 3RNBC 1S1QB 2KTFA 2KWDA 2KO3A 1YX5B 3E9SA 2GMIC 2RPQA 3VR9B 3DVNV 3MC0B 2D3AA 5HHDG 2LRUA 1RWSA 1D5MC 2WXPA 3TEYA 1VZ8A 1TIFA 2D10A 1B1ZA 1WJ6A 1DGJA 4YSZB 2LJ5A 1LM8B 2IO0B 1HTQA 2K8HA 4MELA 2WXMA 4ZHPA 4LJOB 3ZRCA 1FRDA 1WXMA 4EUTA 2N9LA 1XXGA 3L13A 3PLVA 1KLGD 2GB1A 2INCC 3TSSA 3W1SA 4KSLC 4JE3B 4K3BA 2D07B 5BMGA 2GBMA 2ACZB 4XYCA 2QIEB 2LHEA 2KYWA 5G2NA 1QOFA 3ABVB 3SFDB 4ICVA 5CHFA 4TV3A 4RMAA 3R2IA 4AJYB 3MTNB 1Z2MA 3IBEA 1T0SC 5CX3A 1XLQA 1YJ1A 3N1XC 3AEBB 4HVBA 5AZHA 3HUIA 4XZ4A 2L76A 2KDMA 4B0EA 1FD6A 2W3RA 5EE0A 4B6WA 1Y56A 4NQLB 3AV8A 3GE8C 2MW5A 1JCKB 1TJEA 2M1MA 3L16A 2WDRB 2ZZPB 4PYZA 3NS8A 3HM6X 4HROA 1D6EC 2MBEA 3U2SC 4IG7B 2NPTA 3N32A 4MSQB 2WX1A 1SE2A 2V1YA 1F0ZA 2QMTA 3NVZA 2BS4B 2MLBA 4O1NA 2V3PA 2KMAA 1VD2A 3ZXRA 1T6BX 3ZJUA 5BO4B 1OEYJ 3ZJTA 4ZRIA 4E3CA 1FNVA 1IBXA 1JWMD 1V5OA 2KMCA 1T5XD 2JVCA 3BWUD 5IN7A 2L1AA 1AN8A 1C3TA 4XE0A 5DPSA 3KQ4A 2KQSA 3Q3JA 2PW9A 3BK1A 4WQMA 2MBOA 4RF0A 2O2VA 5DPRA 3ZNGC 3B1LX 4LJPB 1I42A 1FXAA 5AEKB 1M4VA 2HJ1A 3L54A 3PLUA 3ZIMA 1YJJA 1R7SA 2W9NA 3KUDB 3C8YA 2W3SA 2LGXA 3RFZB 4TUUA 1XQQA 2K3UA 1UNSA 2GBRA 3A4RA 3P4RB 3TCAA 2D3CA 1L0YB 2DBYA 3ZTCA 3PHXB 3C19A 3EUB2 3S2AA 1WH3A 1C1YB 3NZUA 2L52A 2K6QA 1C4PA 4TQ1A 1GAQB 3BIID 2KC2A 3QX1A 2X8XX 3ALBA 1E8WA 1Q1OA 3SHQA 1WZ0A 2LI5A 3RCZA 1NYRA 5D7GA 2BVCA 2WNMA 3AN1A 3M3JA 5FK9C 2Z0EB 2SEBD 3WCQA 3ZLZA 2KDBA 4BFRA 2VRRB 2W55A 5KHOA 1JRPA 4LK0M 2INDC 1JWSD 4AOFA 2AL3A 3IXSA 2RSUA 3DBHI 3DBHB 4RM9A 2WXGA 3OJ3A 1WIAA 3R2TA 3AU5A 4L1BA 2RDBC 1UH6A 2AQ2B 3RYTA 4JLCA 1R4NI 2IBIB 2BYEA 4I6LB 3RZWC 2FCMA 2JZPA 1JALA 3Q8CA 4KKIA 4WJQA 3V61A 2WDTB 4TSSA 1LXDA 1UGJA 1WE6A 3QIJA 3VDZA 4YT0B 4G3XB 5D3IB 1HZ5A 2LGYA 4IW0A 3A4SC 3RULA 1OGWA 2LJIA 2EMTA 4A3PA 3HVDA 2NBUA 3URYA 4GB9A 1EWCA 4BVUC 4HJKA 1HEZE 4HKZE 2PKOA 2LGSA 5IA7A 5BYSA 1PYWD 2I1JA 2WXIA 4FJYA 3DVNU 4BZAA 1BXTA 2MP2A 5GMVA 3AEEB 1XCQL 3ZUNA 2KN4A 2KWVB 5EE9A 2Z8LA 2DWQA 3Q3OC 2WXOA 3DBRB 4C00A 1QOGA 2C9WB 1N6ZA 3PS6A 2ZPYA 3CMMB 1MHHE 3EECA 2O6VA 4HRSA 2MBBB 1FEHA 4W9JA 4BKSA 4WWPA 3WAOA 3HK0A 1LO5D 3BY4B 3AH7A 1NYQA 2IJ0A 2KFJA 2D5GA 3PRMB 4GN1A 3E56A 4BBNF 4KVGB 1SE3A 2ZW1A 1P0RA 1P7EA 1M94A 3ML8A 5I4DA 2L8JA 4PT5A 4R3DA 1FO4A 2MWSB 1SIFA 1Q10A 2C5LC 2ZPNA 4ZRKA 4ARIA 2WXFA 2GLSA 2KANA 4ZRJA 4CQNA 3NHEB 1WRIA 3AU4A 3AEDB 4HJGE 3JW0X 1FXTB 2BYFA 4GDKB 4ICUA 4A8XC 2GBJA 3Q3NC 2KHWB 3PHWB 4MGZE 3DBLB 1E90A 1HE8A 2RDHA 1CJEA 1WXQA 3KYCD 4Q2JA 2L83A 3QAQA 5HKHA 1RFKA 1TS4A 2MSED 1ACCA 4EEWA 1V5TA 3EHVA 3FC4A 2WU5B 3APCA 3Q8BA 2Z59B 2VH2A 2KQ4X 3KYDD 2KJHB 1U4AA 1BUIC 1GB4A 2Y3AA 4I6PA 2CS4A 4LNOA 4M0WA 1IUEA 2EKIA 2R61A 4GU2A 4RCOA 4GDLA 1J0GA 1MPEA 4JQWC 2RMMA 5IAAC 2J53A 4CHKA 1F77A 2HTHA 2FAZA 3AECB 1STEA 3Q8AA 5HG2A 1V49A 1JROA 4II3B 5E6NA 5AZGA 4DXGA 1CK1A 4W9GA 4TMAB 4NJCA 4YTMB 2FUG1 1ROEA 2BYTA 4HDOA 3HHMA 3AULA 4EZJA 2BB5A 4RGTA 3B2FA 1UZXB 4MGKE 3WIMA 3MHZA 4GOCA 3H7SA 4IKGA 1CMXB 3PREA 4LDTD 3PRPB 2JRHA 5LXHA 2JRIB 1FFVA 4WJPA 2XK5B 2J4XA 3ZO5B 3I5JC 2JWUA 3Q8FA 2N1VA 4KDIC 3A1QA 3L17A 2DAFA 1GB1A 2AWTA 2QEJC 1K51A 4WQOB 1ZW7A 2BPSA 2BT6A 1T0QC 4NJ6A 3ZGZA 1HXYD 2WGSA 4E71A 2MJ3A 1FXIA 3TL5A 2NVUI 3LJ3A 4HXDA 5L83A 2KJ6A 2G1EA 5J2RA 1V2YA 2KZRA 4FJVB 2MJEA 2NR2A 5D3DA 2LVQA 3Q14C 1FCCC 3BYYB 2WDVB 3CIRB 2WU2B 3VUXA 1N5XA 2NTSA 2OOBB 1WGGA 1QOBA 2WQYB 1GPXA 3SEBA 1JQ4A 2DZMA 1XLNA 1XLOA 2MX2A 1LFDA 1MFWA 2NPTB 4KZ0A 3AEFB 4AWJA 2V0GA 3V62A 2WHIA 5LNK1 4IWOA 4M0WB 1E8ZA 2CHXA 4KX6B 1F1HA 3IVFA 5CHVC 2N7EA 4YSYB 3BK2A 4M01A 4EE2A 2N7DA 1D4BA 3JSVB 1WGYA 3PZDA 4GSWA 3KUCB 3IT4B 1VRAB 3U8ZA 1N60A 4NNJB 2I2YA 2DZKA 2PLPA 4HEA1 2V4LA 2KXJA 1A5RA 4BKSD 1JW9D 3WAMA 4ANWA 2OHFA 2BYVE 3VHTC 4HLEA 2Y5BB 1HZ6A 2BF8B 2G4SA 3NY5A 5E6PA 4ACFA 4ZRQA 3ZRFA 2UYZB 4DBGA 1L6VA 4RGNA 3JVZX 4FBJB 3B0AA 2W54A 2JQRB 1YIWA 1FFUA 1SXTA 4P6VF 3GZNI 1J19A 2L0FA 2FCSA 2K1FA 4C4VA 4CYEA 4KKJA 3O13A 1WJNA 2L7RA 3N3KB 4HCNB 5LLIA 1XF5L 3ZQ4A 5T8IA 2REXA 3GS2A 2D11A 2V9HA 1FM0D 4IOIE 1GC7A 3H8HA 1QF6A 2CJOA 3Q8EA 3UQBA 3UF8A 2I1KA 1VLBA 2LRWA 2ZJDA 4ZRPA 5D94A 4N59A 3VH4B 4RGOS 4W9IA 1WJUA 2NMQA 2KDFB 2O2VB 2QCZA 1I4PA 4LNIA 2JU6X 2PIAA 2DENB 3QA8A 2BWES 4NZLB 4W9LA 1TS5A 3RD2A 2KLCA 1SBBB 4XDDA 3KUZA 3ZYYX 3NUHB 3PPAA 1XT9B 5BYQA 4M8NA 1WY8A 2YLMA 1QLBB 5IKCM 2M56B 2AQ3B 3K9OB 2PJHA 5D2MB 3UINB 4AP4C 1TZ1A 2CR5A 3EFUA 3MHSD 3OWEB 4A55A 4C7ZA 4JIOU 1Z5SB 4JL9A 2KTRB 2IPKD 2IY0B 3QJZA 2ZEQA 2N9EB 3GB1A 2KWUB 2Z0DB 3FKYA 4RGMA 1DYQA 4KGRA 4MH0E 1C4AA 3PO0A 2LXAA 3AM9A 3V60A 2LASA 4XX5A 2JSVX 2GBNA 4BAXA 5H8YE 2G3QB 3TBLD 1TKEA 1UGMA 3ZTDA 5JHAA 2JXXA 4WURA 1JWAD 3X0WA 3ZXVA 3ZW3A 3VTVA 1OEYA 3RZFA 2JWZA 3P42A 2BWFA 1I4HA 4ZOHC 1IGCA 1WI0A 4AJWA 1ZXHA 4XWWA 4FHJA 4PK1A 3VH3B 2KFKB 2AYOB 2N7JA 2BTEA 1V81A 1YOVB 4URKA 3VTUA 2YEPF 3KH0A 1N63A 4XGAB 1ZPSA 3UGBB 1P1AA 4HK2A 4PS7A 4FJZA 2K0PA 1HA5A 1JWUD 2WXJA 2JX5A 2LD9A 5FR3A 2DX5B 1WWTA 1JMLA 4FN2A 3U7DA 2IO2B 2PMVA 2L0TA 2E3TA 2BQQA 3M62B 5E6OA 4QAYA 1TYGB 2L00B 3OG5A 1Q0WB 1TT5B 1VZ6A 1JRUA 2GRIA 3Q3FA 3PZ7A 5C2TB 3T9LA 1OFFA 1PFDA 4P16A 4MEMA 1E10A 1KOTA 2FNJB 1K52A 3N1ZC 3DBRI 3B08A 1YD8U 4GDLB 4MJSB 1D3ZA 2LVOA 1ZKHA 2MQJA 4A90A 1J7BA 5FKAC 4J6IA 1WYGA 3QK0A 2J42A 4LTUA 2PE9A 4ZYNA 1FNUA 1SSNA 4CO7A 2YEPB 4MH8A 4BOSC 1OQRA 3Q3MC 4BBNC 4FULA 2K6DB 2KX3A 1KF6B 1YQBA 3LB8C 4NQKE 2L32A 2HJ8A 2FBWB 1RRBA 4AUQC 1E8XA 3MC9A 2FE8A 4DHJD 1SB3C 4WAFA 4LNNA 1RM6C 4YL8A 2TSSA 4YXDB 1E7VA 3ZDTA 2LHDA 4GDKA 3DWMA 1NVID 4LCDE 1V1PA 3BINA 3TEZA 2QSDA 4HKQA 2EELA 1WF9A 1QKZA 3LXFA 2DHZA 2LXCA 4GLSC 3DPDA 3VRAB 4XWTA 2QDFA 2WS3B 1ZP0B 1NENB 1P98A 3D32A 4P1BC 4MACA 4DHZE 4NJ7A 1QOAA 2KLGA 4RNAA 2K8BA 3ZNID 4DXFA 3HVZA 4ASWC 3FILB 3RNCC 4DHJB 5LXIB 4M02A 4HWIB 1ISNA 2AX5A 3DBLI 3EFCA 3UQAA 1IGDA 1ZUD2 2ICIA 5TSSA 4A9AA 1F2RI 1C9FA 2DNFA 1DOYA 3MJ5A 4WAAA 3RT3B 4F8CB 3HM3A 1K53A 4ANXA 1GOZA 1YNTE 2HTME 4JWSC 1KLVA 2LFIA 1ENFA 2IGHA 4LLGM 4IWQA 1AWDA 3IAS1 3P2BA 4OVVA 5BMIA 3DHHC 4PS3A 5E6JA 1KH0A 1F9JA 4EFOA 4D2KA 3I9V1 4JWUC 2AL6A 4KSKC 3KWVA 2L3ZA 4B0MA 2V4IB 2KD0A 3UIOB 2N9PC 4S0RA 5GXGB 3DHIC 2Y5PA 4B9KA 2MA9B 3VQIA 2DZJA 2XEWA 1WGRA 2EMSA 4MT5A 2IDYA 3MP9A 1VJKA 3Q69A 3W5VB 3TJPA 4MGYE 1BMLC 2K8CA 5CHWA 1QZEA 1D5XC 3OLMD 3HRDD 2K9XA 3W1YA 1VCBA 3TUOA 1XO3A 2WP9B 1FNWA 2PE6B 3T3NA 2M19A 1C79A 4IWPA 5BYRA 4IC7B 1GG3A 2KTRA 2ZCBA 2JZ3B 1NBFC 2PVGC 3K9PB 2Q5WD 1Q5WB 2BS3B 1DOIA 2LUMA 3PZ8A 1R4NB 4GGQA 4C4VB 1UELA 1NEKB 5EE1A 3RPFC 2ZVNA 1V6EA 1XEEA 1QQRA 1P3QU 3V6CB 1G6JA 3DWGC 3VUWA 4AS1A 1LQBA 1L5PA 3P1MA 1WJ4A 3APFA 3QWZB 4UDUC 4W9FA 2C7MB 1HQRD 2JT4B 5JHBA 3FAHA 2BB6A 2MJDA 1MG4A 3ETRA 1C76A 1OQYA 1SIJA 2LMCA 1IYFA 2KAJA 1FPYA 4ITKA 1Y8RC 2XK5A 1YJIA 2IY1B 3QCAA 4DWFA 3VUYA 3AE5B 1E7PB 3H1UA 1CQVA 2QHOA 2QILA 2BS2B 2X38A 1RFAA 4HPLB 1TBEA 2HD5B 4DDGD 2V3NA 4FA6A 2J0KA 1MI0A 4WH4A 4NPNA 3U30A 5BMHA 3AMZA 2JF5A 2KDEB 4K3CA 1PGBA 1UF0A 3JYUA 2B76B 1TY0A 1F52A 2K25A 1R4MI 1KFYB 4FHKA 1RLFA 2N1WA 4S17A 3RNFC 1X1MA 3ENEA 2JYTA 3A9KA 2NBVB 4AQ7A 1FIQA 1H4RA 2KMMA 2KQ7A 1YQ4B 1KRHA 1FRRA 5G5GA 1E6EB 2K5PA 4BKTA 4KGSA 1SE4A 3N1YC 3VR8B 4MGIE 1L0VB 3Q2AC 2M8SA 1FMAD 2FIFA 4FLHA 3R3MA 4C7YA 4IM2A 3NVYA 1H8CA 2E6XA 1J8CA 5EDSA 1I4GA 1V8CA 2PPHA 3MC8A 3MJWA 1T0YA 3JSVA 2K22A 3A9JA 4IM0A 5L95C 2IGDA 3SDLC 4RF1A 1AARA 4ZYSA 3DBSA 1DOXA 3DVGX 5AZFA 1VDVA 1EO6A 2G9HD 2FUHB 1IP9A 2DZIA 4MM3A 2O6VD 4NAWA 4OHJA 1EU4A 1RYJA 1WM3A 3L08A 1QT9A 2BKFA 4JX1C 3WAPA 3A1QB 4C80A 4MJSA 2YVCA 2D3GA 4YWGG 3ZVVA 4F7ZA 2L05A 4OVUA 2RDGA 3ML9A 4DHZB 1ZDVA 3I3TB 3L0WB 3W1SC 4K7WA 1QILA 2CKHB 1GNUA 1WX7A 3A9JB 1K50A 3AEGB 4P7IA 3WALA 2J0JA 2R2OA 3T3OA 1EM7A 4HCPB 2A4ZA 2RR9A 4LNFA 4F1SA 4W9KA 1T3QA 1XLPA 1N62A 2PTLA 4FXCA 1SJED 2ZNVC 2JUOA 2KFKA 3AE4B 1V1OA 1I35A 2MCNB 3BZDB 2HE7A 4M00A 2GI9A 1IPGA 3DQVA 4KV2A 1E8YA 3GZNB 3QHTA 1PUTA 1UUPA 1ZXIA 4DXAB 2MH7A 1EF5A 1ZOYB 1UWXA 3U4EG 4EZLA 3IG3A 5D6JB 3VVWB 2RPVA 4HPMB 2KC1A 2VH1A 4EOYA 1SE9A 4DDID 3H9DA 1UBQA 2GBKA 4GMVA 4II2B 5AUKA 2NTTA 1C77A 4LDTB 4TQ0A 1WZ3A 2KK8A 1WSPA 3VRBB 1UWMA 3AE2B 3W9CB 5FR6A 3UIPB 4WWMA 3EC8A 2J7QB 3L4PA 2M17A 1WXSA 4K7UA 4N6EB 3PTFC 2WXNA 1SGHA 5DPWA 2KJRA 3RN9C 1NI2A 3P4PB 5EE3A 3AB5A 3A33B 3RNEC 3PGEA 2UWQA 3BYTB 4K7SA 3W2DA 1AW7A 1WR1A 2C7NB 2KOXA 2JY6A 3ONSA 4ARCA 2KT7A 2MP2B 3OAWA 2CHZA 3EA6A 1NDDA 3DDCB 1YX6B 4HDQA 1ZDXA 2WX0A 1PQSA 3RUIB 3I57A 3BVZA 2JYEA 2IZVB 2ONQA 4WWNA 3GOEA 2C60A 4P1CC 1N5WA 3KLSX 1WE7A 3TEXA 1MJDA 2MEKA 1WMHA 3CSTA 1J7CA 1VZ7A 5JXVA 3AE3B 1WXAA 5IP4D 1L0XB 3VXWA 1V80A 2KACA 2N0SB 3CWIA 4KGTA 1PGAA 3ZJVA 1I7HA 2WDQB 4IUMB 3KW5B 4W9DA 3ZKJC 2WWZA 1P7FA 2J0MA 2MRPA 1MHXA 1MVKA 1UBIA 1E5WA 1ET9A 4C56C 4NAMA 2D3BA 2VZKD 1SJHD 1FCLA 3FILA 3QQ8B 1E9MA 1EF1A 5C3JB 4ZDVA 3NG0A 1MG8A 1XCTL 2EKEC 2JXTA 1WMHB 2WYQA 3Q6BA 3DOWA 2IGGA 1YN4A 3AE8B 1L7YA 1V1PB 2V3SA 3PT2B 3AEAB 5JZEB 1WXVA 3QARA 4NAWB 4ZHOA 4YSXB 3C0RB 2WXHA 2IO3B 3CSFA 2OJWA 1GC6A 3R7RA 3TIXA 3APDA 2IYDB 4A3OA 3R8BA 5DCNA 2INNE 2RD0A 4PS8A 2C7HA 3NJTA 1XD3B 3ZNHB 3X23A 1E0ZA 2ZW0A 3IAM1 3PRZA 3EGRA 2DLBA 4K81A 2B3AA 3DVGY 3PSEB 4US8A 3P63A 2OEDA 4DQOC
chains in the Genus database with same CATH topology
4IC7B 3WA0A 1GG3A 2KTRA 2ZCBA 2JZ3B 1NBFC 3K9PB 2N7DA 3OJ4B 1V5OA 1V9JA 2KMCA 3JSVB 1WGYA 2JVCA 3PZDA 1Q5WB 4GSWA 3KUCB 1C3TA 2M4NA 4MSMB 5DPSA 4GGQA 2KQSA 1UELA 3Q3JA 4NNJB 3U8ZA 2DZKA 3PVLA 2MBOA 2V4LA 2ZVNA 2O2VA 3A9KB 1V6EA 5DPRA 3ZNGC 3AI5A 2KXJA 3B1LX 4LJPB 1A5RA 1I42A 5AEKB 1TGZB 4BKSD 1P3QU 3L54A 3V6CB 3WAMA 3PLUA 3ZIMA 1G6JA 4ANWA 1GUAB 3O65B 3KUDB 2W9NA 4WWOA 3L10B 3VUWA 2BYVE 3VHTC 1LQBA 1WJ4A 2LGXA 3APFA 4HLEA 3QWZB 2Y5BB 1WM2A 4TUUA 1XQQA 2C7MB 2BF8B 2G4SA 2KWCA 2JT4B 2M0XA 4W9FA 5JHBA 2GBRA 3A4RA 3NY5A 1ZGUB 5C23A 3TCAA 5E6PA 3ZRFA 2UYZB 4DBGA 5CTRC 2KNBA 1OQYA 3JVZX 4FBJB 2BGFA 1IYFA 3B0AA 3ZTCA 3PHXB 4EZKA 5J18A 3S2AA 1WH3A 1YIWA 2DYOA 3M95A 4G50A 1Y8RC 1C1YB 2XK5A 3NZUA 3ZDMC 2K6QA 4N9F4 2IY1B 4TQ1A 3QCAA 4DWFA 3VUYA 3GZNI 3H1UA 1J19A 3SU8X 2L0FA 2LWPA 2QHOA 2FCSA 2K1FA 2KC2A 3QX1A 4GXBA 3ZNZB 4CYEA 1WJNA 3CF6E 2G45B 1RFAA 2L7RA 3ALBA 3N3KB 4TKNA 4HCNB 4HPLB 5LLIA 1E8WA 2ZCCA 1TBEA 1Q1OA 2HD5B 3SHQA 2LVPA 4DDGD 1WZ0A 4FA6A 2J0KA 2REXA 4NPNA 3U30A 2LI5A 2D11A 3RCZA 3H6NA 1WFYA 1GC7A 2JF5A 4FADA 1RAXA 2KDEB 5D7GA 2RGFA 3JYUA 4M8MA 3LDZE 4I6NB 3M3JA 4MDKE 3UQBA 2Z0EB 2K25A 3UF8A 2I1KA 1R4MI 4FHKA 3ZLZA 2KDBA 1RLFA 2LRWA 2ZJDA 4BFRA 2VRRB 2N1WA 5JH5C 5D94A 5KHOA 3VH4B 4W9IA 1WJUA 2NS5A 1X1MA 2KDFB 3ENEA 3A9KA 2O2VB 3VAWA 4JGHB 2NBVB 4AOFA 2AL3A 1H4RA 2KQ7A 2RSUA 3DBHI 4RM9A 3QC8B 3OJ3A 2DENB 1OTRB 3QA8A 4GIVA 2BWES 1WIAA 4W9LA 3AU5A 4BKTA 1UH6A 3RD2A 1WGHA 3RYTA 3SD5A 1KM7A 2KLCA 4MGIE 4JLCA 1R4NI 1TTNA 3PV1A 2A5UA 3VFKA 3KUZA 2IBIB 2M8SA 2BYEA 4I6LB 4WJNA 3RZWC 2FIFA 3PPAA 3R3MA 4FLHA 1XT9B 2FCMA 4M8NA 4WJQA 3V6EB 1WGDA 1WY8A 4IM2A 1H8CA 3V61A 1J8CA 2YLMA 3T8MA 5EDSA 1BT0A 2WDTB 2FCNA 1V86A 1LXDA 3K9OB 4B95A 2PJHA 5D2MB 5TR5A 3UINB 4AP4C 1WE6A 3QIJA 2PPHA 3N30A 1TZ1A 3MJWA 4IM3A 2CR5A 3EFUA 1T0YA 3MHSD 4NY0A 3R7QA 2GOWA 2DYMA 3JSVA 1Z5SB 4G3XB 4JIOU 4JL9A 2JZZA 2KTRB 2N9XA 3A9JA 4IM0A 2IY0B 2LGYA 5L95C 2DAJA 4IW0A 3A4SC 2KX0A 3QJZA 3RULA 1AARA 3SDLC 1OGWA 1WX8A 2NCNA 1GJZA 2ZEQA 1L2NA 3DBSA 2N9EB 2EMTA 2KWUB 2Z0DB 3DVGX 4A3PA 1E7UA 2NBUA 5AZFA 1EO6A 3IHPC 2FUHB 1IP9A 2DZIA 4GB9A 4MM3A 2O6VD 4NAWA 4BVUC 4MH0E 1WM3A 4HJKA 3L08A 2BKFA 2LXAA 3WAPA 3A1QB 4W9HA 3V60A 2ZNVB 5IA7A 4MJSA 2LASA 2YVCA 4XX5A 2D3GA 2GBNA 2I1JA 3ZVVA 4F7ZA 4FJYA 2L05A 3DVNU 4OVUA 5J17A 2G3QB 3TBLD 3ML9A 4DHZB 3L0WB 3I3TB 3W1SC 1WX9A 2N4FA 2MP2A 4W9EA 1S3SG 2NBWB 5GMVA 2LUEA 4K7WA 1UGMA 4KIKA 3ZTDA 5JHAA 2JXXA 2PEAA 5C1ZA 2CKHB 1K8RB 4W9CA 3H7PB 3X0WA 3ZUNA 1GNUA 1WX7A 1WR6E 3A9JB 4RM8A 2KWVB 1P9DU 3ZW3A 3VTVA 4P7IA 3WALA 1OEYA 3RZFA 2JWZA 2J0JA 3NOBA 2BWFA 2CU1A 2R2OA 2C9WB 3PS6A 1WI0A 2G4DB 4AJWA 4HCPB 2ZPYA 2KVRA 3CMMB 3EECA 3HIZA 4FHJA 2O6VA 2A4ZA 2MBBB 3VH3B 2KFKB 2AYOB 2RR9A 4W9JA 2KN5A 4F1SA 1KJTA 4W9KA 4K1RB 4A20A 4BKSA 5KHQA 2IO1B 4WWPA 1V81A 1EUVB 3WAOA 3TMPB 3KVFB 3HK0A 4DK5A 4URKA 2ZNVC 3BY4B 3VTUA 3KH0A 3AXCA 2JUOA 2KFKA 4E74A 2KFJA 3UGBB 2ASQA 1P1AA 4HK2A 3PRMB 4GN1A 4BBNF 4KVGB 1I35A 2MCNB 4PS7A 4FJZA 1P0RA 4KDLB 2AEHA 2HE7A 2CHWA 1IPGA 1M94A 3DQVA 4ANVA 3ML8A 2LD9A 2DX5B 2DYBA 2L8JA 4WJOA 4KV2A 1E8YA 2MWSB 3QHTA 4FN2A 3U7DA 4ANUA 2LZ6A 1SIFA 2C5LC 2IO2B 2ZPNA 4G0NB 2JPHA 2L0TA 2O6VB 4ZRKA 3M62B 5E6OA 3H7PA 2KANA 4DXAB 4EKUA 4ZRJA 2L00B 1EF5A 4KIKB 3NHEB 3M63B 3AU4A 5G55A 1Q0WB 4EZLA 3IG3A 5D6JB 3VVWB 3JW0X 4HPMB 1FXTB 2KC1A 2BYFA 4BKGA 1JRUA 4GDKB 4ICUA 4BOZB 4EOYA 1SE9A 2GBJA 3Q3FA 3T9LA 2KHWB 4G11A 3PHWB 2OJRA 3IFWB 4MGZE 3H9DA 4DDID 1E90A 1UBQA 2GBKA 4GMVA 4II2B 1HE8A 4KZCA 4MEMA 1KOTA 2FNJB 3KYCD 3WANA 4LDTB 4TQ0A 1WRDB 1WZ3A 2KK8A 5HKHA 3QAQA 3DBRI 3B08A 1YD8U 4GDLB 4MJSB 2MSED 4X57B 2D2QA 5FR6A 3UIPB 2LVOA 1ZKHA 1D3ZA 5DPTA 4XC2A 4EEWA 2MQJA 3EC8A 2BKRB 1V5TA 2J7QB 3EHVA 2MBHA 4J6IA 3VTWA 2M17A 3QK0A 3APCA 1WXSA 4K7UA 3PTFC 2PE9A 4ZYNA 2Z59B 2ZVOA 1SGHA 2KKCA 3DCGA 4CO7A 2KJRA 5DPWA 3KYDD 1NI2A 1UD7A 4BOSC 2KDIA 2KJHB 2R2QA 1U4AA 2K39A 4BBNC 4FULA 2FCQA 2K6DB 3ECIA 4I6PA 2KX3A 2CS4A 2LGDA 3A33B 3R66C 4PYUA 1YQBA 1WYWB 2MBQA 3PGEA 2XBBC 4NQKE 2UWQA 3NZSA 4GU2A 4K7SA 2FIDA 4GDLA 1WR1A 2HJ8A 1S1QB 1J0GA 2C7NB 4JQWC 2KTFA 2KO3A 1RRBA 2JY6A 1YX5B 2KOXA 1E8XA 5IAAC 4AUQC 3ONSA 2MP2B 2GMIC 3OAWA 4DHJD 2RPQA 4CHKA 3DVNV 2CHZA 2HTHA 3VDZA 2FAZA 1NDDA 2LRUA 3DDCB 4YL8A 1YX6B 1E7VA 4HDQA 3ZDTA 2WX0A 1PQSA 1V49A 4GDKA 3RUIB 4II3B 4LCDE 2D10A 3BINA 5E6NA 1WJ6A 2IZVB 1WF9A 4WWNA 2DHZA 5AZGA 2LJ5A 2C60A 2LXCA 3GOEA 4W9GA 3DPDA 1LM8B 1WE7A 2IO0B 4HDOA 2K8HA 3HHMA 4MELA 3AULA 3D32A 1P98A 1WMHA 4EZJA 3CSTA 4LJOB 3ZRCA 1WXMA 4DHZE 4EUTA 1UZXB 4MGKE 4NJ7A 2KLGA 1WXAA 2K8BA 3WIMA 3L13A 3PLVA 3ZNID 3VXWA 4GOCA 1V80A 4ASWC 3H7SA 1CMXB 3PREA 4DHJB 4LDTD 3W1SA 5LXIB 3PRPB 4IUMB 4HWIB 4KSLC 3KW5B 4W9DA 2JRHA 1ISNA 5LXHA 3DBLI 2D07B 2JRIB 3ZKJC 2WWZA 2GBMA 2J0MA 3UQAA 2MRPA 4WJPA 2XK5B 1UBIA 1E5WA 3ZO5B 2N1VA 4KDIC 5G2NA 3A1QA 3L17A 2DAFA 2AWTA 4ICVA 4WAAA 5CHFA 3RT3B 4F8CB 3HM3A 4TV3A 4WQOB 1ZW7A 2BPSA 4RMAA 4AJYB 3MTNB 1Z2MA 3IBEA 4ANXA 5CX3A 1YJ1A 4NJ6A 4HVBA 1KLVA 3QQ8B 1EF1A 4OVVA 4IWQA 4E71A 3P2BA 4ZDVA 5AZHA 4XZ4A 4PS3A 2L76A 3TL5A 1F9JA 4EFOA 1MG8A 2EKEC 2NVUI 1WMHB 2AL6A 3LJ3A 4KSKC 4B6WA 2WYQA 4HXDA 4NQLB 5L83A 2L3ZA 2KJ6A 3DOWA 5J2RA 2MW5A 2KD0A 2M1MA 3UIOB 3L16A 1V2YA 2N9PC 2KZRA 4FJVB 2ZZPB 2NR2A 4PYZA 3NS8A 1L7YA 3HM6X 2V3SA 2LVQA 3PT2B 5JZEB 2MBEA 4IG7B 1WXVA 3QARA 4B9KA 2NPTA 4NAWB 3VUXA 2MA9B 3VQIA 2DZJA 2OOBB 1WGGA 2XEWA 3N32A 4MSQB 2WX1A 2V1YA 2DZMA 3C0RB 1WGRA 2EMSA 2IO3B 2MX2A 2MLBA 3TJPA 1LFDA 2NPTB 3CSFA 4MGYE 2K8CA 5CHWA 4KZ0A 1GC6A 1QZEA 3R7RA 3TIXA 2KMAA 3APDA 3OLMD 4AWJA 2IYDB 4A3OA 3V62A 1VD2A 5DCNA 2RD0A 1VCBA 4PS8A 3W1YA 2C7HA 4IWOA 4M0WB 1E8ZA 1XD3B 3ZNHB 3X23A 3PRZA 2CHXA 2PE6B 4K81A 5BO4B 2B3AA 3IVFA 5CHVC 1OEYJ 3DVGY 2N7EA 3PSEB 4IWPA 4ZRIA 4E3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC7 B;  3WA0 A;  1GG3 A;  2KTR A;  2ZCB A;  2JZ3 B;  1NBF C;  3K9P B;  2N7D A;  3OJ4 B;  1V5O A;  1V9J A;  2KMC A;  3JSV B;  1WGY A;  2JVC A;  3PZD A;  1Q5W B;  4GSW A;  3KUC B;  1C3T A;  2M4N A;  4MSM B;  5DPS A;  4GGQ A;  2KQS A;  1UEL A;  3Q3J A;  4NNJ B;  3U8Z A;  2DZK A;  3PVL A;  2MBO A;  2V4L A;  2ZVN A;  2O2V A;  3A9K B;  1V6E A;  5DPR A;  3ZNG C;  3AI5 A;  2KXJ A;  3B1L X;  4LJP B;  1A5R A;  1I42 A;  5AEK B;  1TGZ B;  4BKS D;  1P3Q U;  3L54 A;  3V6C B;  3WAM A;  3PLU A;  3ZIM A;  1G6J A;  4ANW A;  1GUA B;  3O65 B;  3KUD B;  2W9N A;  4WWO A;  3L10 B;  3VUW A;  2BYV E;  3VHT C;  1LQB A;  1WJ4 A;  2LGX A;  3APF A;  4HLE A;  3QWZ B;  2Y5B B;  1WM2 A;  4TUU A;  1XQQ A;  2C7M B;  2BF8 B;  2G4S A;  2KWC A;  2JT4 B;  2M0X A;  4W9F A;  5JHB A;  2GBR A;  3A4R A;  3NY5 A;  1ZGU B;  5C23 A;  3TCA A;  5E6P A;  3ZRF A;  2UYZ B;  4DBG A;  5CTR C;  2KNB A;  1OQY A;  3JVZ X;  4FBJ B;  2BGF A;  1IYF A;  3B0A A;  3ZTC A;  3PHX B;  4EZK A;  5J18 A;  3S2A A;  1WH3 A;  1YIW A;  2DYO A;  3M95 A;  4G50 A;  1Y8R C;  1C1Y B;  2XK5 A;  3NZU A;  3ZDM C;  2K6Q A;  4N9F 4;  2IY1 B;  4TQ1 A;  3QCA A;  4DWF A;  3VUY A;  3GZN I;  3H1U A;  1J19 A;  3SU8 X;  2L0F A;  2LWP A;  2QHO A;  2FCS A;  2K1F A;  2KC2 A;  3QX1 A;  4GXB A;  3ZNZ B;  4CYE A;  1WJN A;  3CF6 E;  2G45 B;  1RFA A;  2L7R A;  3ALB A;  3N3K B;  4TKN A;  4HCN B;  4HPL B;  5LLI A;  1E8W A;  2ZCC A;  1TBE A;  1Q1O A;  2HD5 B;  3SHQ A;  2LVP A;  4DDG D;  1WZ0 A;  4FA6 A;  2J0K A;  2REX A;  4NPN A;  3U30 A;  2LI5 A;  2D11 A;  3RCZ A;  3H6N A;  1WFY A;  1GC7 A;  2JF5 A;  4FAD A;  1RAX A;  2KDE B;  5D7G A;  2RGF A;  3JYU A;  4M8M A;  3LDZ E;  4I6N B;  3M3J A;  4MDK E;  3UQB A;  2Z0E B;  2K25 A;  3UF8 A;  2I1K A;  1R4M I;  4FHK A;  3ZLZ A;  2KDB A;  1RLF A;  2LRW A;  2ZJD A;  4BFR A;  2VRR B;  2N1W A;  5JH5 C;  5D94 A;  5KHO A;  3VH4 B;  4W9I A;  1WJU A;  2NS5 A;  1X1M A;  2KDF B;  3ENE A;  3A9K A;  2O2V B;  3VAW A;  4JGH B;  2NBV B;  4AOF A;  2AL3 A;  1H4R A;  2KQ7 A;  2RSU A;  3DBH I;  4RM9 A;  3QC8 B;  3OJ3 A;  2DEN B;  1OTR B;  3QA8 A;  4GIV A;  2BWE S;  1WIA A;  4W9L A;  3AU5 A;  4BKT A;  1UH6 A;  3RD2 A;  1WGH A;  3RYT A;  3SD5 A;  1KM7 A;  2KLC A;  4MGI E;  4JLC A;  1R4N I;  1TTN A;  3PV1 A;  2A5U A;  3VFK A;  3KUZ A;  2IBI B;  2M8S A;  2BYE A;  4I6L B;  4WJN A;  3RZW C;  2FIF A;  3PPA A;  3R3M A;  4FLH A;  1XT9 B;  2FCM A;  4M8N A;  4WJQ A;  3V6E B;  1WGD A;  1WY8 A;  4IM2 A;  1H8C A;  3V61 A;  1J8C A;  2YLM A;  3T8M A;  5EDS A;  1BT0 A;  2WDT B;  2FCN A;  1V86 A;  1LXD A;  3K9O B;  4B95 A;  2PJH A;  5D2M B;  5TR5 A;  3UIN B;  4AP4 C;  1WE6 A;  3QIJ A;  2PPH A;  3N30 A;  1TZ1 A;  3MJW A;  4IM3 A;  2CR5 A;  3EFU A;  1T0Y A;  3MHS D;  4NY0 A;  3R7Q A;  2GOW A;  2DYM A;  3JSV A;  1Z5S B;  4G3X B;  4JIO U;  4JL9 A;  2JZZ A;  2KTR B;  2N9X A;  3A9J A;  4IM0 A;  2IY0 B;  2LGY A;  5L95 C;  2DAJ A;  4IW0 A;  3A4S C;  2KX0 A;  3QJZ A;  3RUL A;  1AAR A;  3SDL C;  1OGW A;  1WX8 A;  2NCN A;  1GJZ A;  2ZEQ A;  1L2N A;  3DBS A;  2N9E B;  2EMT A;  2KWU B;  2Z0D B;  3DVG X;  4A3P A;  1E7U A;  2NBU A;  5AZF A;  1EO6 A;  3IHP C;  2FUH B;  1IP9 A;  2DZI A;  4GB9 A;  4MM3 A;  2O6V D;  4NAW A;  4BVU C;  4MH0 E;  1WM3 A;  4HJK A;  3L08 A;  2BKF A;  2LXA A;  3WAP A;  3A1Q B;  4W9H A;  3V60 A;  2ZNV B;  5IA7 A;  4MJS A;  2LAS A;  2YVC A;  4XX5 A;  2D3G A;  2GBN A;  2I1J A;  3ZVV A;  4F7Z A;  4FJY A;  2L05 A;  3DVN U;  4OVU A;  5J17 A;  2G3Q B;  3TBL D;  3ML9 A;  4DHZ B;  3L0W B;  3I3T B;  3W1S C;  1WX9 A;  2N4F A;  2MP2 A;  4W9E A;  1S3S G;  2NBW B;  5GMV A;  2LUE A;  4K7W A;  1UGM A;  4KIK A;  3ZTD A;  5JHA A;  2JXX A;  2PEA A;  5C1Z A;  2CKH B;  1K8R B;  4W9C A;  3H7P B;  3X0W A;  3ZUN A;  1GNU A;  1WX7 A;  1WR6 E;  3A9J B;  4RM8 A;  2KWV B;  1P9D U;  3ZW3 A;  3VTV A;  4P7I A;  3WAL A;  1OEY A;  3RZF A;  2JWZ A;  2J0J A;  3NOB A;  2BWF A;  2CU1 A;  2R2O A;  2C9W B;  3PS6 A;  1WI0 A;  2G4D B;  4AJW A;  4HCP B;  2ZPY A;  2KVR A;  3CMM B;  3EEC A;  3HIZ A;  4FHJ A;  2O6V A;  2A4Z A;  2MBB B;  3VH3 B;  2KFK B;  2AYO B;  2RR9 A;  4W9J A;  2KN5 A;  4F1S A;  1KJT A;  4W9K A;  4K1R B;  4A20 A;  4BKS A;  5KHQ A;  2IO1 B;  4WWP A;  1V81 A;  1EUV B;  3WAO A;  3TMP B;  3KVF B;  3HK0 A;  4DK5 A;  4URK A;  2ZNV C;  3BY4 B;  3VTU A;  3KH0 A;  3AXC A;  2JUO A;  2KFK A;  4E74 A;  2KFJ A;  3UGB B;  2ASQ A;  1P1A A;  4HK2 A;  3PRM B;  4GN1 A;  4BBN F;  4KVG B;  1I35 A;  2MCN B;  4PS7 A;  4FJZ A;  1P0R A;  4KDL B;  2AEH A;  2HE7 A;  2CHW A;  1IPG A;  1M94 A;  3DQV A;  4ANV A;  3ML8 A;  2LD9 A;  2DX5 B;  2DYB A;  2L8J A;  4WJO A;  4KV2 A;  1E8Y A;  2MWS B;  3QHT A;  4FN2 A;  3U7D A;  4ANU A;  2LZ6 A;  1SIF A;  2C5L C;  2IO2 B;  2ZPN A;  4G0N B;  2JPH A;  2L0T A;  2O6V B;  4ZRK A;  3M62 B;  5E6O A;  3H7P A;  2KAN A;  4DXA B;  4EKU A;  4ZRJ A;  2L00 B;  1EF5 A;  4KIK B;  3NHE B;  3M63 B;  3AU4 A;  5G55 A;  1Q0W B;  4EZL A;  3IG3 A;  5D6J B;  3VVW B;  3JW0 X;  4HPM B;  1FXT B;  2KC1 A;  2BYF A;  4BKG A;  1JRU A;  4GDK B;  4ICU A;  4BOZ B;  4EOY A;  1SE9 A;  2GBJ A;  3Q3F A;  3T9L A;  2KHW B;  4G11 A;  3PHW B;  2OJR A;  3IFW B;  4MGZ E;  3H9D A;  4DDI D;  1E90 A;  1UBQ A;  2GBK A;  4GMV A;  4II2 B;  1HE8 A;  4KZC A;  4MEM A;  1KOT A;  2FNJ B;  3KYC D;  3WAN A;  4LDT B;  4TQ0 A;  1WRD B;  1WZ3 A;  2KK8 A;  5HKH A;  3QAQ A;  3DBR I;  3B08 A;  1YD8 U;  4GDL B;  4MJS B;  2MSE D;  4X57 B;  2D2Q A;  5FR6 A;  3UIP B;  2LVO A;  1ZKH A;  1D3Z A;  5DPT A;  4XC2 A;  4EEW A;  2MQJ A;  3EC8 A;  2BKR B;  1V5T A;  2J7Q B;  3EHV A;  2MBH A;  4J6I A;  3VTW A;  2M17 A;  3QK0 A;  3APC A;  1WXS A;  4K7U A;  3PTF C;  2PE9 A;  4ZYN A;  2Z59 B;  2ZVO A;  1SGH A;  2KKC A;  3DCG A;  4CO7 A;  2KJR A;  5DPW A;  3KYD D;  1NI2 A;  1UD7 A;  4BOS C;  2KDI A;  2KJH B;  2R2Q A;  1U4A A;  2K39 A;  4BBN C;  4FUL A;  2FCQ A;  2K6D B;  3ECI A;  4I6P A;  2KX3 A;  2CS4 A;  2LGD A;  3A33 B;  3R66 C;  4PYU A;  1YQB A;  1WYW B;  2MBQ A;  3PGE A;  2XBB C;  4NQK E;  2UWQ A;  3NZS A;  4GU2 A;  4K7S A;  2FID A;  4GDL A;  1WR1 A;  2HJ8 A;  1S1Q B;  1J0G A;  2C7N B;  4JQW C;  2KTF A;  2KO3 A;  1RRB A;  2JY6 A;  1YX5 B;  2KOX A;  1E8X A;  5IAA C;  4AUQ C;  3ONS A;  2MP2 B;  2GMI C;  3OAW A;  4DHJ D;  2RPQ A;  4CHK A;  3DVN V;  2CHZ A;  2HTH A;  3VDZ A;  2FAZ A;  1NDD A;  2LRU A;  3DDC B;  4YL8 A;  1YX6 B;  1E7V A;  4HDQ A;  3ZDT A;  2WX0 A;  1PQS A;  1V49 A;  4GDK A;  3RUI B;  4II3 B;  4LCD E;  2D10 A;  3BIN A;  5E6N A;  1WJ6 A;  2IZV B;  1WF9 A;  4WWN A;  2DHZ A;  5AZG A;  2LJ5 A;  2C60 A;  2LXC A;  3GOE A;  4W9G A;  3DPD A;  1LM8 B;  1WE7 A;  2IO0 B;  4HDO A;  2K8H A;  3HHM A;  4MEL A;  3AUL A;  3D32 A;  1P98 A;  1WMH A;  4EZJ A;  3CST A;  4LJO B;  3ZRC A;  1WXM A;  4DHZ E;  4EUT A;  1UZX B;  4MGK E;  4NJ7 A;  2KLG A;  1WXA A;  2K8B A;  3WIM A;  3L13 A;  3PLV A;  3ZNI D;  3VXW A;  4GOC A;  1V80 A;  4ASW C;  3H7S A;  1CMX B;  3PRE A;  4DHJ B;  4LDT D;  3W1S A;  5LXI B;  3PRP B;  4IUM B;  4HWI B;  4KSL C;  3KW5 B;  4W9D A;  2JRH A;  1ISN A;  5LXH A;  3DBL I;  2D07 B;  2JRI B;  3ZKJ C;  2WWZ A;  2GBM A;  2J0M A;  3UQA A;  2MRP A;  4WJP A;  2XK5 B;  1UBI A;  1E5W A;  3ZO5 B;  2N1V A;  4KDI C;  5G2N A;  3A1Q A;  3L17 A;  2DAF A;  2AWT A;  4ICV A;  4WAA A;  5CHF A;  3RT3 B;  4F8C B;  3HM3 A;  4TV3 A;  4WQO B;  1ZW7 A;  2BPS A;  4RMA A;  4AJY B;  3MTN B;  1Z2M A;  3IBE A;  4ANX A;  5CX3 A;  1YJ1 A;  4NJ6 A;  4HVB A;  1KLV A;  3QQ8 B;  1EF1 A;  4OVV A;  4IWQ A;  4E71 A;  3P2B A;  4ZDV A;  5AZH A;  4XZ4 A;  4PS3 A;  2L76 A;  3TL5 A;  1F9J A;  4EFO A;  1MG8 A;  2EKE C;  2NVU I;  1WMH B;  2AL6 A;  3LJ3 A;  4KSK C;  4B6W A;  2WYQ A;  4HXD A;  4NQL B;  5L83 A;  2L3Z A;  2KJ6 A;  3DOW A;  5J2R A;  2MW5 A;  2KD0 A;  2M1M A;  3UIO B;  3L16 A;  1V2Y A;  2N9P C;  2KZR A;  4FJV B;  2ZZP B;  2NR2 A;  4PYZ A;  3NS8 A;  1L7Y A;  3HM6 X;  2V3S A;  2LVQ A;  3PT2 B;  5JZE B;  2MBE A;  4IG7 B;  1WXV A;  3QAR A;  4B9K A;  2NPT A;  4NAW B;  3VUX A;  2MA9 B;  3VQI A;  2DZJ A;  2OOB B;  1WGG A;  2XEW A;  3N32 A;  4MSQ B;  2WX1 A;  2V1Y A;  2DZM A;  3C0R B;  1WGR A;  2EMS A;  2IO3 B;  2MX2 A;  2MLB A;  3TJP A;  1LFD A;  2NPT B;  3CSF A;  4MGY E;  2K8C A;  5CHW A;  4KZ0 A;  1GC6 A;  1QZE A;  3R7R A;  3TIX A;  2KMA A;  3APD A;  3OLM D;  4AWJ A;  2IYD B;  4A3O A;  3V62 A;  1VD2 A;  5DCN A;  2RD0 A;  1VCB A;  4PS8 A;  3W1Y A;  2C7H A;  4IWO A;  4M0W B;  1E8Z A;  1XD3 B;  3ZNH B;  3X23 A;  3PRZ A;  2CHX A;  2PE6 B;  4K81 A;  5BO4 B;  2B3A A;  3IVF A;  5CHV C;  1OEY J;  3DVG Y;  2N7E A;  3PSE B;  4IWP A;  4ZRI A;  4E3C A; 
#chains in the Genus database with same CATH topology
 3B9J A;  3WA0 A;  3OJ4 B;  1IBX B;  1V9J A;  2WXR A;  1LGR A;  3MFG A;  2M4N A;  4MSM B;  3U52 E;  2PVO D;  5H92 C;  5IO9 A;  2BBC A;  3KWL A;  3U7Z A;  1A70 A;  3PVL A;  3BVG A;  3A9K B;  3AI5 A;  1TGZ B;  3SFE B;  1GUA B;  3O65 B;  2UU7 A;  4WWO A;  3BVM A;  3L10 B;  1C78 A;  3NRZ A;  1WM2 A;  4USA A;  2KWC A;  2M0X A;  1ZGU B;  5C23 A;  1I4X A;  5CTR C;  2KNB A;  2BGF A;  5G5H A;  4EZK A;  1L6U A;  5J18 A;  3AE7 B;  2DYO A;  3M95 A;  3RI7 C;  3ZDM C;  4G50 A;  4N9F 4;  4L23 A;  3NZ3 A;  2VZK B;  3SU8 X;  2LWP A;  4GXB A;  3ZNZ B;  2Y5C A;  3CF6 E;  2G45 B;  4TKN A;  2ZCC A;  4REZ A;  2J52 A;  2LVP A;  4XDC A;  4US9 A;  1N61 A;  4YTP B;  2LEK A;  1I4Q A;  1TY2 A;  3H6N A;  1WFY A;  1SEB D;  4FAD A;  1RAX A;  4OVZ A;  2W82 A;  2M0A A;  2RGF A;  2INP E;  5AUI A;  4M8M A;  2HDE A;  1JWB D;  1C4C A;  3LDZ E;  4I6N B;  4MDK E;  1TS2 A;  2CJN A;  3W5U B;  3AE6 B;  5JH5 C;  1F2R C;  3UI3 A;  2H88 B;  2NS5 A;  2QC8 A;  2XNA C;  5MPO A;  3B2G A;  4RFB A;  3VAW A;  4JGH B;  1B9R A;  3GP7 A;  1WGK A;  1TS3 A;  3QC8 B;  1OTR B;  4GIV A;  3GE3 C;  4LNK A;  1WGH A;  3SD5 A;  1KM7 A;  2H89 B;  1TTN A;  3PV1 A;  2A5U A;  3VFK A;  4MM3 B;  4WJN A;  3N9Y C;  4WIP A;  4A6Q A;  4OZA A;  3V6E B;  1WGD A;  3T8M A;  1BT0 A;  2FCN A;  1PGX A;  1V86 A;  2N9K A;  1ZE3 D;  4B95 A;  5TR5 A;  3N30 A;  4IM3 A;  4NY0 A;  3R7Q A;  2GOW A;  2DYM A;  2I38 A;  2JZZ A;  2N9X A;  4N58 A;  2ON8 A;  2DAJ A;  2KX0 A;  1GJZ A;  3DHG C;  1WX8 A;  2NCN A;  4J3O D;  1NI3 A;  1L2N A;  1V97 A;  1ET6 A;  3P4Q B;  1E7U A;  1VR9 A;  1AYF A;  3IHP C;  3IT6 B;  3V3X A;  1D5Z C;  2WXK A;  2WXL A;  1YN5 A;  1YMH E;  4W9H A;  2ZNV B;  5J17 A;  1T0R C;  2LGI A;  4L2Y A;  1KLU D;  2WXQ A;  1WX9 A;  2N4F A;  4W9E A;  1S3S G;  2NBW B;  2LUE A;  4KIK A;  3J9C A;  1TKG A;  4OZC A;  2PEA A;  5C1Z A;  1K8R B;  4W9C A;  3H7P B;  2BW2 A;  1WR6 E;  4RM8 A;  3AE9 B;  1P9D U;  1ESF A;  1KTK A;  3NOB A;  4IDI A;  3RNA C;  2CU1 A;  5HFY A;  1HTO A;  3NS1 A;  2G4D B;  2KVR A;  1OQQ A;  2KVZ A;  3HIZ A;  1L4Z B;  2KN5 A;  1KJT A;  5KHQ A;  4K1R B;  4A20 A;  2IO1 B;  2AQ1 B;  3I63 C;  1EUV B;  3NVV A;  3TMP B;  3KVF B;  4DK5 A;  3AXC A;  4E74 A;  1J7A A;  2ASQ A;  4KDL B;  1YQ3 B;  2AEH A;  2CHW A;  4ANV A;  1TZO A;  1EWY C;  2DYB A;  4WJO A;  4H2A A;  1R4M B;  4ANU A;  2LZ6 A;  4G0N B;  3RNG C;  2JPH A;  4JPS A;  2O6V B;  1SF0 A;  3H7P A;  4EKU A;  1TKY A;  4KIK B;  3M63 B;  5G55 A;  4RH6 A;  4OW0 A;  4HPP A;  4BKG A;  4BOZ B;  4G11 A;  3N20 C;  3RMK C;  2OJR A;  3IFW B;  5HI1 A;  4YTN B;  2MHJ A;  4KZC A;  4OZB A;  1YN3 A;  1I4R A;  3WAN A;  3AE1 B;  1WRD B;  3SR6 A;  3V05 A;  3NVW A;  5IOI A;  3TEW A;  4X57 B;  2D2Q A;  3P4S B;  2CU3 A;  5DPT A;  4XC2 A;  1PDX A;  2BKR B;  2MBH A;  3VTW A;  1L4D B;  2SAK A;  3LYY A;  2ZVO A;  3DCG A;  1CZP A;  2KKC A;  2XN9 C;  1UD7 A;  2QJL A;  2KDI A;  2R2Q A;  2K39 A;  2FCQ A;  3ECI A;  2LGD A;  3R66 C;  4PYU A;  2MBQ A;  1WYW B;  1EU3 A;  2XBB C;  3NZS A;  2FID A;  2WLB A;  3RNB C;  1S1Q B;  2KTF A;  2KWD A;  2KO3 A;  1YX5 B;  3E9S A;  2GMI C;  2RPQ A;  3VR9 B;  3DVN V;  3MC0 B;  2D3A A;  5HHD G;  2LRU A;  1RWS A;  1D5M C;  2WXP A;  3TEY A;  1VZ8 A;  1TIF A;  2D10 A;  1B1Z A;  1WJ6 A;  1DGJ A;  4YSZ B;  2LJ5 A;  1LM8 B;  2IO0 B;  1HTQ A;  2K8H A;  4MEL A;  2WXM A;  4ZHP A;  4LJO B;  3ZRC A;  1FRD A;  1WXM A;  4EUT A;  2N9L A;  1XXG A;  3L13 A;  3PLV A;  1KLG D;  2GB1 A;  2INC C;  3TSS A;  3W1S A;  4KSL C;  4JE3 B;  4K3B A;  2D07 B;  5BMG A;  2GBM A;  2ACZ B;  4XYC A;  2QIE B;  2LHE A;  2KYW A;  5G2N A;  1QOF A;  3ABV B;  3SFD B;  4ICV A;  5CHF A;  4TV3 A;  4RMA A;  3R2I A;  4AJY B;  3MTN B;  1Z2M A;  3IBE A;  1T0S C;  5CX3 A;  1XLQ A;  1YJ1 A;  3N1X C;  3AEB B;  4HVB A;  5AZH A;  3HUI A;  4XZ4 A;  2L76 A;  2KDM A;  4B0E A;  1FD6 A;  2W3R A;  5EE0 A;  4B6W A;  1Y56 A;  4NQL B;  3AV8 A;  3GE8 C;  2MW5 A;  1JCK B;  1TJE A;  2M1M A;  3L16 A;  2WDR B;  2ZZP B;  4PYZ A;  3NS8 A;  3HM6 X;  4HRO A;  1D6E C;  2MBE A;  3U2S C;  4IG7 B;  2NPT A;  3N32 A;  4MSQ B;  2WX1 A;  1SE2 A;  2V1Y A;  1F0Z A;  2QMT A;  3NVZ A;  2BS4 B;  2MLB A;  4O1N A;  2V3P A;  2KMA A;  1VD2 A;  3ZXR A;  1T6B X;  3ZJU A;  5BO4 B;  1OEY J;  3ZJT A;  4ZRI A;  4E3C A;  1FNV A;  1IBX A;  1JWM D;  1V5O A;  2KMC A;  1T5X D;  2JVC A;  3BWU D;  5IN7 A;  2L1A A;  1AN8 A;  1C3T A;  4XE0 A;  5DPS A;  3KQ4 A;  2KQS A;  3Q3J A;  2PW9 A;  3BK1 A;  4WQM A;  2MBO A;  4RF0 A;  2O2V A;  5DPR A;  3ZNG C;  3B1L X;  4LJP B;  1I42 A;  1FXA A;  5AEK B;  1M4V A;  2HJ1 A;  3L54 A;  3PLU A;  3ZIM A;  1YJJ A;  1R7S A;  2W9N A;  3KUD B;  3C8Y A;  2W3S A;  2LGX A;  3RFZ B;  4TUU A;  1XQQ A;  2K3U A;  1UNS A;  2GBR A;  3A4R A;  3P4R B;  3TCA A;  2D3C A;  1L0Y B;  2DBY A;  3ZTC A;  3PHX B;  3C19 A;  3EUB 2;  3S2A A;  1WH3 A;  1C1Y B;  3NZU A;  2L52 A;  2K6Q A;  1C4P A;  4TQ1 A;  1GAQ B;  3BII D;  2KC2 A;  3QX1 A;  2X8X X;  3ALB A;  1E8W A;  1Q1O A;  3SHQ A;  1WZ0 A;  2LI5 A;  3RCZ A;  1NYR A;  5D7G A;  2BVC A;  2WNM A;  3AN1 A;  3M3J A;  5FK9 C;  2Z0E B;  2SEB D;  3WCQ A;  3ZLZ A;  2KDB A;  4BFR A;  2VRR B;  2W55 A;  5KHO A;  1JRP A;  4LK0 M;  2IND C;  1JWS D;  4AOF A;  2AL3 A;  3IXS A;  2RSU A;  3DBH I;  3DBH B;  4RM9 A;  2WXG A;  3OJ3 A;  1WIA A;  3R2T A;  3AU5 A;  4L1B A;  2RDB C;  1UH6 A;  2AQ2 B;  3RYT A;  4JLC A;  1R4N I;  2IBI B;  2BYE A;  4I6L B;  3RZW C;  2FCM A;  2JZP A;  1JAL A;  3Q8C A;  4KKI A;  4WJQ A;  3V61 A;  2WDT B;  4TSS A;  1LXD A;  1UGJ A;  1WE6 A;  3QIJ A;  3VDZ A;  4YT0 B;  4G3X B;  5D3I B;  1HZ5 A;  2LGY A;  4IW0 A;  3A4S C;  3RUL A;  1OGW A;  2LJI A;  2EMT A;  4A3P A;  3HVD A;  2NBU A;  3URY A;  4GB9 A;  1EWC A;  4BVU C;  4HJK A;  1HEZ E;  4HKZ E;  2PKO A;  2LGS A;  5IA7 A;  5BYS A;  1PYW D;  2I1J A;  2WXI A;  4FJY A;  3DVN U;  4BZA A;  1BXT A;  2MP2 A;  5GMV A;  3AEE B;  1XCQ L;  3ZUN A;  2KN4 A;  2KWV B;  5EE9 A;  2Z8L A;  2DWQ A;  3Q3O C;  2WXO A;  3DBR B;  4C00 A;  1QOG A;  2C9W B;  1N6Z A;  3PS6 A;  2ZPY A;  3CMM B;  1MHH E;  3EEC A;  2O6V A;  4HRS A;  2MBB B;  1FEH A;  4W9J A;  4BKS A;  4WWP A;  3WAO A;  3HK0 A;  1LO5 D;  3BY4 B;  3AH7 A;  1NYQ A;  2IJ0 A;  2KFJ A;  2D5G A;  3PRM B;  4GN1 A;  3E56 A;  4BBN F;  4KVG B;  1SE3 A;  2ZW1 A;  1P0R A;  1P7E A;  1M94 A;  3ML8 A;  5I4D A;  2L8J A;  4PT5 A;  4R3D A;  1FO4 A;  2MWS B;  1SIF A;  1Q10 A;  2C5L C;  2ZPN A;  4ZRK A;  4ARI A;  2WXF A;  2GLS A;  2KAN A;  4ZRJ A;  4CQN A;  3NHE B;  1WRI A;  3AU4 A;  3AED B;  4HJG E;  3JW0 X;  1FXT B;  2BYF A;  4GDK B;  4ICU A;  4A8X C;  2GBJ A;  3Q3N C;  2KHW B;  3PHW B;  4MGZ E;  3DBL B;  1E90 A;  1HE8 A;  2RDH A;  1CJE A;  1WXQ A;  3KYC D;  4Q2J A;  2L83 A;  3QAQ A;  5HKH A;  1RFK A;  1TS4 A;  2MSE D;  1ACC A;  4EEW A;  1V5T A;  3EHV A;  3FC4 A;  2WU5 B;  3APC A;  3Q8B A;  2Z59 B;  2VH2 A;  2KQ4 X;  3KYD D;  2KJH B;  1U4A A;  1BUI C;  1GB4 A;  2Y3A A;  4I6P A;  2CS4 A;  4LNO A;  4M0W A;  1IUE A;  2EKI A;  2R61 A;  4GU2 A;  4RCO A;  4GDL A;  1J0G A;  1MPE A;  4JQW C;  2RMM A;  5IAA C;  2J53 A;  4CHK A;  1F77 A;  2HTH A;  2FAZ A;  3AEC B;  1STE A;  3Q8A A;  5HG2 A;  1V49 A;  1JRO A;  4II3 B;  5E6N A;  5AZG A;  4DXG A;  1CK1 A;  4W9G A;  4TMA B;  4NJC A;  4YTM B;  2FUG 1;  1ROE A;  2BYT A;  4HDO A;  3HHM A;  3AUL A;  4EZJ A;  2BB5 A;  4RGT A;  3B2F A;  1UZX B;  4MGK E;  3WIM A;  3MHZ A;  4GOC A;  3H7S A;  4IKG A;  1CMX B;  3PRE A;  4LDT D;  3PRP B;  2JRH A;  5LXH A;  2JRI B;  1FFV A;  4WJP A;  2XK5 B;  2J4X A;  3ZO5 B;  3I5J C;  2JWU A;  3Q8F A;  2N1V A;  4KDI C;  3A1Q A;  3L17 A;  2DAF A;  1GB1 A;  2AWT A;  2QEJ C;  1K51 A;  4WQO B;  1ZW7 A;  2BPS A;  2BT6 A;  1T0Q C;  4NJ6 A;  3ZGZ A;  1HXY D;  2WGS A;  4E71 A;  2MJ3 A;  1FXI A;  3TL5 A;  2NVU I;  3LJ3 A;  4HXD A;  5L83 A;  2KJ6 A;  2G1E A;  5J2R A;  1V2Y A;  2KZR A;  4FJV B;  2MJE A;  2NR2 A;  5D3D A;  2LVQ A;  3Q14 C;  1FCC C;  3BYY B;  2WDV B;  3CIR B;  2WU2 B;  3VUX A;  1N5X A;  2NTS A;  2OOB B;  1WGG A;  1QOB A;  2WQY B;  1GPX A;  3SEB A;  1JQ4 A;  2DZM A;  1XLN A;  1XLO A;  2MX2 A;  1LFD A;  1MFW A;  2NPT B;  4KZ0 A;  3AEF B;  4AWJ A;  2V0G A;  3V62 A;  2WHI A;  5LNK 1;  4IWO A;  4M0W B;  1E8Z A;  2CHX A;  4KX6 B;  1F1H A;  3IVF A;  5CHV C;  2N7E A;  4YSY B;  3BK2 A;  4M01 A;  4EE2 A;  2N7D A;  1D4B A;  3JSV B;  1WGY A;  3PZD A;  4GSW A;  3KUC B;  3IT4 B;  1VRA B;  3U8Z A;  1N60 A;  4NNJ B;  2I2Y A;  2DZK A;  2PLP A;  4HEA 1;  2V4L A;  2KXJ A;  1A5R A;  4BKS D;  1JW9 D;  3WAM A;  4ANW A;  2OHF A;  2BYV E;  3VHT C;  4HLE A;  2Y5B B;  1HZ6 A;  2BF8 B;  2G4S A;  3NY5 A;  5E6P A;  4ACF A;  4ZRQ A;  3ZRF A;  2UYZ B;  4DBG A;  1L6V A;  4RGN A;  3JVZ X;  4FBJ B;  3B0A A;  2W54 A;  2JQR B;  1YIW A;  1FFU A;  1SXT A;  4P6V F;  3GZN I;  1J19 A;  2L0F A;  2FCS A;  2K1F A;  4C4V A;  4CYE A;  4KKJ A;  3O13 A;  1WJN A;  2L7R A;  3N3K B;  4HCN B;  5LLI A;  1XF5 L;  3ZQ4 A;  5T8I A;  2REX A;  3GS2 A;  2D11 A;  2V9H A;  1FM0 D;  4IOI E;  1GC7 A;  3H8H A;  1QF6 A;  2CJO A;  3Q8E A;  3UQB A;  3UF8 A;  2I1K A;  1VLB A;  2LRW A;  2ZJD A;  4ZRP A;  5D94 A;  4N59 A;  3VH4 B;  4RGO S;  4W9I A;  1WJU A;  2NMQ A;  2KDF B;  2O2V B;  2QCZ A;  1I4P A;  4LNI A;  2JU6 X;  2PIA A;  2DEN B;  3QA8 A;  2BWE S;  4NZL B;  4W9L A;  1TS5 A;  3RD2 A;  2KLC A;  1SBB B;  4XDD A;  3KUZ A;  3ZYY X;  3NUH B;  3PPA A;  1XT9 B;  5BYQ A;  4M8N A;  1WY8 A;  2YLM A;  1QLB B;  5IKC M;  2M56 B;  2AQ3 B;  3K9O B;  2PJH A;  5D2M B;  3UIN B;  4AP4 C;  1TZ1 A;  2CR5 A;  3EFU A;  3MHS D;  3OWE B;  4A55 A;  4C7Z A;  4JIO U;  1Z5S B;  4JL9 A;  2KTR B;  2IPK D;  2IY0 B;  3QJZ A;  2ZEQ A;  2N9E B;  3GB1 A;  2KWU B;  2Z0D B;  3FKY A;  4RGM A;  1DYQ A;  4KGR A;  4MH0 E;  1C4A A;  3PO0 A;  2LXA A;  3AM9 A;  3V60 A;  2LAS A;  4XX5 A;  2JSV X;  2GBN A;  4BAX A;  5H8Y E;  2G3Q B;  3TBL D;  1TKE A;  1UGM A;  3ZTD A;  5JHA A;  2JXX A;  4WUR A;  1JWA D;  3X0W A;  3ZXV A;  3ZW3 A;  3VTV A;  1OEY A;  3RZF A;  2JWZ A;  3P42 A;  2BWF A;  1I4H A;  4ZOH C;  1IGC A;  1WI0 A;  4AJW A;  1ZXH A;  4XWW A;  4FHJ A;  4PK1 A;  3VH3 B;  2KFK B;  2AYO B;  2N7J A;  2BTE A;  1V81 A;  1YOV B;  4URK A;  3VTU A;  2YEP F;  3KH0 A;  1N63 A;  4XGA B;  1ZPS A;  3UGB B;  1P1A A;  4HK2 A;  4PS7 A;  4FJZ A;  2K0P A;  1HA5 A;  1JWU D;  2WXJ A;  2JX5 A;  2LD9 A;  5FR3 A;  2DX5 B;  1WWT A;  1JML A;  4FN2 A;  3U7D A;  2IO2 B;  2PMV A;  2L0T A;  2E3T A;  2BQQ A;  3M62 B;  5E6O A;  4QAY A;  1TYG B;  2L00 B;  3OG5 A;  1Q0W B;  1TT5 B;  1VZ6 A;  1JRU A;  2GRI A;  3Q3F A;  3PZ7 A;  5C2T B;  3T9L A;  1OFF A;  1PFD A;  4P16 A;  4MEM A;  1E10 A;  1KOT A;  2FNJ B;  1K52 A;  3N1Z C;  3DBR I;  3B08 A;  1YD8 U;  4GDL B;  4MJS B;  1D3Z A;  2LVO A;  1ZKH A;  2MQJ A;  4A90 A;  1J7B A;  5FKA C;  4J6I A;  1WYG A;  3QK0 A;  2J42 A;  4LTU A;  2PE9 A;  4ZYN A;  1FNU A;  1SSN A;  4CO7 A;  2YEP B;  4MH8 A;  4BOS C;  1OQR A;  3Q3M C;  4BBN C;  4FUL A;  2K6D B;  2KX3 A;  1KF6 B;  1YQB A;  3LB8 C;  4NQK E;  2L32 A;  2HJ8 A;  2FBW B;  1RRB A;  4AUQ C;  1E8X A;  3MC9 A;  2FE8 A;  4DHJ D;  1SB3 C;  4WAF A;  4LNN A;  1RM6 C;  4YL8 A;  2TSS A;  4YXD B;  1E7V A;  3ZDT A;  2LHD A;  4GDK A;  3DWM A;  1NVI D;  4LCD E;  1V1P A;  3BIN A;  3TEZ A;  2QSD A;  4HKQ A;  2EEL A;  1WF9 A;  1QKZ A;  3LXF A;  2DHZ A;  2LXC A;  4GLS C;  3DPD A;  3VRA B;  4XWT A;  2QDF A;  2WS3 B;  1ZP0 B;  1NEN B;  1P98 A;  3D32 A;  4P1B C;  4MAC A;  4DHZ E;  4NJ7 A;  1QOA A;  2KLG A;  4RNA A;  2K8B A;  3ZNI D;  4DXF A;  3HVZ A;  4ASW C;  3FIL B;  3RNC C;  4DHJ B;  5LXI B;  4M02 A;  4HWI B;  1ISN A;  2AX5 A;  3DBL I;  3EFC A;  3UQA A;  1IGD A;  1ZUD 2;  2ICI A;  5TSS A;  4A9A A;  1F2R I;  1C9F A;  2DNF A;  1DOY A;  3MJ5 A;  4WAA A;  3RT3 B;  4F8C B;  3HM3 A;  1K53 A;  4ANX A;  1GOZ A;  1YNT E;  2HTM E;  4JWS C;  1KLV A;  2LFI A;  1ENF A;  2IGH A;  4LLG M;  4IWQ A;  1AWD A;  3IAS 1;  3P2B A;  4OVV A;  5BMI A;  3DHH C;  4PS3 A;  5E6J A;  1KH0 A;  1F9J A;  4EFO A;  4D2K A;  3I9V 1;  4JWU C;  2AL6 A;  4KSK C;  3KWV A;  2L3Z A;  4B0M A;  2V4I B;  2KD0 A;  3UIO B;  2N9P C;  4S0R A;  5GXG B;  3DHI C;  2Y5P A;  4B9K A;  2MA9 B;  3VQI A;  2DZJ A;  2XEW A;  1WGR A;  2EMS A;  4MT5 A;  2IDY A;  3MP9 A;  1VJK A;  3Q69 A;  3W5V B;  3TJP A;  4MGY E;  1BML C;  2K8C A;  5CHW A;  1QZE A;  1D5X C;  3OLM D;  3HRD D;  2K9X A;  3W1Y A;  1VCB A;  3TUO A;  1XO3 A;  2WP9 B;  1FNW A;  2PE6 B;  3T3N A;  2M19 A;  1C79 A;  4IWP A;  5BYR A;  4IC7 B;  1GG3 A;  2KTR A;  2ZCB A;  2JZ3 B;  1NBF C;  2PVG C;  3K9P B;  2Q5W D;  1Q5W B;  2BS3 B;  1DOI A;  2LUM A;  3PZ8 A;  1R4N B;  4GGQ A;  4C4V B;  1UEL A;  1NEK B;  5EE1 A;  3RPF C;  2ZVN A;  1V6E A;  1XEE A;  1QQR A;  1P3Q U;  3V6C B;  1G6J A;  3DWG C;  3VUW A;  4AS1 A;  1LQB A;  1L5P A;  3P1M A;  1WJ4 A;  3APF A;  3QWZ B;  4UDU C;  4W9F A;  2C7M B;  1HQR D;  2JT4 B;  5JHB A;  3FAH A;  2BB6 A;  2MJD A;  1MG4 A;  3ETR A;  1C76 A;  1OQY A;  1SIJ A;  2LMC A;  1IYF A;  2KAJ A;  1FPY A;  4ITK A;  1Y8R C;  2XK5 A;  1YJI A;  2IY1 B;  3QCA A;  4DWF A;  3VUY A;  3AE5 B;  1E7P B;  3H1U A;  1CQV A;  2QHO A;  2QIL A;  2BS2 B;  2X38 A;  1RFA A;  4HPL B;  1TBE A;  2HD5 B;  4DDG D;  2V3N A;  4FA6 A;  2J0K A;  1MI0 A;  4WH4 A;  4NPN A;  3U30 A;  5BMH A;  3AMZ A;  2JF5 A;  2KDE B;  4K3C A;  1PGB A;  1UF0 A;  3JYU A;  2B76 B;  1TY0 A;  1F52 A;  2K25 A;  1R4M I;  1KFY B;  4FHK A;  1RLF A;  2N1W A;  4S17 A;  3RNF C;  1X1M A;  3ENE A;  2JYT A;  3A9K A;  2NBV B;  4AQ7 A;  1FIQ A;  1H4R A;  2KMM A;  2KQ7 A;  1YQ4 B;  1KRH A;  1FRR A;  5G5G A;  1E6E B;  2K5P A;  4BKT A;  4KGS A;  1SE4 A;  3N1Y C;  3VR8 B;  4MGI E;  1L0V B;  3Q2A C;  2M8S A;  1FMA D;  2FIF A;  4FLH A;  3R3M A;  4C7Y A;  4IM2 A;  3NVY A;  1H8C A;  2E6X A;  1J8C A;  5EDS A;  1I4G A;  1V8C A;  2PPH A;  3MC8 A;  3MJW A;  1T0Y A;  3JSV A;  2K22 A;  3A9J A;  4IM0 A;  5L95 C;  2IGD A;  3SDL C;  4RF1 A;  1AAR A;  4ZYS A;  3DBS A;  1DOX A;  3DVG X;  5AZF A;  1VDV A;  1EO6 A;  2G9H D;  2FUH B;  1IP9 A;  2DZI A;  4MM3 A;  2O6V D;  4NAW A;  4OHJ A;  1EU4 A;  1RYJ A;  1WM3 A;  3L08 A;  1QT9 A;  2BKF A;  4JX1 C;  3WAP A;  3A1Q B;  4C80 A;  4MJS A;  2YVC A;  2D3G A;  4YWG G;  3ZVV A;  4F7Z A;  2L05 A;  4OVU A;  2RDG A;  3ML9 A;  4DHZ B;  1ZDV A;  3I3T B;  3L0W B;  3W1S C;  4K7W A;  1QIL A;  2CKH B;  1GNU A;  1WX7 A;  3A9J B;  1K50 A;  3AEG B;  4P7I A;  3WAL A;  2J0J A;  2R2O A;  3T3O A;  1EM7 A;  4HCP B;  2A4Z A;  2RR9 A;  4LNF A;  4F1S A;  4W9K A;  1T3Q A;  1XLP A;  1N62 A;  2PTL A;  4FXC A;  1SJE D;  2ZNV C;  2JUO A;  2KFK A;  3AE4 B;  1V1O A;  1I35 A;  2MCN B;  3BZD B;  2HE7 A;  4M00 A;  2GI9 A;  1IPG A;  3DQV A;  4KV2 A;  1E8Y A;  3GZN B;  3QHT A;  1PUT A;  1UUP A;  1ZXI A;  4DXA B;  2MH7 A;  1EF5 A;  1ZOY B;  1UWX A;  3U4E G;  4EZL A;  3IG3 A;  5D6J B;  3VVW B;  2RPV A;  4HPM B;  2KC1 A;  2VH1 A;  4EOY A;  1SE9 A;  4DDI D;  3H9D A;  1UBQ A;  2GBK A;  4GMV A;  4II2 B;  5AUK A;  2NTT A;  1C77 A;  4LDT B;  4TQ0 A;  1WZ3 A;  2KK8 A;  1WSP A;  3VRB B;  1UWM A;  3AE2 B;  3W9C B;  5FR6 A;  3UIP B;  4WWM A;  3EC8 A;  2J7Q B;  3L4P A;  2M17 A;  1WXS A;  4K7U A;  4N6E B;  3PTF C;  2WXN A;  1SGH A;  5DPW A;  2KJR A;  3RN9 C;  1NI2 A;  3P4P B;  5EE3 A;  3AB5 A;  3A33 B;  3RNE C;  3PGE A;  2UWQ A;  3BYT B;  4K7S A;  3W2D A;  1AW7 A;  1WR1 A;  2C7N B;  2KOX A;  2JY6 A;  3ONS A;  4ARC A;  2KT7 A;  2MP2 B;  3OAW A;  2CHZ A;  3EA6 A;  1NDD A;  3DDC B;  1YX6 B;  4HDQ A;  1ZDX A;  2WX0 A;  1PQS A;  3RUI B;  3I57 A;  3BVZ A;  2JYE A;  2IZV B;  2ONQ A;  4WWN A;  3GOE A;  2C60 A;  4P1C C;  1N5W A;  3KLS X;  1WE7 A;  3TEX A;  1MJD A;  2MEK A;  1WMH A;  3CST A;  1J7C A;  1VZ7 A;  5JXV A;  3AE3 B;  1WXA A;  5IP4 D;  1L0X B;  3VXW A;  1V80 A;  2KAC A;  2N0S B;  3CWI A;  4KGT A;  1PGA A;  3ZJV A;  1I7H A;  2WDQ B;  4IUM B;  3KW5 B;  4W9D A;  3ZKJ C;  2WWZ A;  1P7F A;  2J0M A;  2MRP A;  1MHX A;  1MVK A;  1UBI A;  1E5W A;  1ET9 A;  4C56 C;  4NAM A;  2D3B A;  2VZK D;  1SJH D;  1FCL A;  3FIL A;  3QQ8 B;  1E9M A;  1EF1 A;  5C3J B;  4ZDV A;  3NG0 A;  1MG8 A;  1XCT L;  2EKE C;  2JXT A;  1WMH B;  2WYQ A;  3Q6B A;  3DOW A;  2IGG A;  1YN4 A;  3AE8 B;  1L7Y A;  1V1P B;  2V3S A;  3PT2 B;  3AEA B;  5JZE B;  1WXV A;  3QAR A;  4NAW B;  4ZHO A;  4YSX B;  3C0R B;  2WXH A;  2IO3 B;  3CSF A;  2OJW A;  1GC6 A;  3R7R A;  3TIX A;  3APD A;  2IYD B;  4A3O A;  3R8B A;  5DCN A;  2INN E;  2RD0 A;  4PS8 A;  2C7H A;  3NJT A;  1XD3 B;  3ZNH B;  3X23 A;  1E0Z A;  2ZW0 A;  3IAM 1;  3PRZ A;  3EGR A;  2DLB A;  4K81 A;  2B3A A;  3DVG Y;  3PSE B;  4US8 A;  3P63 A;  2OED A;  4DQO C; 
#chains in the Genus database with same CATH homology
 4IC7 B;  3WA0 A;  1GG3 A;  2KTR A;  2ZCB A;  2JZ3 B;  1NBF C;  3K9P B;  2N7D A;  3OJ4 B;  1V5O A;  1V9J A;  2KMC A;  3JSV B;  1WGY A;  2JVC A;  3PZD A;  1Q5W B;  4GSW A;  3KUC B;  1C3T A;  2M4N A;  4MSM B;  5DPS A;  4GGQ A;  2KQS A;  1UEL A;  3Q3J A;  4NNJ B;  3U8Z A;  2DZK A;  3PVL A;  2MBO A;  2V4L A;  2ZVN A;  2O2V A;  3A9K B;  1V6E A;  5DPR A;  3ZNG C;  3AI5 A;  2KXJ A;  3B1L X;  4LJP B;  1A5R A;  1I42 A;  5AEK B;  1TGZ B;  4BKS D;  1P3Q U;  3L54 A;  3V6C B;  3WAM A;  3PLU A;  3ZIM A;  1G6J A;  4ANW A;  1GUA B;  3O65 B;  3KUD B;  2W9N A;  4WWO A;  3L10 B;  3VUW A;  2BYV E;  3VHT C;  1LQB A;  1WJ4 A;  2LGX A;  3APF A;  4HLE A;  3QWZ B;  2Y5B B;  1WM2 A;  4TUU A;  1XQQ A;  2C7M B;  2BF8 B;  2G4S A;  2KWC A;  2JT4 B;  2M0X A;  4W9F A;  5JHB A;  2GBR A;  3A4R A;  3NY5 A;  1ZGU B;  5C23 A;  3TCA A;  5E6P A;  3ZRF A;  2UYZ B;  4DBG A;  5CTR C;  2KNB A;  1OQY A;  3JVZ X;  4FBJ B;  2BGF A;  1IYF A;  3B0A A;  3ZTC A;  3PHX B;  4EZK A;  5J18 A;  3S2A A;  1WH3 A;  1YIW A;  2DYO A;  3M95 A;  4G50 A;  1Y8R C;  1C1Y B;  2XK5 A;  3NZU A;  3ZDM C;  2K6Q A;  4N9F 4;  2IY1 B;  4TQ1 A;  3QCA A;  4DWF A;  3VUY A;  3GZN I;  3H1U A;  1J19 A;  3SU8 X;  2L0F A;  2LWP A;  2QHO A;  2FCS A;  2K1F A;  2KC2 A;  3QX1 A;  4GXB A;  3ZNZ B;  4CYE A;  1WJN A;  3CF6 E;  2G45 B;  1RFA A;  2L7R A;  3ALB A;  3N3K B;  4TKN A;  4HCN B;  4HPL B;  5LLI A;  1E8W A;  2ZCC A;  1TBE A;  1Q1O A;  2HD5 B;  3SHQ A;  2LVP A;  4DDG D;  1WZ0 A;  4FA6 A;  2J0K A;  2REX A;  4NPN A;  3U30 A;  2LI5 A;  2D11 A;  3RCZ A;  3H6N A;  1WFY A;  1GC7 A;  2JF5 A;  4FAD A;  1RAX A;  2KDE B;  5D7G A;  2RGF A;  3JYU A;  4M8M A;  3LDZ E;  4I6N B;  3M3J A;  4MDK E;  3UQB A;  2Z0E B;  2K25 A;  3UF8 A;  2I1K A;  1R4M I;  4FHK A;  3ZLZ A;  2KDB A;  1RLF A;  2LRW A;  2ZJD A;  4BFR A;  2VRR B;  2N1W A;  5JH5 C;  5D94 A;  5KHO A;  3VH4 B;  4W9I A;  1WJU A;  2NS5 A;  1X1M A;  2KDF B;  3ENE A;  3A9K A;  2O2V B;  3VAW A;  4JGH B;  2NBV B;  4AOF A;  2AL3 A;  1H4R A;  2KQ7 A;  2RSU A;  3DBH I;  4RM9 A;  3QC8 B;  3OJ3 A;  2DEN B;  1OTR B;  3QA8 A;  4GIV A;  2BWE S;  1WIA A;  4W9L A;  3AU5 A;  4BKT A;  1UH6 A;  3RD2 A;  1WGH A;  3RYT A;  3SD5 A;  1KM7 A;  2KLC A;  4MGI E;  4JLC A;  1R4N I;  1TTN A;  3PV1 A;  2A5U A;  3VFK A;  3KUZ A;  2IBI B;  2M8S A;  2BYE A;  4I6L B;  4WJN A;  3RZW C;  2FIF A;  3PPA A;  3R3M A;  4FLH A;  1XT9 B;  2FCM A;  4M8N A;  4WJQ A;  3V6E B;  1WGD A;  1WY8 A;  4IM2 A;  1H8C A;  3V61 A;  1J8C A;  2YLM A;  3T8M A;  5EDS A;  1BT0 A;  2WDT B;  2FCN A;  1V86 A;  1LXD A;  3K9O B;  4B95 A;  2PJH A;  5D2M B;  5TR5 A;  3UIN B;  4AP4 C;  1WE6 A;  3QIJ A;  2PPH A;  3N30 A;  1TZ1 A;  3MJW A;  4IM3 A;  2CR5 A;  3EFU A;  1T0Y A;  3MHS D;  4NY0 A;  3R7Q A;  2GOW A;  2DYM A;  3JSV A;  1Z5S B;  4G3X B;  4JIO U;  4JL9 A;  2JZZ A;  2KTR B;  2N9X A;  3A9J A;  4IM0 A;  2IY0 B;  2LGY A;  5L95 C;  2DAJ A;  4IW0 A;  3A4S C;  2KX0 A;  3QJZ A;  3RUL A;  1AAR A;  3SDL C;  1OGW A;  1WX8 A;  2NCN A;  1GJZ A;  2ZEQ A;  1L2N A;  3DBS A;  2N9E B;  2EMT A;  2KWU B;  2Z0D B;  3DVG X;  4A3P A;  1E7U A;  2NBU A;  5AZF A;  1EO6 A;  3IHP C;  2FUH B;  1IP9 A;  2DZI A;  4GB9 A;  4MM3 A;  2O6V D;  4NAW A;  4BVU C;  4MH0 E;  1WM3 A;  4HJK A;  3L08 A;  2BKF A;  2LXA A;  3WAP A;  3A1Q B;  4W9H A;  3V60 A;  2ZNV B;  5IA7 A;  4MJS A;  2LAS A;  2YVC A;  4XX5 A;  2D3G A;  2GBN A;  2I1J A;  3ZVV A;  4F7Z A;  4FJY A;  2L05 A;  3DVN U;  4OVU A;  5J17 A;  2G3Q B;  3TBL D;  3ML9 A;  4DHZ B;  3L0W B;  3I3T B;  3W1S C;  1WX9 A;  2N4F A;  2MP2 A;  4W9E A;  1S3S G;  2NBW B;  5GMV A;  2LUE A;  4K7W A;  1UGM A;  4KIK A;  3ZTD A;  5JHA A;  2JXX A;  2PEA A;  5C1Z A;  2CKH B;  1K8R B;  4W9C A;  3H7P B;  3X0W A;  3ZUN A;  1GNU A;  1WX7 A;  1WR6 E;  3A9J B;  4RM8 A;  2KWV B;  1P9D U;  3ZW3 A;  3VTV A;  4P7I A;  3WAL A;  1OEY A;  3RZF A;  2JWZ A;  2J0J A;  3NOB A;  2BWF A;  2CU1 A;  2R2O A;  2C9W B;  3PS6 A;  1WI0 A;  2G4D B;  4AJW A;  4HCP B;  2ZPY A;  2KVR A;  3CMM B;  3EEC A;  3HIZ A;  4FHJ A;  2O6V A;  2A4Z A;  2MBB B;  3VH3 B;  2KFK B;  2AYO B;  2RR9 A;  4W9J A;  2KN5 A;  4F1S A;  1KJT A;  4W9K A;  4K1R B;  4A20 A;  4BKS A;  5KHQ A;  2IO1 B;  4WWP A;  1V81 A;  1EUV B;  3WAO A;  3TMP B;  3KVF B;  3HK0 A;  4DK5 A;  4URK A;  2ZNV C;  3BY4 B;  3VTU A;  3KH0 A;  3AXC A;  2JUO A;  2KFK A;  4E74 A;  2KFJ A;  3UGB B;  2ASQ A;  1P1A A;  4HK2 A;  3PRM B;  4GN1 A;  4BBN F;  4KVG B;  1I35 A;  2MCN B;  4PS7 A;  4FJZ A;  1P0R A;  4KDL B;  2AEH A;  2HE7 A;  2CHW A;  1IPG A;  1M94 A;  3DQV A;  4ANV A;  3ML8 A;  2LD9 A;  2DX5 B;  2DYB A;  2L8J A;  4WJO A;  4KV2 A;  1E8Y A;  2MWS B;  3QHT A;  4FN2 A;  3U7D A;  4ANU A;  2LZ6 A;  1SIF A;  2C5L C;  2IO2 B;  2ZPN A;  4G0N B;  2JPH A;  2L0T A;  2O6V B;  4ZRK A;  3M62 B;  5E6O A;  3H7P A;  2KAN A;  4DXA B;  4EKU A;  4ZRJ A;  2L00 B;  1EF5 A;  4KIK B;  3NHE B;  3M63 B;  3AU4 A;  5G55 A;  1Q0W B;  4EZL A;  3IG3 A;  5D6J B;  3VVW B;  3JW0 X;  4HPM B;  1FXT B;  2KC1 A;  2BYF A;  4BKG A;  1JRU A;  4GDK B;  4ICU A;  4BOZ B;  4EOY A;  1SE9 A;  2GBJ A;  3Q3F A;  3T9L A;  2KHW B;  4G11 A;  3PHW B;  2OJR A;  3IFW B;  4MGZ E;  3H9D A;  4DDI D;  1E90 A;  1UBQ A;  2GBK A;  4GMV A;  4II2 B;  1HE8 A;  4KZC A;  4MEM A;  1KOT A;  2FNJ B;  3KYC D;  3WAN A;  4LDT B;  4TQ0 A;  1WRD B;  1WZ3 A;  2KK8 A;  5HKH A;  3QAQ A;  3DBR I;  3B08 A;  1YD8 U;  4GDL B;  4MJS B;  2MSE D;  4X57 B;  2D2Q A;  5FR6 A;  3UIP B;  2LVO A;  1ZKH A;  1D3Z A;  5DPT A;  4XC2 A;  4EEW A;  2MQJ A;  3EC8 A;  2BKR B;  1V5T A;  2J7Q B;  3EHV A;  2MBH A;  4J6I A;  3VTW A;  2M17 A;  3QK0 A;  3APC A;  1WXS A;  4K7U A;  3PTF C;  2PE9 A;  4ZYN A;  2Z59 B;  2ZVO A;  1SGH A;  2KKC A;  3DCG A;  4CO7 A;  2KJR A;  5DPW A;  3KYD D;  1NI2 A;  1UD7 A;  4BOS C;  2KDI A;  2KJH B;  2R2Q A;  1U4A A;  2K39 A;  4BBN C;  4FUL A;  2FCQ A;  2K6D B;  3ECI A;  4I6P A;  2KX3 A;  2CS4 A;  2LGD A;  3A33 B;  3R66 C;  4PYU A;  1YQB A;  1WYW B;  2MBQ A;  3PGE A;  2XBB C;  4NQK E;  2UWQ A;  3NZS A;  4GU2 A;  4K7S A;  2FID A;  4GDL A;  1WR1 A;  2HJ8 A;  1S1Q B;  1J0G A;  2C7N B;  4JQW C;  2KTF A;  2KO3 A;  1RRB A;  2JY6 A;  1YX5 B;  2KOX A;  1E8X A;  5IAA C;  4AUQ C;  3ONS A;  2MP2 B;  2GMI C;  3OAW A;  4DHJ D;  2RPQ A;  4CHK A;  3DVN V;  2CHZ A;  2HTH A;  3VDZ A;  2FAZ A;  1NDD A;  2LRU A;  3DDC B;  4YL8 A;  1YX6 B;  1E7V A;  4HDQ A;  3ZDT A;  2WX0 A;  1PQS A;  1V49 A;  4GDK A;  3RUI B;  4II3 B;  4LCD E;  2D10 A;  3BIN A;  5E6N A;  1WJ6 A;  2IZV B;  1WF9 A;  4WWN A;  2DHZ A;  5AZG A;  2LJ5 A;  2C60 A;  2LXC A;  3GOE A;  4W9G A;  3DPD A;  1LM8 B;  1WE7 A;  2IO0 B;  4HDO A;  2K8H A;  3HHM A;  4MEL A;  3AUL A;  3D32 A;  1P98 A;  1WMH A;  4EZJ A;  3CST A;  4LJO B;  3ZRC A;  1WXM A;  4DHZ E;  4EUT A;  1UZX B;  4MGK E;  4NJ7 A;  2KLG A;  1WXA A;  2K8B A;  3WIM A;  3L13 A;  3PLV A;  3ZNI D;  3VXW A;  4GOC A;  1V80 A;  4ASW C;  3H7S A;  1CMX B;  3PRE A;  4DHJ B;  4LDT D;  3W1S A;  5LXI B;  3PRP B;  4IUM B;  4HWI B;  4KSL C;  3KW5 B;  4W9D A;  2JRH A;  1ISN A;  5LXH A;  3DBL I;  2D07 B;  2JRI B;  3ZKJ C;  2WWZ A;  2GBM A;  2J0M A;  3UQA A;  2MRP A;  4WJP A;  2XK5 B;  1UBI A;  1E5W A;  3ZO5 B;  2N1V A;  4KDI C;  5G2N A;  3A1Q A;  3L17 A;  2DAF A;  2AWT A;  4ICV A;  4WAA A;  5CHF A;  3RT3 B;  4F8C B;  3HM3 A;  4TV3 A;  4WQO B;  1ZW7 A;  2BPS A;  4RMA A;  4AJY B;  3MTN B;  1Z2M A;  3IBE A;  4ANX A;  5CX3 A;  1YJ1 A;  4NJ6 A;  4HVB A;  1KLV A;  3QQ8 B;  1EF1 A;  4OVV A;  4IWQ A;  4E71 A;  3P2B A;  4ZDV A;  5AZH A;  4XZ4 A;  4PS3 A;  2L76 A;  3TL5 A;  1F9J A;  4EFO A;  1MG8 A;  2EKE C;  2NVU I;  1WMH B;  2AL6 A;  3LJ3 A;  4KSK C;  4B6W A;  2WYQ A;  4HXD A;  4NQL B;  5L83 A;  2L3Z A;  2KJ6 A;  3DOW A;  5J2R A;  2MW5 A;  2KD0 A;  2M1M A;  3UIO B;  3L16 A;  1V2Y A;  2N9P C;  2KZR A;  4FJV B;  2ZZP B;  2NR2 A;  4PYZ A;  3NS8 A;  1L7Y A;  3HM6 X;  2V3S A;  2LVQ A;  3PT2 B;  5JZE B;  2MBE A;  4IG7 B;  1WXV A;  3QAR A;  4B9K A;  2NPT A;  4NAW B;  3VUX A;  2MA9 B;  3VQI A;  2DZJ A;  2OOB B;  1WGG A;  2XEW A;  3N32 A;  4MSQ B;  2WX1 A;  2V1Y A;  2DZM A;  3C0R B;  1WGR A;  2EMS A;  2IO3 B;  2MX2 A;  2MLB A;  3TJP A;  1LFD A;  2NPT B;  3CSF A;  4MGY E;  2K8C A;  5CHW A;  4KZ0 A;  1GC6 A;  1QZE A;  3R7R A;  3TIX A;  2KMA A;  3APD A;  3OLM D;  4AWJ A;  2IYD B;  4A3O A;  3V62 A;  1VD2 A;  5DCN A;  2RD0 A;  1VCB A;  4PS8 A;  3W1Y A;  2C7H A;  4IWO A;  4M0W B;  1E8Z A;  1XD3 B;  3ZNH B;  3X23 A;  3PRZ A;  2CHX A;  2PE6 B;  4K81 A;  5BO4 B;  2B3A A;  3IVF A;  5CHV C;  1OEY J;  3DVG Y;  2N7E A;  3PSE B;  4IWP A;  4ZRI A;  4E3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...