2C5LC

Structure of plc epsilon ras association domain with hras
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
97
Chain Sequence
EESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSLSILSNPNPSDYVLLEEVVKDKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTPASE HRAS
publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 26
structure length 97
sequence length 106
chains with identical sequence D
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c5lC01
4MJSB 4KDIC 2FIDA 2G3QB 1WGYA 2J0KA 2KMAA 2K6DB 4FJVB 5D7GA 4FJYA 4NQLB 3H7PB 4ICUA 2AL6A 4MEMA 2JZ3B 4N9F4 5E6OA 3ZDTA 3V61A 2NBUA 4IM2A 2KN5A 4MSQB 1E8XA 4K1RB 4EFOA 1PQSA 5DPSA 3IG3A 2NPTB 2KTFA 2ZVOA 1C1YB 2LWPA 1AARA 3JSVA 1WH3A 2BKFA 4FA6A 2AL3A 3ONSA 1X1MA 1S1QB 2L7RA 2B3AA 3DVGY 1E5WA 2AEHA 3C0RB 4GGQA 2C7NB 5C23A 2BWFA 3R7QA 5AEKB 2LGDA 3RYTA 3JW0X 5E6PA 2WX0A 2W9NA 4URKA 1I42A 4MGZE 5L95C 4W9DA 4AJWA 4F7ZA 2Z59B 4MELA 3A4SC 4JGHB 3I3TB 1G6JA 2L05A 4HVBA 1WM3A 4IG7B 5JHBA 4DHJB 2K39A 3OJ3A 1T0YA 2GBRA 2MRPA 4K81A 1IP9A 2FCMA 2KJ6A 2KX3A 2LI5A 1P98A 3AXCA 4JQWC 5AZHA 3BINA 3SD5A 2O6VB 4KIKA 4ZRIA 3U30A 1Q5WB 2NS5A 1WF9A 3ML9A 2XK5A 3A9JB 1V80A 2MW5A 4IWQA 4NAWA 4ICVA 1F9JA 5CHWA 3PLVA 3UIPB 1P0RA 1WXMA 3EC8A 2J7QB 2IO1B 3A4RA 3ZLZA 4PYZA 3DBRI 4EKUA 4A3OA 2BYEA 2KJHB 1CMXB 4BOSC 4W9FA 4OVUA 2IO3B 3PVLA 3KVFB 4WWOA 4DHJD 1WX8A 2WDTB 4I6PA 2EMSA 1P1AA 1YD8U 2JT4B 4W9HA 2C5LC 1WM2A 2O6VD 3K9OB 2LVQA 4TUUA 2JRHA 1GC7A 1NI2A 1GC6A 2MQJA 3A9KB 3TIXA 4G50A 4F1SA 1E7VA 2KKCA 3DBLI 2CHXA 4YL8A 1WR1A 3PHXB 5DCNA 5G2NA 3T9LA 1WXVA 2KX0A 3TCAA 3N3KB 3NHEB 1UD7A 2K8CA 4GDLA 1WJ6A 3T8MA 3TJPA 1M94A 2M1MA 2DX5B 3ZW3A 3EHVA 4FN2A 4FULA 1YIWA 4TKNA 1E7UA 4RM8A 3HHMA 3LJ3A 4II3B 4E71A 4WJOA 2KDIA 1KM7A 5L83A 5G55A 3RT3B 2ZCBA 4HWIB 2JF5A 4E3CA 2PE6B 4BKSD 5C1ZA 2ZJDA 3CSFA 2LXCA 1H4RA 4JL9A 4K7SA 4CYEA 1WJNA 3EFUA 4W9LA 1WGRA 3DDCB 3JSVB 3DBSA 2MP2B 2CS4A 3L08A 3RULA 3B08A 3ZNZB 2ZZPB 3QA8A 4W9CA 4AWJA 5D2MB 1WE6A 2NR2A 2KFKA 3BY4B 2D3GA 3O65B 2KZRA 2O2VA 2V1YA 4I6LB 4M0WB 1OGWA 2V3SA 3WAMA 2KMCA 2K8BA 1R4NI 5JHAA 4MDKE 3IFWB 1YX5B 3U8ZA 2CKHB 2LGYA 3KW5B 4JLCA 3JYUA 3IVFA 2MCNB 2LXAA 4AP4C 4FBJB 3VUYA 2IYDB 4GN1A 1UELA 4KIKB 3HM3A 2N1VA 2FIFA 3AULA 4ANVA 2HTHA 4LJOB 2YVCA 1WJUA 3L10B 2DAFA 1RFAA 2GBKA 3HK0A 3QWZB 3ZRCA 2RPQA 1WE7A 3M63B 2AYOB 2KWVB 1WGHA 3K9PB 4J6IA 5GMVA 5LLIA 2N4FA 3APFA 1KLVA 2HJ8A 4NPNA 1WY8A 3KYCD 2D2QA 2J0MA 2RGFA 3RZFA 3V6EB 3DVNV 3L17A 1LM8B 2PPHA 3ALBA 4WWNA 5BO4B 1EF1A 1IYFA 1GUAB 3M95A 3WALA 1WMHA 3QC8B 3DCGA 3TL5A 2M8SA 4EZJA 2BGFA 4ZYNA 3D32A 3VH4B 5KHQA 4GDKB 3PREA 3H9DA 4IW0A 3N30A 5TR5A 4ANXA 5CTRC 5AZGA 3DVGX 2C7HA 2D11A 3ENEA 3PS6A 4CO7A 4DBGA 2JZZA 4HJKA 1EUVB 4MGYE 3W1YA 5DPTA 2ZNVC 1ISNA 1OEYA 2PE9A 4ASWC 3TMPB 4GOCA 4II2B 4GDLB 2GBNA 3APDA 5IA7A 4WAAA 4FHKA 2KTRA 2M0XA 4G3XB 4BBNC 1QZEA 2L8JA 3P2BA 4FHJA 3L0WB 4WQOB 4CHKA 2KK8A 1S3SG 1WI0A 2FCNA 2ASQA 2J0JA 3WA0A 3L54A 2FAZA 1RLFA 1V5OA 4EOYA 4IM3A 2KQ7A 3AU5A 3TBLD 2DHZA 3UF8A 2HE7A 4HLEA 2KC1A 2EKEC 2MX2A 4KZCA 3PRMB 5D94A 2C60A 2N9PC 4M8NA 3VHTC 3A1QA 2ZEQA 3VXWA 3ZO5B 2UYZB 2PEAA 1U4AA 2L00B 1V6EA 1XD3B 3QARA 3OJ4B 4KSLC 2KFKB 3WANA 2KLGA 3ZTCA 2PJHA 2KC2A 1JRUA 3VTUA 4BFRA 1P3QU 2O2VB 3NZSA 4PS7A 1E8WA 4B95A 3PRPB 1J8CA 1WXAA 2K25A 3QHTA 4I6NB 3VTWA 3HM6X 3M3JA 2LJ5A 4EZKA 2BWES 2I1JA 2IO2B 2NVUI 4AOFA 3Q3JA 3RD2A 2DAJA 3NZUA 1GG3A 3JVZX 2LRUA 3H7PA 2L3ZA 4BKGA 1WYWB 3V6CB 3AU4A 2JRIB 3L16A 1A5RA 3QK0A 2MBEA 2LUEA 2MBBB 2FUHB 4RM9A 3B0AA 4HK2A 4LCDE 1TBEA 2N9XA 2NPTA 5JH5C 1K8RB 3GOEA 2R2QA 3APCA 3QX1A 2JY6A 4PS3A 3UIOB 3CMMB 3X0WA 3R66C 2ZPNA 1WGDA 2WWZA 3PT2B 4ANWA 3ZDMC 4W9KA 4DHZE 4GU2A 1VD2A 3QAQA 4BVUC 1SIFA 3QQ8B 1RAXA 5DPRA 5J17A 3MJWA 3ZTDA 3ZNID 4W9GA 2L76A 3UGBB 2BKRB 2NBVB 1XQQA 4IUMB 2JXXA 2G45B 1XT9B 3DVNU 2I1KA 2BF8B 1NBFC 3H6NA 1Q0WB 3R7RA 4KSKC 2CHWA 3V62A 3WAPA 4MM3A 2IBIB 2K6QA 2XBBC 3NY5A 1I35A 1V5TA 3PTFC 1P9DU 2M17A 2KTRB 1EO6A 4IM0A 4PS8A 3WAOA 1TTNA 1WZ0A 1D3ZA 3VUXA 1LQBA 3ZNGC 3VUWA 3AI5A 4DHZB 1WFYA 2LRWA 4IWPA 4OVVA 4E74A 2UWQA 1TZ1A 2N1WA 2CU1A 2XK5B 4IWOA 4KDLB 2LVPA 3V60A 3ZIMA 1L2NA 2K1FA 4NAWB 2GMIC 4A3PA 1NDDA 3PSEB 2NBWB 1C3TA 1WX9A 2KNBA 2R2OA 1YQBA 3N32A 4HPLB 3ML8A 4DK5A 2OJRA 3H7SA 1Z2MA 4ZRKA 2N7EA 4DDGD 5CHVC 4XZ4A 2GBJA 4MGKE 3CSTA 2N7DA 3A9KA 3MHSD 3QIJA 4AJYB 1E8YA 2N9EB 2BYFA 1UBQA 1BT0A 2LGXA 5JZEB 3QCAA 4NJ7A 5CX3A 1ZW7A 1GJZA 2DZJA 1Z5SB 2BPSA 4NY0A 3A33B 3OAWA 3PV1A 3L13A 2AWTA 2LVOA 1OTRB 4BKTA 1WXSA 4F8CB 3SDLC 2CHZA 2KWUB 3IHPC 1L7YA 2KDEB 4K7UA 2IY0B 1UH6A 4DWFA 4HDQA 3KYDD 3UINB 4M8MA 3ECIA 4TQ1A 1LXDA 3KUZA 4A20A 1E8ZA 4LJPB 3Q3FA 4KZ0A 5LXIB 1HE8A 2LASA 2MP2A 1OQYA 1KOTA 2MBHA 3EECA 3OLMD 4GIVA 4WJQA 2FCQA 2VRRB 4DDID 3KUCB 2MBQA 4FLHA 4WJNA 2KHWB 5EDSA 3RCZA 2RSUA 2IO0B 1IPGA 2G4SA 5IAAC 3ZNHB 3PLUA 1VCBA 3ZVVA 2OOBB 2Z0DB 3H1UA 1E90A 2DZMA 1WIAA 2CR5A 3VH3B 2C9WB 4HDOA 2JPHA 1GNUA 4X57B 2LZ6A 1V49A 4TQ0A 4ANUA 2JWZA 5J18A 2FCSA 2MBOA 2A5UA 2JVCA 1R4MI 2FNJB 2WX1A 1FXTB 2C7MB 3B1LX 3MTNB 4B6WA 4FJZA 3VDZA 2WYQA 4PYUA 3UQAA 1SE9A 4NQKE 4LDTB 2ZNVB 3VFKA 2D10A 4MJSA 4MSMB 4NJ6A 4EUTA 2YLMA 1ZGUB 3KH0A 4HXDA 5FR6A 4GB9A 2Z0EB 2KO3A 4G0NB 3QJZA 4BBNF 1WJ4A 2GBMA 2KJRA 2Y5BB 3RZWC 1RRBA 4HCNB 2D07B 2RR9A 3GZNI 3KUDB 2DZKA 1YX6B 3R3MA 4MH0E 4HPMB 3VQIA 2A4ZA 2MWSB 4GDKA 4EZLA 1WX7A 2KDBA 3W1SA 4NNJB 1V9JA 2KVRA 3PGEA 2K8HA 1V81A 4ZRJA 5LXHA 3ZKJC 3HIZA 1V86A 1OEYJ 2NCNA 2DYMA 4JIOU 5KHOA 4AUQC 5J2RA 2DZIA 4IC7B 1TGZB 3DOWA 1WR6E 2KOXA 4LDTD 1WMHB 4FADA 2MA9B 3X23A 2DENB 2L0TA 4GXBA 4W9EA 3UQBA 2ZPYA 1SGHA 1WGGA 1EF5A 3ZRFA 3VTVA 4BOZB 4EEWA 4GMVA 1LFDA 1UZXB 2O6VA 2ZCCA 4GSWA 4MGIE 1WZ3A 4HCPB 2DYOA 2DYBA 2BYVE 4K7WA 2REXA 3A9JA 4WWPA 4TV3A 3DBHI 2KQSA 3S2AA 2JUOA 5HKHA 2L0FA 4B9KA 2XEWA 2KWCA 3U7DA 4XX5A 3IBEA 4XC2A 3PPAA 3PZDA 1V2YA 2HD5B 3DPDA 4P7IA 2KFJA 2KD0A 2LD9A 3SHQA 2M4NA 4RMAA 3NOBA 3W1SC 4G11A 2ZVNA 2IZVB 2EMTA 2V4LA 5AZFA 3VVWB 1Q1OA 2RD0A 3DQVA 4KVGB 4WJPA 4ZDVA 2KLCA 2KXJA 1MG8A 2MLBA 4KV2A 5E6NA 1Y8RC 5DPWA 3LDZE 1J0GA 3NS8A 2QHOA 4W9JA 4W9IA 1ZKHA 4BKSA 3A1QB 1J19A 1WRDB 3ZUNA 1YJ1A 1UBIA 2G4DB 2GOWA 1UGMA 2MSED 3M62B 3PRZA 5D6JB 2IY1B 1H8CA 2KDFB 2KANA 3WIMA 3VAWA 4DXAB 3PHWB 3CF6E 3RUIB 1KJTA 3SU8X 5CHFA
chains in the Genus database with same CATH superfamily
4KDIC 3BVGA 3AMZA 2KMAA 2HDEA 4NQLB 4YSXB 2JZ3B 2E6XA 2KDMA 1FNUA 1E8XA 4K1RB 1VZ8A 2NPTB 2JQRB 1E5WA 3Q3OC 3R7QA 1N5XA 2QCZA 3MHZA 3TEWA 4M0WA 4W9DA 1RFKA 2L05A 4HVBA 3Q8AA 2K39A 2MRPA 4XWTA 1IP9A 2KJ6A 2WDRB 5AZHA 1XEEA 3KQ4A 1Q5WB 1V80A 2MW5A 1FFVA 3DWMA 4NAWA 1JROA 4ICVA 4USAA 5CHWA 1I4XA 1KH0A 3DBRI 4A3OA 1CMXB 2IO3B 4DHJD 2LFIA 1P1AA 2C5LC 1ZOYB 3K9OB 2LVQA 2JRHA 5G5HA 1D6EC 1C78A 1FFUA 2KKCA 5HHDG 5DCNA 5G2NA 1WXVA 3TCAA 3N3KB 4GDLA 1QILA 3T8MA 3ZYYX 3TJPA 4FN2A 1YIWA 1UGJA 2PIAA 4WJOA 5L83A 3P4PB 4ITKA 2PE6B 4S17A 1SSNA 1H4RA 2QDFA 1WJNA 3DDCB 1BMLC 3JSVB 3DBSA 3MC9A 3IAM1 2WXOA 3L08A 3RULA 2I38A 3RNGC 4DQOC 5D2MB 3MFGA 4BAXA 4B0EA 1CQVA 1AWDA 4GLSC 2WXFA 3ZXVA 2J53A 3AEGB 2CKHB 2LGYA 3KW5B 1FXAA 3AEFB 3VUYA 3ABVB 4KIKB 3HM3A 3AULA 2HTHA 4N58A 1JRPA 4RGNA 2WDQB 3QWZB 3M63B 3K9PB 1WGHA 3APFA 2WP9B 2J0MA 4A6QA 1T0RC 1FXIA 1AN8A 1SBBB 1EF1A 3WALA 2WXKA 3NS1A 5IP4D 3DCGA 4EZJA 4UDUC 4ZYNA 3VH4B 5KHQA 1MJDA 5BYSA 3AEAB 4REZA 2LGSA 5CTRC 4YXDB 4CO7A 1EUVB 5DPTA 5BYQA 1ZE3D 3AE2B 1OEYA 1I4GA 3CIRB 4II2B 1B9RA 4WAAA 2WQYB 4FHKA 1K51A 1NYQA 1S3SG 2INNE 2XN9C 2K5PA 1DGJA 2KQ7A 4HLEA 2DHZA 3Q6BA 2WXJA 2PEAA 1V6EA 3DBRB 1R7SA 2DBYA 4KSLC 2KFKB 3WANA 1D5ZC 4US8A 4BFRA 1P3QU 4BZAA 4PS7A 1L0YB 3PRPB 1J8CA 3QHTA 3AN1A 2LJ5A 4EZKA 1IGCA 4AOFA 4BKGA 3R2TA 2JRIB 2KT7A 1A5RA 2LUEA 2L1AA 4RM9A 4HK2A 4YSZB 1FD6A 2NPTA 2R2QA 2WXMA 3I5JC 4NJCA 1WGDA 2WWZA 4LNOA 3GE8C 3QQ8B 5J17A 2KVZA 3MC0B 4HEA1 1VDVA 2I2YA 3H6NA 2TSSA 2JYEA 3WAPA 2IBIB 2K6QA 3NY5A 1I35A 4ARIA 2WGSA 2QSDA 1P9DU 3FILB 3SFDB 2BT6A 1D3ZA 3ZXRA 3VUWA 4DHZB 4OVVA 1TZ1A 2CU1A 2XK5B 2LVPA 1L2NA 1TYGB 1N5WA 2NBWB 1WX9A 5JXVA 4HPLB 5C3JB 5IN7A 2N7EA 5CHVC 4RCOA 4XZ4A 3LXFA 2BYFA 2WXNA 1UBQA 1BT0A 2LGXA 3QCAA 4NJ7A 1YJIA 3A33B 3OAWA 4P1BC 2H89B 1OTRB 4F8CB 1TS3A 2KWUB 1L7YA 2KDEB 2IY0B 4DWFA 4RFBA 3KYDD 1WGKA 4KZ0A 1KOTA 3EECA 1D5XC 2L83A 4WJQA 2FCQA 4M01A 2IO0B 2G4SA 2NMQA 3ZNHB 2V3NA 2OOBB 2Z0DB 1E90A 3RNFC 4OHJA 4HDOA 3C19A 1CK1A 2JWZA 2PLPA 5J18A 1UWXA 2FCSA 2A5UA 4HPPA 2JVCA 3EFCA 2KACA 4MM3B 3MTNB 4WQMA 4LDTB 2D10A 1YQ4B 4MSMB 2BBCA 4N6EB 1I4PA 5FK9C 2RR9A 3GZNI 3ZGZA 1YX6B 1M4VA 1T3QA 1TZOA 2W3RA 3P4QB 1V86A 4JIOU 5J2RA 1WMHB 5HG2A 3E9SA 4RF0A 2L0TA 3UQBA 1SGHA 3OWEB 3ZRFA 1YMHE 4EEWA 3I57A 2ZCCA 4LNKA 4HCPB 2J52A 2REXA 3A9JA 4B9KA 2XEWA 3BVZA 4JE3B 3IBEA 4XC2A 1C4AA 3PPAA 3PZDA 2HD5B 3DPDA 3P1MA 4G11A 1V1OA 3VVWB 2KLCA 2KXJA 2MLBA 4KV2A 1Y8RC 1J0GA 3NS8A 2QIEB 4LNIA 2AQ2B 1VLBA 4ZRPA 2KMMA 4IKGA 1H8CA 2KANA 3AE5B 3PHWB 3VR9B 3RUIB 3SU8X 3T3NA 3T3OA 5CHFA 4ARCA 1ET6A 2ICIA 4MJSB 1PDXA 1F77A 2K6DB 2Y5CA 3H7PB 4ICUA 4MEMA 3V61A 2KN5A 4MSQB 3AE1B 4EFOA 1PQSA 1ET9A 4FA6A 1AARA 2BKFA 1PGAA 1FRDA 2B3AA 2D3BA 2BWFA 4AS1A 1B1ZA 2DLBA 1I42A 4OW0A 1FO4A 4AJWA 1E0ZA 2Z59B 3NRZA 3A4SC 4MELA 4KX6B 1G6JA 1A70A 3FILA 1T0YA 1C4PA 3AXCA 2O6VB 1SE3A 3U30A 2NS5A 1WF9A 3ML9A 2XK5A 4A55A 1YJJA 1L4DB 1ZP0B 3UIPB 1P0RA 3EC8A 1F1HA 2WHIA 2KJHB 4OVUA 3KVFB 1WX8A 2MEKA 4I6PA 3GZNB 2EMSA 1YD8U 3KWVA 4W9HA 2MHJA 1WM2A 1CZPA 1GC6A 2GRIA 2MQJA 4F1SA 5BMHA 2CHXA 3URYA 3T9LA 2KX0A 1YN4A 4QAYA 1WJ6A 1V1PB 1M94A 3B9JA 2M1MA 3ZW3A 4FULA 4KKJA 1E7UA 3LJ3A 4E71A 3V3XA 5G55A 1QOGA 2JF5A 3EFUA 4W9LA 3FKYA 1SE4A 1MPEA 2W54A 2ZZPB 2NTTA 1WE6A 3Q8CA 2NR2A 3BY4B 3GE3C 2D3GA 1OGWA 2V3SA 1R4NI 5JHAA 2V3PA 3JYUA 2LXAA 4AP4C 2IPKD 1UELA 2N1VA 4ANVA 2R61A 3ZRCA 2GBKA 4OZBA 1WE7A 2AYOB 1C77A 5LLIA 1KLVA 2G9HD 4LLGM 2D2QA 2RGFA 3DVNV 5AUIA 5D3DA 1GUAB 3M95A 1WMHA 1P7FA 2BGFA 3D32A 2QEJC 5EE1A 3WCQA 3H9DA 4IW0A 2Y5PA 1F0ZA 5TR5A 1TS2A 1ZDVA 4ANXA 3DVGX 3ENEA 3PS6A 4DBGA 2JZZA 4HJKA 3W1YA 4L2YA 3AEBB 4IOIE 4RH6A 1FRRA 4C7ZA 5C2TB 1T0QC 4GOCA 2GBNA 1TIFA 2N9KA 2AQ1B 2KTRA 4G3XB 4XDCA 1VJKA 2LHDA 2Y3AA 4CHKA 2FCNA 5IKCM 3WA0A 3L54A 1RLFA 4IM3A 3NVVA 2KC1A 3PRMB 4M8NA 2ZEQA 3VXWA 4LNFA 3E56A 2L00B 1XD3B 3QARA 4WURA 3ZTCA 1IBXB 1I4QA 2KC2A 1JRUA 3VTUA 2O2VB 4B95A 1E8WA 1WXAA 4I6NB 2K25A 1TT5B 3O13A 2PKOA 2EELA 2BWES 4IDIA 3RD2A 3NZUA 1GG3A 3P4SB 3H7PA 1ZDXA 3V6CB 1NEKB 2MBEA 1MVKA 2MBBB 2FUHB 1TBEA 1XO3A 1K8RB 3GOEA 4Q2JA 3QX1A 2JY6A 2UU7A 3UIOB 2PW9A 3X0WA 3R66C 2ZPNA 2WXQA 3ZDMC 4W9KA 4C4VB 3NG0A 3BK1A 4GU2A 3RMKC 2LHEA 3BWUD 3N9YC 3ZTDA 2NBVB 1XQQA 1L6VA 2JXXA 1NVID 3DVNU 1YOVB 1J7AA 4WH4A 3ZJVA 2RDGA 1XLPA 2K3UA 1V5TA 1R4NB 1SE2A 1EO6A 4IM0A 4PS8A 1LQBA 4IWPA 4E74A 1BUIC 2RPVA 3V05A 4IWOA 2GMIC 1FCCC 1HTOA 2KNBA 1YQBA 3N32A 3SR6A 4DK5A 2OJRA 1Z2MA 4MGKE 1GOZA 1E8YA 2N9EB 3ETRA 1SJED 5JZEB 1EWYC 4C00A 1ZW7A 4US9A 2DZJA 3Q8EA 1XLQA 2BPSA 1V97A 4NY0A 4MT5A 2OEDA 1V1PA 1QOFA 4BKTA 5BMIA 4KGSA 5EE3A 4OZAA 2JYTA 3SDLC 4CQNA 1XF5L 2CHZA 1UH6A 3KUZA 4C7YA 2WXLA 3Q3FA 4RGMA 2LASA 1C76A 3FAHA 3RPFC 2KHWB 5EDSA 3AE3B 5IAAC 3PLUA 1L6UA 2DZMA 1WIAA 1RWSA 4P6VF 1UWMA 2LZ6A 1LGRA 2FE8A 2GLSA 1R4MI 2FNJB 2N9LA 2C7MB 2JWUA 3VDZA 3UQAA 1SE9A 4NQKE 2ZNVB 3AH7A 4KGTA 3KH0A 4HXDA 5FR6A 1DOYA 1XLOA 4BBNF 1WJ4A 2GBMA 2KJRA 2Y5BB 3J9CA 1KFYB 1RRBA 1QKZA 2DZKA 3U52E 2MWSB 4EZLA 1WX7A 3PGEA 3ZKJC 3TUOA 3AB5A 1OEYJ 2NCNA 1TGZB 1WR6E 4LDTD 4FADA 2MA9B 1DOXA 1QF6A 2DENB 3N1ZC 3PO0A 1WGGA 1XCQL 3VTVA 3AEEB 1J7BA 1WZ3A 2DYOA 2DYBA 4TV3A 2OHFA 3DBHI 5D3IB 5I4DA 1WXQA 2ZW0A 1C4CA 3U7DA 2VZKB 1GB4A 4P7IA 2KD0A 2M4NA 4RMAA 4YT0B 2EMTA 1ZXHA 2V4LA 5AZFA 2K22A 2H88B 5DPWA 4W9JA 4W9IA 1E9MA 4XYCA 2WS3B 3ZUNA 3Q8BA 2FUG1 1UF0A 1YJ1A 2G4DB 3M62B 3RI7C 2N0SB 3BYYB 2IY1B 2KDFB 2NTSA 2MH7A 1KJTA 3TEZA 1HEZE 4C80A 2FIDA 1TY0A 1F2RI 2G3QB 1WGYA 2J0KA 4FJVB 4FJYA 4MH8A 5T8IA 3MP9A 5E6OA 2AL6A 4N9F4 3Q2AC 4ZYSA 2NBUA 1JCKB 4IM2A 1C9FA 2KN4A 1WWTA 3IG3A 2ZVOA 3JSVA 4RGTA 3RNBC 1WH3A 4C56C 3ONSA 1X1MA 1S1QB 2L7RA 3DVGY 1XCTL 3KLSX 3Q69A 5C23A 1K53A 3RYTA 5E6PA 2WX0A 2W9NA 4URKA 1HQRD 1XLNA 4RGOS 5L95C 3RNEC 1SIJA 3I3TB 3OJ3A 2GBRA 4K81A 2FCMA 4JQWC 4HROA 1FEHA 3BINA 3R8BA 4KIKA 1VRAB 4HJGE 1KTKA 2L52A 1FCLA 3RN9C 1R4MB 3AE8B 3PLVA 2J7QB 2DNFA 5EE0A 1MFWA 3EGRA 1T0SC 2BYEA 2BW2A 4WWOA 4PK1A 1PGBA 2MJEA 4TSSA 2JT4B 1NYRA 2O6VD 3KWLA 2BS2B 2M0AA 3A9KB 3TIXA 1QLBB 1JQ4A 3DBLI 1WRIA 2IGGA 2E3TA 3PHXB 1HXYD 1YN3A 3LB8C 1UD7A 4H2AA 5MPOA 1VZ6A 2DX5B 3EHVA 4RM8A 1YQ3B 1KM7A 1FM0D 1VZ7A 1OQRA 2ZCBA 4K3BA 3BIID 2ZJDA 3DBHB 2K9XA 2RDHA 3QA8A 4AWJA 3ZQ4A 2KFKA 4HKQA 2KZRA 2GB1A 2V1YA 4M0WB 3DHIC 3WAMA 2KMCA 3IFWB 3GS2A 3U8ZA 4JLCA 3IVFA 4GN1A 1N61A 2FIFA 3Q3NC 1IUEA 3FC4A 4B0MA 1WJUA 3L10B 1RFAA 2KWDA 2KWVB 5GMVA 2N4FA 2HJ8A 1WY8A 3RZFA 1K52A 1MI0A 1LM8B 4WWNA 5BO4B 3ZJTA 2D5GA 1EWCA 2PTLA 1L0VB 3QC8B 3TL5A 2M8SA 4GDKB 3PREA 1IGDA 3NVWA 4YSYB 1JALA 1GPXA 2C7HA 2D11A 4MGYE 4WAFA 2ZW1A 2ZNVC 2PE9A 4ASWC 4DXFA 4GDLB 4BBNC 4WQOB 1WI0A 2J0JA 3IXSA 3AU5A 2JX5A 2EKEC 2MX2A 5D94A 2WNMA 3ZO5B 2UYZB 1SEBD 1U4AA 1D5MC 1DYQA 3OJ4B 4ZRQA 2X8XX 1MHHE 2KLGA 2PJHA 3N1YC 3W5VB 2PVGC 3SEBA 3BYTB 2ACZB 3M3JA 2EKIA 2IO2B 1JWMD 2GI9A 3BVMA 3Q3JA 2BTEA 1WYWB 3DBLB 2YEPF 3QK0A 2YEPB 2WXGA 4LCDE 2IDYA 2OJWA 1TS5A 5JH5C 4EE2A 1SJHD 3APCA 1N63A 4PS3A 3CMMB 1QOBA 3PT2B 4ANWA 1VD2A 3QAQA 2VH2A 4BVUC 4YTMB 1RAXA 5DPRA 1GB1A 3ZNID 4W9GA 2L76A 3UGBB 5H92C 4JPSA 1MHXA 2JXTA 2J4XA 2I1KA 1NBFC 4NAMA 3V62A 2BS3B 3HVZA 4MM3A 2XBBC 2M17A 4JWUC 3WAOA 1TTNA 1WZ0A 3VUXA 3U7ZA 3ZNGC 3PZ7A 1WFYA 2LRWA 2UWQA 1HA5A 2N1WA 3AE6B 4KDLB 3I63C 3IT4B 2WU5B 3ZIMA 2K1FA 1NDDA 2R2OA 2QILA 4ZHOA 3H7SA 4M02A 1QQRA 3P42A 3RNAC 2GBJA 3SFEB 1SB3C 4D2KA 3A9KA 5HFYA 3L4PA 3VR8B 3LYYA 5CX3A 1GJZA 1Z5SB 4N59A 3PV1A 2AWTA 1EU4A 2LVOA 3P63A 2V0GA 2BS4B 3H8HA 1QOAA 2M19A 3HUIA 3DHHC 4P16A 4K7UA 4LTUA 1OQQA 4HDQA 3TEXA 3UINB 4M8MA 1LXDA 1JW9D 1I7HA 4A20A 4LJPB 2DWQA 1HE8A 2MBHA 3OLMD 4GIVA 2VRRB 3KUCB 2MBQA 4FLHA 4WJNA 1IPGA 4L1BA 4FXCA 1FNVA 2C9WB 2JPHA 1V49A 5FKAC 1TJEA 4ANUA 2WXPA 1NENB 1OFFA 2JZPA 3B1LX 4B6WA 1TKEA 2MJDA 4FJZA 1D4BA 4PYUA 1TKYA 2ON8A 4MJSA 2IGDA 3VFKA 4NJ6A 2KO3A 3NJTA 4G0NB 1TKGA 3RZWC 1L5PA 3Q3MC 4MH0E 2BB6A 4GDKA 3IT6B 4NNJB 4ZRJA 2KVRA 1V81A 3DHGC 1JWUD 3HIZA 2WXIA 2DZIA 2KOXA 2BVCA 3NVYA 3NUHB 4GXBA 4W9EA 1ZUD2 1N62A 1EM7A 4XWWA 1EF5A 3W9CB 1UZXB 2O6VA 4GSWA 4MGIE 2D3CA 2X38A 1VR9A 1FPYA 2LMCA 1F2RC 2J42A 1ESFA 4XX5A 1V2YA 3OG5A 3SHQA 5BYRA 2ZVNA 2CJNA 4WJPA 1SF0A 5TSSA 2QHOA 3A1QB 1J19A 4S0RA 1JWAD 1T5XD 2GOWA 2HJ1A 2MSED 5GXGB 5D6JB 2WDVB 3WIMA 3VAWA 1V8CA 2VZKD 3CF6E 1PGXA 1HZ6A 1JWBD 2WLBA 5D7GA 1DOIA 1T6BX 3TEYA 1Q10A 3DWGC 3ZDTA 2AQ3B 5DPSA 2M56B 2KTFA 1C1YB 2LWPA 3PZ8A 2AL3A 5IO9A 5LNK1 1J7CA 2AEHA 3C0RB 1ZPSA 2C7NB 4GGQA 1FNWA 5AEKB 1JMLA 2LGDA 3JW0X 4MGZE 4F7ZA 4JGHB 4WWMA 1WM3A 4IG7B 1RYJA 5JHBA 4DHJB 2LI5A 2KX3A 1P98A 3SD5A 4ZRIA 3A9JB 1PUTA 4IWQA 3CWIA 5G5GA 3U4EG 1F9JA 2SAKA 1KLGD 2B76B 3MC8A 1WXMA 3N1XC 2IO1B 3A4RA 3ZLZA 4PYZA 4EKUA 2N7JA 4BOSC 4W9FA 3PVLA 2WXRA 4R3DA 2WDTB 4O1NA 1PFDA 1E10A 4JX1C 1Y56A 1AYFA 4P1CC 1WYGA 4TUUA 2W55A 4MACA 1GC7A 1NI2A 2HTME 2RMMA 4ZOHC 4G50A 3UI3A 1E7VA 2Z8LA 4YL8A 1WR1A 3GP7A 2QJLA 3NHEB 2K8CA 2INCC 1P7EA 4RF1A 3TSSA 2LGIA 4TKNA 3HHMA 4II3B 2KDIA 2D3AA 3RT3B 2FBWB 4HWIB 4E3CA 4BKSD 5C1ZA 1EU3A 3CSFA 2LXCA 4JL9A 4K7SA 3NZ3A 4CYEA 2CJOA 1WGRA 1WSPA 2MP2B 2CS4A 1MG4A 3B08A 3ZNZB 4W9CA 3AE7B 5AUKA 1NI3A 2QMTA 1IBXA 3O65B 2O2VA 4I6LB 2K8BA 1KF6B 4MDKE 1YX5B 2MCNB 2PVOD 4FBJB 2IYDB 2RDBC 1XXGA 4LNNA 4LJOB 2YVCA 2DAFA 3HK0A 2RPQA 4J6IA 2KQ4X 1JWSD 4NPNA 1TY2A 3KYCD 4YTPB 3V6EB 2IJ0A 3L17A 2AX5A 1E6EB 4KGRA 3W5UB 2PPHA 3ALBA 3NVZA 1IYFA 3AV8A 4C4VA 4YWGG 2KAJA 3AM9A 3N30A 2IGHA 5AZGA 1SXTA 3HVDA 4A8XC 3MJ5A 1ISNA 1N6ZA 5HI1A 1F52A 3TMPB 2V9HA 3APDA 3HRDD 5IA7A 4PT5A 2M0XA 2SEBD 1QZEA 2L8JA 3P2BA 4FHJA 3L0WB 2KK8A 5EE9A 2BB5A 4YTNB 2ASQA 2MJ3A 2FAZA 1V5OA 5BMGA 4EOYA 3TBLD 3UF8A 2HE7A 4KZCA 2C60A 2N9PC 3VHTC 1FIQA 2Q5WD 3A1QA 2K0PA 3AE4B 3ZJUA 3NZSA 4ZHPA 5H8YE 3VTWA 3HM6X 3P4RB 1QT9A 2I1JA 2NVUI 1ACCA 2DAJA 3JVZX 3Q8FA 2LRUA 2L3ZA 3AU4A 3L16A 2CU3A 3AEDB 2PMVA 3B0AA 3N20C 2N9XA 4NZLB 2V4IB 2QC8A 3BK2A 1K50A 4L23A 1L0XB 4LK0M 3U2SC 4DHZE 1YN5A 1UNSA 1CJEA 3B2FA 1RM6C 1SIFA 1TS4A 3R2IA 3MJWA 2BKRB 1HTQA 4IUMB 1KLUD 2G45B 1XT9B 2BF8B 1Q0WB 3R7RA 4KSKC 2CHWA 2INDC 4TMAB 3PTFC 2KTRB 3EUB2 5FR3A 3AI5A 2LJIA 3V60A 2INPE 4OZCA 4NAWB 4WIPA 4A3PA 3W2DA 3PSEB 3I9V1 2BYTA 1C3TA 4HKZE 2JSVX 3ML8A 4DDGD 1FMAD 1N60A 3C8YA 4ZRKA 3AE9B 3CSTA 2N7DA 3MHSD 3QIJA 4AJYB 1L4ZB 2KYWA 4DXGA 1I4RA 4OVZA 3L13A 1WXSA 4XE0A 1ZXIA 3BZDB 3IHPC 3ECIA 4TQ1A 4JWSC 1E8ZA 4HRSA 2G1EA 2ONQA 2BQQA 5LXIB 2MP2A 1OQYA 3AECB 3B2GA 4DDID 3RCZA 1AW7A 2RSUA 3ZVVA 1VCBA 3H1UA 2CR5A 2W3SA 3VH3B 4X57B 1GNUA 3VRAB 4TQ0A 1C79A 2W82A 2MBOA 4XDDA 4AQ7A 2WX1A 1FXTB 2WYQA 1E7PB 2YLMA 4EUTA 1ZGUB 1I4HA 4GB9A 2Z0EB 2VH1A 3QJZA 1STEA 4K3CA 1HZ5A 4HCNB 2D07B 3KUDB 1PYWD 3R3MA 4HPMB 3VQIA 2A4ZA 2KDBA 3W1SA 5LXHA 1V9JA 2K8HA 1UUPA 2DYMA 5KHOA 4AUQC 4ACFA 4IC7B 1LO5D 3DOWA 1ENFA 2L32A 3X23A 1BXTA 4A9AA 2LEKA 2ZPYA 4BOZB 5E6JA 2WXHA 3IAS1 4GMVA 1LFDA 3RNCC 5IOIA 2BYVE 4K7WA 4WWPA 2JU6X 2KQSA 3S2AA 2JUOA 5HKHA 3GB1A 2WU2B 2L0FA 2KWCA 1GAQB 2XNAC 2KFJA 2LD9A 1KRHA 3W1SC 3NOBA 4J3OD 2IZVB 2LUMA 1Q1OA 2RD0A 3DQVA 3Q14C 4KVGB 4ZDVA 4KKIA 5E6NA 1MG8A 3EA6A 1YNTE 3LDZE 1ZKHA 1ROEA 4BKSA 1WRDB 4RNAA 4M00A 1UBIA 1UGMA 4XGAB 3VRBB 3PRZA 4A90A 4DXAB 3RFZB
chains in the Genus database with same CATH topology
4MJSB 4KDIC 2FIDA 2G3QB 1WGYA 2J0KA 2KMAA 2K6DB 4FJVB 5D7GA 4FJYA 4NQLB 3H7PB 4ICUA 2AL6A 4MEMA 2JZ3B 4N9F4 5E6OA 3ZDTA 3V61A 2NBUA 4IM2A 2KN5A 4MSQB 1E8XA 4K1RB 4EFOA 1PQSA 5DPSA 3IG3A 2NPTB 2KTFA 2ZVOA 1C1YB 2LWPA 1AARA 3JSVA 1WH3A 2BKFA 4FA6A 2AL3A 3ONSA 1X1MA 1S1QB 2L7RA 2B3AA 3DVGY 1E5WA 2AEHA 3C0RB 4GGQA 2C7NB 5C23A 2BWFA 3R7QA 5AEKB 2LGDA 3RYTA 3JW0X 5E6PA 2WX0A 2W9NA 4URKA 1I42A 4MGZE 5L95C 4W9DA 4AJWA 4F7ZA 2Z59B 4MELA 3A4SC 4JGHB 3I3TB 1G6JA 2L05A 4HVBA 1WM3A 4IG7B 5JHBA 4DHJB 2K39A 3OJ3A 1T0YA 2GBRA 2MRPA 4K81A 1IP9A 2FCMA 2KJ6A 2KX3A 2LI5A 1P98A 3AXCA 4JQWC 5AZHA 3BINA 3SD5A 2O6VB 4KIKA 4ZRIA 3U30A 1Q5WB 2NS5A 1WF9A 3ML9A 2XK5A 3A9JB 1V80A 2MW5A 4IWQA 4NAWA 4ICVA 1F9JA 5CHWA 3PLVA 3UIPB 1P0RA 1WXMA 3EC8A 2J7QB 2IO1B 3A4RA 3ZLZA 4PYZA 3DBRI 4EKUA 4A3OA 2BYEA 2KJHB 1CMXB 4BOSC 4W9FA 4OVUA 2IO3B 3PVLA 3KVFB 4WWOA 4DHJD 1WX8A 2WDTB 4I6PA 2EMSA 1P1AA 1YD8U 2JT4B 4W9HA 2C5LC 1WM2A 2O6VD 3K9OB 2LVQA 4TUUA 2JRHA 1GC7A 1NI2A 1GC6A 2MQJA 3A9KB 3TIXA 4G50A 4F1SA 1E7VA 2KKCA 3DBLI 2CHXA 4YL8A 1WR1A 3PHXB 5DCNA 5G2NA 3T9LA 1WXVA 2KX0A 3TCAA 3N3KB 3NHEB 1UD7A 2K8CA 4GDLA 1WJ6A 3T8MA 3TJPA 1M94A 2M1MA 2DX5B 3ZW3A 3EHVA 4FN2A 4FULA 1YIWA 4TKNA 1E7UA 4RM8A 3HHMA 3LJ3A 4II3B 4E71A 4WJOA 2KDIA 1KM7A 5L83A 5G55A 3RT3B 2ZCBA 4HWIB 2JF5A 4E3CA 2PE6B 4BKSD 5C1ZA 2ZJDA 3CSFA 2LXCA 1H4RA 4JL9A 4K7SA 4CYEA 1WJNA 3EFUA 4W9LA 1WGRA 3DDCB 3JSVB 3DBSA 2MP2B 2CS4A 3L08A 3RULA 3B08A 3ZNZB 2ZZPB 3QA8A 4W9CA 4AWJA 5D2MB 1WE6A 2NR2A 2KFKA 3BY4B 2D3GA 3O65B 2KZRA 2O2VA 2V1YA 4I6LB 4M0WB 1OGWA 2V3SA 3WAMA 2KMCA 2K8BA 1R4NI 5JHAA 4MDKE 3IFWB 1YX5B 3U8ZA 2CKHB 2LGYA 3KW5B 4JLCA 3JYUA 3IVFA 2MCNB 2LXAA 4AP4C 4FBJB 3VUYA 2IYDB 4GN1A 1UELA 4KIKB 3HM3A 2N1VA 2FIFA 3AULA 4ANVA 2HTHA 4LJOB 2YVCA 1WJUA 3L10B 2DAFA 1RFAA 2GBKA 3HK0A 3QWZB 3ZRCA 2RPQA 1WE7A 3M63B 2AYOB 2KWVB 1WGHA 3K9PB 4J6IA 5GMVA 5LLIA 2N4FA 3APFA 1KLVA 2HJ8A 4NPNA 1WY8A 3KYCD 2D2QA 2J0MA 2RGFA 3RZFA 3V6EB 3DVNV 3L17A 1LM8B 2PPHA 3ALBA 4WWNA 5BO4B 1EF1A 1IYFA 1GUAB 3M95A 3WALA 1WMHA 3QC8B 3DCGA 3TL5A 2M8SA 4EZJA 2BGFA 4ZYNA 3D32A 3VH4B 5KHQA 4GDKB 3PREA 3H9DA 4IW0A 3N30A 5TR5A 4ANXA 5CTRC 5AZGA 3DVGX 2C7HA 2D11A 3ENEA 3PS6A 4CO7A 4DBGA 2JZZA 4HJKA 1EUVB 4MGYE 3W1YA 5DPTA 2ZNVC 1ISNA 1OEYA 2PE9A 4ASWC 3TMPB 4GOCA 4II2B 4GDLB 2GBNA 3APDA 5IA7A 4WAAA 4FHKA 2KTRA 2M0XA 4G3XB 4BBNC 1QZEA 2L8JA 3P2BA 4FHJA 3L0WB 4WQOB 4CHKA 2KK8A 1S3SG 1WI0A 2FCNA 2ASQA 2J0JA 3WA0A 3L54A 2FAZA 1RLFA 1V5OA 4EOYA 4IM3A 2KQ7A 3AU5A 3TBLD 2DHZA 3UF8A 2HE7A 4HLEA 2KC1A 2EKEC 2MX2A 4KZCA 3PRMB 5D94A 2C60A 2N9PC 4M8NA 3VHTC 3A1QA 2ZEQA 3VXWA 3ZO5B 2UYZB 2PEAA 1U4AA 2L00B 1V6EA 1XD3B 3QARA 3OJ4B 4KSLC 2KFKB 3WANA 2KLGA 3ZTCA 2PJHA 2KC2A 1JRUA 3VTUA 4BFRA 1P3QU 2O2VB 3NZSA 4PS7A 1E8WA 4B95A 3PRPB 1J8CA 1WXAA 2K25A 3QHTA 4I6NB 3VTWA 3HM6X 3M3JA 2LJ5A 4EZKA 2BWES 2I1JA 2IO2B 2NVUI 4AOFA 3Q3JA 3RD2A 2DAJA 3NZUA 1GG3A 3JVZX 2LRUA 3H7PA 2L3ZA 4BKGA 1WYWB 3V6CB 3AU4A 2JRIB 3L16A 1A5RA 3QK0A 2MBEA 2LUEA 2MBBB 2FUHB 4RM9A 3B0AA 4HK2A 4LCDE 1TBEA 2N9XA 2NPTA 5JH5C 1K8RB 3GOEA 2R2QA 3APCA 3QX1A 2JY6A 4PS3A 3UIOB 3CMMB 3X0WA 3R66C 2ZPNA 1WGDA 2WWZA 3PT2B 4ANWA 3ZDMC 4W9KA 4DHZE 4GU2A 1VD2A 3QAQA 4BVUC 1SIFA 3QQ8B 1RAXA 5DPRA 5J17A 3MJWA 3ZTDA 3ZNID 4W9GA 2L76A 3UGBB 2BKRB 2NBVB 1XQQA 4IUMB 2JXXA 2G45B 1XT9B 3DVNU 2I1KA 2BF8B 1NBFC 3H6NA 1Q0WB 3R7RA 4KSKC 2CHWA 3V62A 3WAPA 4MM3A 2IBIB 2K6QA 2XBBC 3NY5A 1I35A 1V5TA 3PTFC 1P9DU 2M17A 2KTRB 1EO6A 4IM0A 4PS8A 3WAOA 1TTNA 1WZ0A 1D3ZA 3VUXA 1LQBA 3ZNGC 3VUWA 3AI5A 4DHZB 1WFYA 2LRWA 4IWPA 4OVVA 4E74A 2UWQA 1TZ1A 2N1WA 2CU1A 2XK5B 4IWOA 4KDLB 2LVPA 3V60A 3ZIMA 1L2NA 2K1FA 4NAWB 2GMIC 4A3PA 1NDDA 3PSEB 2NBWB 1C3TA 1WX9A 2KNBA 2R2OA 1YQBA 3N32A 4HPLB 3ML8A 4DK5A 2OJRA 3H7SA 1Z2MA 4ZRKA 2N7EA 4DDGD 5CHVC 4XZ4A 2GBJA 4MGKE 3CSTA 2N7DA 3A9KA 3MHSD 3QIJA 4AJYB 1E8YA 2N9EB 2BYFA 1UBQA 1BT0A 2LGXA 5JZEB 3QCAA 4NJ7A 5CX3A 1ZW7A 1GJZA 2DZJA 1Z5SB 2BPSA 4NY0A 3A33B 3OAWA 3PV1A 3L13A 2AWTA 2LVOA 1OTRB 4BKTA 1WXSA 4F8CB 3SDLC 2CHZA 2KWUB 3IHPC 1L7YA 2KDEB 4K7UA 2IY0B 1UH6A 4DWFA 4HDQA 3KYDD 3UINB 4M8MA 3ECIA 4TQ1A 1LXDA 3KUZA 4A20A 1E8ZA 4LJPB 3Q3FA 4KZ0A 5LXIB 1HE8A 2LASA 2MP2A 1OQYA 1KOTA 2MBHA 3EECA 3OLMD 4GIVA 4WJQA 2FCQA 2VRRB 4DDID 3KUCB 2MBQA 4FLHA 4WJNA 2KHWB 5EDSA 3RCZA 2RSUA 2IO0B 1IPGA 2G4SA 5IAAC 3ZNHB 3PLUA 1VCBA 3ZVVA 2OOBB 2Z0DB 3H1UA 1E90A 2DZMA 1WIAA 2CR5A 3VH3B 2C9WB 4HDOA 2JPHA 1GNUA 4X57B 2LZ6A 1V49A 4TQ0A 4ANUA 2JWZA 5J18A 2FCSA 2MBOA 2A5UA 2JVCA 1R4MI 2FNJB 2WX1A 1FXTB 2C7MB 3B1LX 3MTNB 4B6WA 4FJZA 3VDZA 2WYQA 4PYUA 3UQAA 1SE9A 4NQKE 4LDTB 2ZNVB 3VFKA 2D10A 4MJSA 4MSMB 4NJ6A 4EUTA 2YLMA 1ZGUB 3KH0A 4HXDA 5FR6A 4GB9A 2Z0EB 2KO3A 4G0NB 3QJZA 4BBNF 1WJ4A 2GBMA 2KJRA 2Y5BB 3RZWC 1RRBA 4HCNB 2D07B 2RR9A 3GZNI 3KUDB 2DZKA 1YX6B 3R3MA 4MH0E 4HPMB 3VQIA 2A4ZA 2MWSB 4GDKA 4EZLA 1WX7A 2KDBA 3W1SA 4NNJB 1V9JA 2KVRA 3PGEA 2K8HA 1V81A 4ZRJA 5LXHA 3ZKJC 3HIZA 1V86A 1OEYJ 2NCNA 2DYMA 4JIOU 5KHOA 4AUQC 5J2RA 2DZIA 4IC7B 1TGZB 3DOWA 1WR6E 2KOXA 4LDTD 1WMHB 4FADA 2MA9B 3X23A 2DENB 2L0TA 4GXBA 4W9EA 3UQBA 2ZPYA 1SGHA 1WGGA 1EF5A 3ZRFA 3VTVA 4BOZB 4EEWA 4GMVA 1LFDA 1UZXB 2O6VA 2ZCCA 4GSWA 4MGIE 1WZ3A 4HCPB 2DYOA 2DYBA 2BYVE 4K7WA 2REXA 3A9JA 4WWPA 4TV3A 3DBHI 2KQSA 3S2AA 2JUOA 5HKHA 2L0FA 4B9KA 2XEWA 2KWCA 3U7DA 4XX5A 3IBEA 4XC2A 3PPAA 3PZDA 1V2YA 2HD5B 3DPDA 4P7IA 2KFJA 2KD0A 2LD9A 3SHQA 2M4NA 4RMAA 3NOBA 3W1SC 4G11A 2ZVNA 2IZVB 2EMTA 2V4LA 5AZFA 3VVWB 1Q1OA 2RD0A 3DQVA 4KVGB 4WJPA 4ZDVA 2KLCA 2KXJA 1MG8A 2MLBA 4KV2A 5E6NA 1Y8RC 5DPWA 3LDZE 1J0GA 3NS8A 2QHOA 4W9JA 4W9IA 1ZKHA 4BKSA 3A1QB 1J19A 1WRDB 3ZUNA 1YJ1A 1UBIA 2G4DB 2GOWA 1UGMA 2MSED 3M62B 3PRZA 5D6JB 2IY1B 1H8CA 2KDFB 2KANA 3WIMA 3VAWA 4DXAB 3PHWB 3CF6E 3RUIB 1KJTA 3SU8X 5CHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS B;  4KDI C;  2FID A;  2G3Q B;  1WGY A;  2J0K A;  2KMA A;  2K6D B;  4FJV B;  5D7G A;  4FJY A;  4NQL B;  3H7P B;  4ICU A;  2AL6 A;  4MEM A;  2JZ3 B;  4N9F 4;  5E6O A;  3ZDT A;  3V61 A;  2NBU A;  4IM2 A;  2KN5 A;  4MSQ B;  1E8X A;  4K1R B;  4EFO A;  1PQS A;  5DPS A;  3IG3 A;  2NPT B;  2KTF A;  2ZVO A;  1C1Y B;  2LWP A;  1AAR A;  3JSV A;  1WH3 A;  2BKF A;  4FA6 A;  2AL3 A;  3ONS A;  1X1M A;  1S1Q B;  2L7R A;  2B3A A;  3DVG Y;  1E5W A;  2AEH A;  3C0R B;  4GGQ A;  2C7N B;  5C23 A;  2BWF A;  3R7Q A;  5AEK B;  2LGD A;  3RYT A;  3JW0 X;  5E6P A;  2WX0 A;  2W9N A;  4URK A;  1I42 A;  4MGZ E;  5L95 C;  4W9D A;  4AJW A;  4F7Z A;  2Z59 B;  4MEL A;  3A4S C;  4JGH B;  3I3T B;  1G6J A;  2L05 A;  4HVB A;  1WM3 A;  4IG7 B;  5JHB A;  4DHJ B;  2K39 A;  3OJ3 A;  1T0Y A;  2GBR A;  2MRP A;  4K81 A;  1IP9 A;  2FCM A;  2KJ6 A;  2KX3 A;  2LI5 A;  1P98 A;  3AXC A;  4JQW C;  5AZH A;  3BIN A;  3SD5 A;  2O6V B;  4KIK A;  4ZRI A;  3U30 A;  1Q5W B;  2NS5 A;  1WF9 A;  3ML9 A;  2XK5 A;  3A9J B;  1V80 A;  2MW5 A;  4IWQ A;  4NAW A;  4ICV A;  1F9J A;  5CHW A;  3PLV A;  3UIP B;  1P0R A;  1WXM A;  3EC8 A;  2J7Q B;  2IO1 B;  3A4R A;  3ZLZ A;  4PYZ A;  3DBR I;  4EKU A;  4A3O A;  2BYE A;  2KJH B;  1CMX B;  4BOS C;  4W9F A;  4OVU A;  2IO3 B;  3PVL A;  3KVF B;  4WWO A;  4DHJ D;  1WX8 A;  2WDT B;  4I6P A;  2EMS A;  1P1A A;  1YD8 U;  2JT4 B;  4W9H A;  2C5L C;  1WM2 A;  2O6V D;  3K9O B;  2LVQ A;  4TUU A;  2JRH A;  1GC7 A;  1NI2 A;  1GC6 A;  2MQJ A;  3A9K B;  3TIX A;  4G50 A;  4F1S A;  1E7V A;  2KKC A;  3DBL I;  2CHX A;  4YL8 A;  1WR1 A;  3PHX B;  5DCN A;  5G2N A;  3T9L A;  1WXV A;  2KX0 A;  3TCA A;  3N3K B;  3NHE B;  1UD7 A;  2K8C A;  4GDL A;  1WJ6 A;  3T8M A;  3TJP A;  1M94 A;  2M1M A;  2DX5 B;  3ZW3 A;  3EHV A;  4FN2 A;  4FUL A;  1YIW A;  4TKN A;  1E7U A;  4RM8 A;  3HHM A;  3LJ3 A;  4II3 B;  4E71 A;  4WJO A;  2KDI A;  1KM7 A;  5L83 A;  5G55 A;  3RT3 B;  2ZCB A;  4HWI B;  2JF5 A;  4E3C A;  2PE6 B;  4BKS D;  5C1Z A;  2ZJD A;  3CSF A;  2LXC A;  1H4R A;  4JL9 A;  4K7S A;  4CYE A;  1WJN A;  3EFU A;  4W9L A;  1WGR A;  3DDC B;  3JSV B;  3DBS A;  2MP2 B;  2CS4 A;  3L08 A;  3RUL A;  3B08 A;  3ZNZ B;  2ZZP B;  3QA8 A;  4W9C A;  4AWJ A;  5D2M B;  1WE6 A;  2NR2 A;  2KFK A;  3BY4 B;  2D3G A;  3O65 B;  2KZR A;  2O2V A;  2V1Y A;  4I6L B;  4M0W B;  1OGW A;  2V3S A;  3WAM A;  2KMC A;  2K8B A;  1R4N I;  5JHA A;  4MDK E;  3IFW B;  1YX5 B;  3U8Z A;  2CKH B;  2LGY A;  3KW5 B;  4JLC A;  3JYU A;  3IVF A;  2MCN B;  2LXA A;  4AP4 C;  4FBJ B;  3VUY A;  2IYD B;  4GN1 A;  1UEL A;  4KIK B;  3HM3 A;  2N1V A;  2FIF A;  3AUL A;  4ANV A;  2HTH A;  4LJO B;  2YVC A;  1WJU A;  3L10 B;  2DAF A;  1RFA A;  2GBK A;  3HK0 A;  3QWZ B;  3ZRC A;  2RPQ A;  1WE7 A;  3M63 B;  2AYO B;  2KWV B;  1WGH A;  3K9P B;  4J6I A;  5GMV A;  5LLI A;  2N4F A;  3APF A;  1KLV A;  2HJ8 A;  4NPN A;  1WY8 A;  3KYC D;  2D2Q A;  2J0M A;  2RGF A;  3RZF A;  3V6E B;  3DVN V;  3L17 A;  1LM8 B;  2PPH A;  3ALB A;  4WWN A;  5BO4 B;  1EF1 A;  1IYF A;  1GUA B;  3M95 A;  3WAL A;  1WMH A;  3QC8 B;  3DCG A;  3TL5 A;  2M8S A;  4EZJ A;  2BGF A;  4ZYN A;  3D32 A;  3VH4 B;  5KHQ A;  4GDK B;  3PRE A;  3H9D A;  4IW0 A;  3N30 A;  5TR5 A;  4ANX A;  5CTR C;  5AZG A;  3DVG X;  2C7H A;  2D11 A;  3ENE A;  3PS6 A;  4CO7 A;  4DBG A;  2JZZ A;  4HJK A;  1EUV B;  4MGY E;  3W1Y A;  5DPT A;  2ZNV C;  1ISN A;  1OEY A;  2PE9 A;  4ASW C;  3TMP B;  4GOC A;  4II2 B;  4GDL B;  2GBN A;  3APD A;  5IA7 A;  4WAA A;  4FHK A;  2KTR A;  2M0X A;  4G3X B;  4BBN C;  1QZE A;  2L8J A;  3P2B A;  4FHJ A;  3L0W B;  4WQO B;  4CHK A;  2KK8 A;  1S3S G;  1WI0 A;  2FCN A;  2ASQ A;  2J0J A;  3WA0 A;  3L54 A;  2FAZ A;  1RLF A;  1V5O A;  4EOY A;  4IM3 A;  2KQ7 A;  3AU5 A;  3TBL D;  2DHZ A;  3UF8 A;  2HE7 A;  4HLE A;  2KC1 A;  2EKE C;  2MX2 A;  4KZC A;  3PRM B;  5D94 A;  2C60 A;  2N9P C;  4M8N A;  3VHT C;  3A1Q A;  2ZEQ A;  3VXW A;  3ZO5 B;  2UYZ B;  2PEA A;  1U4A A;  2L00 B;  1V6E A;  1XD3 B;  3QAR A;  3OJ4 B;  4KSL C;  2KFK B;  3WAN A;  2KLG A;  3ZTC A;  2PJH A;  2KC2 A;  1JRU A;  3VTU A;  4BFR A;  1P3Q U;  2O2V B;  3NZS A;  4PS7 A;  1E8W A;  4B95 A;  3PRP B;  1J8C A;  1WXA A;  2K25 A;  3QHT A;  4I6N B;  3VTW A;  3HM6 X;  3M3J A;  2LJ5 A;  4EZK A;  2BWE S;  2I1J A;  2IO2 B;  2NVU I;  4AOF A;  3Q3J A;  3RD2 A;  2DAJ A;  3NZU A;  1GG3 A;  3JVZ X;  2LRU A;  3H7P A;  2L3Z A;  4BKG A;  1WYW B;  3V6C B;  3AU4 A;  2JRI B;  3L16 A;  1A5R A;  3QK0 A;  2MBE A;  2LUE A;  2MBB B;  2FUH B;  4RM9 A;  3B0A A;  4HK2 A;  4LCD E;  1TBE A;  2N9X A;  2NPT A;  5JH5 C;  1K8R B;  3GOE A;  2R2Q A;  3APC A;  3QX1 A;  2JY6 A;  4PS3 A;  3UIO B;  3CMM B;  3X0W A;  3R66 C;  2ZPN A;  1WGD A;  2WWZ A;  3PT2 B;  4ANW A;  3ZDM C;  4W9K A;  4DHZ E;  4GU2 A;  1VD2 A;  3QAQ A;  4BVU C;  1SIF A;  3QQ8 B;  1RAX A;  5DPR A;  5J17 A;  3MJW A;  3ZTD A;  3ZNI D;  4W9G A;  2L76 A;  3UGB B;  2BKR B;  2NBV B;  1XQQ A;  4IUM B;  2JXX A;  2G45 B;  1XT9 B;  3DVN U;  2I1K A;  2BF8 B;  1NBF C;  3H6N A;  1Q0W B;  3R7R A;  4KSK C;  2CHW A;  3V62 A;  3WAP A;  4MM3 A;  2IBI B;  2K6Q A;  2XBB C;  3NY5 A;  1I35 A;  1V5T A;  3PTF C;  1P9D U;  2M17 A;  2KTR B;  1EO6 A;  4IM0 A;  4PS8 A;  3WAO A;  1TTN A;  1WZ0 A;  1D3Z A;  3VUX A;  1LQB A;  3ZNG C;  3VUW A;  3AI5 A;  4DHZ B;  1WFY A;  2LRW A;  4IWP A;  4OVV A;  4E74 A;  2UWQ A;  1TZ1 A;  2N1W A;  2CU1 A;  2XK5 B;  4IWO A;  4KDL B;  2LVP A;  3V60 A;  3ZIM A;  1L2N A;  2K1F A;  4NAW B;  2GMI C;  4A3P A;  1NDD A;  3PSE B;  2NBW B;  1C3T A;  1WX9 A;  2KNB A;  2R2O A;  1YQB A;  3N32 A;  4HPL B;  3ML8 A;  4DK5 A;  2OJR A;  3H7S A;  1Z2M A;  4ZRK A;  2N7E A;  4DDG D;  5CHV C;  4XZ4 A;  2GBJ A;  4MGK E;  3CST A;  2N7D A;  3A9K A;  3MHS D;  3QIJ A;  4AJY B;  1E8Y A;  2N9E B;  2BYF A;  1UBQ A;  1BT0 A;  2LGX A;  5JZE B;  3QCA A;  4NJ7 A;  5CX3 A;  1ZW7 A;  1GJZ A;  2DZJ A;  1Z5S B;  2BPS A;  4NY0 A;  3A33 B;  3OAW A;  3PV1 A;  3L13 A;  2AWT A;  2LVO A;  1OTR B;  4BKT A;  1WXS A;  4F8C B;  3SDL C;  2CHZ A;  2KWU B;  3IHP C;  1L7Y A;  2KDE B;  4K7U A;  2IY0 B;  1UH6 A;  4DWF A;  4HDQ A;  3KYD D;  3UIN B;  4M8M A;  3ECI A;  4TQ1 A;  1LXD A;  3KUZ A;  4A20 A;  1E8Z A;  4LJP B;  3Q3F A;  4KZ0 A;  5LXI B;  1HE8 A;  2LAS A;  2MP2 A;  1OQY A;  1KOT A;  2MBH A;  3EEC A;  3OLM D;  4GIV A;  4WJQ A;  2FCQ A;  2VRR B;  4DDI D;  3KUC B;  2MBQ A;  4FLH A;  4WJN A;  2KHW B;  5EDS A;  3RCZ A;  2RSU A;  2IO0 B;  1IPG A;  2G4S A;  5IAA C;  3ZNH B;  3PLU A;  1VCB A;  3ZVV A;  2OOB B;  2Z0D B;  3H1U A;  1E90 A;  2DZM A;  1WIA A;  2CR5 A;  3VH3 B;  2C9W B;  4HDO A;  2JPH A;  1GNU A;  4X57 B;  2LZ6 A;  1V49 A;  4TQ0 A;  4ANU A;  2JWZ A;  5J18 A;  2FCS A;  2MBO A;  2A5U A;  2JVC A;  1R4M I;  2FNJ B;  2WX1 A;  1FXT B;  2C7M B;  3B1L X;  3MTN B;  4B6W A;  4FJZ A;  3VDZ A;  2WYQ A;  4PYU A;  3UQA A;  1SE9 A;  4NQK E;  4LDT B;  2ZNV B;  3VFK A;  2D10 A;  4MJS A;  4MSM B;  4NJ6 A;  4EUT A;  2YLM A;  1ZGU B;  3KH0 A;  4HXD A;  5FR6 A;  4GB9 A;  2Z0E B;  2KO3 A;  4G0N B;  3QJZ A;  4BBN F;  1WJ4 A;  2GBM A;  2KJR A;  2Y5B B;  3RZW C;  1RRB A;  4HCN B;  2D07 B;  2RR9 A;  3GZN I;  3KUD B;  2DZK A;  1YX6 B;  3R3M A;  4MH0 E;  4HPM B;  3VQI A;  2A4Z A;  2MWS B;  4GDK A;  4EZL A;  1WX7 A;  2KDB A;  3W1S A;  4NNJ B;  1V9J A;  2KVR A;  3PGE A;  2K8H A;  1V81 A;  4ZRJ A;  5LXH A;  3ZKJ C;  3HIZ A;  1V86 A;  1OEY J;  2NCN A;  2DYM A;  4JIO U;  5KHO A;  4AUQ C;  5J2R A;  2DZI A;  4IC7 B;  1TGZ B;  3DOW A;  1WR6 E;  2KOX A;  4LDT D;  1WMH B;  4FAD A;  2MA9 B;  3X23 A;  2DEN B;  2L0T A;  4GXB A;  4W9E A;  3UQB A;  2ZPY A;  1SGH A;  1WGG A;  1EF5 A;  3ZRF A;  3VTV A;  4BOZ B;  4EEW A;  4GMV A;  1LFD A;  1UZX B;  2O6V A;  2ZCC A;  4GSW A;  4MGI E;  1WZ3 A;  4HCP B;  2DYO A;  2DYB A;  2BYV E;  4K7W A;  2REX A;  3A9J A;  4WWP A;  4TV3 A;  3DBH I;  2KQS A;  3S2A A;  2JUO A;  5HKH A;  2L0F A;  4B9K A;  2XEW A;  2KWC A;  3U7D A;  4XX5 A;  3IBE A;  4XC2 A;  3PPA A;  3PZD A;  1V2Y A;  2HD5 B;  3DPD A;  4P7I A;  2KFJ A;  2KD0 A;  2LD9 A;  3SHQ A;  2M4N A;  4RMA A;  3NOB A;  3W1S C;  4G11 A;  2ZVN A;  2IZV B;  2EMT A;  2V4L A;  5AZF A;  3VVW B;  1Q1O A;  2RD0 A;  3DQV A;  4KVG B;  4WJP A;  4ZDV A;  2KLC A;  2KXJ A;  1MG8 A;  2MLB A;  4KV2 A;  5E6N A;  1Y8R C;  5DPW A;  3LDZ E;  1J0G A;  3NS8 A;  2QHO A;  4W9J A;  4W9I A;  1ZKH A;  4BKS A;  3A1Q B;  1J19 A;  1WRD B;  3ZUN A;  1YJ1 A;  1UBI A;  2G4D B;  2GOW A;  1UGM A;  2MSE D;  3M62 B;  3PRZ A;  5D6J B;  2IY1 B;  1H8C A;  2KDF B;  2KAN A;  3WIM A;  3VAW A;  4DXA B;  3PHW B;  3CF6 E;  3RUI B;  1KJT A;  3SU8 X;  5CHF A; 
#chains in the Genus database with same CATH topology
 4KDI C;  3BVG A;  3AMZ A;  2KMA A;  2HDE A;  4NQL B;  4YSX B;  2JZ3 B;  2E6X A;  2KDM A;  1FNU A;  1E8X A;  4K1R B;  1VZ8 A;  2NPT B;  2JQR B;  1E5W A;  3Q3O C;  3R7Q A;  1N5X A;  2QCZ A;  3MHZ A;  3TEW A;  4M0W A;  4W9D A;  1RFK A;  2L05 A;  4HVB A;  3Q8A A;  2K39 A;  2MRP A;  4XWT A;  1IP9 A;  2KJ6 A;  2WDR B;  5AZH A;  1XEE A;  3KQ4 A;  1Q5W B;  1V80 A;  2MW5 A;  1FFV A;  3DWM A;  4NAW A;  1JRO A;  4ICV A;  4USA A;  5CHW A;  1I4X A;  1KH0 A;  3DBR I;  4A3O A;  1CMX B;  2IO3 B;  4DHJ D;  2LFI A;  1P1A A;  2C5L C;  1ZOY B;  3K9O B;  2LVQ A;  2JRH A;  5G5H A;  1D6E C;  1C78 A;  1FFU A;  2KKC A;  5HHD G;  5DCN A;  5G2N A;  1WXV A;  3TCA A;  3N3K B;  4GDL A;  1QIL A;  3T8M A;  3ZYY X;  3TJP A;  4FN2 A;  1YIW A;  1UGJ A;  2PIA A;  4WJO A;  5L83 A;  3P4P B;  4ITK A;  2PE6 B;  4S17 A;  1SSN A;  1H4R A;  2QDF A;  1WJN A;  3DDC B;  1BML C;  3JSV B;  3DBS A;  3MC9 A;  3IAM 1;  2WXO A;  3L08 A;  3RUL A;  2I38 A;  3RNG C;  4DQO C;  5D2M B;  3MFG A;  4BAX A;  4B0E A;  1CQV A;  1AWD A;  4GLS C;  2WXF A;  3ZXV A;  2J53 A;  3AEG B;  2CKH B;  2LGY A;  3KW5 B;  1FXA A;  3AEF B;  3VUY A;  3ABV B;  4KIK B;  3HM3 A;  3AUL A;  2HTH A;  4N58 A;  1JRP A;  4RGN A;  2WDQ B;  3QWZ B;  3M63 B;  3K9P B;  1WGH A;  3APF A;  2WP9 B;  2J0M A;  4A6Q A;  1T0R C;  1FXI A;  1AN8 A;  1SBB B;  1EF1 A;  3WAL A;  2WXK A;  3NS1 A;  5IP4 D;  3DCG A;  4EZJ A;  4UDU C;  4ZYN A;  3VH4 B;  5KHQ A;  1MJD A;  5BYS A;  3AEA B;  4REZ A;  2LGS A;  5CTR C;  4YXD B;  4CO7 A;  1EUV B;  5DPT A;  5BYQ A;  1ZE3 D;  3AE2 B;  1OEY A;  1I4G A;  3CIR B;  4II2 B;  1B9R A;  4WAA A;  2WQY B;  4FHK A;  1K51 A;  1NYQ A;  1S3S G;  2INN E;  2XN9 C;  2K5P A;  1DGJ A;  2KQ7 A;  4HLE A;  2DHZ A;  3Q6B A;  2WXJ A;  2PEA A;  1V6E A;  3DBR B;  1R7S A;  2DBY A;  4KSL C;  2KFK B;  3WAN A;  1D5Z C;  4US8 A;  4BFR A;  1P3Q U;  4BZA A;  4PS7 A;  1L0Y B;  3PRP B;  1J8C A;  3QHT A;  3AN1 A;  2LJ5 A;  4EZK A;  1IGC A;  4AOF A;  4BKG A;  3R2T A;  2JRI B;  2KT7 A;  1A5R A;  2LUE A;  2L1A A;  4RM9 A;  4HK2 A;  4YSZ B;  1FD6 A;  2NPT A;  2R2Q A;  2WXM A;  3I5J C;  4NJC A;  1WGD A;  2WWZ A;  4LNO A;  3GE8 C;  3QQ8 B;  5J17 A;  2KVZ A;  3MC0 B;  4HEA 1;  1VDV A;  2I2Y A;  3H6N A;  2TSS A;  2JYE A;  3WAP A;  2IBI B;  2K6Q A;  3NY5 A;  1I35 A;  4ARI A;  2WGS A;  2QSD A;  1P9D U;  3FIL B;  3SFD B;  2BT6 A;  1D3Z A;  3ZXR A;  3VUW A;  4DHZ B;  4OVV A;  1TZ1 A;  2CU1 A;  2XK5 B;  2LVP A;  1L2N A;  1TYG B;  1N5W A;  2NBW B;  1WX9 A;  5JXV A;  4HPL B;  5C3J B;  5IN7 A;  2N7E A;  5CHV C;  4RCO A;  4XZ4 A;  3LXF A;  2BYF A;  2WXN A;  1UBQ A;  1BT0 A;  2LGX A;  3QCA A;  4NJ7 A;  1YJI A;  3A33 B;  3OAW A;  4P1B C;  2H89 B;  1OTR B;  4F8C B;  1TS3 A;  2KWU B;  1L7Y A;  2KDE B;  2IY0 B;  4DWF A;  4RFB A;  3KYD D;  1WGK A;  4KZ0 A;  1KOT A;  3EEC A;  1D5X C;  2L83 A;  4WJQ A;  2FCQ A;  4M01 A;  2IO0 B;  2G4S A;  2NMQ A;  3ZNH B;  2V3N A;  2OOB B;  2Z0D B;  1E90 A;  3RNF C;  4OHJ A;  4HDO A;  3C19 A;  1CK1 A;  2JWZ A;  2PLP A;  5J18 A;  1UWX A;  2FCS A;  2A5U A;  4HPP A;  2JVC A;  3EFC A;  2KAC A;  4MM3 B;  3MTN B;  4WQM A;  4LDT B;  2D10 A;  1YQ4 B;  4MSM B;  2BBC A;  4N6E B;  1I4P A;  5FK9 C;  2RR9 A;  3GZN I;  3ZGZ A;  1YX6 B;  1M4V A;  1T3Q A;  1TZO A;  2W3R A;  3P4Q B;  1V86 A;  4JIO U;  5J2R A;  1WMH B;  5HG2 A;  3E9S A;  4RF0 A;  2L0T A;  3UQB A;  1SGH A;  3OWE B;  3ZRF A;  1YMH E;  4EEW A;  3I57 A;  2ZCC A;  4LNK A;  4HCP B;  2J52 A;  2REX A;  3A9J A;  4B9K A;  2XEW A;  3BVZ A;  4JE3 B;  3IBE A;  4XC2 A;  1C4A A;  3PPA A;  3PZD A;  2HD5 B;  3DPD A;  3P1M A;  4G11 A;  1V1O A;  3VVW B;  2KLC A;  2KXJ A;  2MLB A;  4KV2 A;  1Y8R C;  1J0G A;  3NS8 A;  2QIE B;  4LNI A;  2AQ2 B;  1VLB A;  4ZRP A;  2KMM A;  4IKG A;  1H8C A;  2KAN A;  3AE5 B;  3PHW B;  3VR9 B;  3RUI B;  3SU8 X;  3T3N A;  3T3O A;  5CHF A;  4ARC A;  1ET6 A;  2ICI A;  4MJS B;  1PDX A;  1F77 A;  2K6D B;  2Y5C A;  3H7P B;  4ICU A;  4MEM A;  3V61 A;  2KN5 A;  4MSQ B;  3AE1 B;  4EFO A;  1PQS A;  1ET9 A;  4FA6 A;  1AAR A;  2BKF A;  1PGA A;  1FRD A;  2B3A A;  2D3B A;  2BWF A;  4AS1 A;  1B1Z A;  2DLB A;  1I42 A;  4OW0 A;  1FO4 A;  4AJW A;  1E0Z A;  2Z59 B;  3NRZ A;  3A4S C;  4MEL A;  4KX6 B;  1G6J A;  1A70 A;  3FIL A;  1T0Y A;  1C4P A;  3AXC A;  2O6V B;  1SE3 A;  3U30 A;  2NS5 A;  1WF9 A;  3ML9 A;  2XK5 A;  4A55 A;  1YJJ A;  1L4D B;  1ZP0 B;  3UIP B;  1P0R A;  3EC8 A;  1F1H A;  2WHI A;  2KJH B;  4OVU A;  3KVF B;  1WX8 A;  2MEK A;  4I6P A;  3GZN B;  2EMS A;  1YD8 U;  3KWV A;  4W9H A;  2MHJ A;  1WM2 A;  1CZP A;  1GC6 A;  2GRI A;  2MQJ A;  4F1S A;  5BMH A;  2CHX A;  3URY A;  3T9L A;  2KX0 A;  1YN4 A;  4QAY A;  1WJ6 A;  1V1P B;  1M94 A;  3B9J A;  2M1M A;  3ZW3 A;  4FUL A;  4KKJ A;  1E7U A;  3LJ3 A;  4E71 A;  3V3X A;  5G55 A;  1QOG A;  2JF5 A;  3EFU A;  4W9L A;  3FKY A;  1SE4 A;  1MPE A;  2W54 A;  2ZZP B;  2NTT A;  1WE6 A;  3Q8C A;  2NR2 A;  3BY4 B;  3GE3 C;  2D3G A;  1OGW A;  2V3S A;  1R4N I;  5JHA A;  2V3P A;  3JYU A;  2LXA A;  4AP4 C;  2IPK D;  1UEL A;  2N1V A;  4ANV A;  2R61 A;  3ZRC A;  2GBK A;  4OZB A;  1WE7 A;  2AYO B;  1C77 A;  5LLI A;  1KLV A;  2G9H D;  4LLG M;  2D2Q A;  2RGF A;  3DVN V;  5AUI A;  5D3D A;  1GUA B;  3M95 A;  1WMH A;  1P7F A;  2BGF A;  3D32 A;  2QEJ C;  5EE1 A;  3WCQ A;  3H9D A;  4IW0 A;  2Y5P A;  1F0Z A;  5TR5 A;  1TS2 A;  1ZDV A;  4ANX A;  3DVG X;  3ENE A;  3PS6 A;  4DBG A;  2JZZ A;  4HJK A;  3W1Y A;  4L2Y A;  3AEB B;  4IOI E;  4RH6 A;  1FRR A;  4C7Z A;  5C2T B;  1T0Q C;  4GOC A;  2GBN A;  1TIF A;  2N9K A;  2AQ1 B;  2KTR A;  4G3X B;  4XDC A;  1VJK A;  2LHD A;  2Y3A A;  4CHK A;  2FCN A;  5IKC M;  3WA0 A;  3L54 A;  1RLF A;  4IM3 A;  3NVV A;  2KC1 A;  3PRM B;  4M8N A;  2ZEQ A;  3VXW A;  4LNF A;  3E56 A;  2L00 B;  1XD3 B;  3QAR A;  4WUR A;  3ZTC A;  1IBX B;  1I4Q A;  2KC2 A;  1JRU A;  3VTU A;  2O2V B;  4B95 A;  1E8W A;  1WXA A;  4I6N B;  2K25 A;  1TT5 B;  3O13 A;  2PKO A;  2EEL A;  2BWE S;  4IDI A;  3RD2 A;  3NZU A;  1GG3 A;  3P4S B;  3H7P A;  1ZDX A;  3V6C B;  1NEK B;  2MBE A;  1MVK A;  2MBB B;  2FUH B;  1TBE A;  1XO3 A;  1K8R B;  3GOE A;  4Q2J A;  3QX1 A;  2JY6 A;  2UU7 A;  3UIO B;  2PW9 A;  3X0W A;  3R66 C;  2ZPN A;  2WXQ A;  3ZDM C;  4W9K A;  4C4V B;  3NG0 A;  3BK1 A;  4GU2 A;  3RMK C;  2LHE A;  3BWU D;  3N9Y C;  3ZTD A;  2NBV B;  1XQQ A;  1L6V A;  2JXX A;  1NVI D;  3DVN U;  1YOV B;  1J7A A;  4WH4 A;  3ZJV A;  2RDG A;  1XLP A;  2K3U A;  1V5T A;  1R4N B;  1SE2 A;  1EO6 A;  4IM0 A;  4PS8 A;  1LQB A;  4IWP A;  4E74 A;  1BUI C;  2RPV A;  3V05 A;  4IWO A;  2GMI C;  1FCC C;  1HTO A;  2KNB A;  1YQB A;  3N32 A;  3SR6 A;  4DK5 A;  2OJR A;  1Z2M A;  4MGK E;  1GOZ A;  1E8Y A;  2N9E B;  3ETR A;  1SJE D;  5JZE B;  1EWY C;  4C00 A;  1ZW7 A;  4US9 A;  2DZJ A;  3Q8E A;  1XLQ A;  2BPS A;  1V97 A;  4NY0 A;  4MT5 A;  2OED A;  1V1P A;  1QOF A;  4BKT A;  5BMI A;  4KGS A;  5EE3 A;  4OZA A;  2JYT A;  3SDL C;  4CQN A;  1XF5 L;  2CHZ A;  1UH6 A;  3KUZ A;  4C7Y A;  2WXL A;  3Q3F A;  4RGM A;  2LAS A;  1C76 A;  3FAH A;  3RPF C;  2KHW B;  5EDS A;  3AE3 B;  5IAA C;  3PLU A;  1L6U A;  2DZM A;  1WIA A;  1RWS A;  4P6V F;  1UWM A;  2LZ6 A;  1LGR A;  2FE8 A;  2GLS A;  1R4M I;  2FNJ B;  2N9L A;  2C7M B;  2JWU A;  3VDZ A;  3UQA A;  1SE9 A;  4NQK E;  2ZNV B;  3AH7 A;  4KGT A;  3KH0 A;  4HXD A;  5FR6 A;  1DOY A;  1XLO A;  4BBN F;  1WJ4 A;  2GBM A;  2KJR A;  2Y5B B;  3J9C A;  1KFY B;  1RRB A;  1QKZ A;  2DZK A;  3U52 E;  2MWS B;  4EZL A;  1WX7 A;  3PGE A;  3ZKJ C;  3TUO A;  3AB5 A;  1OEY J;  2NCN A;  1TGZ B;  1WR6 E;  4LDT D;  4FAD A;  2MA9 B;  1DOX A;  1QF6 A;  2DEN B;  3N1Z C;  3PO0 A;  1WGG A;  1XCQ L;  3VTV A;  3AEE B;  1J7B A;  1WZ3 A;  2DYO A;  2DYB A;  4TV3 A;  2OHF A;  3DBH I;  5D3I B;  5I4D A;  1WXQ A;  2ZW0 A;  1C4C A;  3U7D A;  2VZK B;  1GB4 A;  4P7I A;  2KD0 A;  2M4N A;  4RMA A;  4YT0 B;  2EMT A;  1ZXH A;  2V4L A;  5AZF A;  2K22 A;  2H88 B;  5DPW A;  4W9J A;  4W9I A;  1E9M A;  4XYC A;  2WS3 B;  3ZUN A;  3Q8B A;  2FUG 1;  1UF0 A;  1YJ1 A;  2G4D B;  3M62 B;  3RI7 C;  2N0S B;  3BYY B;  2IY1 B;  2KDF B;  2NTS A;  2MH7 A;  1KJT A;  3TEZ A;  1HEZ E;  4C80 A;  2FID A;  1TY0 A;  1F2R I;  2G3Q B;  1WGY A;  2J0K A;  4FJV B;  4FJY A;  4MH8 A;  5T8I A;  3MP9 A;  5E6O A;  2AL6 A;  4N9F 4;  3Q2A C;  4ZYS A;  2NBU A;  1JCK B;  4IM2 A;  1C9F A;  2KN4 A;  1WWT A;  3IG3 A;  2ZVO A;  3JSV A;  4RGT A;  3RNB C;  1WH3 A;  4C56 C;  3ONS A;  1X1M A;  1S1Q B;  2L7R A;  3DVG Y;  1XCT L;  3KLS X;  3Q69 A;  5C23 A;  1K53 A;  3RYT A;  5E6P A;  2WX0 A;  2W9N A;  4URK A;  1HQR D;  1XLN A;  4RGO S;  5L95 C;  3RNE C;  1SIJ A;  3I3T B;  3OJ3 A;  2GBR A;  4K81 A;  2FCM A;  4JQW C;  4HRO A;  1FEH A;  3BIN A;  3R8B A;  4KIK A;  1VRA B;  4HJG E;  1KTK A;  2L52 A;  1FCL A;  3RN9 C;  1R4M B;  3AE8 B;  3PLV A;  2J7Q B;  2DNF A;  5EE0 A;  1MFW A;  3EGR A;  1T0S C;  2BYE A;  2BW2 A;  4WWO A;  4PK1 A;  1PGB A;  2MJE A;  4TSS A;  2JT4 B;  1NYR A;  2O6V D;  3KWL A;  2BS2 B;  2M0A A;  3A9K B;  3TIX A;  1QLB B;  1JQ4 A;  3DBL I;  1WRI A;  2IGG A;  2E3T A;  3PHX B;  1HXY D;  1YN3 A;  3LB8 C;  1UD7 A;  4H2A A;  5MPO A;  1VZ6 A;  2DX5 B;  3EHV A;  4RM8 A;  1YQ3 B;  1KM7 A;  1FM0 D;  1VZ7 A;  1OQR A;  2ZCB A;  4K3B A;  3BII D;  2ZJD A;  3DBH B;  2K9X A;  2RDH A;  3QA8 A;  4AWJ A;  3ZQ4 A;  2KFK A;  4HKQ A;  2KZR A;  2GB1 A;  2V1Y A;  4M0W B;  3DHI C;  3WAM A;  2KMC A;  3IFW B;  3GS2 A;  3U8Z A;  4JLC A;  3IVF A;  4GN1 A;  1N61 A;  2FIF A;  3Q3N C;  1IUE A;  3FC4 A;  4B0M A;  1WJU A;  3L10 B;  1RFA A;  2KWD A;  2KWV B;  5GMV A;  2N4F A;  2HJ8 A;  1WY8 A;  3RZF A;  1K52 A;  1MI0 A;  1LM8 B;  4WWN A;  5BO4 B;  3ZJT A;  2D5G A;  1EWC A;  2PTL A;  1L0V B;  3QC8 B;  3TL5 A;  2M8S A;  4GDK B;  3PRE A;  1IGD A;  3NVW A;  4YSY B;  1JAL A;  1GPX A;  2C7H A;  2D11 A;  4MGY E;  4WAF A;  2ZW1 A;  2ZNV C;  2PE9 A;  4ASW C;  4DXF A;  4GDL B;  4BBN C;  4WQO B;  1WI0 A;  2J0J A;  3IXS A;  3AU5 A;  2JX5 A;  2EKE C;  2MX2 A;  5D94 A;  2WNM A;  3ZO5 B;  2UYZ B;  1SEB D;  1U4A A;  1D5M C;  1DYQ A;  3OJ4 B;  4ZRQ A;  2X8X X;  1MHH E;  2KLG A;  2PJH A;  3N1Y C;  3W5V B;  2PVG C;  3SEB A;  3BYT B;  2ACZ B;  3M3J A;  2EKI A;  2IO2 B;  1JWM D;  2GI9 A;  3BVM A;  3Q3J A;  2BTE A;  1WYW B;  3DBL B;  2YEP F;  3QK0 A;  2YEP B;  2WXG A;  4LCD E;  2IDY A;  2OJW A;  1TS5 A;  5JH5 C;  4EE2 A;  1SJH D;  3APC A;  1N63 A;  4PS3 A;  3CMM B;  1QOB A;  3PT2 B;  4ANW A;  1VD2 A;  3QAQ A;  2VH2 A;  4BVU C;  4YTM B;  1RAX A;  5DPR A;  1GB1 A;  3ZNI D;  4W9G A;  2L76 A;  3UGB B;  5H92 C;  4JPS A;  1MHX A;  2JXT A;  2J4X A;  2I1K A;  1NBF C;  4NAM A;  3V62 A;  2BS3 B;  3HVZ A;  4MM3 A;  2XBB C;  2M17 A;  4JWU C;  3WAO A;  1TTN A;  1WZ0 A;  3VUX A;  3U7Z A;  3ZNG C;  3PZ7 A;  1WFY A;  2LRW A;  2UWQ A;  1HA5 A;  2N1W A;  3AE6 B;  4KDL B;  3I63 C;  3IT4 B;  2WU5 B;  3ZIM A;  2K1F A;  1NDD A;  2R2O A;  2QIL A;  4ZHO A;  3H7S A;  4M02 A;  1QQR A;  3P42 A;  3RNA C;  2GBJ A;  3SFE B;  1SB3 C;  4D2K A;  3A9K A;  5HFY A;  3L4P A;  3VR8 B;  3LYY A;  5CX3 A;  1GJZ A;  1Z5S B;  4N59 A;  3PV1 A;  2AWT A;  1EU4 A;  2LVO A;  3P63 A;  2V0G A;  2BS4 B;  3H8H A;  1QOA A;  2M19 A;  3HUI A;  3DHH C;  4P16 A;  4K7U A;  4LTU A;  1OQQ A;  4HDQ A;  3TEX A;  3UIN B;  4M8M A;  1LXD A;  1JW9 D;  1I7H A;  4A20 A;  4LJP B;  2DWQ A;  1HE8 A;  2MBH A;  3OLM D;  4GIV A;  2VRR B;  3KUC B;  2MBQ A;  4FLH A;  4WJN A;  1IPG A;  4L1B A;  4FXC A;  1FNV A;  2C9W B;  2JPH A;  1V49 A;  5FKA C;  1TJE A;  4ANU A;  2WXP A;  1NEN B;  1OFF A;  2JZP A;  3B1L X;  4B6W A;  1TKE A;  2MJD A;  4FJZ A;  1D4B A;  4PYU A;  1TKY A;  2ON8 A;  4MJS A;  2IGD A;  3VFK A;  4NJ6 A;  2KO3 A;  3NJT A;  4G0N B;  1TKG A;  3RZW C;  1L5P A;  3Q3M C;  4MH0 E;  2BB6 A;  4GDK A;  3IT6 B;  4NNJ B;  4ZRJ A;  2KVR A;  1V81 A;  3DHG C;  1JWU D;  3HIZ A;  2WXI A;  2DZI A;  2KOX A;  2BVC A;  3NVY A;  3NUH B;  4GXB A;  4W9E A;  1ZUD 2;  1N62 A;  1EM7 A;  4XWW A;  1EF5 A;  3W9C B;  1UZX B;  2O6V A;  4GSW A;  4MGI E;  2D3C A;  2X38 A;  1VR9 A;  1FPY A;  2LMC A;  1F2R C;  2J42 A;  1ESF A;  4XX5 A;  1V2Y A;  3OG5 A;  3SHQ A;  5BYR A;  2ZVN A;  2CJN A;  4WJP A;  1SF0 A;  5TSS A;  2QHO A;  3A1Q B;  1J19 A;  4S0R A;  1JWA D;  1T5X D;  2GOW A;  2HJ1 A;  2MSE D;  5GXG B;  5D6J B;  2WDV B;  3WIM A;  3VAW A;  1V8C A;  2VZK D;  3CF6 E;  1PGX A;  1HZ6 A;  1JWB D;  2WLB A;  5D7G A;  1DOI A;  1T6B X;  3TEY A;  1Q10 A;  3DWG C;  3ZDT A;  2AQ3 B;  5DPS A;  2M56 B;  2KTF A;  1C1Y B;  2LWP A;  3PZ8 A;  2AL3 A;  5IO9 A;  5LNK 1;  1J7C A;  2AEH A;  3C0R B;  1ZPS A;  2C7N B;  4GGQ A;  1FNW A;  5AEK B;  1JML A;  2LGD A;  3JW0 X;  4MGZ E;  4F7Z A;  4JGH B;  4WWM A;  1WM3 A;  4IG7 B;  1RYJ A;  5JHB A;  4DHJ B;  2LI5 A;  2KX3 A;  1P98 A;  3SD5 A;  4ZRI A;  3A9J B;  1PUT A;  4IWQ A;  3CWI A;  5G5G A;  3U4E G;  1F9J A;  2SAK A;  1KLG D;  2B76 B;  3MC8 A;  1WXM A;  3N1X C;  2IO1 B;  3A4R A;  3ZLZ A;  4PYZ A;  4EKU A;  2N7J A;  4BOS C;  4W9F A;  3PVL A;  2WXR A;  4R3D A;  2WDT B;  4O1N A;  1PFD A;  1E10 A;  4JX1 C;  1Y56 A;  1AYF A;  4P1C C;  1WYG A;  4TUU A;  2W55 A;  4MAC A;  1GC7 A;  1NI2 A;  2HTM E;  2RMM A;  4ZOH C;  4G50 A;  3UI3 A;  1E7V A;  2Z8L A;  4YL8 A;  1WR1 A;  3GP7 A;  2QJL A;  3NHE B;  2K8C A;  2INC C;  1P7E A;  4RF1 A;  3TSS A;  2LGI A;  4TKN A;  3HHM A;  4II3 B;  2KDI A;  2D3A A;  3RT3 B;  2FBW B;  4HWI B;  4E3C A;  4BKS D;  5C1Z A;  1EU3 A;  3CSF A;  2LXC A;  4JL9 A;  4K7S A;  3NZ3 A;  4CYE A;  2CJO A;  1WGR A;  1WSP A;  2MP2 B;  2CS4 A;  1MG4 A;  3B08 A;  3ZNZ B;  4W9C A;  3AE7 B;  5AUK A;  1NI3 A;  2QMT A;  1IBX A;  3O65 B;  2O2V A;  4I6L B;  2K8B A;  1KF6 B;  4MDK E;  1YX5 B;  2MCN B;  2PVO D;  4FBJ B;  2IYD B;  2RDB C;  1XXG A;  4LNN A;  4LJO B;  2YVC A;  2DAF A;  3HK0 A;  2RPQ A;  4J6I A;  2KQ4 X;  1JWS D;  4NPN A;  1TY2 A;  3KYC D;  4YTP B;  3V6E B;  2IJ0 A;  3L17 A;  2AX5 A;  1E6E B;  4KGR A;  3W5U B;  2PPH A;  3ALB A;  3NVZ A;  1IYF A;  3AV8 A;  4C4V A;  4YWG G;  2KAJ A;  3AM9 A;  3N30 A;  2IGH A;  5AZG A;  1SXT A;  3HVD A;  4A8X C;  3MJ5 A;  1ISN A;  1N6Z A;  5HI1 A;  1F52 A;  3TMP B;  2V9H A;  3APD A;  3HRD D;  5IA7 A;  4PT5 A;  2M0X A;  2SEB D;  1QZE A;  2L8J A;  3P2B A;  4FHJ A;  3L0W B;  2KK8 A;  5EE9 A;  2BB5 A;  4YTN B;  2ASQ A;  2MJ3 A;  2FAZ A;  1V5O A;  5BMG A;  4EOY A;  3TBL D;  3UF8 A;  2HE7 A;  4KZC A;  2C60 A;  2N9P C;  3VHT C;  1FIQ A;  2Q5W D;  3A1Q A;  2K0P A;  3AE4 B;  3ZJU A;  3NZS A;  4ZHP A;  5H8Y E;  3VTW A;  3HM6 X;  3P4R B;  1QT9 A;  2I1J A;  2NVU I;  1ACC A;  2DAJ A;  3JVZ X;  3Q8F A;  2LRU A;  2L3Z A;  3AU4 A;  3L16 A;  2CU3 A;  3AED B;  2PMV A;  3B0A A;  3N20 C;  2N9X A;  4NZL B;  2V4I B;  2QC8 A;  3BK2 A;  1K50 A;  4L23 A;  1L0X B;  4LK0 M;  3U2S C;  4DHZ E;  1YN5 A;  1UNS A;  1CJE A;  3B2F A;  1RM6 C;  1SIF A;  1TS4 A;  3R2I A;  3MJW A;  2BKR B;  1HTQ A;  4IUM B;  1KLU D;  2G45 B;  1XT9 B;  2BF8 B;  1Q0W B;  3R7R A;  4KSK C;  2CHW A;  2IND C;  4TMA B;  3PTF C;  2KTR B;  3EUB 2;  5FR3 A;  3AI5 A;  2LJI A;  3V60 A;  2INP E;  4OZC A;  4NAW B;  4WIP A;  4A3P A;  3W2D A;  3PSE B;  3I9V 1;  2BYT A;  1C3T A;  4HKZ E;  2JSV X;  3ML8 A;  4DDG D;  1FMA D;  1N60 A;  3C8Y A;  4ZRK A;  3AE9 B;  3CST A;  2N7D A;  3MHS D;  3QIJ A;  4AJY B;  1L4Z B;  2KYW A;  4DXG A;  1I4R A;  4OVZ A;  3L13 A;  1WXS A;  4XE0 A;  1ZXI A;  3BZD B;  3IHP C;  3ECI A;  4TQ1 A;  4JWS C;  1E8Z A;  4HRS A;  2G1E A;  2ONQ A;  2BQQ A;  5LXI B;  2MP2 A;  1OQY A;  3AEC B;  3B2G A;  4DDI D;  3RCZ A;  1AW7 A;  2RSU A;  3ZVV A;  1VCB A;  3H1U A;  2CR5 A;  2W3S A;  3VH3 B;  4X57 B;  1GNU A;  3VRA B;  4TQ0 A;  1C79 A;  2W82 A;  2MBO A;  4XDD A;  4AQ7 A;  2WX1 A;  1FXT B;  2WYQ A;  1E7P B;  2YLM A;  4EUT A;  1ZGU B;  1I4H A;  4GB9 A;  2Z0E B;  2VH1 A;  3QJZ A;  1STE A;  4K3C A;  1HZ5 A;  4HCN B;  2D07 B;  3KUD B;  1PYW D;  3R3M A;  4HPM B;  3VQI A;  2A4Z A;  2KDB A;  3W1S A;  5LXH A;  1V9J A;  2K8H A;  1UUP A;  2DYM A;  5KHO A;  4AUQ C;  4ACF A;  4IC7 B;  1LO5 D;  3DOW A;  1ENF A;  2L32 A;  3X23 A;  1BXT A;  4A9A A;  2LEK A;  2ZPY A;  4BOZ B;  5E6J A;  2WXH A;  3IAS 1;  4GMV A;  1LFD A;  3RNC C;  5IOI A;  2BYV E;  4K7W A;  4WWP A;  2JU6 X;  2KQS A;  3S2A A;  2JUO A;  5HKH A;  3GB1 A;  2WU2 B;  2L0F A;  2KWC A;  1GAQ B;  2XNA C;  2KFJ A;  2LD9 A;  1KRH A;  3W1S C;  3NOB A;  4J3O D;  2IZV B;  2LUM A;  1Q1O A;  2RD0 A;  3DQV A;  3Q14 C;  4KVG B;  4ZDV A;  4KKI A;  5E6N A;  1MG8 A;  3EA6 A;  1YNT E;  3LDZ E;  1ZKH A;  1ROE A;  4BKS A;  1WRD B;  4RNA A;  4M00 A;  1UBI A;  1UGM A;  4XGA B;  3VRB B;  3PRZ A;  4A90 A;  4DXA B;  3RFZ B; 
#chains in the Genus database with same CATH homology
 4MJS B;  4KDI C;  2FID A;  2G3Q B;  1WGY A;  2J0K A;  2KMA A;  2K6D B;  4FJV B;  5D7G A;  4FJY A;  4NQL B;  3H7P B;  4ICU A;  2AL6 A;  4MEM A;  2JZ3 B;  4N9F 4;  5E6O A;  3ZDT A;  3V61 A;  2NBU A;  4IM2 A;  2KN5 A;  4MSQ B;  1E8X A;  4K1R B;  4EFO A;  1PQS A;  5DPS A;  3IG3 A;  2NPT B;  2KTF A;  2ZVO A;  1C1Y B;  2LWP A;  1AAR A;  3JSV A;  1WH3 A;  2BKF A;  4FA6 A;  2AL3 A;  3ONS A;  1X1M A;  1S1Q B;  2L7R A;  2B3A A;  3DVG Y;  1E5W A;  2AEH A;  3C0R B;  4GGQ A;  2C7N B;  5C23 A;  2BWF A;  3R7Q A;  5AEK B;  2LGD A;  3RYT A;  3JW0 X;  5E6P A;  2WX0 A;  2W9N A;  4URK A;  1I42 A;  4MGZ E;  5L95 C;  4W9D A;  4AJW A;  4F7Z A;  2Z59 B;  4MEL A;  3A4S C;  4JGH B;  3I3T B;  1G6J A;  2L05 A;  4HVB A;  1WM3 A;  4IG7 B;  5JHB A;  4DHJ B;  2K39 A;  3OJ3 A;  1T0Y A;  2GBR A;  2MRP A;  4K81 A;  1IP9 A;  2FCM A;  2KJ6 A;  2KX3 A;  2LI5 A;  1P98 A;  3AXC A;  4JQW C;  5AZH A;  3BIN A;  3SD5 A;  2O6V B;  4KIK A;  4ZRI A;  3U30 A;  1Q5W B;  2NS5 A;  1WF9 A;  3ML9 A;  2XK5 A;  3A9J B;  1V80 A;  2MW5 A;  4IWQ A;  4NAW A;  4ICV A;  1F9J A;  5CHW A;  3PLV A;  3UIP B;  1P0R A;  1WXM A;  3EC8 A;  2J7Q B;  2IO1 B;  3A4R A;  3ZLZ A;  4PYZ A;  3DBR I;  4EKU A;  4A3O A;  2BYE A;  2KJH B;  1CMX B;  4BOS C;  4W9F A;  4OVU A;  2IO3 B;  3PVL A;  3KVF B;  4WWO A;  4DHJ D;  1WX8 A;  2WDT B;  4I6P A;  2EMS A;  1P1A A;  1YD8 U;  2JT4 B;  4W9H A;  2C5L C;  1WM2 A;  2O6V D;  3K9O B;  2LVQ A;  4TUU A;  2JRH A;  1GC7 A;  1NI2 A;  1GC6 A;  2MQJ A;  3A9K B;  3TIX A;  4G50 A;  4F1S A;  1E7V A;  2KKC A;  3DBL I;  2CHX A;  4YL8 A;  1WR1 A;  3PHX B;  5DCN A;  5G2N A;  3T9L A;  1WXV A;  2KX0 A;  3TCA A;  3N3K B;  3NHE B;  1UD7 A;  2K8C A;  4GDL A;  1WJ6 A;  3T8M A;  3TJP A;  1M94 A;  2M1M A;  2DX5 B;  3ZW3 A;  3EHV A;  4FN2 A;  4FUL A;  1YIW A;  4TKN A;  1E7U A;  4RM8 A;  3HHM A;  3LJ3 A;  4II3 B;  4E71 A;  4WJO A;  2KDI A;  1KM7 A;  5L83 A;  5G55 A;  3RT3 B;  2ZCB A;  4HWI B;  2JF5 A;  4E3C A;  2PE6 B;  4BKS D;  5C1Z A;  2ZJD A;  3CSF A;  2LXC A;  1H4R A;  4JL9 A;  4K7S A;  4CYE A;  1WJN A;  3EFU A;  4W9L A;  1WGR A;  3DDC B;  3JSV B;  3DBS A;  2MP2 B;  2CS4 A;  3L08 A;  3RUL A;  3B08 A;  3ZNZ B;  2ZZP B;  3QA8 A;  4W9C A;  4AWJ A;  5D2M B;  1WE6 A;  2NR2 A;  2KFK A;  3BY4 B;  2D3G A;  3O65 B;  2KZR A;  2O2V A;  2V1Y A;  4I6L B;  4M0W B;  1OGW A;  2V3S A;  3WAM A;  2KMC A;  2K8B A;  1R4N I;  5JHA A;  4MDK E;  3IFW B;  1YX5 B;  3U8Z A;  2CKH B;  2LGY A;  3KW5 B;  4JLC A;  3JYU A;  3IVF A;  2MCN B;  2LXA A;  4AP4 C;  4FBJ B;  3VUY A;  2IYD B;  4GN1 A;  1UEL A;  4KIK B;  3HM3 A;  2N1V A;  2FIF A;  3AUL A;  4ANV A;  2HTH A;  4LJO B;  2YVC A;  1WJU A;  3L10 B;  2DAF A;  1RFA A;  2GBK A;  3HK0 A;  3QWZ B;  3ZRC A;  2RPQ A;  1WE7 A;  3M63 B;  2AYO B;  2KWV B;  1WGH A;  3K9P B;  4J6I A;  5GMV A;  5LLI A;  2N4F A;  3APF A;  1KLV A;  2HJ8 A;  4NPN A;  1WY8 A;  3KYC D;  2D2Q A;  2J0M A;  2RGF A;  3RZF A;  3V6E B;  3DVN V;  3L17 A;  1LM8 B;  2PPH A;  3ALB A;  4WWN A;  5BO4 B;  1EF1 A;  1IYF A;  1GUA B;  3M95 A;  3WAL A;  1WMH A;  3QC8 B;  3DCG A;  3TL5 A;  2M8S A;  4EZJ A;  2BGF A;  4ZYN A;  3D32 A;  3VH4 B;  5KHQ A;  4GDK B;  3PRE A;  3H9D A;  4IW0 A;  3N30 A;  5TR5 A;  4ANX A;  5CTR C;  5AZG A;  3DVG X;  2C7H A;  2D11 A;  3ENE A;  3PS6 A;  4CO7 A;  4DBG A;  2JZZ A;  4HJK A;  1EUV B;  4MGY E;  3W1Y A;  5DPT A;  2ZNV C;  1ISN A;  1OEY A;  2PE9 A;  4ASW C;  3TMP B;  4GOC A;  4II2 B;  4GDL B;  2GBN A;  3APD A;  5IA7 A;  4WAA A;  4FHK A;  2KTR A;  2M0X A;  4G3X B;  4BBN C;  1QZE A;  2L8J A;  3P2B A;  4FHJ A;  3L0W B;  4WQO B;  4CHK A;  2KK8 A;  1S3S G;  1WI0 A;  2FCN A;  2ASQ A;  2J0J A;  3WA0 A;  3L54 A;  2FAZ A;  1RLF A;  1V5O A;  4EOY A;  4IM3 A;  2KQ7 A;  3AU5 A;  3TBL D;  2DHZ A;  3UF8 A;  2HE7 A;  4HLE A;  2KC1 A;  2EKE C;  2MX2 A;  4KZC A;  3PRM B;  5D94 A;  2C60 A;  2N9P C;  4M8N A;  3VHT C;  3A1Q A;  2ZEQ A;  3VXW A;  3ZO5 B;  2UYZ B;  2PEA A;  1U4A A;  2L00 B;  1V6E A;  1XD3 B;  3QAR A;  3OJ4 B;  4KSL C;  2KFK B;  3WAN A;  2KLG A;  3ZTC A;  2PJH A;  2KC2 A;  1JRU A;  3VTU A;  4BFR A;  1P3Q U;  2O2V B;  3NZS A;  4PS7 A;  1E8W A;  4B95 A;  3PRP B;  1J8C A;  1WXA A;  2K25 A;  3QHT A;  4I6N B;  3VTW A;  3HM6 X;  3M3J A;  2LJ5 A;  4EZK A;  2BWE S;  2I1J A;  2IO2 B;  2NVU I;  4AOF A;  3Q3J A;  3RD2 A;  2DAJ A;  3NZU A;  1GG3 A;  3JVZ X;  2LRU A;  3H7P A;  2L3Z A;  4BKG A;  1WYW B;  3V6C B;  3AU4 A;  2JRI B;  3L16 A;  1A5R A;  3QK0 A;  2MBE A;  2LUE A;  2MBB B;  2FUH B;  4RM9 A;  3B0A A;  4HK2 A;  4LCD E;  1TBE A;  2N9X A;  2NPT A;  5JH5 C;  1K8R B;  3GOE A;  2R2Q A;  3APC A;  3QX1 A;  2JY6 A;  4PS3 A;  3UIO B;  3CMM B;  3X0W A;  3R66 C;  2ZPN A;  1WGD A;  2WWZ A;  3PT2 B;  4ANW A;  3ZDM C;  4W9K A;  4DHZ E;  4GU2 A;  1VD2 A;  3QAQ A;  4BVU C;  1SIF A;  3QQ8 B;  1RAX A;  5DPR A;  5J17 A;  3MJW A;  3ZTD A;  3ZNI D;  4W9G A;  2L76 A;  3UGB B;  2BKR B;  2NBV B;  1XQQ A;  4IUM B;  2JXX A;  2G45 B;  1XT9 B;  3DVN U;  2I1K A;  2BF8 B;  1NBF C;  3H6N A;  1Q0W B;  3R7R A;  4KSK C;  2CHW A;  3V62 A;  3WAP A;  4MM3 A;  2IBI B;  2K6Q A;  2XBB C;  3NY5 A;  1I35 A;  1V5T A;  3PTF C;  1P9D U;  2M17 A;  2KTR B;  1EO6 A;  4IM0 A;  4PS8 A;  3WAO A;  1TTN A;  1WZ0 A;  1D3Z A;  3VUX A;  1LQB A;  3ZNG C;  3VUW A;  3AI5 A;  4DHZ B;  1WFY A;  2LRW A;  4IWP A;  4OVV A;  4E74 A;  2UWQ A;  1TZ1 A;  2N1W A;  2CU1 A;  2XK5 B;  4IWO A;  4KDL B;  2LVP A;  3V60 A;  3ZIM A;  1L2N A;  2K1F A;  4NAW B;  2GMI C;  4A3P A;  1NDD A;  3PSE B;  2NBW B;  1C3T A;  1WX9 A;  2KNB A;  2R2O A;  1YQB A;  3N32 A;  4HPL B;  3ML8 A;  4DK5 A;  2OJR A;  3H7S A;  1Z2M A;  4ZRK A;  2N7E A;  4DDG D;  5CHV C;  4XZ4 A;  2GBJ A;  4MGK E;  3CST A;  2N7D A;  3A9K A;  3MHS D;  3QIJ A;  4AJY B;  1E8Y A;  2N9E B;  2BYF A;  1UBQ A;  1BT0 A;  2LGX A;  5JZE B;  3QCA A;  4NJ7 A;  5CX3 A;  1ZW7 A;  1GJZ A;  2DZJ A;  1Z5S B;  2BPS A;  4NY0 A;  3A33 B;  3OAW A;  3PV1 A;  3L13 A;  2AWT A;  2LVO A;  1OTR B;  4BKT A;  1WXS A;  4F8C B;  3SDL C;  2CHZ A;  2KWU B;  3IHP C;  1L7Y A;  2KDE B;  4K7U A;  2IY0 B;  1UH6 A;  4DWF A;  4HDQ A;  3KYD D;  3UIN B;  4M8M A;  3ECI A;  4TQ1 A;  1LXD A;  3KUZ A;  4A20 A;  1E8Z A;  4LJP B;  3Q3F A;  4KZ0 A;  5LXI B;  1HE8 A;  2LAS A;  2MP2 A;  1OQY A;  1KOT A;  2MBH A;  3EEC A;  3OLM D;  4GIV A;  4WJQ A;  2FCQ A;  2VRR B;  4DDI D;  3KUC B;  2MBQ A;  4FLH A;  4WJN A;  2KHW B;  5EDS A;  3RCZ A;  2RSU A;  2IO0 B;  1IPG A;  2G4S A;  5IAA C;  3ZNH B;  3PLU A;  1VCB A;  3ZVV A;  2OOB B;  2Z0D B;  3H1U A;  1E90 A;  2DZM A;  1WIA A;  2CR5 A;  3VH3 B;  2C9W B;  4HDO A;  2JPH A;  1GNU A;  4X57 B;  2LZ6 A;  1V49 A;  4TQ0 A;  4ANU A;  2JWZ A;  5J18 A;  2FCS A;  2MBO A;  2A5U A;  2JVC A;  1R4M I;  2FNJ B;  2WX1 A;  1FXT B;  2C7M B;  3B1L X;  3MTN B;  4B6W A;  4FJZ A;  3VDZ A;  2WYQ A;  4PYU A;  3UQA A;  1SE9 A;  4NQK E;  4LDT B;  2ZNV B;  3VFK A;  2D10 A;  4MJS A;  4MSM B;  4NJ6 A;  4EUT A;  2YLM A;  1ZGU B;  3KH0 A;  4HXD A;  5FR6 A;  4GB9 A;  2Z0E B;  2KO3 A;  4G0N B;  3QJZ A;  4BBN F;  1WJ4 A;  2GBM A;  2KJR A;  2Y5B B;  3RZW C;  1RRB A;  4HCN B;  2D07 B;  2RR9 A;  3GZN I;  3KUD B;  2DZK A;  1YX6 B;  3R3M A;  4MH0 E;  4HPM B;  3VQI A;  2A4Z A;  2MWS B;  4GDK A;  4EZL A;  1WX7 A;  2KDB A;  3W1S A;  4NNJ B;  1V9J A;  2KVR A;  3PGE A;  2K8H A;  1V81 A;  4ZRJ A;  5LXH A;  3ZKJ C;  3HIZ A;  1V86 A;  1OEY J;  2NCN A;  2DYM A;  4JIO U;  5KHO A;  4AUQ C;  5J2R A;  2DZI A;  4IC7 B;  1TGZ B;  3DOW A;  1WR6 E;  2KOX A;  4LDT D;  1WMH B;  4FAD A;  2MA9 B;  3X23 A;  2DEN B;  2L0T A;  4GXB A;  4W9E A;  3UQB A;  2ZPY A;  1SGH A;  1WGG A;  1EF5 A;  3ZRF A;  3VTV A;  4BOZ B;  4EEW A;  4GMV A;  1LFD A;  1UZX B;  2O6V A;  2ZCC A;  4GSW A;  4MGI E;  1WZ3 A;  4HCP B;  2DYO A;  2DYB A;  2BYV E;  4K7W A;  2REX A;  3A9J A;  4WWP A;  4TV3 A;  3DBH I;  2KQS A;  3S2A A;  2JUO A;  5HKH A;  2L0F A;  4B9K A;  2XEW A;  2KWC A;  3U7D A;  4XX5 A;  3IBE A;  4XC2 A;  3PPA A;  3PZD A;  1V2Y A;  2HD5 B;  3DPD A;  4P7I A;  2KFJ A;  2KD0 A;  2LD9 A;  3SHQ A;  2M4N A;  4RMA A;  3NOB A;  3W1S C;  4G11 A;  2ZVN A;  2IZV B;  2EMT A;  2V4L A;  5AZF A;  3VVW B;  1Q1O A;  2RD0 A;  3DQV A;  4KVG B;  4WJP A;  4ZDV A;  2KLC A;  2KXJ A;  1MG8 A;  2MLB A;  4KV2 A;  5E6N A;  1Y8R C;  5DPW A;  3LDZ E;  1J0G A;  3NS8 A;  2QHO A;  4W9J A;  4W9I A;  1ZKH A;  4BKS A;  3A1Q B;  1J19 A;  1WRD B;  3ZUN A;  1YJ1 A;  1UBI A;  2G4D B;  2GOW A;  1UGM A;  2MSE D;  3M62 B;  3PRZ A;  5D6J B;  2IY1 B;  1H8C A;  2KDF B;  2KAN A;  3WIM A;  3VAW A;  4DXA B;  3PHW B;  3CF6 E;  3RUI B;  1KJT A;  3SU8 X;  5CHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...