2C5LC

Structure of plc epsilon ras association domain with hras
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
97
Chain Sequence
EESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSLSILSNPNPSDYVLLEEVVKDKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Insights Into Ras Association Domains of Phospholipase C Epsilon
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPASE HRAS
total genus 26
structure length 97
sequence length 106
chains with identical sequence D
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2005-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c5lC01
3NHEB 4MGYE 4J6IA 4HPMB 1P0RA 3WAMA 4TV3A 5C1ZA 3QIJA 3VFKA 4FA6A 3APFA 4EZKA 4BVUC 3ZW3A 2Y5BB 2OOBB 2M8SA 4AUQC 1WIAA 1S3SG 4FADA 4YL8A 5C23A 4DHJD 2N1WA 1U4AA 1WGHA 2FCQA 3HM3A 5GMVA 3U8ZA 2A5UA 2KFJA 3P2BA 5FR6A 3V6EB 2LXAA 1GUAB 4HXDA 1LXDA 1NBFC 1OGWA 2MW5A 2N9PC 1OQYA 3KW5B 2NR2A 2KNBA 4W9DA 2M1MA 3PSEB 3ZTCA 3RCZA 2NBUA 3A1QB 5J2RA 3PREA 2FIDA 1AARA 4EZLA 3IHPC 1IPGA 1C1YB 4W9HA 1Q0WB 4HK2A 2C7MB 4W9IA 2ZPNA 3RULA 2JPHA 1TZ1A 4IUMB 3V60A 3A9KA 3VUYA 3DDCB 5G2NA 2GBNA 2I1JA 1J0GA 3MTNB 3PLVA 2LZ6A 2PE6B 3ECIA 5CX3A 3A9JA 3JYUA 3W1SC 3KUZA 2AL3A 4KIKB 4TKNA 4MSQB 1TTNA 3TBLD 2JWZA 4K7WA 4FHJA 2JZ3B 4F8CB 4K7UA 4BFRA 2DZKA 4BKTA 2LVOA 3W1SA 4A20A 4ANXA 1E8XA 3KVFB 1F9JA 2NS5A 3CF6E 2XEWA 2REXA 4GDKB 3AXCA 4CYEA 1WJUA 3ML8A 2JUOA 3QARA 4IW0A 1T0YA 3APCA 2RD0A 3R66C 4LJPB 1WXMA 4PS8A 1D3ZA 2KDFB 2K6DB 2J0KA 1P98A 5DPWA 5HKHA 1E90A 4HVBA 2J0MA 2XK5A 4W9FA 2CHXA 2MLBA 2KDBA 4GN1A 3PT2B 4DHZE 2DZJA 1RRBA 3R3MA 3QX1A 3LJ3A 1GG3A 1Q1OA 2K8CA 3O65B 3X0WA 4A3PA 1IP9A 1OEYA 3DPDA 1PQSA 3UIPB 2Z59B 2BWFA 2KC1A 4FJVB 2KJRA 2HD5B 2GOWA 3M3JA 2CHZA 2GBRA 2KFKA 4PYZA 2DENB 2LVPA 4AP4C 2DZMA 2O6VA 5TR5A 2AYOB 3A9JB 3UGBB 1WMHB 2KQSA 2DAFA 3U30A 4IWQA 2UYZB 1E8YA 3DQVA 1E8WA 2CR5A 3A9KB 3QC8B 2MBOA 4MH0E 4XC2A 3GZNI 4EUTA 3APDA 1XQQA 3WA0A 1CMXB 3VUWA 1C3TA 3H7PB 1I35A 3HIZA 3KYDD 3A1QA 1J8CA 2KTRB 3AU5A 2FCSA 3C0RB 2FUHB 1KLVA 4MGZE 1UZXB 3ZRFA 4FBJB 4GMVA 2D3GA 1R4NI 3RYTA 4BKGA 4IG7B 3VHTC 4OVVA 3QHTA 4B95A 2WWZA 4ZRIA 1TGZB 2ZJDA 3V61A 1NI2A 1RLFA 5LLIA 4BOSC 3EECA 1L2NA 2IY1B 2K39A 2MP2A 3R7RA 4MELA 3CSFA 2KJ6A 2FIFA 3QCAA 4ZDVA 1WGRA 3JSVB 3PGEA 5KHQA 2D2QA 4FJZA 3PS6A 2DX5B 1ZGUB 4DHJB 2L7RA 2YVCA 4FULA 2RPQA 4E3CA 4GSWA 2J0JA 2IO1B 2N4FA 4LDTB 2DHZA 2MWSB 2D11A 1KM7A 2KTRA 4TQ1A 3A33B 4FLHA 1S1QB 3H7PA 1WGDA 3T8MA 2ZEQA 4EEWA 2NBWB 4WJOA 2LGXA 1UELA 2NCNA 2BGFA 3L08A 3PVLA 3IG3A 3VUXA 2VRRB 4KZ0A 1RFAA 2EKEC 2KKCA 3JVZX 4WWNA 4ANVA 1WF9A 5DCNA 4HPLB 2K1FA 3L54A 4XZ4A 4GB9A 1RAXA 3B0AA 3WAPA 2YLMA 2WX0A 4KDLB 1WX8A 5AZFA 2K8HA 1V6EA 3R7QA 4IC7B 2C5LC 2KC2A 3AI5A 2LXCA 4ANUA 4F1SA 4GGQA 4FHKA 3PRMB 3ZNZB 1OTRB 2JRIB 4HDOA 3K9OB 1WX9A 2L8JA 4DDGD 2D07B 4NY0A 2DYBA 3RD2A 3ALBA 3ZNID 3IVFA 4MEMA 3SU8X 4G3XB 3KUDB 2DZIA 5JZEB 1LFDA 1UGMA 2BKRB 3PHWB 2ZNVC 1Y8RC 2IY0B 3DVNV 4KV2A 5AZHA 2XK5B 5DPSA 2KHWB 4K81A 4KZCA 4CHKA 3RUIB 1BT0A 2C60A 1YQBA 3ZVVA 3DCGA 4DBGA 4WWOA 4B9KA 3DBSA 4LDTD 2IZVB 3UQBA 2ZNVB 3VQIA 2EMSA 4DK5A 2KLGA 4RMAA 2O2VA 2D10A 2V4LA 4KDIC 2BYEA 3AU4A 2KWUB 1MG8A 2LGYA 4GDKA 2C7NB 4DXAB 4W9GA 1UD7A 1JRUA 1WXSA 1EUVB 2PE9A 5DPTA 1V2YA 2KTFA 4WJPA 2LD9A 3BINA 1H4RA 4WJNA 1ZKHA 2PEAA 3ENEA 5AEKB 2C9WB 3UIOB 2KMAA 5L83A 4JL9A 4XX5A 4I6LB 3ZNGC 4MGKE 4F7ZA 2LJ5A 3DBRI 1WE7A 2ZCBA 2PPHA 2JVCA 3PPAA 3GOEA 2MBBB 2JXXA 2ASQA 2MSED 3OLMD 2WYQA 3VTUA 1QZEA 1VD2A 4MGIE 4GDLB 3JSVA 3ML9A 3L17A 2M0XA 3M95A 2MP2B 3QWZB 2KX3A 4K7SA 2KXJA 3QA8A 4NQKE 1WZ0A 4PS3A 4AOFA 4BBNC 4WQOB 4MJSB 2MQJA 4W9KA 3ZRCA 2FAZA 3WAOA 3OJ3A 1L7YA 2CS4A 4MJSA 5D2MB 5L95C 2J7QB 2JY6A 5IAAC 5BO4B 1ZW7A 3T9LA 4BKSA 4IM0A 1SGHA 2HE7A 5LXIB 4X57B 2NBVB 3ZTDA 2XBBC 3N3KB 4GDLA 3H9DA 5D7GA 5G55A 3I3TB 3A4RA 3DVGX 1G6JA 2O6VD 5D6JB 3CSTA 5CHWA 1WMHA 3VVWB 3EFUA 2A4ZA 1A5RA 2AEHA 4NJ7A 4I6PA 4GU2A 1VCBA 4II2B 2KFKB 4NNJB 1GNUA 1KJTA 3HM6X 3KYCD 5JHAA 5IA7A 3N32A 1TBEA 3L10B 4ICVA 1V5OA 1WRDB 1GC6A 4W9LA 4ZYNA 2L00B 3SD5A 2V1YA 3LDZE 4HJKA 2M4NA 1Z5SB 1LM8B 2FCNA 2BYVE 2MBEA 2IYDB 1Q5WB 4HCPB 3PV1A 2GMIC 3ZUNA 4NAWB 1OEYJ 3OAWA 4BBNF 1WM2A 4A3OA 2Z0DB 4RM8A 4IWPA 1WJ6A 2NVUI 2BPSA 2W9NA 2ZZPB 2DAJA 4AWJA 3MJWA 3PRPB 3H6NA 3RZWC 4ASWC 3MHSD 3PRZA 2HJ8A 5J18A 1J19A 2IO0B 3PLUA 3TMPB 5E6NA 3V6CB 1WXAA 4IM3A 2KJHB 5E6OA 2JT4B 1SIFA 1V9JA 4MSMB 3M62B 3N30A 3V62A 4ICUA 1H8CA 1UBQA 2I1KA 3VAWA 1EF1A 2LUEA 4PYUA 5LXHA 3X23A 4EOYA 4EFOA 1E8ZA 2FCMA 2L05A 2OJRA 4GOCA 2KMCA 3UF8A 4ANWA 4DDID 3QJZA 4KIKA 4URKA 2KDIA 2ZVNA 3L0WB 4HDQA 3UQAA 2AWTA 3NZSA 2PJHA 2C7HA 4I6NB 2HTHA 4BOZB 1UBIA 2R2QA 3M63B 4W9JA 5D94A 1SE9A 2KWCA 5E6PA 3TCAA 3ZNHB 3D32A 3ZKJC 4AJWA 4AJYB 4IM2A 1ISNA 3CMMB 1E5WA 3NZUA 4TQ0A 2BF8B 3DVNU 2MRPA 2N9EB 2NPTB 3SDLC 3KH0A 4M8MA 2KANA 1XD3B 3K9PB 2L3ZA 3EC8A 5KHOA 1WH3A 1WI0A 1WXVA 4FJYA 4JGHB 1WGYA 2GBMA 2GBKA 1YX6B 2AL6A 2IBIB 2Z0EB 2LRUA 2ZPYA 1K8RB 2DYMA 2JRHA 3PZDA 2GBJA 4M0WB 2ZCCA 2MCNB 1WR6E 4JQWC 4IWOA 1P3QU 2LGDA 4WWPA 2WX1A 4HWIB 1LQBA 1WR1A 2CU1A 3QK0A 3QQ8B 3TL5A 4BKSD 4DHZB 1FXTB 2G4DB 2KN5A 3HHMA 4W9CA 1KOTA 5DPRA 3WANA 2KVRA 5JH5C 2JF5A 4G0NB 3TIXA 1E7UA 2RSUA 2L76A 3VH3B 4KSLC 2WDTB 3JW0X 4EZJA 3DOWA 1WJ4A 3DBHI 2LWPA 3ZIMA 4G50A 2BKFA 2BWES 1WE6A 1E7VA 2KOXA 3KUCB 2ZVOA 2EMTA 3VXWA 1IYFA 3H1UA 3BY4B 2L0TA 4II3B 2UWQA 1V81A 2CHWA 1I42A 4OVUA 4N9F4 4NJ6A 2O6VB 3ONSA 1M94A 1WM3A 2LVQA 1NDDA 2KK8A 4G11A 4WAAA 3B1LX 4MDKE 4LJOB 4PS7A 4B6WA 3Q3FA 3WALA 2MBQA 1V80A 2V3SA 4GIVA 3TJPA 3ZO5B 1WJNA 1X1MA 2N7EA 5J17A 2RGFA 2KO3A 4HCNB 2QHOA 1GJZA 2RR9A 2NPTA 3DBLI 3W1YA 5JHBA 3NOBA 4HLEA 4NQLB 4E74A 1WY8A 2KLCA 3QAQA 3PTFC 4GXBA 2G3QB 2MBHA 3NS8A 4WJQA 3ZLZA 4W9EA 3HK0A 3OJ4B 2N9XA 4MM3A 5AZGA 2M17A 1V86A 2CKHB 2IO3B 2O2VB 2MA9B 4ZRKA 1WGGA 3U7DA 3UINB 2JZZA 2K8BA 3B08A 3IFWB 4P7IA 2G4SA 3S2AA 3PHXB 1YX5B 3A4SC 3EHVA 5CTRC 3WIMA 4NPNA 2K6QA 2DYOA 1WX7A 2BYFA 1EO6A 2B3AA 4TUUA 5CHFA 1Z2MA 2IO2B 4KSKC 3VTWA 4K1RB 4EKUA 1P1AA 1WFYA 1R4MI 2KZRA 4JLCA 3Q3JA 1V49A 1P9DU 2KX0A 3VTVA 3L16A 2KD0A 3AULA 4DWFA 4KVGB 2LRWA 1HE8A 1EF5A 1YJ1A 3SHQA 3DVGY 3RZFA 3VDZA 2MX2A 3VH4B 1YIWA 2N1VA 2R2OA 2KDEB 3ZDMC 4JIOU 2K25A 1WYWB 1XT9B 5EDSA 4NAWA 3ZDTA 1V5TA 1WZ3A 3L13A 1GC7A 4LCDE 3RT3B 4ZRJA 2G45B 4RM9A 1YD8U 3IBEA 5CHVC 3H7SA 3NY5A 2KWVB 4M8NA 2N7DA 2LI5A 2LASA 1UH6A 2L0FA 2KQ7A 4E71A 2FNJB 4CO7A 4FN2A
chains in the Genus database with same CATH superfamily
3P4QB 3HVZA 4HPMB 1P0RA 4M01A 4Q2JA 1R4NB 2LUMA 4AUQC 2X38A 2WQYB 5C23A 4DHJD 3ZGZA 1WGHA 3N20C 2A5UA 5FR6A 2LXAA 1GUAB 1LXDA 2MW5A 2WXRA 3Q8EA 5IP4D 2NR2A 2KNBA 3ZYYX 4O1NA 3A1QB 3PREA 5JXVA 2V9HA 1AARA 1C1YB 2C7MB 2ZPNA 2JPHA 4IUMB 1ET9A 1T0SC 5G2NA 2LHEA 2Y3AA 3ECIA 4D2KA 2QEJC 5CX3A 3A9JA 3JYUA 3W1SC 2WU2B 3Q69A 4KIKB 1TTNA 2K3UA 1GAQB 1VLBA 1TS4A 2LVOA 5TSSA 2KDMA 1HEZE 2XEWA 4GDKB 4CYEA 1WJUA 1QQRA 2V0GA 4HPPA 3R66C 4LJPB 1L4ZB 1JWMD 3Q8BA 1AN8A 1TIFA 5G5HA 2K6DB 5HKHA 1E90A 2J0MA 3IT4B 2QILA 1PFDA 2CHXA 2KDBA 4GN1A 3CIRB 1VJKA 4C7ZA 4ARCA 4A3PA 1F2RI 1V1OA 2NTSA 3DPDA 1PQSA 4WH4A 2BWFA 1FXIA 2KC1A 4DXFA 1XCTL 2CHZA 2GBRA 2LVPA 4K3CA 2DZMA 5TR5A 3N1XC 3VR9B 3VRAB 2KQSA 2M56B 1E8YA 3AB5A 1HZ6A 4EUTA 2WXGA 3LXFA 2SAKA 4MH8A 1I35A 3KYDD 3C0RB 1ENFA 1SIJA 4MGZE 1NI2A 2HJ1A 3EECA 4RGOS 3R7RA 4MELA 2KJ6A 3QCAA 5KHQA 2D2QA 3E9SA 4AQ7A 3I57A 4DHJB 3PO0A 4FULA 2RPQA 2QC8A 4LLGM 2W3SA 4LDTB 3KWVA 1MFWA 2MWSB 1YQ4B 3A33B 1S1QB 1K51A 3T8MA 2ZEQA 4C4VA 2PVOD 3IAM1 2JU6X 2EKEC 4WWNA 4ANVA 2Y5CA 3L54A 4XZ4A 4GB9A 3AE3B 1WX8A 4IC7B 2C5LC 2KC2A 3AI5A 3BVZA 1PGXA 1TKEA 2X8XX 5H8YE 5D3IB 4DDGD 2D07B 2JQRB 4NY0A 4ZHPA 3ZNID 3SU8X 1JWBD 1TJEA 2DZIA 1PUTA 2B76B 4A55A 1T5XD 4KV2A 2XK5B 5DPSA 4K81A 4CHKA 2BB6A 4XWTA 1BT0A 1K53A 3EUB2 3DBSA 1UNSA 2ZNVB 2O2VA 3LYYA 2D10A 2V3NA 1F1HA 4MM3B 4RH6A 4B0EA 2C7NB 2YEPB 3RMKC 1UD7A 1EUVB 2KTFA 3U2SC 3BINA 3N1ZC 2LGSA 5AEKB 2RDGA 2C9WB 5IOIA 2KMAA 3UIOB 4JL9A 4XX5A 4I6LB 3ZNGC 3PZ7A 4ZOHC 2LJ5A 2ZCBA 3W2DA 3L4PA 2AQ3B 2ASQA 2JXXA 4DXGA 2MSED 2D3BA 1ZXHA 1VD2A 4MGIE 5FKAC 3JSVA 2W82A 2M0XA 3QWZB 2KX3A 2KXJA 4NQKE 5AUIA 4PS3A 1EWCA 4MJSB 2MQJA 4W9KA 1EU4A 1ESFA 1L7YA 3SEBA 2INPE 2N9KA 4BKSA 1QLBB 4XE0A 4R3DA 2XBBC 1B9RA 4HKQA 5G55A 1WSPA 2LHDA 2H88B 1I7HA 1VCBA 1SSNA 1KJTA 3L10B 1UWXA 4ICVA 4KX6B 2L00B 1YN3A 2V1YA 3MFGA 1Z5SB 2FCNA 2MBEA 1YJIA 2IYDB 4RCOA 3FILA 2GMIC 3P42A 1BMLC 4RM8A 4WAFA 4QAYA 1C9FA 2NVUI 1I4GA 4C80A 3PRPB 4ASWC 1FRDA 3TMPB 5E6NA 1DGJA 2UU7A 1FFUA 5E6OA 2JT4B 3N30A 3VAWA 1EF1A 5BYSA 4EOYA 1D5ZC 4EFOA 1KLGD 3AEDB 4GOCA 4DDID 2N0SB 3J9CA 4URKA 1QOAA 5GXGB 1CQVA 2AWTA 4BOZB 5BMHA 1UBIA 5E6PA 2KWCA 5I4DA 4IM2A 4NAMA 3EGRA 3Q8AA 2AQ2B 2BF8B 2QJLA 3DVNU 2NPTB 3KH0A 3N1YC 3RPFC 1XD3B 3K9PB 1WI0A 4RGTA 2GBKA 3P4SB 3PZDA 4WWPA 1DYQA 4HWIB 1LQBA 1WR1A 2CU1A 3NVWA 4DHZB 2PLPA 3WANA 1KTKA 2JF5A 4G0NB 2L1AA 2BS3B 2PW9A 4ZRPA 3Q3MC 4G50A 1WE6A 3ZJUA 3C19A 4IDIA 2CHWA 4XDDA 4NJ6A 1E0ZA 1QKZA 1WM3A 4WAAA 4PS7A 3WALA 4GIVA 3TJPA 3KQ4A 1X1MA 3U7ZA 1RM6C 1GJZA 5JHBA 3DBLI 2WDVB 4H2AA 1JROA 4TSSA 2MBHA 4WJQA 3HK0A 4C56C 4MM3A 4RGMA 1R7SA 1T0RC 4PK1A 2G4SA 3A4SC 5CTRC 2FUG1 1DOYA 1WX7A 1EO6A 2G1EA 5CHFA 1Z2MA 2K9XA 4KSKC 3VTWA 1JQ4A 4K1RB 3HVDA 1WFYA 4JLCA 2OJWA 1V49A 3VTVA 2KD0A 4US9A 1ZXIA 4WWMA 1MPEA 1V1PA 3DVGY 3RZFA 1VZ8A 5FR3A 3VDZA 2N1VA 1SF0A 2WXJA 3DHHC 1XT9B 1WZ3A 4CQNA 1KF6B 1N6ZA 2E3TA 5CHVC 3NY5A 2KWVB 3R2IA 2LI5A 2LASA 1FD6A 2R61A 3OWEB 4E71A 4MGYE 1LGRA 1D6EC 1BUIC 4TV3A 2INCC 2DWQA 4FA6A 3APFA 4EZKA 4BVUC 2WXPA 2Y5BB 1EWYC 1RWSA 1WIAA 1S3SG 4P1BC 2Y5PA 1U4AA 1C79A 1YQ3B 1ZDVA 2BBCA 1FO4A 1EM7A 3U8ZA 4XWWA 4OHJA 1NBFC 1ZP0B 1WWTA 2N9PC 1JWAD 4YWGG 2M1MA 3ZTCA 3RCZA 5HFYA 4J3OD 1FCLA 2JXTA 2AX5A 4HJGE 3IHPC 4W9HA 3RULA 1GOZA 1TZ1A 3V60A 3VUYA 1F52A 1VR9A 2LZ6A 2PE6B 5IKCM 4TKNA 2E6XA 4K7WA 2N7JA 4BFRA 2DZKA 1XLQA 3BWUD 1F9JA 1I4QA 3AXCA 3QARA 1T0YA 4KGRA 4PS8A 2KDFB 2J0KA 3AE2B 5DPWA 2GB1A 4HVBA 1KFYB 2VH1A 2MLBA 4N6EB 2DZJA 1KH0A 3BYTB 1XCQL 1WYGA 3LJ3A 3R2TA 1MJDA 3ZXRA 2MJEA 3BK1A 2K8CA 3O65B 1KRHA 1OEYA 1N60A 4FJVB 2HD5B 2WU5B 2PVGC 2LMCA 1YNTE 1OQRA 3P4RB 3DQVA 3A9KB 3QC8B 3V3XA 4DQOC 4XC2A 3GZNI 2KN4A 5EE1A 2NTTA 5C3JB 3BZDB 3H7PB 3A1QA 1J8CA 3AU5A 2FCSA 5T8IA 1KLVA 1UZXB 3ZRFA 2INDC 2D3GA 1R4NI 3VHTC 4OVVA 4HROA 1TGZB 2ZJDA 2K39A 2MP2A 3PZ8A 4NZLB 2FIFA 1C78A 2WDQB 3MP9A 2PMVA 3PS6A 2DX5B 2D3CA 1ZGUB 3C8YA 2YVCA 4E3CA 3DBLB 4GSWA 2ON8A 2Q5WD 1HXYD 1TS2A 2D11A 2QIEB 1AWDA 1QOBA 3H7PA 1WGDA 3Q14C 4EEWA 4WJOA 5IO9A 3GZNB 3VUXA 2VRRB 2KKCA 1WF9A 3RNFC 1Q10A 2LGIA 1XXGA 3WAPA 2YLMA 2WX0A 5AZFA 2K8HA 1V6EA 2QMTA 4XDCA 1XLPA 2YEPF 4ANUA 1J7BA 2IGHA 2KMMA 2RDHA 3I5JC 1K52A 2JRIB 3K9OB 1WX9A 3DBHB 2DYBA 3ALBA 1JALA 3IVFA 2BKRB 5AZHA 2ZNVC 1Y8RC 2IY0B 1EU3A 4KZCA 4HEA1 2C60A 3ZVVA 2PIAA 3DCGA 4JWSC 4LDTD 2IZVB 4DK5A 2KLGA 4RMAA 2WNMA 2V4LA 4US8A 2KWUB 1MG8A 1JRUA 3TUOA 2LD9A 4YTNB 4KKIA 1WE7A 2PPHA 4NJCA 3GOEA 2MBBB 3URYA 1T0QC 3Q8CA 4GDLB 5HG2A 3L17A 3HUIA 3M95A 3MHZA 2CJNA 4K7SA 1WZ0A 3KWLA 3ZRCA 2FAZA 2BT6A 3WAOA 2BTEA 5L95C 2J7QB 4WQMA 1NENB 4IM0A 1C4CA 5LXIB 1J7CA 2PKOA 3AEEB 3H9DA 3I3TB 2WS3B 3DVGX 3VVWB 1WMHA 2J42A 3NUHB 3AEFB 4I6PA 1FCCC 4II2B 1HTOA 2CU3A 5JHAA 2MH7A 1V5OA 1WRDB 4M0WA 3LDZE 2M4NA 3PV1A 4NAWB 1OEYJ 5C2TB 4BBNF 1WM2A 4A3OA 3FAHA 4IWPA 1WJ6A 2JZPA 2W9NA 2ZZPB 2DAJA 3MJWA 5J18A 1TZOA 3NS1A 3V6CB 4IM3A 1XLOA 2KJHB 1SIFA 1V9JA 3M62B 1UBQA 1FFVA 5LXHA 3X23A 4B0MA 2WXKA 3UF8A 2OJRA 1C76A 3NVYA 5D3DA 2QCZA 2JSVX 3L0WB 3UQAA 2PJHA 2C7HA 4I6NB 3ETRA 2V4IB 1SE9A 1N63A 3TCAA 3ZKJC 2BVCA 4AJWA 4AJYB 4KKJA 4GLSC 2M19A 4TQ0A 2N9EB 3RN9C 4M8MA 1Y56A 2L3ZA 3B9JA 3EC8A 1N5XA 1WXVA 4LNKA 5KHOA 3TEWA 2GBMA 3GB1A 2Z0EB 2ZPYA 2ZCCA 4IKGA 2RMMA 2MCNB 2JYTA 2LGDA 2JYEA 3QK0A 1JW9D 2AQ1B 4BKSD 4W9CA 2G4DB 3AE5B 1XF5L 1KOTA 4K3BA 1L0YB 2KVRA 4OZAA 3TIXA 3VH3B 3RNGC 4IOIE 4EZJA 3DBHI 3ZIMA 2KOXA 2EMTA 1L6UA 3DHIC 4RGNA 3Q3NC 3BY4B 2UWQA 4N9F4 2O6VB 3ONSA 3B2FA 2LVQA 3I63C 4LJOB 2WGSA 4B6WA 3Q3FA 5G5GA 1SEBD 1FXAA 4HCNB 3BVMA 4HLEA 4NQLB 1SE4A 1WY8A 2WXMA 4WIPA 1TY2A 1HA5A 1SE2A 2VZKD 3AV8A 2CKHB 3RFZB 3NVZA 2MA9B 3U7DA 1WGGA 2KWDA 1WGKA 3S2AA 3PHXB 3EHVA 3B2GA 2BYFA 4TUUA 1JWSD 4WURA 3OG5A 1SE3A 4EKUA 3T3OA 1R4MI 3EFCA 4KVGB 2QSDA 2WXLA 3ZDMC 2W55A 5BMIA 5EDSA 4NAWA 1V5TA 3N9YC 2G45B 4JWUC 3IBEA 1L0XB 1A70A 2KQ7A 3ABVB 4LNIA 1ACCA 2FNJB 4USAA 3NHEB 2XN9C 4YSXB 2WXOA 4J6IA 3WAMA 5C1ZA 3QIJA 3VFKA 2M8SA 3UI3A 3ZQ4A 1L5PA 4FADA 3HM3A 1MVKA 4EE2A 5GMVA 1OGWA 4BZAA 4ZHOA 4W9DA 2VH2A 1JMLA 1AW7A 5J2RA 2FIDA 1RYJA 1Q0WB 3DDCB 2I1JA 1ZPSA 3KUZA 2AL3A 4MSQB 3TBLD 4N58A 2JZ3B 4ANXA 4A20A 3GP7A 2FBWB 2N9LA 3KVFB 2NS5A 3CF6E 4C7YA 4RNAA 1K50A 3ML8A 2MEKA 2JUOA 3HRDD 3APCA 2RD0A 1R4MB 2VZKB 4OW0A 1P98A 2BQQA 3FC4A 3RNEC 3MJ5A 4L2YA 1UF0A 5EE3A 2I38A 5HI1A 1GG3A 1Q1OA 2KAJA 2KJRA 3E56A 3TSSA 2GOWA 3M3JA 2DENB 3Q2AC 1YOVB 5BYQA 2O6VA 4XGAB 1TS3A 1WRIA 2LEKA 2UYZB 1E8WA 4MH0E 1F77A 1XQQA 1C3TA 2ONQA 1JWUD 2K22A 1BXTA 3VR8B 1HQRD 2KTRB 4FBJB 4GMVA 3RYTA 4BKGA 2G9HD 4IG7B 1SJHD 3QHTA 3CWIA 3TEYA 1IGDA 1RLFA 4L1BA 4BOSC 1L2NA 1NYRA 1WGRA 3PGEA 4RF1A 4HKZE 2KT7A 2L7RA 3AE6B 2IO1B 2CJOA 1ZE3D 2DHZA 4JPSA 1IBXA 3NG0A 1KM7A 4TQ1A 4FLHA 1VRAB 2NBWB 2WXHA 2LGXA 1UELA 2NCNA 1FIQA 3IG3A 3NZ3A 3JVZX 2ZW1A 5DCNA 4HPLB 2K1FA 5IN7A 4KGTA 2J52A 2HDEA 4KDLB 3DHGC 2LXCA 1T3QA 4XYCA 1N5WA 4GGQA 4RF0A 1L4DB 3PRMB 4HDOA 2L8JA 1TS5A 4MEMA 3KUDB 5JZEB 1YJJA 1UGMA 3PHWB 2EELA 2KHWB 1YQBA 4P6VF 3AE8B 4WWOA 1TKYA 2BS2B 3VQIA 2EMSA 3NVVA 4KDIC 4DXAB 3DWMA 1WXSA 2PE9A 5DPTA 1V2YA 1PYWD 1H4RA 4WJNA 1ZKHA 2W3RA 4P1CC 1QOFA 2JVCA 4A90A 1TKGA 2NMQA 3OLMD 2J4XA 3VTUA 2ICIA 3AEGB 1MHHE 3IT6B 5BMGA 3H8HA 2ZW0A 4AOFA 4WQOB 4ARIA 5EE9A 4LTUA 5AUKA 2CS4A 2HTME 5IAAC 4HRSA 4OVZA 2HE7A 4X57B 2NBVB 4YT0B 1TYGB 4GDLA 1I4RA 4A9AA 2O6VD 5D6JB 3CSTA 3EFUA 2RDBC 2PTLA 4GU2A 2KFKB 4NNJB 2KYWA 1GNUA 3HM6X 3N32A 1GC6A 4W9LA 2KACA 4HJKA 4HCPB 3OAWA 4MT5A 1C4AA 1UUPA 3H6NA 1DOIA 3PRZA 2HJ8A 3PLUA 1TT5B 1FMAD 1YN4A 4MSMB 1H8CA 2I1KA 2LUEA 4PYUA 2L05A 2KMCA 1I4HA 3QJZA 2GI9A 1B1ZA 2ZVNA 4HDQA 3NZSA 1OQQA 4C4VB 3M63B 4W9JA 2K0PA 2BB5A 3D32A 1HTQA 5EE0A 1PGBA 1IBXB 1ISNA 1E5WA 3GE8C 3FKYA 2MRPA 1CJEA 1PGAA 1WGYA 2DLBA 2IBIB 2LRUA 2JRHA 1TY0A 3U4EG 4L23A 1QILA 4JQWC 1F0ZA 4IWOA 1FNVA 1E10A 2EKIA 2KN5A 4S17A 3TEZA 2RSUA 1CK1A 4KSLC 1ZOYB 1D5XC 3DOWA 1C77A 2WXFA 2BWES 1I4PA 1IYFA 3H1UA 2L0TA 1F2RC 1AYFA 1M94A 3GS2A 3SFEB 1NDDA 4G11A 4MDKE 3Q3OC 2MBQA 2WXQA 1GPXA 1WJNA 4UDUC 2KO3A 3RNAC 2JWUA 2NPTA 3NOBA 1FM0D 4FXCA 2KLCA 1OFFA 3NS8A 3MC0B 2I2YA 2N9XA 4YSYB 2O2VB 3AEAB 1NEKB 3IFWB 1JRPA 1YX5B 1D4BA 4NPNA 2TSSA 2DYOA 2K6QA 4P16A 2B3AA 2ACZB 3EA6A 3WCQA 1DOXA 3Q3JA 2M0AA 3SHQA 1YIWA 2R2OA 4JIOU 3AE9B 1UGJA 1JCKB 3ZXVA 3ZDTA 3LB8C 2IDYA 1VZ7A 3L13A 1GC7A 4LCDE 2IGDA 4LK0M 4ZRJA 4RM9A 4M8NA 2N7DA 3P63A 2L52A 1UH6A 1MI0A 4CO7A 2GLSA 2K5PA 3ZW3A 2OOBB 4JE3B 3DWGC 4YL8A 3I9V1 2N1WA 2FCQA 3W5UB 2KFJA 3P2BA 3V6EB 4HXDA 2D5GA 1OQYA 3KW5B 1SB3C 3PSEB 2NBUA 1HZ5A 4EZLA 4KGSA 1IPGA 4W9IA 4HK2A 3A9KA 2BS4B 2GBNA 1J0GA 3MTNB 3PLVA 4A6QA 1KLUD 2OHFA 2JWZA 1ZUD2 4FHJA 4M02A 4F8CB 4K7UA 4BKTA 3W1SA 1E8XA 2REXA 4IW0A 4OZCA 1WXMA 2OEDA 4N59A 1D3ZA 1NYQA 2H89B 3RI7C 1FNWA 1FPYA 2WHIA 4M00A 4AS1A 4BAXA 3ZJTA 2XK5A 3AE7B 4W9FA 4JX1C 1P7EA 3PT2B 4DHZE 1RRBA 3R3MA 3QX1A 3O13A 4C00A 3X0WA 1PDXA 1IP9A 3UIPB 2Z59B 4LNOA 4YSZB 2KFKA 4PYZA 4AP4C 1I4XA 2J53A 1IGCA 2AYOB 2XNAC 3A9JB 3UGBB 1MHXA 1WMHB 4ITKA 4YTPB 2DAFA 3U30A 4IWQA 2CR5A 3AN1A 2MBOA 4YTMB 3APDA 2SEBD 3WA0A 2MHJA 1CMXB 1XO3A 3VUWA 3HIZA 2FUHB 1SXTA 5E6JA 1QF6A 4B95A 2WWZA 4ZRIA 3V61A 5LLIA 2IY1B 3CSFA 4ZDVA 3JSVB 5H92C 2JX5A 4FJZA 2LJIA 2J0JA 3AM9A 2N4FA 3W5VB 1XLNA 1GB1A 2KTRA 2L32A 5LNK1 1E9MA 1VZ6A 3L08A 2BGFA 3PVLA 3BK2A 3AE1B 4KZ0A 1ET6A 1RFAA 1L0VB 1RAXA 3W9CB 3B0AA 2MJ3A 2QDFA 3R7QA 4F1SA 1YMHE 4FHKA 1D5MC 3ZNZB 1OTRB 1M4VA 2RPVA 2WDRB 3RD2A 4G3XB 1LFDA 1MG4A 3Q6BA 2WLBA 1QOGA 3DVNV 3RUIB 4DBGA 4B9KA 3UQBA 1GB4A 3BYYB 2W54A 3BVGA 2BYEA 3AU4A 1C4PA 2LGYA 2WXNA 1L6VA 4GDKA 4W9GA 1SJED 3DBRB 3NRZA 4WJPA 2PEAA 3ENEA 3VRBB 3U52E 5L83A 4F7ZA 4MGKE 3DBRI 4LNFA 3PPAA 5MPOA 2WYQA 1QZEA 3ML9A 3Q8FA 3MC8A 3AMZA 2MP2B 3QA8A 3GE3C 4BBNC 2BYTA 3R8BA 1SBBB 3IXSA 3OJ3A 4MJSA 5D2MB 2JY6A 5BO4B 1ZW7A 3T9LA 1SGHA 3ZTDA 3N3KB 4OZBA 5D7GA 1IUEA 3A4RA 1G6JA 1T6BX 5CHWA 3BIID 2IPKD 2A4ZA 1A5RA 2AEHA 4NJ7A 3KYCD 2V3PA 4YXDB 5IA7A 1TBEA 4ZYNA 3ZJVA 3SD5A 1LM8B 2BYVE 1Q5WB 3ZUNA 2IGGA 2Z0DB 2BPSA 3TEXA 3SFDB 1E7PB 1V1PB 4AWJA 1P7FA 3RZWC 3MHSD 1J19A 2IO0B 3T3NA 2INNE 1WXAA 3MC9A 3V62A 4ICUA 4ZYSA 1E8ZA 2FCMA 4ANWA 1N61A 4REZA 4KIKA 4ZRQA 2KDIA 4RFBA 2HTHA 2R2QA 3V05A 5D94A 3ZNHB 1FEHA 4LNNA 3CMMB 3NZUA 1NVID 3SDLC 1E6EB 2KANA 3FILB 1WH3A 4JGHB 3AECB 4FJYA 1YX6B 2AL6A 1K8RB 2DYMA 2GBJA 3AE4B 4M0WB 4ACFA 1WR6E 1P3QU 2WX1A 1STEA 2DBYA 3QQ8B 3TL5A 1FXTB 2BW2A 3HHMA 2KVZA 3P4PB 5DPRA 5JH5C 4MACA 1E7UA 2L76A 4TMAB 2WDTB 3JW0X 1CZPA 1WJ4A 1ROEA 2LWPA 2BKFA 3KUCB 1E7VA 2ZVOA 3VXWA 4II3B 1V81A 2Z8LA 1I42A 4OVUA 4A8XC 2MJDA 3AH7A 2L83A 2KK8A 1NI3A 3B1LX 1V97A 3P1MA 1V80A 2V3SA 3ZO5B 2DNFA 2N7EA 1V8CA 5J17A 2RGFA 2IJ0A 3RNBC 2QHOA 2RR9A 3W1YA 5FK9C 4E74A 1RFKA 4S0RA 4PT5A 3QAQA 3PTFC 4GXBA 2G3QB 3ZLZA 4W9EA 3OJ4B 3KLSX 2LFIA 1J7AA 5AZGA 1XEEA 2M17A 1V86A 2IO3B 4ZRKA 3IAS1 2JZZA 2K8BA 3B08A 4P7IA 3UINB 2WXIA 1UWMA 1ZDXA 3WIMA 1QT9A 2IO2B 1VDVA 5HHDG 1FNUA 2FE8A 1P1AA 3AEBB 2KZRA 3SR6A 1P9DU 2KX0A 3L16A 3AULA 2GRIA 4DWFA 2LRWA 1HE8A 3RNCC 1EF5A 1YJ1A 2MX2A 3VH4B 3NJTA 2KDEB 1N62A 2K25A 1FRRA 1WYWB 1LO5D 3RT3B 1YN5A 2KQ4X 2D3AA 5BYRA 1WXQA 1YD8U 3H7SA 2L0FA 2WP9B 4FN2A
chains in the Genus database with same CATH topology
3NHEB 4MGYE 4J6IA 4HPMB 1P0RA 3WAMA 4TV3A 5C1ZA 3QIJA 3VFKA 4FA6A 3APFA 4EZKA 4BVUC 3ZW3A 2Y5BB 2OOBB 2M8SA 4AUQC 1WIAA 1S3SG 4FADA 4YL8A 5C23A 4DHJD 2N1WA 1U4AA 1WGHA 2FCQA 3HM3A 5GMVA 3U8ZA 2A5UA 2KFJA 3P2BA 5FR6A 3V6EB 2LXAA 1GUAB 4HXDA 1LXDA 1NBFC 1OGWA 2MW5A 2N9PC 1OQYA 3KW5B 2NR2A 2KNBA 4W9DA 2M1MA 3PSEB 3ZTCA 3RCZA 2NBUA 3A1QB 5J2RA 3PREA 2FIDA 1AARA 4EZLA 3IHPC 1IPGA 1C1YB 4W9HA 1Q0WB 4HK2A 2C7MB 4W9IA 2ZPNA 3RULA 2JPHA 1TZ1A 4IUMB 3V60A 3A9KA 3VUYA 3DDCB 5G2NA 2GBNA 2I1JA 1J0GA 3MTNB 3PLVA 2LZ6A 2PE6B 3ECIA 5CX3A 3A9JA 3JYUA 3W1SC 3KUZA 2AL3A 4KIKB 4TKNA 4MSQB 1TTNA 3TBLD 2JWZA 4K7WA 4FHJA 2JZ3B 4F8CB 4K7UA 4BFRA 2DZKA 4BKTA 2LVOA 3W1SA 4A20A 4ANXA 1E8XA 3KVFB 1F9JA 2NS5A 3CF6E 2XEWA 2REXA 4GDKB 3AXCA 4CYEA 1WJUA 3ML8A 2JUOA 3QARA 4IW0A 1T0YA 3APCA 2RD0A 3R66C 4LJPB 1WXMA 4PS8A 1D3ZA 2KDFB 2K6DB 2J0KA 1P98A 5DPWA 5HKHA 1E90A 4HVBA 2J0MA 2XK5A 4W9FA 2CHXA 2MLBA 2KDBA 4GN1A 3PT2B 4DHZE 2DZJA 1RRBA 3R3MA 3QX1A 3LJ3A 1GG3A 1Q1OA 2K8CA 3O65B 3X0WA 4A3PA 1IP9A 1OEYA 3DPDA 1PQSA 3UIPB 2Z59B 2BWFA 2KC1A 4FJVB 2KJRA 2HD5B 2GOWA 3M3JA 2CHZA 2GBRA 2KFKA 4PYZA 2DENB 2LVPA 4AP4C 2DZMA 2O6VA 5TR5A 2AYOB 3A9JB 3UGBB 1WMHB 2KQSA 2DAFA 3U30A 4IWQA 2UYZB 1E8YA 3DQVA 1E8WA 2CR5A 3A9KB 3QC8B 2MBOA 4MH0E 4XC2A 3GZNI 4EUTA 3APDA 1XQQA 3WA0A 1CMXB 3VUWA 1C3TA 3H7PB 1I35A 3HIZA 3KYDD 3A1QA 1J8CA 2KTRB 3AU5A 2FCSA 3C0RB 2FUHB 1KLVA 4MGZE 1UZXB 3ZRFA 4FBJB 4GMVA 2D3GA 1R4NI 3RYTA 4BKGA 4IG7B 3VHTC 4OVVA 3QHTA 4B95A 2WWZA 4ZRIA 1TGZB 2ZJDA 3V61A 1NI2A 1RLFA 5LLIA 4BOSC 3EECA 1L2NA 2IY1B 2K39A 2MP2A 3R7RA 4MELA 3CSFA 2KJ6A 2FIFA 3QCAA 4ZDVA 1WGRA 3JSVB 3PGEA 5KHQA 2D2QA 4FJZA 3PS6A 2DX5B 1ZGUB 4DHJB 2L7RA 2YVCA 4FULA 2RPQA 4E3CA 4GSWA 2J0JA 2IO1B 2N4FA 4LDTB 2DHZA 2MWSB 2D11A 1KM7A 2KTRA 4TQ1A 3A33B 4FLHA 1S1QB 3H7PA 1WGDA 3T8MA 2ZEQA 4EEWA 2NBWB 4WJOA 2LGXA 1UELA 2NCNA 2BGFA 3L08A 3PVLA 3IG3A 3VUXA 2VRRB 4KZ0A 1RFAA 2EKEC 2KKCA 3JVZX 4WWNA 4ANVA 1WF9A 5DCNA 4HPLB 2K1FA 3L54A 4XZ4A 4GB9A 1RAXA 3B0AA 3WAPA 2YLMA 2WX0A 4KDLB 1WX8A 5AZFA 2K8HA 1V6EA 3R7QA 4IC7B 2C5LC 2KC2A 3AI5A 2LXCA 4ANUA 4F1SA 4GGQA 4FHKA 3PRMB 3ZNZB 1OTRB 2JRIB 4HDOA 3K9OB 1WX9A 2L8JA 4DDGD 2D07B 4NY0A 2DYBA 3RD2A 3ALBA 3ZNID 3IVFA 4MEMA 3SU8X 4G3XB 3KUDB 2DZIA 5JZEB 1LFDA 1UGMA 2BKRB 3PHWB 2ZNVC 1Y8RC 2IY0B 3DVNV 4KV2A 5AZHA 2XK5B 5DPSA 2KHWB 4K81A 4KZCA 4CHKA 3RUIB 1BT0A 2C60A 1YQBA 3ZVVA 3DCGA 4DBGA 4WWOA 4B9KA 3DBSA 4LDTD 2IZVB 3UQBA 2ZNVB 3VQIA 2EMSA 4DK5A 2KLGA 4RMAA 2O2VA 2D10A 2V4LA 4KDIC 2BYEA 3AU4A 2KWUB 1MG8A 2LGYA 4GDKA 2C7NB 4DXAB 4W9GA 1UD7A 1JRUA 1WXSA 1EUVB 2PE9A 5DPTA 1V2YA 2KTFA 4WJPA 2LD9A 3BINA 1H4RA 4WJNA 1ZKHA 2PEAA 3ENEA 5AEKB 2C9WB 3UIOB 2KMAA 5L83A 4JL9A 4XX5A 4I6LB 3ZNGC 4MGKE 4F7ZA 2LJ5A 3DBRI 1WE7A 2ZCBA 2PPHA 2JVCA 3PPAA 3GOEA 2MBBB 2JXXA 2ASQA 2MSED 3OLMD 2WYQA 3VTUA 1QZEA 1VD2A 4MGIE 4GDLB 3JSVA 3ML9A 3L17A 2M0XA 3M95A 2MP2B 3QWZB 2KX3A 4K7SA 2KXJA 3QA8A 4NQKE 1WZ0A 4PS3A 4AOFA 4BBNC 4WQOB 4MJSB 2MQJA 4W9KA 3ZRCA 2FAZA 3WAOA 3OJ3A 1L7YA 2CS4A 4MJSA 5D2MB 5L95C 2J7QB 2JY6A 5IAAC 5BO4B 1ZW7A 3T9LA 4BKSA 4IM0A 1SGHA 2HE7A 5LXIB 4X57B 2NBVB 3ZTDA 2XBBC 3N3KB 4GDLA 3H9DA 5D7GA 5G55A 3I3TB 3A4RA 3DVGX 1G6JA 2O6VD 5D6JB 3CSTA 5CHWA 1WMHA 3VVWB 3EFUA 2A4ZA 1A5RA 2AEHA 4NJ7A 4I6PA 4GU2A 1VCBA 4II2B 2KFKB 4NNJB 1GNUA 1KJTA 3HM6X 3KYCD 5JHAA 5IA7A 3N32A 1TBEA 3L10B 4ICVA 1V5OA 1WRDB 1GC6A 4W9LA 4ZYNA 2L00B 3SD5A 2V1YA 3LDZE 4HJKA 2M4NA 1Z5SB 1LM8B 2FCNA 2BYVE 2MBEA 2IYDB 1Q5WB 4HCPB 3PV1A 2GMIC 3ZUNA 4NAWB 1OEYJ 3OAWA 4BBNF 1WM2A 4A3OA 2Z0DB 4RM8A 4IWPA 1WJ6A 2NVUI 2BPSA 2W9NA 2ZZPB 2DAJA 4AWJA 3MJWA 3PRPB 3H6NA 3RZWC 4ASWC 3MHSD 3PRZA 2HJ8A 5J18A 1J19A 2IO0B 3PLUA 3TMPB 5E6NA 3V6CB 1WXAA 4IM3A 2KJHB 5E6OA 2JT4B 1SIFA 1V9JA 4MSMB 3M62B 3N30A 3V62A 4ICUA 1H8CA 1UBQA 2I1KA 3VAWA 1EF1A 2LUEA 4PYUA 5LXHA 3X23A 4EOYA 4EFOA 1E8ZA 2FCMA 2L05A 2OJRA 4GOCA 2KMCA 3UF8A 4ANWA 4DDID 3QJZA 4KIKA 4URKA 2KDIA 2ZVNA 3L0WB 4HDQA 3UQAA 2AWTA 3NZSA 2PJHA 2C7HA 4I6NB 2HTHA 4BOZB 1UBIA 2R2QA 3M63B 4W9JA 5D94A 1SE9A 2KWCA 5E6PA 3TCAA 3ZNHB 3D32A 3ZKJC 4AJWA 4AJYB 4IM2A 1ISNA 3CMMB 1E5WA 3NZUA 4TQ0A 2BF8B 3DVNU 2MRPA 2N9EB 2NPTB 3SDLC 3KH0A 4M8MA 2KANA 1XD3B 3K9PB 2L3ZA 3EC8A 5KHOA 1WH3A 1WI0A 1WXVA 4FJYA 4JGHB 1WGYA 2GBMA 2GBKA 1YX6B 2AL6A 2IBIB 2Z0EB 2LRUA 2ZPYA 1K8RB 2DYMA 2JRHA 3PZDA 2GBJA 4M0WB 2ZCCA 2MCNB 1WR6E 4JQWC 4IWOA 1P3QU 2LGDA 4WWPA 2WX1A 4HWIB 1LQBA 1WR1A 2CU1A 3QK0A 3QQ8B 3TL5A 4BKSD 4DHZB 1FXTB 2G4DB 2KN5A 3HHMA 4W9CA 1KOTA 5DPRA 3WANA 2KVRA 5JH5C 2JF5A 4G0NB 3TIXA 1E7UA 2RSUA 2L76A 3VH3B 4KSLC 2WDTB 3JW0X 4EZJA 3DOWA 1WJ4A 3DBHI 2LWPA 3ZIMA 4G50A 2BKFA 2BWES 1WE6A 1E7VA 2KOXA 3KUCB 2ZVOA 2EMTA 3VXWA 1IYFA 3H1UA 3BY4B 2L0TA 4II3B 2UWQA 1V81A 2CHWA 1I42A 4OVUA 4N9F4 4NJ6A 2O6VB 3ONSA 1M94A 1WM3A 2LVQA 1NDDA 2KK8A 4G11A 4WAAA 3B1LX 4MDKE 4LJOB 4PS7A 4B6WA 3Q3FA 3WALA 2MBQA 1V80A 2V3SA 4GIVA 3TJPA 3ZO5B 1WJNA 1X1MA 2N7EA 5J17A 2RGFA 2KO3A 4HCNB 2QHOA 1GJZA 2RR9A 2NPTA 3DBLI 3W1YA 5JHBA 3NOBA 4HLEA 4NQLB 4E74A 1WY8A 2KLCA 3QAQA 3PTFC 4GXBA 2G3QB 2MBHA 3NS8A 4WJQA 3ZLZA 4W9EA 3HK0A 3OJ4B 2N9XA 4MM3A 5AZGA 2M17A 1V86A 2CKHB 2IO3B 2O2VB 2MA9B 4ZRKA 1WGGA 3U7DA 3UINB 2JZZA 2K8BA 3B08A 3IFWB 4P7IA 2G4SA 3S2AA 3PHXB 1YX5B 3A4SC 3EHVA 5CTRC 3WIMA 4NPNA 2K6QA 2DYOA 1WX7A 2BYFA 1EO6A 2B3AA 4TUUA 5CHFA 1Z2MA 2IO2B 4KSKC 3VTWA 4K1RB 4EKUA 1P1AA 1WFYA 1R4MI 2KZRA 4JLCA 3Q3JA 1V49A 1P9DU 2KX0A 3VTVA 3L16A 2KD0A 3AULA 4DWFA 4KVGB 2LRWA 1HE8A 1EF5A 1YJ1A 3SHQA 3DVGY 3RZFA 3VDZA 2MX2A 3VH4B 1YIWA 2N1VA 2R2OA 2KDEB 3ZDMC 4JIOU 2K25A 1WYWB 1XT9B 5EDSA 4NAWA 3ZDTA 1V5TA 1WZ3A 3L13A 1GC7A 4LCDE 3RT3B 4ZRJA 2G45B 4RM9A 1YD8U 3IBEA 5CHVC 3H7SA 3NY5A 2KWVB 4M8NA 2N7DA 2LI5A 2LASA 1UH6A 2L0FA 2KQ7A 4E71A 2FNJB 4CO7A 4FN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE B;  4MGY E;  4J6I A;  4HPM B;  1P0R A;  3WAM A;  4TV3 A;  5C1Z A;  3QIJ A;  3VFK A;  4FA6 A;  3APF A;  4EZK A;  4BVU C;  3ZW3 A;  2Y5B B;  2OOB B;  2M8S A;  4AUQ C;  1WIA A;  1S3S G;  4FAD A;  4YL8 A;  5C23 A;  4DHJ D;  2N1W A;  1U4A A;  1WGH A;  2FCQ A;  3HM3 A;  5GMV A;  3U8Z A;  2A5U A;  2KFJ A;  3P2B A;  5FR6 A;  3V6E B;  2LXA A;  1GUA B;  4HXD A;  1LXD A;  1NBF C;  1OGW A;  2MW5 A;  2N9P C;  1OQY A;  3KW5 B;  2NR2 A;  2KNB A;  4W9D A;  2M1M A;  3PSE B;  3ZTC A;  3RCZ A;  2NBU A;  3A1Q B;  5J2R A;  3PRE A;  2FID A;  1AAR A;  4EZL A;  3IHP C;  1IPG A;  1C1Y B;  4W9H A;  1Q0W B;  4HK2 A;  2C7M B;  4W9I A;  2ZPN A;  3RUL A;  2JPH A;  1TZ1 A;  4IUM B;  3V60 A;  3A9K A;  3VUY A;  3DDC B;  5G2N A;  2GBN A;  2I1J A;  1J0G A;  3MTN B;  3PLV A;  2LZ6 A;  2PE6 B;  3ECI A;  5CX3 A;  3A9J A;  3JYU A;  3W1S C;  3KUZ A;  2AL3 A;  4KIK B;  4TKN A;  4MSQ B;  1TTN A;  3TBL D;  2JWZ A;  4K7W A;  4FHJ A;  2JZ3 B;  4F8C B;  4K7U A;  4BFR A;  2DZK A;  4BKT A;  2LVO A;  3W1S A;  4A20 A;  4ANX A;  1E8X A;  3KVF B;  1F9J A;  2NS5 A;  3CF6 E;  2XEW A;  2REX A;  4GDK B;  3AXC A;  4CYE A;  1WJU A;  3ML8 A;  2JUO A;  3QAR A;  4IW0 A;  1T0Y A;  3APC A;  2RD0 A;  3R66 C;  4LJP B;  1WXM A;  4PS8 A;  1D3Z A;  2KDF B;  2K6D B;  2J0K A;  1P98 A;  5DPW A;  5HKH A;  1E90 A;  4HVB A;  2J0M A;  2XK5 A;  4W9F A;  2CHX A;  2MLB A;  2KDB A;  4GN1 A;  3PT2 B;  4DHZ E;  2DZJ A;  1RRB A;  3R3M A;  3QX1 A;  3LJ3 A;  1GG3 A;  1Q1O A;  2K8C A;  3O65 B;  3X0W A;  4A3P A;  1IP9 A;  1OEY A;  3DPD A;  1PQS A;  3UIP B;  2Z59 B;  2BWF A;  2KC1 A;  4FJV B;  2KJR A;  2HD5 B;  2GOW A;  3M3J A;  2CHZ A;  2GBR A;  2KFK A;  4PYZ A;  2DEN B;  2LVP A;  4AP4 C;  2DZM A;  2O6V A;  5TR5 A;  2AYO B;  3A9J B;  3UGB B;  1WMH B;  2KQS A;  2DAF A;  3U30 A;  4IWQ A;  2UYZ B;  1E8Y A;  3DQV A;  1E8W A;  2CR5 A;  3A9K B;  3QC8 B;  2MBO A;  4MH0 E;  4XC2 A;  3GZN I;  4EUT A;  3APD A;  1XQQ A;  3WA0 A;  1CMX B;  3VUW A;  1C3T A;  3H7P B;  1I35 A;  3HIZ A;  3KYD D;  3A1Q A;  1J8C A;  2KTR B;  3AU5 A;  2FCS A;  3C0R B;  2FUH B;  1KLV A;  4MGZ E;  1UZX B;  3ZRF A;  4FBJ B;  4GMV A;  2D3G A;  1R4N I;  3RYT A;  4BKG A;  4IG7 B;  3VHT C;  4OVV A;  3QHT A;  4B95 A;  2WWZ A;  4ZRI A;  1TGZ B;  2ZJD A;  3V61 A;  1NI2 A;  1RLF A;  5LLI A;  4BOS C;  3EEC A;  1L2N A;  2IY1 B;  2K39 A;  2MP2 A;  3R7R A;  4MEL A;  3CSF A;  2KJ6 A;  2FIF A;  3QCA A;  4ZDV A;  1WGR A;  3JSV B;  3PGE A;  5KHQ A;  2D2Q A;  4FJZ A;  3PS6 A;  2DX5 B;  1ZGU B;  4DHJ B;  2L7R A;  2YVC A;  4FUL A;  2RPQ A;  4E3C A;  4GSW A;  2J0J A;  2IO1 B;  2N4F A;  4LDT B;  2DHZ A;  2MWS B;  2D11 A;  1KM7 A;  2KTR A;  4TQ1 A;  3A33 B;  4FLH A;  1S1Q B;  3H7P A;  1WGD A;  3T8M A;  2ZEQ A;  4EEW A;  2NBW B;  4WJO A;  2LGX A;  1UEL A;  2NCN A;  2BGF A;  3L08 A;  3PVL A;  3IG3 A;  3VUX A;  2VRR B;  4KZ0 A;  1RFA A;  2EKE C;  2KKC A;  3JVZ X;  4WWN A;  4ANV A;  1WF9 A;  5DCN A;  4HPL B;  2K1F A;  3L54 A;  4XZ4 A;  4GB9 A;  1RAX A;  3B0A A;  3WAP A;  2YLM A;  2WX0 A;  4KDL B;  1WX8 A;  5AZF A;  2K8H A;  1V6E A;  3R7Q A;  4IC7 B;  2C5L C;  2KC2 A;  3AI5 A;  2LXC A;  4ANU A;  4F1S A;  4GGQ A;  4FHK A;  3PRM B;  3ZNZ B;  1OTR B;  2JRI B;  4HDO A;  3K9O B;  1WX9 A;  2L8J A;  4DDG D;  2D07 B;  4NY0 A;  2DYB A;  3RD2 A;  3ALB A;  3ZNI D;  3IVF A;  4MEM A;  3SU8 X;  4G3X B;  3KUD B;  2DZI A;  5JZE B;  1LFD A;  1UGM A;  2BKR B;  3PHW B;  2ZNV C;  1Y8R C;  2IY0 B;  3DVN V;  4KV2 A;  5AZH A;  2XK5 B;  5DPS A;  2KHW B;  4K81 A;  4KZC A;  4CHK A;  3RUI B;  1BT0 A;  2C60 A;  1YQB A;  3ZVV A;  3DCG A;  4DBG A;  4WWO A;  4B9K A;  3DBS A;  4LDT D;  2IZV B;  3UQB A;  2ZNV B;  3VQI A;  2EMS A;  4DK5 A;  2KLG A;  4RMA A;  2O2V A;  2D10 A;  2V4L A;  4KDI C;  2BYE A;  3AU4 A;  2KWU B;  1MG8 A;  2LGY A;  4GDK A;  2C7N B;  4DXA B;  4W9G A;  1UD7 A;  1JRU A;  1WXS A;  1EUV B;  2PE9 A;  5DPT A;  1V2Y A;  2KTF A;  4WJP A;  2LD9 A;  3BIN A;  1H4R A;  4WJN A;  1ZKH A;  2PEA A;  3ENE A;  5AEK B;  2C9W B;  3UIO B;  2KMA A;  5L83 A;  4JL9 A;  4XX5 A;  4I6L B;  3ZNG C;  4MGK E;  4F7Z A;  2LJ5 A;  3DBR I;  1WE7 A;  2ZCB A;  2PPH A;  2JVC A;  3PPA A;  3GOE A;  2MBB B;  2JXX A;  2ASQ A;  2MSE D;  3OLM D;  2WYQ A;  3VTU A;  1QZE A;  1VD2 A;  4MGI E;  4GDL B;  3JSV A;  3ML9 A;  3L17 A;  2M0X A;  3M95 A;  2MP2 B;  3QWZ B;  2KX3 A;  4K7S A;  2KXJ A;  3QA8 A;  4NQK E;  1WZ0 A;  4PS3 A;  4AOF A;  4BBN C;  4WQO B;  4MJS B;  2MQJ A;  4W9K A;  3ZRC A;  2FAZ A;  3WAO A;  3OJ3 A;  1L7Y A;  2CS4 A;  4MJS A;  5D2M B;  5L95 C;  2J7Q B;  2JY6 A;  5IAA C;  5BO4 B;  1ZW7 A;  3T9L A;  4BKS A;  4IM0 A;  1SGH A;  2HE7 A;  5LXI B;  4X57 B;  2NBV B;  3ZTD A;  2XBB C;  3N3K B;  4GDL A;  3H9D A;  5D7G A;  5G55 A;  3I3T B;  3A4R A;  3DVG X;  1G6J A;  2O6V D;  5D6J B;  3CST A;  5CHW A;  1WMH A;  3VVW B;  3EFU A;  2A4Z A;  1A5R A;  2AEH A;  4NJ7 A;  4I6P A;  4GU2 A;  1VCB A;  4II2 B;  2KFK B;  4NNJ B;  1GNU A;  1KJT A;  3HM6 X;  3KYC D;  5JHA A;  5IA7 A;  3N32 A;  1TBE A;  3L10 B;  4ICV A;  1V5O A;  1WRD B;  1GC6 A;  4W9L A;  4ZYN A;  2L00 B;  3SD5 A;  2V1Y A;  3LDZ E;  4HJK A;  2M4N A;  1Z5S B;  1LM8 B;  2FCN A;  2BYV E;  2MBE A;  2IYD B;  1Q5W B;  4HCP B;  3PV1 A;  2GMI C;  3ZUN A;  4NAW B;  1OEY J;  3OAW A;  4BBN F;  1WM2 A;  4A3O A;  2Z0D B;  4RM8 A;  4IWP A;  1WJ6 A;  2NVU I;  2BPS A;  2W9N A;  2ZZP B;  2DAJ A;  4AWJ A;  3MJW A;  3PRP B;  3H6N A;  3RZW C;  4ASW C;  3MHS D;  3PRZ A;  2HJ8 A;  5J18 A;  1J19 A;  2IO0 B;  3PLU A;  3TMP B;  5E6N A;  3V6C B;  1WXA A;  4IM3 A;  2KJH B;  5E6O A;  2JT4 B;  1SIF A;  1V9J A;  4MSM B;  3M62 B;  3N30 A;  3V62 A;  4ICU A;  1H8C A;  1UBQ A;  2I1K A;  3VAW A;  1EF1 A;  2LUE A;  4PYU A;  5LXH A;  3X23 A;  4EOY A;  4EFO A;  1E8Z A;  2FCM A;  2L05 A;  2OJR A;  4GOC A;  2KMC A;  3UF8 A;  4ANW A;  4DDI D;  3QJZ A;  4KIK A;  4URK A;  2KDI A;  2ZVN A;  3L0W B;  4HDQ A;  3UQA A;  2AWT A;  3NZS A;  2PJH A;  2C7H A;  4I6N B;  2HTH A;  4BOZ B;  1UBI A;  2R2Q A;  3M63 B;  4W9J A;  5D94 A;  1SE9 A;  2KWC A;  5E6P A;  3TCA A;  3ZNH B;  3D32 A;  3ZKJ C;  4AJW A;  4AJY B;  4IM2 A;  1ISN A;  3CMM B;  1E5W A;  3NZU A;  4TQ0 A;  2BF8 B;  3DVN U;  2MRP A;  2N9E B;  2NPT B;  3SDL C;  3KH0 A;  4M8M A;  2KAN A;  1XD3 B;  3K9P B;  2L3Z A;  3EC8 A;  5KHO A;  1WH3 A;  1WI0 A;  1WXV A;  4FJY A;  4JGH B;  1WGY A;  2GBM A;  2GBK A;  1YX6 B;  2AL6 A;  2IBI B;  2Z0E B;  2LRU A;  2ZPY A;  1K8R B;  2DYM A;  2JRH A;  3PZD A;  2GBJ A;  4M0W B;  2ZCC A;  2MCN B;  1WR6 E;  4JQW C;  4IWO A;  1P3Q U;  2LGD A;  4WWP A;  2WX1 A;  4HWI B;  1LQB A;  1WR1 A;  2CU1 A;  3QK0 A;  3QQ8 B;  3TL5 A;  4BKS D;  4DHZ B;  1FXT B;  2G4D B;  2KN5 A;  3HHM A;  4W9C A;  1KOT A;  5DPR A;  3WAN A;  2KVR A;  5JH5 C;  2JF5 A;  4G0N B;  3TIX A;  1E7U A;  2RSU A;  2L76 A;  3VH3 B;  4KSL C;  2WDT B;  3JW0 X;  4EZJ A;  3DOW A;  1WJ4 A;  3DBH I;  2LWP A;  3ZIM A;  4G50 A;  2BKF A;  2BWE S;  1WE6 A;  1E7V A;  2KOX A;  3KUC B;  2ZVO A;  2EMT A;  3VXW A;  1IYF A;  3H1U A;  3BY4 B;  2L0T A;  4II3 B;  2UWQ A;  1V81 A;  2CHW A;  1I42 A;  4OVU A;  4N9F 4;  4NJ6 A;  2O6V B;  3ONS A;  1M94 A;  1WM3 A;  2LVQ A;  1NDD A;  2KK8 A;  4G11 A;  4WAA A;  3B1L X;  4MDK E;  4LJO B;  4PS7 A;  4B6W A;  3Q3F A;  3WAL A;  2MBQ A;  1V80 A;  2V3S A;  4GIV A;  3TJP A;  3ZO5 B;  1WJN A;  1X1M A;  2N7E A;  5J17 A;  2RGF A;  2KO3 A;  4HCN B;  2QHO A;  1GJZ A;  2RR9 A;  2NPT A;  3DBL I;  3W1Y A;  5JHB A;  3NOB A;  4HLE A;  4NQL B;  4E74 A;  1WY8 A;  2KLC A;  3QAQ A;  3PTF C;  4GXB A;  2G3Q B;  2MBH A;  3NS8 A;  4WJQ A;  3ZLZ A;  4W9E A;  3HK0 A;  3OJ4 B;  2N9X A;  4MM3 A;  5AZG A;  2M17 A;  1V86 A;  2CKH B;  2IO3 B;  2O2V B;  2MA9 B;  4ZRK A;  1WGG A;  3U7D A;  3UIN B;  2JZZ A;  2K8B A;  3B08 A;  3IFW B;  4P7I A;  2G4S A;  3S2A A;  3PHX B;  1YX5 B;  3A4S C;  3EHV A;  5CTR C;  3WIM A;  4NPN A;  2K6Q A;  2DYO A;  1WX7 A;  2BYF A;  1EO6 A;  2B3A A;  4TUU A;  5CHF A;  1Z2M A;  2IO2 B;  4KSK C;  3VTW A;  4K1R B;  4EKU A;  1P1A A;  1WFY A;  1R4M I;  2KZR A;  4JLC A;  3Q3J A;  1V49 A;  1P9D U;  2KX0 A;  3VTV A;  3L16 A;  2KD0 A;  3AUL A;  4DWF A;  4KVG B;  2LRW A;  1HE8 A;  1EF5 A;  1YJ1 A;  3SHQ A;  3DVG Y;  3RZF A;  3VDZ A;  2MX2 A;  3VH4 B;  1YIW A;  2N1V A;  2R2O A;  2KDE B;  3ZDM C;  4JIO U;  2K25 A;  1WYW B;  1XT9 B;  5EDS A;  4NAW A;  3ZDT A;  1V5T A;  1WZ3 A;  3L13 A;  1GC7 A;  4LCD E;  3RT3 B;  4ZRJ A;  2G45 B;  4RM9 A;  1YD8 U;  3IBE A;  5CHV C;  3H7S A;  3NY5 A;  2KWV B;  4M8N A;  2N7D A;  2LI5 A;  2LAS A;  1UH6 A;  2L0F A;  2KQ7 A;  4E71 A;  2FNJ B;  4CO7 A;  4FN2 A; 
#chains in the Genus database with same CATH topology
 3P4Q B;  3HVZ A;  4HPM B;  1P0R A;  4M01 A;  4Q2J A;  1R4N B;  2LUM A;  4AUQ C;  2X38 A;  2WQY B;  5C23 A;  4DHJ D;  3ZGZ A;  1WGH A;  3N20 C;  2A5U A;  5FR6 A;  2LXA A;  1GUA B;  1LXD A;  2MW5 A;  2WXR A;  3Q8E A;  5IP4 D;  2NR2 A;  2KNB A;  3ZYY X;  4O1N A;  3A1Q B;  3PRE A;  5JXV A;  2V9H A;  1AAR A;  1C1Y B;  2C7M B;  2ZPN A;  2JPH A;  4IUM B;  1ET9 A;  1T0S C;  5G2N A;  2LHE A;  2Y3A A;  3ECI A;  4D2K A;  2QEJ C;  5CX3 A;  3A9J A;  3JYU A;  3W1S C;  2WU2 B;  3Q69 A;  4KIK B;  1TTN A;  2K3U A;  1GAQ B;  1VLB A;  1TS4 A;  2LVO A;  5TSS A;  2KDM A;  1HEZ E;  2XEW A;  4GDK B;  4CYE A;  1WJU A;  1QQR A;  2V0G A;  4HPP A;  3R66 C;  4LJP B;  1L4Z B;  1JWM D;  3Q8B A;  1AN8 A;  1TIF A;  5G5H A;  2K6D B;  5HKH A;  1E90 A;  2J0M A;  3IT4 B;  2QIL A;  1PFD A;  2CHX A;  2KDB A;  4GN1 A;  3CIR B;  1VJK A;  4C7Z A;  4ARC A;  4A3P A;  1F2R I;  1V1O A;  2NTS A;  3DPD A;  1PQS A;  4WH4 A;  2BWF A;  1FXI A;  2KC1 A;  4DXF A;  1XCT L;  2CHZ A;  2GBR A;  2LVP A;  4K3C A;  2DZM A;  5TR5 A;  3N1X C;  3VR9 B;  3VRA B;  2KQS A;  2M56 B;  1E8Y A;  3AB5 A;  1HZ6 A;  4EUT A;  2WXG A;  3LXF A;  2SAK A;  4MH8 A;  1I35 A;  3KYD D;  3C0R B;  1ENF A;  1SIJ A;  4MGZ E;  1NI2 A;  2HJ1 A;  3EEC A;  4RGO S;  3R7R A;  4MEL A;  2KJ6 A;  3QCA A;  5KHQ A;  2D2Q A;  3E9S A;  4AQ7 A;  3I57 A;  4DHJ B;  3PO0 A;  4FUL A;  2RPQ A;  2QC8 A;  4LLG M;  2W3S A;  4LDT B;  3KWV A;  1MFW A;  2MWS B;  1YQ4 B;  3A33 B;  1S1Q B;  1K51 A;  3T8M A;  2ZEQ A;  4C4V A;  2PVO D;  3IAM 1;  2JU6 X;  2EKE C;  4WWN A;  4ANV A;  2Y5C A;  3L54 A;  4XZ4 A;  4GB9 A;  3AE3 B;  1WX8 A;  4IC7 B;  2C5L C;  2KC2 A;  3AI5 A;  3BVZ A;  1PGX A;  1TKE A;  2X8X X;  5H8Y E;  5D3I B;  4DDG D;  2D07 B;  2JQR B;  4NY0 A;  4ZHP A;  3ZNI D;  3SU8 X;  1JWB D;  1TJE A;  2DZI A;  1PUT A;  2B76 B;  4A55 A;  1T5X D;  4KV2 A;  2XK5 B;  5DPS A;  4K81 A;  4CHK A;  2BB6 A;  4XWT A;  1BT0 A;  1K53 A;  3EUB 2;  3DBS A;  1UNS A;  2ZNV B;  2O2V A;  3LYY A;  2D10 A;  2V3N A;  1F1H A;  4MM3 B;  4RH6 A;  4B0E A;  2C7N B;  2YEP B;  3RMK C;  1UD7 A;  1EUV B;  2KTF A;  3U2S C;  3BIN A;  3N1Z C;  2LGS A;  5AEK B;  2RDG A;  2C9W B;  5IOI A;  2KMA A;  3UIO B;  4JL9 A;  4XX5 A;  4I6L B;  3ZNG C;  3PZ7 A;  4ZOH C;  2LJ5 A;  2ZCB A;  3W2D A;  3L4P A;  2AQ3 B;  2ASQ A;  2JXX A;  4DXG A;  2MSE D;  2D3B A;  1ZXH A;  1VD2 A;  4MGI E;  5FKA C;  3JSV A;  2W82 A;  2M0X A;  3QWZ B;  2KX3 A;  2KXJ A;  4NQK E;  5AUI A;  4PS3 A;  1EWC A;  4MJS B;  2MQJ A;  4W9K A;  1EU4 A;  1ESF A;  1L7Y A;  3SEB A;  2INP E;  2N9K A;  4BKS A;  1QLB B;  4XE0 A;  4R3D A;  2XBB C;  1B9R A;  4HKQ A;  5G55 A;  1WSP A;  2LHD A;  2H88 B;  1I7H A;  1VCB A;  1SSN A;  1KJT A;  3L10 B;  1UWX A;  4ICV A;  4KX6 B;  2L00 B;  1YN3 A;  2V1Y A;  3MFG A;  1Z5S B;  2FCN A;  2MBE A;  1YJI A;  2IYD B;  4RCO A;  3FIL A;  2GMI C;  3P42 A;  1BML C;  4RM8 A;  4WAF A;  4QAY A;  1C9F A;  2NVU I;  1I4G A;  4C80 A;  3PRP B;  4ASW C;  1FRD A;  3TMP B;  5E6N A;  1DGJ A;  2UU7 A;  1FFU A;  5E6O A;  2JT4 B;  3N30 A;  3VAW A;  1EF1 A;  5BYS A;  4EOY A;  1D5Z C;  4EFO A;  1KLG D;  3AED B;  4GOC A;  4DDI D;  2N0S B;  3J9C A;  4URK A;  1QOA A;  5GXG B;  1CQV A;  2AWT A;  4BOZ B;  5BMH A;  1UBI A;  5E6P A;  2KWC A;  5I4D A;  4IM2 A;  4NAM A;  3EGR A;  3Q8A A;  2AQ2 B;  2BF8 B;  2QJL A;  3DVN U;  2NPT B;  3KH0 A;  3N1Y C;  3RPF C;  1XD3 B;  3K9P B;  1WI0 A;  4RGT A;  2GBK A;  3P4S B;  3PZD A;  4WWP A;  1DYQ A;  4HWI B;  1LQB A;  1WR1 A;  2CU1 A;  3NVW A;  4DHZ B;  2PLP A;  3WAN A;  1KTK A;  2JF5 A;  4G0N B;  2L1A A;  2BS3 B;  2PW9 A;  4ZRP A;  3Q3M C;  4G50 A;  1WE6 A;  3ZJU A;  3C19 A;  4IDI A;  2CHW A;  4XDD A;  4NJ6 A;  1E0Z A;  1QKZ A;  1WM3 A;  4WAA A;  4PS7 A;  3WAL A;  4GIV A;  3TJP A;  3KQ4 A;  1X1M A;  3U7Z A;  1RM6 C;  1GJZ A;  5JHB A;  3DBL I;  2WDV B;  4H2A A;  1JRO A;  4TSS A;  2MBH A;  4WJQ A;  3HK0 A;  4C56 C;  4MM3 A;  4RGM A;  1R7S A;  1T0R C;  4PK1 A;  2G4S A;  3A4S C;  5CTR C;  2FUG 1;  1DOY A;  1WX7 A;  1EO6 A;  2G1E A;  5CHF A;  1Z2M A;  2K9X A;  4KSK C;  3VTW A;  1JQ4 A;  4K1R B;  3HVD A;  1WFY A;  4JLC A;  2OJW A;  1V49 A;  3VTV A;  2KD0 A;  4US9 A;  1ZXI A;  4WWM A;  1MPE A;  1V1P A;  3DVG Y;  3RZF A;  1VZ8 A;  5FR3 A;  3VDZ A;  2N1V A;  1SF0 A;  2WXJ A;  3DHH C;  1XT9 B;  1WZ3 A;  4CQN A;  1KF6 B;  1N6Z A;  2E3T A;  5CHV C;  3NY5 A;  2KWV B;  3R2I A;  2LI5 A;  2LAS A;  1FD6 A;  2R61 A;  3OWE B;  4E71 A;  4MGY E;  1LGR A;  1D6E C;  1BUI C;  4TV3 A;  2INC C;  2DWQ A;  4FA6 A;  3APF A;  4EZK A;  4BVU C;  2WXP A;  2Y5B B;  1EWY C;  1RWS A;  1WIA A;  1S3S G;  4P1B C;  2Y5P A;  1U4A A;  1C79 A;  1YQ3 B;  1ZDV A;  2BBC A;  1FO4 A;  1EM7 A;  3U8Z A;  4XWW A;  4OHJ A;  1NBF C;  1ZP0 B;  1WWT A;  2N9P C;  1JWA D;  4YWG G;  2M1M A;  3ZTC A;  3RCZ A;  5HFY A;  4J3O D;  1FCL A;  2JXT A;  2AX5 A;  4HJG E;  3IHP C;  4W9H A;  3RUL A;  1GOZ A;  1TZ1 A;  3V60 A;  3VUY A;  1F52 A;  1VR9 A;  2LZ6 A;  2PE6 B;  5IKC M;  4TKN A;  2E6X A;  4K7W A;  2N7J A;  4BFR A;  2DZK A;  1XLQ A;  3BWU D;  1F9J A;  1I4Q A;  3AXC A;  3QAR A;  1T0Y A;  4KGR A;  4PS8 A;  2KDF B;  2J0K A;  3AE2 B;  5DPW A;  2GB1 A;  4HVB A;  1KFY B;  2VH1 A;  2MLB A;  4N6E B;  2DZJ A;  1KH0 A;  3BYT B;  1XCQ L;  1WYG A;  3LJ3 A;  3R2T A;  1MJD A;  3ZXR A;  2MJE A;  3BK1 A;  2K8C A;  3O65 B;  1KRH A;  1OEY A;  1N60 A;  4FJV B;  2HD5 B;  2WU5 B;  2PVG C;  2LMC A;  1YNT E;  1OQR A;  3P4R B;  3DQV A;  3A9K B;  3QC8 B;  3V3X A;  4DQO C;  4XC2 A;  3GZN I;  2KN4 A;  5EE1 A;  2NTT A;  5C3J B;  3BZD B;  3H7P B;  3A1Q A;  1J8C A;  3AU5 A;  2FCS A;  5T8I A;  1KLV A;  1UZX B;  3ZRF A;  2IND C;  2D3G A;  1R4N I;  3VHT C;  4OVV A;  4HRO A;  1TGZ B;  2ZJD A;  2K39 A;  2MP2 A;  3PZ8 A;  4NZL B;  2FIF A;  1C78 A;  2WDQ B;  3MP9 A;  2PMV A;  3PS6 A;  2DX5 B;  2D3C A;  1ZGU B;  3C8Y A;  2YVC A;  4E3C A;  3DBL B;  4GSW A;  2ON8 A;  2Q5W D;  1HXY D;  1TS2 A;  2D11 A;  2QIE B;  1AWD A;  1QOB A;  3H7P A;  1WGD A;  3Q14 C;  4EEW A;  4WJO A;  5IO9 A;  3GZN B;  3VUX A;  2VRR B;  2KKC A;  1WF9 A;  3RNF C;  1Q10 A;  2LGI A;  1XXG A;  3WAP A;  2YLM A;  2WX0 A;  5AZF A;  2K8H A;  1V6E A;  2QMT A;  4XDC A;  1XLP A;  2YEP F;  4ANU A;  1J7B A;  2IGH A;  2KMM A;  2RDH A;  3I5J C;  1K52 A;  2JRI B;  3K9O B;  1WX9 A;  3DBH B;  2DYB A;  3ALB A;  1JAL A;  3IVF A;  2BKR B;  5AZH A;  2ZNV C;  1Y8R C;  2IY0 B;  1EU3 A;  4KZC A;  4HEA 1;  2C60 A;  3ZVV A;  2PIA A;  3DCG A;  4JWS C;  4LDT D;  2IZV B;  4DK5 A;  2KLG A;  4RMA A;  2WNM A;  2V4L A;  4US8 A;  2KWU B;  1MG8 A;  1JRU A;  3TUO A;  2LD9 A;  4YTN B;  4KKI A;  1WE7 A;  2PPH A;  4NJC A;  3GOE A;  2MBB B;  3URY A;  1T0Q C;  3Q8C A;  4GDL B;  5HG2 A;  3L17 A;  3HUI A;  3M95 A;  3MHZ A;  2CJN A;  4K7S A;  1WZ0 A;  3KWL A;  3ZRC A;  2FAZ A;  2BT6 A;  3WAO A;  2BTE A;  5L95 C;  2J7Q B;  4WQM A;  1NEN B;  4IM0 A;  1C4C A;  5LXI B;  1J7C A;  2PKO A;  3AEE B;  3H9D A;  3I3T B;  2WS3 B;  3DVG X;  3VVW B;  1WMH A;  2J42 A;  3NUH B;  3AEF B;  4I6P A;  1FCC C;  4II2 B;  1HTO A;  2CU3 A;  5JHA A;  2MH7 A;  1V5O A;  1WRD B;  4M0W A;  3LDZ E;  2M4N A;  3PV1 A;  4NAW B;  1OEY J;  5C2T B;  4BBN F;  1WM2 A;  4A3O A;  3FAH A;  4IWP A;  1WJ6 A;  2JZP A;  2W9N A;  2ZZP B;  2DAJ A;  3MJW A;  5J18 A;  1TZO A;  3NS1 A;  3V6C B;  4IM3 A;  1XLO A;  2KJH B;  1SIF A;  1V9J A;  3M62 B;  1UBQ A;  1FFV A;  5LXH A;  3X23 A;  4B0M A;  2WXK A;  3UF8 A;  2OJR A;  1C76 A;  3NVY A;  5D3D A;  2QCZ A;  2JSV X;  3L0W B;  3UQA A;  2PJH A;  2C7H A;  4I6N B;  3ETR A;  2V4I B;  1SE9 A;  1N63 A;  3TCA A;  3ZKJ C;  2BVC A;  4AJW A;  4AJY B;  4KKJ A;  4GLS C;  2M19 A;  4TQ0 A;  2N9E B;  3RN9 C;  4M8M A;  1Y56 A;  2L3Z A;  3B9J A;  3EC8 A;  1N5X A;  1WXV A;  4LNK A;  5KHO A;  3TEW A;  2GBM A;  3GB1 A;  2Z0E B;  2ZPY A;  2ZCC A;  4IKG A;  2RMM A;  2MCN B;  2JYT A;  2LGD A;  2JYE A;  3QK0 A;  1JW9 D;  2AQ1 B;  4BKS D;  4W9C A;  2G4D B;  3AE5 B;  1XF5 L;  1KOT A;  4K3B A;  1L0Y B;  2KVR A;  4OZA A;  3TIX A;  3VH3 B;  3RNG C;  4IOI E;  4EZJ A;  3DBH I;  3ZIM A;  2KOX A;  2EMT A;  1L6U A;  3DHI C;  4RGN A;  3Q3N C;  3BY4 B;  2UWQ A;  4N9F 4;  2O6V B;  3ONS A;  3B2F A;  2LVQ A;  3I63 C;  4LJO B;  2WGS A;  4B6W A;  3Q3F A;  5G5G A;  1SEB D;  1FXA A;  4HCN B;  3BVM A;  4HLE A;  4NQL B;  1SE4 A;  1WY8 A;  2WXM A;  4WIP A;  1TY2 A;  1HA5 A;  1SE2 A;  2VZK D;  3AV8 A;  2CKH B;  3RFZ B;  3NVZ A;  2MA9 B;  3U7D A;  1WGG A;  2KWD A;  1WGK A;  3S2A A;  3PHX B;  3EHV A;  3B2G A;  2BYF A;  4TUU A;  1JWS D;  4WUR A;  3OG5 A;  1SE3 A;  4EKU A;  3T3O A;  1R4M I;  3EFC A;  4KVG B;  2QSD A;  2WXL A;  3ZDM C;  2W55 A;  5BMI A;  5EDS A;  4NAW A;  1V5T A;  3N9Y C;  2G45 B;  4JWU C;  3IBE A;  1L0X B;  1A70 A;  2KQ7 A;  3ABV B;  4LNI A;  1ACC A;  2FNJ B;  4USA A;  3NHE B;  2XN9 C;  4YSX B;  2WXO A;  4J6I A;  3WAM A;  5C1Z A;  3QIJ A;  3VFK A;  2M8S A;  3UI3 A;  3ZQ4 A;  1L5P A;  4FAD A;  3HM3 A;  1MVK A;  4EE2 A;  5GMV A;  1OGW A;  4BZA A;  4ZHO A;  4W9D A;  2VH2 A;  1JML A;  1AW7 A;  5J2R A;  2FID A;  1RYJ A;  1Q0W B;  3DDC B;  2I1J A;  1ZPS A;  3KUZ A;  2AL3 A;  4MSQ B;  3TBL D;  4N58 A;  2JZ3 B;  4ANX A;  4A20 A;  3GP7 A;  2FBW B;  2N9L A;  3KVF B;  2NS5 A;  3CF6 E;  4C7Y A;  4RNA A;  1K50 A;  3ML8 A;  2MEK A;  2JUO A;  3HRD D;  3APC A;  2RD0 A;  1R4M B;  2VZK B;  4OW0 A;  1P98 A;  2BQQ A;  3FC4 A;  3RNE C;  3MJ5 A;  4L2Y A;  1UF0 A;  5EE3 A;  2I38 A;  5HI1 A;  1GG3 A;  1Q1O A;  2KAJ A;  2KJR A;  3E56 A;  3TSS A;  2GOW A;  3M3J A;  2DEN B;  3Q2A C;  1YOV B;  5BYQ A;  2O6V A;  4XGA B;  1TS3 A;  1WRI A;  2LEK A;  2UYZ B;  1E8W A;  4MH0 E;  1F77 A;  1XQQ A;  1C3T A;  2ONQ A;  1JWU D;  2K22 A;  1BXT A;  3VR8 B;  1HQR D;  2KTR B;  4FBJ B;  4GMV A;  3RYT A;  4BKG A;  2G9H D;  4IG7 B;  1SJH D;  3QHT A;  3CWI A;  3TEY A;  1IGD A;  1RLF A;  4L1B A;  4BOS C;  1L2N A;  1NYR A;  1WGR A;  3PGE A;  4RF1 A;  4HKZ E;  2KT7 A;  2L7R A;  3AE6 B;  2IO1 B;  2CJO A;  1ZE3 D;  2DHZ A;  4JPS A;  1IBX A;  3NG0 A;  1KM7 A;  4TQ1 A;  4FLH A;  1VRA B;  2NBW B;  2WXH A;  2LGX A;  1UEL A;  2NCN A;  1FIQ A;  3IG3 A;  3NZ3 A;  3JVZ X;  2ZW1 A;  5DCN A;  4HPL B;  2K1F A;  5IN7 A;  4KGT A;  2J52 A;  2HDE A;  4KDL B;  3DHG C;  2LXC A;  1T3Q A;  4XYC A;  1N5W A;  4GGQ A;  4RF0 A;  1L4D B;  3PRM B;  4HDO A;  2L8J A;  1TS5 A;  4MEM A;  3KUD B;  5JZE B;  1YJJ A;  1UGM A;  3PHW B;  2EEL A;  2KHW B;  1YQB A;  4P6V F;  3AE8 B;  4WWO A;  1TKY A;  2BS2 B;  3VQI A;  2EMS A;  3NVV A;  4KDI C;  4DXA B;  3DWM A;  1WXS A;  2PE9 A;  5DPT A;  1V2Y A;  1PYW D;  1H4R A;  4WJN A;  1ZKH A;  2W3R A;  4P1C C;  1QOF A;  2JVC A;  4A90 A;  1TKG A;  2NMQ A;  3OLM D;  2J4X A;  3VTU A;  2ICI A;  3AEG B;  1MHH E;  3IT6 B;  5BMG A;  3H8H A;  2ZW0 A;  4AOF A;  4WQO B;  4ARI A;  5EE9 A;  4LTU A;  5AUK A;  2CS4 A;  2HTM E;  5IAA C;  4HRS A;  4OVZ A;  2HE7 A;  4X57 B;  2NBV B;  4YT0 B;  1TYG B;  4GDL A;  1I4R A;  4A9A A;  2O6V D;  5D6J B;  3CST A;  3EFU A;  2RDB C;  2PTL A;  4GU2 A;  2KFK B;  4NNJ B;  2KYW A;  1GNU A;  3HM6 X;  3N32 A;  1GC6 A;  4W9L A;  2KAC A;  4HJK A;  4HCP B;  3OAW A;  4MT5 A;  1C4A A;  1UUP A;  3H6N A;  1DOI A;  3PRZ A;  2HJ8 A;  3PLU A;  1TT5 B;  1FMA D;  1YN4 A;  4MSM B;  1H8C A;  2I1K A;  2LUE A;  4PYU A;  2L05 A;  2KMC A;  1I4H A;  3QJZ A;  2GI9 A;  1B1Z A;  2ZVN A;  4HDQ A;  3NZS A;  1OQQ A;  4C4V B;  3M63 B;  4W9J A;  2K0P A;  2BB5 A;  3D32 A;  1HTQ A;  5EE0 A;  1PGB A;  1IBX B;  1ISN A;  1E5W A;  3GE8 C;  3FKY A;  2MRP A;  1CJE A;  1PGA A;  1WGY A;  2DLB A;  2IBI B;  2LRU A;  2JRH A;  1TY0 A;  3U4E G;  4L23 A;  1QIL A;  4JQW C;  1F0Z A;  4IWO A;  1FNV A;  1E10 A;  2EKI A;  2KN5 A;  4S17 A;  3TEZ A;  2RSU A;  1CK1 A;  4KSL C;  1ZOY B;  1D5X C;  3DOW A;  1C77 A;  2WXF A;  2BWE S;  1I4P A;  1IYF A;  3H1U A;  2L0T A;  1F2R C;  1AYF A;  1M94 A;  3GS2 A;  3SFE B;  1NDD A;  4G11 A;  4MDK E;  3Q3O C;  2MBQ A;  2WXQ A;  1GPX A;  1WJN A;  4UDU C;  2KO3 A;  3RNA C;  2JWU A;  2NPT A;  3NOB A;  1FM0 D;  4FXC A;  2KLC A;  1OFF A;  3NS8 A;  3MC0 B;  2I2Y A;  2N9X A;  4YSY B;  2O2V B;  3AEA B;  1NEK B;  3IFW B;  1JRP A;  1YX5 B;  1D4B A;  4NPN A;  2TSS A;  2DYO A;  2K6Q A;  4P16 A;  2B3A A;  2ACZ B;  3EA6 A;  3WCQ A;  1DOX A;  3Q3J A;  2M0A A;  3SHQ A;  1YIW A;  2R2O A;  4JIO U;  3AE9 B;  1UGJ A;  1JCK B;  3ZXV A;  3ZDT A;  3LB8 C;  2IDY A;  1VZ7 A;  3L13 A;  1GC7 A;  4LCD E;  2IGD A;  4LK0 M;  4ZRJ A;  4RM9 A;  4M8N A;  2N7D A;  3P63 A;  2L52 A;  1UH6 A;  1MI0 A;  4CO7 A;  2GLS A;  2K5P A;  3ZW3 A;  2OOB B;  4JE3 B;  3DWG C;  4YL8 A;  3I9V 1;  2N1W A;  2FCQ A;  3W5U B;  2KFJ A;  3P2B A;  3V6E B;  4HXD A;  2D5G A;  1OQY A;  3KW5 B;  1SB3 C;  3PSE B;  2NBU A;  1HZ5 A;  4EZL A;  4KGS A;  1IPG A;  4W9I A;  4HK2 A;  3A9K A;  2BS4 B;  2GBN A;  1J0G A;  3MTN B;  3PLV A;  4A6Q A;  1KLU D;  2OHF A;  2JWZ A;  1ZUD 2;  4FHJ A;  4M02 A;  4F8C B;  4K7U A;  4BKT A;  3W1S A;  1E8X A;  2REX A;  4IW0 A;  4OZC A;  1WXM A;  2OED A;  4N59 A;  1D3Z A;  1NYQ A;  2H89 B;  3RI7 C;  1FNW A;  1FPY A;  2WHI A;  4M00 A;  4AS1 A;  4BAX A;  3ZJT A;  2XK5 A;  3AE7 B;  4W9F A;  4JX1 C;  1P7E A;  3PT2 B;  4DHZ E;  1RRB A;  3R3M A;  3QX1 A;  3O13 A;  4C00 A;  3X0W A;  1PDX A;  1IP9 A;  3UIP B;  2Z59 B;  4LNO A;  4YSZ B;  2KFK A;  4PYZ A;  4AP4 C;  1I4X A;  2J53 A;  1IGC A;  2AYO B;  2XNA C;  3A9J B;  3UGB B;  1MHX A;  1WMH B;  4ITK A;  4YTP B;  2DAF A;  3U30 A;  4IWQ A;  2CR5 A;  3AN1 A;  2MBO A;  4YTM B;  3APD A;  2SEB D;  3WA0 A;  2MHJ A;  1CMX B;  1XO3 A;  3VUW A;  3HIZ A;  2FUH B;  1SXT A;  5E6J A;  1QF6 A;  4B95 A;  2WWZ A;  4ZRI A;  3V61 A;  5LLI A;  2IY1 B;  3CSF A;  4ZDV A;  3JSV B;  5H92 C;  2JX5 A;  4FJZ A;  2LJI A;  2J0J A;  3AM9 A;  2N4F A;  3W5V B;  1XLN A;  1GB1 A;  2KTR A;  2L32 A;  5LNK 1;  1E9M A;  1VZ6 A;  3L08 A;  2BGF A;  3PVL A;  3BK2 A;  3AE1 B;  4KZ0 A;  1ET6 A;  1RFA A;  1L0V B;  1RAX A;  3W9C B;  3B0A A;  2MJ3 A;  2QDF A;  3R7Q A;  4F1S A;  1YMH E;  4FHK A;  1D5M C;  3ZNZ B;  1OTR B;  1M4V A;  2RPV A;  2WDR B;  3RD2 A;  4G3X B;  1LFD A;  1MG4 A;  3Q6B A;  2WLB A;  1QOG A;  3DVN V;  3RUI B;  4DBG A;  4B9K A;  3UQB A;  1GB4 A;  3BYY B;  2W54 A;  3BVG A;  2BYE A;  3AU4 A;  1C4P A;  2LGY A;  2WXN A;  1L6V A;  4GDK A;  4W9G A;  1SJE D;  3DBR B;  3NRZ A;  4WJP A;  2PEA A;  3ENE A;  3VRB B;  3U52 E;  5L83 A;  4F7Z A;  4MGK E;  3DBR I;  4LNF A;  3PPA A;  5MPO A;  2WYQ A;  1QZE A;  3ML9 A;  3Q8F A;  3MC8 A;  3AMZ A;  2MP2 B;  3QA8 A;  3GE3 C;  4BBN C;  2BYT A;  3R8B A;  1SBB B;  3IXS A;  3OJ3 A;  4MJS A;  5D2M B;  2JY6 A;  5BO4 B;  1ZW7 A;  3T9L A;  1SGH A;  3ZTD A;  3N3K B;  4OZB A;  5D7G A;  1IUE A;  3A4R A;  1G6J A;  1T6B X;  5CHW A;  3BII D;  2IPK D;  2A4Z A;  1A5R A;  2AEH A;  4NJ7 A;  3KYC D;  2V3P A;  4YXD B;  5IA7 A;  1TBE A;  4ZYN A;  3ZJV A;  3SD5 A;  1LM8 B;  2BYV E;  1Q5W B;  3ZUN A;  2IGG A;  2Z0D B;  2BPS A;  3TEX A;  3SFD B;  1E7P B;  1V1P B;  4AWJ A;  1P7F A;  3RZW C;  3MHS D;  1J19 A;  2IO0 B;  3T3N A;  2INN E;  1WXA A;  3MC9 A;  3V62 A;  4ICU A;  4ZYS A;  1E8Z A;  2FCM A;  4ANW A;  1N61 A;  4REZ A;  4KIK A;  4ZRQ A;  2KDI A;  4RFB A;  2HTH A;  2R2Q A;  3V05 A;  5D94 A;  3ZNH B;  1FEH A;  4LNN A;  3CMM B;  3NZU A;  1NVI D;  3SDL C;  1E6E B;  2KAN A;  3FIL B;  1WH3 A;  4JGH B;  3AEC B;  4FJY A;  1YX6 B;  2AL6 A;  1K8R B;  2DYM A;  2GBJ A;  3AE4 B;  4M0W B;  4ACF A;  1WR6 E;  1P3Q U;  2WX1 A;  1STE A;  2DBY A;  3QQ8 B;  3TL5 A;  1FXT B;  2BW2 A;  3HHM A;  2KVZ A;  3P4P B;  5DPR A;  5JH5 C;  4MAC A;  1E7U A;  2L76 A;  4TMA B;  2WDT B;  3JW0 X;  1CZP A;  1WJ4 A;  1ROE A;  2LWP A;  2BKF A;  3KUC B;  1E7V A;  2ZVO A;  3VXW A;  4II3 B;  1V81 A;  2Z8L A;  1I42 A;  4OVU A;  4A8X C;  2MJD A;  3AH7 A;  2L83 A;  2KK8 A;  1NI3 A;  3B1L X;  1V97 A;  3P1M A;  1V80 A;  2V3S A;  3ZO5 B;  2DNF A;  2N7E A;  1V8C A;  5J17 A;  2RGF A;  2IJ0 A;  3RNB C;  2QHO A;  2RR9 A;  3W1Y A;  5FK9 C;  4E74 A;  1RFK A;  4S0R A;  4PT5 A;  3QAQ A;  3PTF C;  4GXB A;  2G3Q B;  3ZLZ A;  4W9E A;  3OJ4 B;  3KLS X;  2LFI A;  1J7A A;  5AZG A;  1XEE A;  2M17 A;  1V86 A;  2IO3 B;  4ZRK A;  3IAS 1;  2JZZ A;  2K8B A;  3B08 A;  4P7I A;  3UIN B;  2WXI A;  1UWM A;  1ZDX A;  3WIM A;  1QT9 A;  2IO2 B;  1VDV A;  5HHD G;  1FNU A;  2FE8 A;  1P1A A;  3AEB B;  2KZR A;  3SR6 A;  1P9D U;  2KX0 A;  3L16 A;  3AUL A;  2GRI A;  4DWF A;  2LRW A;  1HE8 A;  3RNC C;  1EF5 A;  1YJ1 A;  2MX2 A;  3VH4 B;  3NJT A;  2KDE B;  1N62 A;  2K25 A;  1FRR A;  1WYW B;  1LO5 D;  3RT3 B;  1YN5 A;  2KQ4 X;  2D3A A;  5BYR A;  1WXQ A;  1YD8 U;  3H7S A;  2L0F A;  2WP9 B;  4FN2 A; 
#chains in the Genus database with same CATH homology
 3NHE B;  4MGY E;  4J6I A;  4HPM B;  1P0R A;  3WAM A;  4TV3 A;  5C1Z A;  3QIJ A;  3VFK A;  4FA6 A;  3APF A;  4EZK A;  4BVU C;  3ZW3 A;  2Y5B B;  2OOB B;  2M8S A;  4AUQ C;  1WIA A;  1S3S G;  4FAD A;  4YL8 A;  5C23 A;  4DHJ D;  2N1W A;  1U4A A;  1WGH A;  2FCQ A;  3HM3 A;  5GMV A;  3U8Z A;  2A5U A;  2KFJ A;  3P2B A;  5FR6 A;  3V6E B;  2LXA A;  1GUA B;  4HXD A;  1LXD A;  1NBF C;  1OGW A;  2MW5 A;  2N9P C;  1OQY A;  3KW5 B;  2NR2 A;  2KNB A;  4W9D A;  2M1M A;  3PSE B;  3ZTC A;  3RCZ A;  2NBU A;  3A1Q B;  5J2R A;  3PRE A;  2FID A;  1AAR A;  4EZL A;  3IHP C;  1IPG A;  1C1Y B;  4W9H A;  1Q0W B;  4HK2 A;  2C7M B;  4W9I A;  2ZPN A;  3RUL A;  2JPH A;  1TZ1 A;  4IUM B;  3V60 A;  3A9K A;  3VUY A;  3DDC B;  5G2N A;  2GBN A;  2I1J A;  1J0G A;  3MTN B;  3PLV A;  2LZ6 A;  2PE6 B;  3ECI A;  5CX3 A;  3A9J A;  3JYU A;  3W1S C;  3KUZ A;  2AL3 A;  4KIK B;  4TKN A;  4MSQ B;  1TTN A;  3TBL D;  2JWZ A;  4K7W A;  4FHJ A;  2JZ3 B;  4F8C B;  4K7U A;  4BFR A;  2DZK A;  4BKT A;  2LVO A;  3W1S A;  4A20 A;  4ANX A;  1E8X A;  3KVF B;  1F9J A;  2NS5 A;  3CF6 E;  2XEW A;  2REX A;  4GDK B;  3AXC A;  4CYE A;  1WJU A;  3ML8 A;  2JUO A;  3QAR A;  4IW0 A;  1T0Y A;  3APC A;  2RD0 A;  3R66 C;  4LJP B;  1WXM A;  4PS8 A;  1D3Z A;  2KDF B;  2K6D B;  2J0K A;  1P98 A;  5DPW A;  5HKH A;  1E90 A;  4HVB A;  2J0M A;  2XK5 A;  4W9F A;  2CHX A;  2MLB A;  2KDB A;  4GN1 A;  3PT2 B;  4DHZ E;  2DZJ A;  1RRB A;  3R3M A;  3QX1 A;  3LJ3 A;  1GG3 A;  1Q1O A;  2K8C A;  3O65 B;  3X0W A;  4A3P A;  1IP9 A;  1OEY A;  3DPD A;  1PQS A;  3UIP B;  2Z59 B;  2BWF A;  2KC1 A;  4FJV B;  2KJR A;  2HD5 B;  2GOW A;  3M3J A;  2CHZ A;  2GBR A;  2KFK A;  4PYZ A;  2DEN B;  2LVP A;  4AP4 C;  2DZM A;  2O6V A;  5TR5 A;  2AYO B;  3A9J B;  3UGB B;  1WMH B;  2KQS A;  2DAF A;  3U30 A;  4IWQ A;  2UYZ B;  1E8Y A;  3DQV A;  1E8W A;  2CR5 A;  3A9K B;  3QC8 B;  2MBO A;  4MH0 E;  4XC2 A;  3GZN I;  4EUT A;  3APD A;  1XQQ A;  3WA0 A;  1CMX B;  3VUW A;  1C3T A;  3H7P B;  1I35 A;  3HIZ A;  3KYD D;  3A1Q A;  1J8C A;  2KTR B;  3AU5 A;  2FCS A;  3C0R B;  2FUH B;  1KLV A;  4MGZ E;  1UZX B;  3ZRF A;  4FBJ B;  4GMV A;  2D3G A;  1R4N I;  3RYT A;  4BKG A;  4IG7 B;  3VHT C;  4OVV A;  3QHT A;  4B95 A;  2WWZ A;  4ZRI A;  1TGZ B;  2ZJD A;  3V61 A;  1NI2 A;  1RLF A;  5LLI A;  4BOS C;  3EEC A;  1L2N A;  2IY1 B;  2K39 A;  2MP2 A;  3R7R A;  4MEL A;  3CSF A;  2KJ6 A;  2FIF A;  3QCA A;  4ZDV A;  1WGR A;  3JSV B;  3PGE A;  5KHQ A;  2D2Q A;  4FJZ A;  3PS6 A;  2DX5 B;  1ZGU B;  4DHJ B;  2L7R A;  2YVC A;  4FUL A;  2RPQ A;  4E3C A;  4GSW A;  2J0J A;  2IO1 B;  2N4F A;  4LDT B;  2DHZ A;  2MWS B;  2D11 A;  1KM7 A;  2KTR A;  4TQ1 A;  3A33 B;  4FLH A;  1S1Q B;  3H7P A;  1WGD A;  3T8M A;  2ZEQ A;  4EEW A;  2NBW B;  4WJO A;  2LGX A;  1UEL A;  2NCN A;  2BGF A;  3L08 A;  3PVL A;  3IG3 A;  3VUX A;  2VRR B;  4KZ0 A;  1RFA A;  2EKE C;  2KKC A;  3JVZ X;  4WWN A;  4ANV A;  1WF9 A;  5DCN A;  4HPL B;  2K1F A;  3L54 A;  4XZ4 A;  4GB9 A;  1RAX A;  3B0A A;  3WAP A;  2YLM A;  2WX0 A;  4KDL B;  1WX8 A;  5AZF A;  2K8H A;  1V6E A;  3R7Q A;  4IC7 B;  2C5L C;  2KC2 A;  3AI5 A;  2LXC A;  4ANU A;  4F1S A;  4GGQ A;  4FHK A;  3PRM B;  3ZNZ B;  1OTR B;  2JRI B;  4HDO A;  3K9O B;  1WX9 A;  2L8J A;  4DDG D;  2D07 B;  4NY0 A;  2DYB A;  3RD2 A;  3ALB A;  3ZNI D;  3IVF A;  4MEM A;  3SU8 X;  4G3X B;  3KUD B;  2DZI A;  5JZE B;  1LFD A;  1UGM A;  2BKR B;  3PHW B;  2ZNV C;  1Y8R C;  2IY0 B;  3DVN V;  4KV2 A;  5AZH A;  2XK5 B;  5DPS A;  2KHW B;  4K81 A;  4KZC A;  4CHK A;  3RUI B;  1BT0 A;  2C60 A;  1YQB A;  3ZVV A;  3DCG A;  4DBG A;  4WWO A;  4B9K A;  3DBS A;  4LDT D;  2IZV B;  3UQB A;  2ZNV B;  3VQI A;  2EMS A;  4DK5 A;  2KLG A;  4RMA A;  2O2V A;  2D10 A;  2V4L A;  4KDI C;  2BYE A;  3AU4 A;  2KWU B;  1MG8 A;  2LGY A;  4GDK A;  2C7N B;  4DXA B;  4W9G A;  1UD7 A;  1JRU A;  1WXS A;  1EUV B;  2PE9 A;  5DPT A;  1V2Y A;  2KTF A;  4WJP A;  2LD9 A;  3BIN A;  1H4R A;  4WJN A;  1ZKH A;  2PEA A;  3ENE A;  5AEK B;  2C9W B;  3UIO B;  2KMA A;  5L83 A;  4JL9 A;  4XX5 A;  4I6L B;  3ZNG C;  4MGK E;  4F7Z A;  2LJ5 A;  3DBR I;  1WE7 A;  2ZCB A;  2PPH A;  2JVC A;  3PPA A;  3GOE A;  2MBB B;  2JXX A;  2ASQ A;  2MSE D;  3OLM D;  2WYQ A;  3VTU A;  1QZE A;  1VD2 A;  4MGI E;  4GDL B;  3JSV A;  3ML9 A;  3L17 A;  2M0X A;  3M95 A;  2MP2 B;  3QWZ B;  2KX3 A;  4K7S A;  2KXJ A;  3QA8 A;  4NQK E;  1WZ0 A;  4PS3 A;  4AOF A;  4BBN C;  4WQO B;  4MJS B;  2MQJ A;  4W9K A;  3ZRC A;  2FAZ A;  3WAO A;  3OJ3 A;  1L7Y A;  2CS4 A;  4MJS A;  5D2M B;  5L95 C;  2J7Q B;  2JY6 A;  5IAA C;  5BO4 B;  1ZW7 A;  3T9L A;  4BKS A;  4IM0 A;  1SGH A;  2HE7 A;  5LXI B;  4X57 B;  2NBV B;  3ZTD A;  2XBB C;  3N3K B;  4GDL A;  3H9D A;  5D7G A;  5G55 A;  3I3T B;  3A4R A;  3DVG X;  1G6J A;  2O6V D;  5D6J B;  3CST A;  5CHW A;  1WMH A;  3VVW B;  3EFU A;  2A4Z A;  1A5R A;  2AEH A;  4NJ7 A;  4I6P A;  4GU2 A;  1VCB A;  4II2 B;  2KFK B;  4NNJ B;  1GNU A;  1KJT A;  3HM6 X;  3KYC D;  5JHA A;  5IA7 A;  3N32 A;  1TBE A;  3L10 B;  4ICV A;  1V5O A;  1WRD B;  1GC6 A;  4W9L A;  4ZYN A;  2L00 B;  3SD5 A;  2V1Y A;  3LDZ E;  4HJK A;  2M4N A;  1Z5S B;  1LM8 B;  2FCN A;  2BYV E;  2MBE A;  2IYD B;  1Q5W B;  4HCP B;  3PV1 A;  2GMI C;  3ZUN A;  4NAW B;  1OEY J;  3OAW A;  4BBN F;  1WM2 A;  4A3O A;  2Z0D B;  4RM8 A;  4IWP A;  1WJ6 A;  2NVU I;  2BPS A;  2W9N A;  2ZZP B;  2DAJ A;  4AWJ A;  3MJW A;  3PRP B;  3H6N A;  3RZW C;  4ASW C;  3MHS D;  3PRZ A;  2HJ8 A;  5J18 A;  1J19 A;  2IO0 B;  3PLU A;  3TMP B;  5E6N A;  3V6C B;  1WXA A;  4IM3 A;  2KJH B;  5E6O A;  2JT4 B;  1SIF A;  1V9J A;  4MSM B;  3M62 B;  3N30 A;  3V62 A;  4ICU A;  1H8C A;  1UBQ A;  2I1K A;  3VAW A;  1EF1 A;  2LUE A;  4PYU A;  5LXH A;  3X23 A;  4EOY A;  4EFO A;  1E8Z A;  2FCM A;  2L05 A;  2OJR A;  4GOC A;  2KMC A;  3UF8 A;  4ANW A;  4DDI D;  3QJZ A;  4KIK A;  4URK A;  2KDI A;  2ZVN A;  3L0W B;  4HDQ A;  3UQA A;  2AWT A;  3NZS A;  2PJH A;  2C7H A;  4I6N B;  2HTH A;  4BOZ B;  1UBI A;  2R2Q A;  3M63 B;  4W9J A;  5D94 A;  1SE9 A;  2KWC A;  5E6P A;  3TCA A;  3ZNH B;  3D32 A;  3ZKJ C;  4AJW A;  4AJY B;  4IM2 A;  1ISN A;  3CMM B;  1E5W A;  3NZU A;  4TQ0 A;  2BF8 B;  3DVN U;  2MRP A;  2N9E B;  2NPT B;  3SDL C;  3KH0 A;  4M8M A;  2KAN A;  1XD3 B;  3K9P B;  2L3Z A;  3EC8 A;  5KHO A;  1WH3 A;  1WI0 A;  1WXV A;  4FJY A;  4JGH B;  1WGY A;  2GBM A;  2GBK A;  1YX6 B;  2AL6 A;  2IBI B;  2Z0E B;  2LRU A;  2ZPY A;  1K8R B;  2DYM A;  2JRH A;  3PZD A;  2GBJ A;  4M0W B;  2ZCC A;  2MCN B;  1WR6 E;  4JQW C;  4IWO A;  1P3Q U;  2LGD A;  4WWP A;  2WX1 A;  4HWI B;  1LQB A;  1WR1 A;  2CU1 A;  3QK0 A;  3QQ8 B;  3TL5 A;  4BKS D;  4DHZ B;  1FXT B;  2G4D B;  2KN5 A;  3HHM A;  4W9C A;  1KOT A;  5DPR A;  3WAN A;  2KVR A;  5JH5 C;  2JF5 A;  4G0N B;  3TIX A;  1E7U A;  2RSU A;  2L76 A;  3VH3 B;  4KSL C;  2WDT B;  3JW0 X;  4EZJ A;  3DOW A;  1WJ4 A;  3DBH I;  2LWP A;  3ZIM A;  4G50 A;  2BKF A;  2BWE S;  1WE6 A;  1E7V A;  2KOX A;  3KUC B;  2ZVO A;  2EMT A;  3VXW A;  1IYF A;  3H1U A;  3BY4 B;  2L0T A;  4II3 B;  2UWQ A;  1V81 A;  2CHW A;  1I42 A;  4OVU A;  4N9F 4;  4NJ6 A;  2O6V B;  3ONS A;  1M94 A;  1WM3 A;  2LVQ A;  1NDD A;  2KK8 A;  4G11 A;  4WAA A;  3B1L X;  4MDK E;  4LJO B;  4PS7 A;  4B6W A;  3Q3F A;  3WAL A;  2MBQ A;  1V80 A;  2V3S A;  4GIV A;  3TJP A;  3ZO5 B;  1WJN A;  1X1M A;  2N7E A;  5J17 A;  2RGF A;  2KO3 A;  4HCN B;  2QHO A;  1GJZ A;  2RR9 A;  2NPT A;  3DBL I;  3W1Y A;  5JHB A;  3NOB A;  4HLE A;  4NQL B;  4E74 A;  1WY8 A;  2KLC A;  3QAQ A;  3PTF C;  4GXB A;  2G3Q B;  2MBH A;  3NS8 A;  4WJQ A;  3ZLZ A;  4W9E A;  3HK0 A;  3OJ4 B;  2N9X A;  4MM3 A;  5AZG A;  2M17 A;  1V86 A;  2CKH B;  2IO3 B;  2O2V B;  2MA9 B;  4ZRK A;  1WGG A;  3U7D A;  3UIN B;  2JZZ A;  2K8B A;  3B08 A;  3IFW B;  4P7I A;  2G4S A;  3S2A A;  3PHX B;  1YX5 B;  3A4S C;  3EHV A;  5CTR C;  3WIM A;  4NPN A;  2K6Q A;  2DYO A;  1WX7 A;  2BYF A;  1EO6 A;  2B3A A;  4TUU A;  5CHF A;  1Z2M A;  2IO2 B;  4KSK C;  3VTW A;  4K1R B;  4EKU A;  1P1A A;  1WFY A;  1R4M I;  2KZR A;  4JLC A;  3Q3J A;  1V49 A;  1P9D U;  2KX0 A;  3VTV A;  3L16 A;  2KD0 A;  3AUL A;  4DWF A;  4KVG B;  2LRW A;  1HE8 A;  1EF5 A;  1YJ1 A;  3SHQ A;  3DVG Y;  3RZF A;  3VDZ A;  2MX2 A;  3VH4 B;  1YIW A;  2N1V A;  2R2O A;  2KDE B;  3ZDM C;  4JIO U;  2K25 A;  1WYW B;  1XT9 B;  5EDS A;  4NAW A;  3ZDT A;  1V5T A;  1WZ3 A;  3L13 A;  1GC7 A;  4LCD E;  3RT3 B;  4ZRJ A;  2G45 B;  4RM9 A;  1YD8 U;  3IBE A;  5CHV C;  3H7S A;  3NY5 A;  2KWV B;  4M8N A;  2N7D A;  2LI5 A;  2LAS A;  1UH6 A;  2L0F A;  2KQ7 A;  4E71 A;  2FNJ B;  4CO7 A;  4FN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...