2C5VB

Differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Differential Binding of Inhibitors to Active and Inactive Cdk2 Provides Insights for Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 98
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5vB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5vB02
3MY1B 5IDNB 3G33B 4BCQD 2PK2A 5HBJB 4CFUB 5I5ZB 1TFBA 4F7JB 3MI9B 4CRLB 1JSUB 5EFQB 5CYIB 4ELLA 4F6UB 4Y72B 4BCMB 1VYWB 2W99A 1O9KB 4IMYB 1OL1B 1QMZB 3MY5B 4EOOB 2UUEB 2WXVB 3BLHB 1H24B 3EIDB 3BLRB 2PHGA 2C6TB 5LQFB 4YOOA 3RGFB 4EOSB 2G9XB 1OL2B 4BCOB 4ELJA 2I40B 2BPMB 2EUFA 2F2CA 4EOKB 1AISB 3BLQB 3QHWB 1H27B 4CFWB 2C5OB 4EOLB 1G3NC 3O0GD 4BCPB 1VOLA 1H4LD 3QHRB 5HNBB 3TNIB 3LQ5B 1OIYB 3F5XB 4EOMB 4G6LB 4BCQB 4I3ZB 2JGZB 4II5B 4CXAB 1XO2A 5CEIB 1C9BA 1H28B 1E9HB 2C4GB 3DDQB 4ROEA 2V22B 1H26B 1H1PB 2IW9B 3DOGB 2WIHB 2PMIB 3K7AM 2UZDB 1GH6B 4F7LB 4EORB 1FVVB 1UNLD 4FX3B 1BU2A 5LMKB 1H25B 5L2WB 1UNGD 4F6SB 4EOPB 2C5XB 4BCKB 4EC8B 1F5QB 3TNWB 2W96A 4YOZA 4F7NB 1W98B 5HBEB 5FGKB 5HQ0B 4BCJB 2QDJA 2WIPB 4OGRB 4CFMB 1H1RB 4EOIB 1GUXB 1JOWA 1UNHD 2CCHB 4KRCB 1OIUB 2PK9B 4KRDB 3POMA 4BCGB 5IDPB 4ROCA 2WMAB 2B9RA 3TNHB 5IF1B 1H1SB 1OI9B 4CFVB 3EJ1B 3BHVB 1OKWB 4TTHA 2W2HA 1H1QB 3BHTB 4YC3B 1PKDB 5ACBA 2WFYB 4EONB 4RODA 1JSTB 1O9KA 4BCHB 4F6WB 5HVYB 1P5EB 2X1NB 2I53A 2CCIB 2IW8B 2C5NB 4OR5B 2BKZB 2UZEB 1N4MA 5BNJB 3BHUB 4F70B 4UN0A 3TN8B 2UZBB 4BCMD 4BCIB 3MIAB 2IW6B 4F7SB 2WHBB 4EC9B 2CJMB 1OGUB 1ZP2A 4CFNB 1OKVB 4EOQB 1URCB 4BCND 2W9FA 1GUXA 2R7GA 1VINA 1GY3B 3H4CA 4BCNB 1AD6A 3DDPB 3M03A 1FINB 4EOJB 1JKWA 2C5VB 5ICPB 2UZLB 2WPAB 3EOCB 2WEVB 2W9ZA 5HBHB 4NSTB 4CFXB 1D3UB 1KXUA 4YOSA 2IVXA 4CFUD 4BCFB 2WMBB
chains in the Genus database with same CATH superfamily
3MY1B 3G33B 5HBJB 1TFBA 3MI9B 1JSUB 5EFQB 4Y72B 4IMYB 3HB9A 1QMZB 3EIDB 2C6TB 4YOOA 2CZ1B 4BCOB 2I40B 4QSHA 4CFWB 3QYEA 4EOLB 3O0GD 4BCPB 4EOMB 3VYHB 4I3ZB 1C9BA 1TD6A 1H28B 2C4GB 4ROEA 2PMIB 2ZCFB 3HHTB 2D0QB 5LMKB 4EOPB 2C5XB 2W96A 3A8MB 4AKHA 4F7NB 2IN3A 4FM4B 1OIUB 4ZGEB 3X20B 4CFVB 5DQWA 2W2HA 2CZ0B 4YC3B 4EONB 4RODA 4OR5B 2BKZB 5BNJB 4F70B 2BS4A 3VKGA 4EC9B 1OGUB 4OB2B 4M6VA 3H4CA 3M03A 1FINB 3EOCB 3A8HB 3HO8A 3KHIA 3X26B 2WMBB 4BCQD 4F7JB 2AHJB 4EOOB 3BLHB 2BS2A 3BLRB 2EUFA 4EOKB 3QHWB 1H27B 2ZPBB 1ENWA 1VOLA 5HNBB 3A8OB 1QLBA 5IHYA 4G6LB 2DPPB 4BCQB 3GTMS 5CEIB 5DQVA 1E9HB 2QDYB 3DDQB 2V22B 1H26B 4AKGA 2IW9B 2WIHB 2CYZB 3K7AM 1GH6B 4F7LB 1UGRB 4BBSM 1BU2A 1H25B 1UNGD 4EC8B 1F5QB 3TNWB 2ZPEB 4NC6A 5HBEB 4BCJB 2QDJA 1JOWA 1UNHD 4HLQA 3POMA 4BCGB 4ROCA 4MIMA 3EJ1B 3BHVB 1PKDB 2WFYB 1O9KA 1UGSB 2DD4B 2CCIB 3QWLA 2DXBB 3QYBA 2IW6B 3TW7A 2WHBB 1ZP2A 4CFNB 1OKVB 2WJ9A 4BY1X 1GUXA 2R7GA 1V29B 3X25B 4BCNB 1AD6A 2QQ8A 1JKWA 4ZGDB 5ICPB 2UZLB 3WVDB 4CFXB 1D3UB 2QF7A 4AI6A 1KXUA 4BCFB 2CZ6B 5I5ZB 4CRLB 5CYIB 4ELLA 2ZPFB 4F6UB 1FKMA 1O9KB 1OL1B 3MY5B 2DMEA 2WXVB 4BY7X 2PHGA 3X28B 3QYHB 4HNVA 3A8GB 3RGFB 3NDQA 1IREB 2BPMB 3QZ5B 1AISB 2ZPGB 1H4LD 3QHRB 3VKHA 3F5XB 4JX6A 4II5B 4CXAB 2ZZDB 4BXXX 1H1PB 1FVVB 1UNLD 4FX3B 5L2WB 3WVEB 4F6SB 2PJQA 4YOZA 5EJCA 2KR6A 4CFMB 1H1RB 4EOIB 2CCHB 4KRCB 2PK9B 4KRDB 5IDPB 2WMAB 1H1SB 3TW6A 1OI9B 4JX4A 5ACBA 3QZ9B 3B57A 4BCHB 4F6WB 2CZ7B 2IW8B 1N4MA 4UN0A 2UZBB 4HNTA 4BCMD 3MIAB 4MFDA 4F7SB 3A8LB 2CJMB 1URCB 4BCND 2W9FA 3X24B 1AHJB 2C5VB 3HZJA 2WEVB 2W9ZA 2QFZA 5HBHB 3BG3A 1UGQB 5IDNB 2PK2A 4CFUB 2ZPHB 1UGPB 4BCMB 1VYWB 2W99A 2UUEB 1H24B 5LQFB 1E7PA 4EOSB 2G9XB 1OL2B 3HBLA 4ELJA 2F2CA 2DD5B 3BLQB 2C5OB 1G3NC 4BBRM 2ZPIB 3DJBA 3TNIB 3DTOA 3LQ5B 4AKIA 1OIYB 2JGZB 1XO2A 3DOGB 2UZDB 2QGSA 4EORB 3DL1A 4BCKB 4OB0B 1W98B 5FGKB 5HQ0B 3BG9A 2WIPB 4OGRB 2LW4A 1GUXB 3QXEB 2KMGA 3TNHB 2B9RA 5IF1B 4LOCA 2BS3A 4OB1B 1OKWB 4TTHA 2DXCB 1H1QB 3BHTB 2G77A 1JSTB 4HNUA 5HVYB 1P5EB 4ZGJB 2X1NB 2I53A 2C5NB 2UZEB 4OB3B 3PO3S 4Z6YA 3BHUB 3TN8B 4MFEA 4BCIB 4EOQB 3QYGB 4JX5A 1VINA 1GY3B 3DDPB 3VYGB 4EOJB 2WPAB 4HL4A 4NSTB 4YOSA 2IVXA 4CFUD 3BG5A
chains in the Genus database with same CATH topology
3MY1B 5IDNB 3G33B 4BCQD 2PK2A 5HBJB 4CFUB 5I5ZB 1TFBA 4F7JB 3MI9B 4CRLB 1JSUB 5EFQB 5CYIB 4ELLA 4F6UB 4Y72B 4BCMB 1VYWB 2W99A 1O9KB 4IMYB 1OL1B 1QMZB 3MY5B 4EOOB 2UUEB 2WXVB 3BLHB 1H24B 3EIDB 3BLRB 2PHGA 2C6TB 5LQFB 4YOOA 3RGFB 4EOSB 2G9XB 1OL2B 4BCOB 4ELJA 2I40B 2BPMB 2EUFA 2F2CA 4EOKB 1AISB 3BLQB 3QHWB 1H27B 4CFWB 2C5OB 4EOLB 1G3NC 3O0GD 4BCPB 1VOLA 1H4LD 3QHRB 5HNBB 3TNIB 3LQ5B 1OIYB 3F5XB 4EOMB 4G6LB 4BCQB 4I3ZB 2JGZB 4II5B 4CXAB 1XO2A 5CEIB 1C9BA 1H28B 1E9HB 2C4GB 3DDQB 4ROEA 2V22B 1H26B 1H1PB 2IW9B 3DOGB 2WIHB 2PMIB 3K7AM 2UZDB 1GH6B 4F7LB 4EORB 1FVVB 1UNLD 4FX3B 1BU2A 5LMKB 1H25B 5L2WB 1UNGD 4F6SB 4EOPB 2C5XB 4BCKB 4EC8B 1F5QB 3TNWB 2W96A 4YOZA 4F7NB 1W98B 5HBEB 5FGKB 5HQ0B 4BCJB 2QDJA 2WIPB 4OGRB 4CFMB 1H1RB 4EOIB 1GUXB 1JOWA 1UNHD 2CCHB 4KRCB 1OIUB 2PK9B 4KRDB 3POMA 4BCGB 5IDPB 4ROCA 2WMAB 2B9RA 3TNHB 5IF1B 1H1SB 1OI9B 4CFVB 3EJ1B 3BHVB 1OKWB 4TTHA 2W2HA 1H1QB 3BHTB 4YC3B 1PKDB 5ACBA 2WFYB 4EONB 4RODA 1JSTB 1O9KA 4BCHB 4F6WB 5HVYB 1P5EB 2X1NB 2I53A 2CCIB 2IW8B 2C5NB 4OR5B 2BKZB 2UZEB 1N4MA 5BNJB 3BHUB 4F70B 4UN0A 3TN8B 2UZBB 4BCMD 4BCIB 3MIAB 2IW6B 4F7SB 2WHBB 4EC9B 2CJMB 1OGUB 1ZP2A 4CFNB 1OKVB 4EOQB 1URCB 4BCND 2W9FA 1GUXA 2R7GA 1VINA 1GY3B 3H4CA 4BCNB 1AD6A 3DDPB 3M03A 1FINB 4EOJB 1JKWA 2C5VB 5ICPB 2UZLB 2WPAB 3EOCB 2WEVB 2W9ZA 5HBHB 4NSTB 4CFXB 1D3UB 1KXUA 4YOSA 2IVXA 4CFUD 4BCFB 2WMBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MY1 B;  5IDN B;  3G33 B;  4BCQ D;  2PK2 A;  5HBJ B;  4CFU B;  5I5Z B;  1TFB A;  4F7J B;  3MI9 B;  4CRL B;  1JSU B;  5EFQ B;  5CYI B;  4ELL A;  4F6U B;  4Y72 B;  4BCM B;  1VYW B;  2W99 A;  1O9K B;  4IMY B;  1OL1 B;  1QMZ B;  3MY5 B;  4EOO B;  2UUE B;  2WXV B;  3BLH B;  1H24 B;  3EID B;  3BLR B;  2PHG A;  2C6T B;  5LQF B;  4YOO A;  3RGF B;  4EOS B;  2G9X B;  1OL2 B;  4BCO B;  4ELJ A;  2I40 B;  2BPM B;  2EUF A;  2F2C A;  4EOK B;  1AIS B;  3BLQ B;  3QHW B;  1H27 B;  4CFW B;  2C5O B;  4EOL B;  1G3N C;  3O0G D;  4BCP B;  1VOL A;  1H4L D;  3QHR B;  5HNB B;  3TNI B;  3LQ5 B;  1OIY B;  3F5X B;  4EOM B;  4G6L B;  4BCQ B;  4I3Z B;  2JGZ B;  4II5 B;  4CXA B;  1XO2 A;  5CEI B;  1C9B A;  1H28 B;  1E9H B;  2C4G B;  3DDQ B;  4ROE A;  2V22 B;  1H26 B;  1H1P B;  2IW9 B;  3DOG B;  2WIH B;  2PMI B;  3K7A M;  2UZD B;  1GH6 B;  4F7L B;  4EOR B;  1FVV B;  1UNL D;  4FX3 B;  1BU2 A;  5LMK B;  1H25 B;  5L2W B;  1UNG D;  4F6S B;  4EOP B;  2C5X B;  4BCK B;  4EC8 B;  1F5Q B;  3TNW B;  2W96 A;  4YOZ A;  4F7N B;  1W98 B;  5HBE B;  5FGK B;  5HQ0 B;  4BCJ B;  2QDJ A;  2WIP B;  4OGR B;  4CFM B;  1H1R B;  4EOI B;  1GUX B;  1JOW A;  1UNH D;  2CCH B;  4KRC B;  1OIU B;  2PK9 B;  4KRD B;  3POM A;  4BCG B;  5IDP B;  4ROC A;  2WMA B;  2B9R A;  3TNH B;  5IF1 B;  1H1S B;  1OI9 B;  4CFV B;  3EJ1 B;  3BHV B;  1OKW B;  4TTH A;  2W2H A;  1H1Q B;  3BHT B;  4YC3 B;  1PKD B;  5ACB A;  2WFY B;  4EON B;  4ROD A;  1JST B;  1O9K A;  4BCH B;  4F6W B;  5HVY B;  1P5E B;  2X1N B;  2I53 A;  2CCI B;  2IW8 B;  2C5N B;  4OR5 B;  2BKZ B;  2UZE B;  1N4M A;  5BNJ B;  3BHU B;  4F70 B;  4UN0 A;  3TN8 B;  2UZB B;  4BCM D;  4BCI B;  3MIA B;  2IW6 B;  4F7S B;  2WHB B;  4EC9 B;  2CJM B;  1OGU B;  1ZP2 A;  4CFN B;  1OKV B;  4EOQ B;  1URC B;  4BCN D;  2W9F A;  1GUX A;  2R7G A;  1VIN A;  1GY3 B;  3H4C A;  4BCN B;  1AD6 A;  3DDP B;  3M03 A;  1FIN B;  4EOJ B;  1JKW A;  2C5V B;  5ICP B;  2UZL B;  2WPA B;  3EOC B;  2WEV B;  2W9Z A;  5HBH B;  4NST B;  4CFX B;  1D3U B;  1KXU A;  4YOS A;  2IVX A;  4CFU D;  4BCF B;  2WMB B; 
#chains in the Genus database with same CATH topology
 3MY1 B;  3G33 B;  5HBJ B;  1TFB A;  3MI9 B;  1JSU B;  5EFQ B;  4Y72 B;  4IMY B;  3HB9 A;  1QMZ B;  3EID B;  2C6T B;  4YOO A;  2CZ1 B;  4BCO B;  2I40 B;  4QSH A;  4CFW B;  3QYE A;  4EOL B;  3O0G D;  4BCP B;  4EOM B;  3VYH B;  4I3Z B;  1C9B A;  1TD6 A;  1H28 B;  2C4G B;  4ROE A;  2PMI B;  2ZCF B;  3HHT B;  2D0Q B;  5LMK B;  4EOP B;  2C5X B;  2W96 A;  3A8M B;  4AKH A;  4F7N B;  2IN3 A;  4FM4 B;  1OIU B;  4ZGE B;  3X20 B;  4CFV B;  5DQW A;  2W2H A;  2CZ0 B;  4YC3 B;  4EON B;  4ROD A;  4OR5 B;  2BKZ B;  5BNJ B;  4F70 B;  2BS4 A;  3VKG A;  4EC9 B;  1OGU B;  4OB2 B;  4M6V A;  3H4C A;  3M03 A;  1FIN B;  3EOC B;  3A8H B;  3HO8 A;  3KHI A;  3X26 B;  2WMB B;  4BCQ D;  4F7J B;  2AHJ B;  4EOO B;  3BLH B;  2BS2 A;  3BLR B;  2EUF A;  4EOK B;  3QHW B;  1H27 B;  2ZPB B;  1ENW A;  1VOL A;  5HNB B;  3A8O B;  1QLB A;  5IHY A;  4G6L B;  2DPP B;  4BCQ B;  3GTM S;  5CEI B;  5DQV A;  1E9H B;  2QDY B;  3DDQ B;  2V22 B;  1H26 B;  4AKG A;  2IW9 B;  2WIH B;  2CYZ B;  3K7A M;  1GH6 B;  4F7L B;  1UGR B;  4BBS M;  1BU2 A;  1H25 B;  1UNG D;  4EC8 B;  1F5Q B;  3TNW B;  2ZPE B;  4NC6 A;  5HBE B;  4BCJ B;  2QDJ A;  1JOW A;  1UNH D;  4HLQ A;  3POM A;  4BCG B;  4ROC A;  4MIM A;  3EJ1 B;  3BHV B;  1PKD B;  2WFY B;  1O9K A;  1UGS B;  2DD4 B;  2CCI B;  3QWL A;  2DXB B;  3QYB A;  2IW6 B;  3TW7 A;  2WHB B;  1ZP2 A;  4CFN B;  1OKV B;  2WJ9 A;  4BY1 X;  1GUX A;  2R7G A;  1V29 B;  3X25 B;  4BCN B;  1AD6 A;  2QQ8 A;  1JKW A;  4ZGD B;  5ICP B;  2UZL B;  3WVD B;  4CFX B;  1D3U B;  2QF7 A;  4AI6 A;  1KXU A;  4BCF B;  2CZ6 B;  5I5Z B;  4CRL B;  5CYI B;  4ELL A;  2ZPF B;  4F6U B;  1FKM A;  1O9K B;  1OL1 B;  3MY5 B;  2DME A;  2WXV B;  4BY7 X;  2PHG A;  3X28 B;  3QYH B;  4HNV A;  3A8G B;  3RGF B;  3NDQ A;  1IRE B;  2BPM B;  3QZ5 B;  1AIS B;  2ZPG B;  1H4L D;  3QHR B;  3VKH A;  3F5X B;  4JX6 A;  4II5 B;  4CXA B;  2ZZD B;  4BXX X;  1H1P B;  1FVV B;  1UNL D;  4FX3 B;  5L2W B;  3WVE B;  4F6S B;  2PJQ A;  4YOZ A;  5EJC A;  2KR6 A;  4CFM B;  1H1R B;  4EOI B;  2CCH B;  4KRC B;  2PK9 B;  4KRD B;  5IDP B;  2WMA B;  1H1S B;  3TW6 A;  1OI9 B;  4JX4 A;  5ACB A;  3QZ9 B;  3B57 A;  4BCH B;  4F6W B;  2CZ7 B;  2IW8 B;  1N4M A;  4UN0 A;  2UZB B;  4HNT A;  4BCM D;  3MIA B;  4MFD A;  4F7S B;  3A8L B;  2CJM B;  1URC B;  4BCN D;  2W9F A;  3X24 B;  1AHJ B;  2C5V B;  3HZJ A;  2WEV B;  2W9Z A;  2QFZ A;  5HBH B;  3BG3 A;  1UGQ B;  5IDN B;  2PK2 A;  4CFU B;  2ZPH B;  1UGP B;  4BCM B;  1VYW B;  2W99 A;  2UUE B;  1H24 B;  5LQF B;  1E7P A;  4EOS B;  2G9X B;  1OL2 B;  3HBL A;  4ELJ A;  2F2C A;  2DD5 B;  3BLQ B;  2C5O B;  1G3N C;  4BBR M;  2ZPI B;  3DJB A;  3TNI B;  3DTO A;  3LQ5 B;  4AKI A;  1OIY B;  2JGZ B;  1XO2 A;  3DOG B;  2UZD B;  2QGS A;  4EOR B;  3DL1 A;  4BCK B;  4OB0 B;  1W98 B;  5FGK B;  5HQ0 B;  3BG9 A;  2WIP B;  4OGR B;  2LW4 A;  1GUX B;  3QXE B;  2KMG A;  3TNH B;  2B9R A;  5IF1 B;  4LOC A;  2BS3 A;  4OB1 B;  1OKW B;  4TTH A;  2DXC B;  1H1Q B;  3BHT B;  2G77 A;  1JST B;  4HNU A;  5HVY B;  1P5E B;  4ZGJ B;  2X1N B;  2I53 A;  2C5N B;  2UZE B;  4OB3 B;  3PO3 S;  4Z6Y A;  3BHU B;  3TN8 B;  4MFE A;  4BCI B;  4EOQ B;  3QYG B;  4JX5 A;  1VIN A;  1GY3 B;  3DDP B;  3VYG B;  4EOJ B;  2WPA B;  4HL4 A;  4NST B;  4YOS A;  2IVX A;  4CFU D;  3BG5 A; 
#chains in the Genus database with same CATH homology
 3MY1 B;  5IDN B;  3G33 B;  4BCQ D;  2PK2 A;  5HBJ B;  4CFU B;  5I5Z B;  1TFB A;  4F7J B;  3MI9 B;  4CRL B;  1JSU B;  5EFQ B;  5CYI B;  4ELL A;  4F6U B;  4Y72 B;  4BCM B;  1VYW B;  2W99 A;  1O9K B;  4IMY B;  1OL1 B;  1QMZ B;  3MY5 B;  4EOO B;  2UUE B;  2WXV B;  3BLH B;  1H24 B;  3EID B;  3BLR B;  2PHG A;  2C6T B;  5LQF B;  4YOO A;  3RGF B;  4EOS B;  2G9X B;  1OL2 B;  4BCO B;  4ELJ A;  2I40 B;  2BPM B;  2EUF A;  2F2C A;  4EOK B;  1AIS B;  3BLQ B;  3QHW B;  1H27 B;  4CFW B;  2C5O B;  4EOL B;  1G3N C;  3O0G D;  4BCP B;  1VOL A;  1H4L D;  3QHR B;  5HNB B;  3TNI B;  3LQ5 B;  1OIY B;  3F5X B;  4EOM B;  4G6L B;  4BCQ B;  4I3Z B;  2JGZ B;  4II5 B;  4CXA B;  1XO2 A;  5CEI B;  1C9B A;  1H28 B;  1E9H B;  2C4G B;  3DDQ B;  4ROE A;  2V22 B;  1H26 B;  1H1P B;  2IW9 B;  3DOG B;  2WIH B;  2PMI B;  3K7A M;  2UZD B;  1GH6 B;  4F7L B;  4EOR B;  1FVV B;  1UNL D;  4FX3 B;  1BU2 A;  5LMK B;  1H25 B;  5L2W B;  1UNG D;  4F6S B;  4EOP B;  2C5X B;  4BCK B;  4EC8 B;  1F5Q B;  3TNW B;  2W96 A;  4YOZ A;  4F7N B;  1W98 B;  5HBE B;  5FGK B;  5HQ0 B;  4BCJ B;  2QDJ A;  2WIP B;  4OGR B;  4CFM B;  1H1R B;  4EOI B;  1GUX B;  1JOW A;  1UNH D;  2CCH B;  4KRC B;  1OIU B;  2PK9 B;  4KRD B;  3POM A;  4BCG B;  5IDP B;  4ROC A;  2WMA B;  2B9R A;  3TNH B;  5IF1 B;  1H1S B;  1OI9 B;  4CFV B;  3EJ1 B;  3BHV B;  1OKW B;  4TTH A;  2W2H A;  1H1Q B;  3BHT B;  4YC3 B;  1PKD B;  5ACB A;  2WFY B;  4EON B;  4ROD A;  1JST B;  1O9K A;  4BCH B;  4F6W B;  5HVY B;  1P5E B;  2X1N B;  2I53 A;  2CCI B;  2IW8 B;  2C5N B;  4OR5 B;  2BKZ B;  2UZE B;  1N4M A;  5BNJ B;  3BHU B;  4F70 B;  4UN0 A;  3TN8 B;  2UZB B;  4BCM D;  4BCI B;  3MIA B;  2IW6 B;  4F7S B;  2WHB B;  4EC9 B;  2CJM B;  1OGU B;  1ZP2 A;  4CFN B;  1OKV B;  4EOQ B;  1URC B;  4BCN D;  2W9F A;  1GUX A;  2R7G A;  1VIN A;  1GY3 B;  3H4C A;  4BCN B;  1AD6 A;  3DDP B;  3M03 A;  1FIN B;  4EOJ B;  1JKW A;  2C5V B;  5ICP B;  2UZL B;  2WPA B;  3EOC B;  2WEV B;  2W9Z A;  5HBH B;  4NST B;  4CFX B;  1D3U B;  1KXU A;  4YOS A;  2IVX A;  4CFU D;  4BCF B;  2WMB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...