2C5XB

Differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Differential Binding of Inhibitors to Active and Inactive Cdk2 Provides Insights for Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 86
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5xB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5xB02
4EONB 1C9BA 2WPAB 5CYIB 1OKVB 2WMBB 1TFBA 4BCOB 2I40B 2WIHB 2IVXA 3EIDB 5LMKB 4CFUD 1GY3B 2W96A 1UNLD 1O9KA 2WXVB 5ACBA 4EORB 4BCQB 4F7SB 2X1NB 5HBEB 3M03A 4G6LB 2WMAB 1UNHD 1VYWB 1H4LD 3BLRB 4YOOA 5HBHB 3H4CA 1FVVB 4BCGB 2UZEB 1H1SB 2IW8B 4CFWB 4ELLA 2WIPB 2W9FA 4CFUB 4I3ZB 1H1QB 1XO2A 3POMA 4EOQB 4CFNB 2UZLB 4BCFB 2C5XB 4EOJB 3BLHB 1JKWA 4CXAB 2W2HA 1N4MA 1OIYB 4EOOB 1F5QB 3MY1B 4YOSA 4ROCA 5LQFB 2UZDB 2V22B 2C4GB 2PK9B 3MI9B 2I53A 4BCND 4CFXB 2WHBB 3LQ5B 5I5ZB 3O0GD 1OKWB 4EOSB 2CCHB 1GUXB 1PKDB 2PK2A 2BPMB 2UZBB 4F6WB 4EOIB 3K7AM 4EOKB 1W98B 2PMIB 4BCHB 3DDPB 3TNHB 3QHWB 4BCNB 1G3NC 1JSTB 4ELJA 1JSUB 2CCIB 4BCPB 1ZP2A 3BHTB 1E9HB 1AISB 3TNIB 1OGUB 2WEVB 1GH6B 2JGZB 3QHRB 1H1PB 4KRDB 2F2CA 4CRLB 3DOGB 5HVYB 4IMYB 4NSTB 1QMZB 3EJ1B 5HBJB 3TN8B 2QDJA 2B9RA 4F7LB 3MY5B 2C5OB 5EFQB 4EOMB 1H27B 3EOCB 3RGFB 4F7JB 1H26B 1VOLA 1BU2A 3BLQB 4FX3B 4Y72B 1URCB 2EUFA 4F7NB 4F6SB 4F6UB 1AD6A 2R7GA 2PHGA 2IW9B 3F5XB 2W99A 2UUEB 1UNGD 2CJMB 1JOWA 3MIAB 3TNWB 4UN0A 5L2WB 4KRCB 1P5EB 5FGKB 4BCMD 4CFMB 4EOLB 4ROEA 1H1RB 1OIUB 5CEIB 1GUXA 1OI9B 3BHUB 2C5NB 5HQ0B 3G33B 1H28B 4TTHA 2IW6B 2G9XB 5ICPB 4RODA 4BCKB 4EOPB 2C5VB 4YOZA 4OGRB 5BNJB 2BKZB 4YC3B 1KXUA 1VINA 5IDPB 4II5B 4F70B 5IF1B 4BCMB 2C6TB 1H25B 3DDQB 4EC8B 1FINB 2W9ZA 1O9KB 4OR5B 1D3UB 2WFYB 1H24B 3BHVB 4BCJB 4CFVB 5HNBB 1OL1B 4BCQD 1OL2B 4BCIB 4EC9B 5IDNB
chains in the Genus database with same CATH superfamily
2WIHB 5LMKB 3X26B 1O9KA 2BS4A 3M03A 3X28B 1H4LD 2UZEB 3QYGB 2AHJB 4CFUB 4BY7X 1XO2A 5DQVA 4EOQB 4CFNB 2C5XB 3A8GB 2DD4B 1JKWA 3BLHB 4HNUA 2QQ8A 3X25B 4HNTA 1OIYB 3TW7A 3MY1B 5LQFB 2UZDB 2V22B 2C4GB 2ZZDB 3VYHB 2I53A 4BCND 4CFXB 1E7PA 1UGRB 3GTMS 4BCPB 3QWLA 1E9HB 2QFZA 1H1PB 2DXBB 4KRDB 4IMYB 4NSTB 2ZPIB 3TN8B 4F7LB 2B9RA 3VKHA 1H27B 5IHYA 2QF7A 4Y72B 2IW9B 3F5XB 2W99A 2CJMB 3MIAB 4AKGA 4UN0A 1P5EB 2DXCB 1OI9B 2G9XB 4OB2B 5ICPB 3QXEB 3B57A 2ZPGB 4YC3B 5IDPB 4II5B 3A8HB 3BG5A 3DDQB 4EC8B 1D3UB 1O9KB 2KR6A 3BHVB 4BCJB 4CFVB 4EC9B 4F6SB 5IDNB 3X24B 2WPAB 5CYIB 4BCOB 2IVXA 2WXVB 2W96A 4EORB 3BG3A 4BY1X 2KMGA 3A8MB 1VYWB 3BLRB 1FVVB 4BCGB 3QYHB 4HL4A 2WIPB 2W9FA 4I3ZB 2UZLB 2ZPBB 3WVDB 1N4MA 3KHIA 3MI9B 2WHBB 3LQ5B 2CZ6B 1OKWB 4MFEA 4AKIA 2UZBB 4F6WB 2PMIB 3DDPB 3TNHB 4BCNB 1JSTB 3QZ5B 4ELJA 1AISB 2ZPHB 3DL1A 1FKMA 1OGUB 4OB1B 2JGZB 3QHRB 2F2CA 4CRLB 4MIMA 2QDJA 3MY5B 2C5OB 5EFQB 4HLQA 3EOCB 3RGFB 4F7JB 2ZPEB 1H26B 1VOLA 3HBLA 2R7GA 1JOWA 4ZGDB 4KRCB 3HB9A 3WVEB 4ROEA 1H1RB 4AKHA 5CEIB 3BHUB 5HQ0B 1H28B 3PO3S 4BCKB 4YOZA 5BNJB 1KXUA 5IF1B 2C6TB 1IREB 1FINB 1OL1B 4BCQD 1V29B 1OKVB 2WMBB 3EIDB 1GY3B 5ACBA 4F7SB 4BBRM 5HBEB 2WMAB 1UNHD 3QYEA 2IW8B 4JX6A 4MFDA 4CFWB 4ELLA 2DMEA 4JX4A 3A8LB 3POMA 4BCFB 2W2HA 3HHTB 4EOOB 4YOSA 4ROCA 2BS3A 2PK9B 3A8OB 1ENWA 3O0GD 4AI6A 1PKDB 2PK2A 1AHJB 4EOIB 4EOKB 4BCHB 3QHWB 1JSUB 2CCIB 3DJBA 4BXXX 1QLBA 3DOGB 1QMZB 3HO8A 2ZCFB 2BS2A 3BLQB 4FX3B 4F7NB 2CZ1B 2PHGA 4FM4B 2UUEB 1UNGD 5L2WB 3VKGA 3TNWB 2CZ7B 5FGKB 5DQWA 4BCMD 4CFMB 2C5NB 2IW6B 4EOPB 4OGRB 4M6VA 2LW4A 1VINA 4F70B 2W9ZA 1UGSB 4OR5B 2WFYB 5EJCA 4EONB 1C9BA 3DTOA 1TFBA 2I40B 4OB0B 4CFUD 1UNLD 4BCQB 2X1NB 4G6LB 2WJ9A 5HBHB 4YOOA 3H4CA 4OB3B 4ZGJB 4BBSM 1H1SB 2QDYB 3X20B 3QYBA 3VYGB 1H1QB 2D0QB 4EOJB 4HNVA 2IN3A 4CXAB 2CYZB 1F5QB 2G77A 1TD6A 4QSHA 5I5ZB 4EOSB 2CCHB 1GUXB 2BPMB 3K7AM 1W98B 4NC6A 1G3NC 4LOCA 1ZP2A 3BHTB 3TNIB 2WEVB 2DD5B 1GH6B 3QZ9B 2CZ0B 4Z6YA 5HVYB 3EJ1B 5HBJB 2PJQA 4EOMB 2ZPFB 3HZJA 3BG9A 1BU2A 1URCB 2EUFA 4F6UB 1AD6A 2DPPB 2QGSA 4JX5A 4EOLB 1OIUB 1GUXA 3TW6A 3G33B 4TTHA 3NDQA 4RODA 2C5VB 1UGQB 2BKZB 1UGPB 4ZGEB 4BCMB 1H25B 1H24B 5HNBB 4BCIB 1OL2B
chains in the Genus database with same CATH topology
4EONB 1C9BA 2WPAB 5CYIB 1OKVB 2WMBB 1TFBA 4BCOB 2I40B 2WIHB 2IVXA 3EIDB 5LMKB 4CFUD 1GY3B 2W96A 1UNLD 1O9KA 2WXVB 5ACBA 4EORB 4BCQB 4F7SB 2X1NB 5HBEB 3M03A 4G6LB 2WMAB 1UNHD 1VYWB 1H4LD 3BLRB 4YOOA 5HBHB 3H4CA 1FVVB 4BCGB 2UZEB 1H1SB 2IW8B 4CFWB 4ELLA 2WIPB 2W9FA 4CFUB 4I3ZB 1H1QB 1XO2A 3POMA 4EOQB 4CFNB 2UZLB 4BCFB 2C5XB 4EOJB 3BLHB 1JKWA 4CXAB 2W2HA 1N4MA 1OIYB 4EOOB 1F5QB 3MY1B 4YOSA 4ROCA 5LQFB 2UZDB 2V22B 2C4GB 2PK9B 3MI9B 2I53A 4BCND 4CFXB 2WHBB 3LQ5B 5I5ZB 3O0GD 1OKWB 4EOSB 2CCHB 1GUXB 1PKDB 2PK2A 2BPMB 2UZBB 4F6WB 4EOIB 3K7AM 4EOKB 1W98B 2PMIB 4BCHB 3DDPB 3TNHB 3QHWB 4BCNB 1G3NC 1JSTB 4ELJA 1JSUB 2CCIB 4BCPB 1ZP2A 3BHTB 1E9HB 1AISB 3TNIB 1OGUB 2WEVB 1GH6B 2JGZB 3QHRB 1H1PB 4KRDB 2F2CA 4CRLB 3DOGB 5HVYB 4IMYB 4NSTB 1QMZB 3EJ1B 5HBJB 3TN8B 2QDJA 2B9RA 4F7LB 3MY5B 2C5OB 5EFQB 4EOMB 1H27B 3EOCB 3RGFB 4F7JB 1H26B 1VOLA 1BU2A 3BLQB 4FX3B 4Y72B 1URCB 2EUFA 4F7NB 4F6SB 4F6UB 1AD6A 2R7GA 2PHGA 2IW9B 3F5XB 2W99A 2UUEB 1UNGD 2CJMB 1JOWA 3MIAB 3TNWB 4UN0A 5L2WB 4KRCB 1P5EB 5FGKB 4BCMD 4CFMB 4EOLB 4ROEA 1H1RB 1OIUB 5CEIB 1GUXA 1OI9B 3BHUB 2C5NB 5HQ0B 3G33B 1H28B 4TTHA 2IW6B 2G9XB 5ICPB 4RODA 4BCKB 4EOPB 2C5VB 4YOZA 4OGRB 5BNJB 2BKZB 4YC3B 1KXUA 1VINA 5IDPB 4II5B 4F70B 5IF1B 4BCMB 2C6TB 1H25B 3DDQB 4EC8B 1FINB 2W9ZA 1O9KB 4OR5B 1D3UB 2WFYB 1H24B 3BHVB 4BCJB 4CFVB 5HNBB 1OL1B 4BCQD 1OL2B 4BCIB 4EC9B 5IDNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EON B;  1C9B A;  2WPA B;  5CYI B;  1OKV B;  2WMB B;  1TFB A;  4BCO B;  2I40 B;  2WIH B;  2IVX A;  3EID B;  5LMK B;  4CFU D;  1GY3 B;  2W96 A;  1UNL D;  1O9K A;  2WXV B;  5ACB A;  4EOR B;  4BCQ B;  4F7S B;  2X1N B;  5HBE B;  3M03 A;  4G6L B;  2WMA B;  1UNH D;  1VYW B;  1H4L D;  3BLR B;  4YOO A;  5HBH B;  3H4C A;  1FVV B;  4BCG B;  2UZE B;  1H1S B;  2IW8 B;  4CFW B;  4ELL A;  2WIP B;  2W9F A;  4CFU B;  4I3Z B;  1H1Q B;  1XO2 A;  3POM A;  4EOQ B;  4CFN B;  2UZL B;  4BCF B;  2C5X B;  4EOJ B;  3BLH B;  1JKW A;  4CXA B;  2W2H A;  1N4M A;  1OIY B;  4EOO B;  1F5Q B;  3MY1 B;  4YOS A;  4ROC A;  5LQF B;  2UZD B;  2V22 B;  2C4G B;  2PK9 B;  3MI9 B;  2I53 A;  4BCN D;  4CFX B;  2WHB B;  3LQ5 B;  5I5Z B;  3O0G D;  1OKW B;  4EOS B;  2CCH B;  1GUX B;  1PKD B;  2PK2 A;  2BPM B;  2UZB B;  4F6W B;  4EOI B;  3K7A M;  4EOK B;  1W98 B;  2PMI B;  4BCH B;  3DDP B;  3TNH B;  3QHW B;  4BCN B;  1G3N C;  1JST B;  4ELJ A;  1JSU B;  2CCI B;  4BCP B;  1ZP2 A;  3BHT B;  1E9H B;  1AIS B;  3TNI B;  1OGU B;  2WEV B;  1GH6 B;  2JGZ B;  3QHR B;  1H1P B;  4KRD B;  2F2C A;  4CRL B;  3DOG B;  5HVY B;  4IMY B;  4NST B;  1QMZ B;  3EJ1 B;  5HBJ B;  3TN8 B;  2QDJ A;  2B9R A;  4F7L B;  3MY5 B;  2C5O B;  5EFQ B;  4EOM B;  1H27 B;  3EOC B;  3RGF B;  4F7J B;  1H26 B;  1VOL A;  1BU2 A;  3BLQ B;  4FX3 B;  4Y72 B;  1URC B;  2EUF A;  4F7N B;  4F6S B;  4F6U B;  1AD6 A;  2R7G A;  2PHG A;  2IW9 B;  3F5X B;  2W99 A;  2UUE B;  1UNG D;  2CJM B;  1JOW A;  3MIA B;  3TNW B;  4UN0 A;  5L2W B;  4KRC B;  1P5E B;  5FGK B;  4BCM D;  4CFM B;  4EOL B;  4ROE A;  1H1R B;  1OIU B;  5CEI B;  1GUX A;  1OI9 B;  3BHU B;  2C5N B;  5HQ0 B;  3G33 B;  1H28 B;  4TTH A;  2IW6 B;  2G9X B;  5ICP B;  4ROD A;  4BCK B;  4EOP B;  2C5V B;  4YOZ A;  4OGR B;  5BNJ B;  2BKZ B;  4YC3 B;  1KXU A;  1VIN A;  5IDP B;  4II5 B;  4F70 B;  5IF1 B;  4BCM B;  2C6T B;  1H25 B;  3DDQ B;  4EC8 B;  1FIN B;  2W9Z A;  1O9K B;  4OR5 B;  1D3U B;  2WFY B;  1H24 B;  3BHV B;  4BCJ B;  4CFV B;  5HNB B;  1OL1 B;  4BCQ D;  1OL2 B;  4BCI B;  4EC9 B;  5IDN B; 
#chains in the Genus database with same CATH topology
 2WIH B;  5LMK B;  3X26 B;  1O9K A;  2BS4 A;  3M03 A;  3X28 B;  1H4L D;  2UZE B;  3QYG B;  2AHJ B;  4CFU B;  4BY7 X;  1XO2 A;  5DQV A;  4EOQ B;  4CFN B;  2C5X B;  3A8G B;  2DD4 B;  1JKW A;  3BLH B;  4HNU A;  2QQ8 A;  3X25 B;  4HNT A;  1OIY B;  3TW7 A;  3MY1 B;  5LQF B;  2UZD B;  2V22 B;  2C4G B;  2ZZD B;  3VYH B;  2I53 A;  4BCN D;  4CFX B;  1E7P A;  1UGR B;  3GTM S;  4BCP B;  3QWL A;  1E9H B;  2QFZ A;  1H1P B;  2DXB B;  4KRD B;  4IMY B;  4NST B;  2ZPI B;  3TN8 B;  4F7L B;  2B9R A;  3VKH A;  1H27 B;  5IHY A;  2QF7 A;  4Y72 B;  2IW9 B;  3F5X B;  2W99 A;  2CJM B;  3MIA B;  4AKG A;  4UN0 A;  1P5E B;  2DXC B;  1OI9 B;  2G9X B;  4OB2 B;  5ICP B;  3QXE B;  3B57 A;  2ZPG B;  4YC3 B;  5IDP B;  4II5 B;  3A8H B;  3BG5 A;  3DDQ B;  4EC8 B;  1D3U B;  1O9K B;  2KR6 A;  3BHV B;  4BCJ B;  4CFV B;  4EC9 B;  4F6S B;  5IDN B;  3X24 B;  2WPA B;  5CYI B;  4BCO B;  2IVX A;  2WXV B;  2W96 A;  4EOR B;  3BG3 A;  4BY1 X;  2KMG A;  3A8M B;  1VYW B;  3BLR B;  1FVV B;  4BCG B;  3QYH B;  4HL4 A;  2WIP B;  2W9F A;  4I3Z B;  2UZL B;  2ZPB B;  3WVD B;  1N4M A;  3KHI A;  3MI9 B;  2WHB B;  3LQ5 B;  2CZ6 B;  1OKW B;  4MFE A;  4AKI A;  2UZB B;  4F6W B;  2PMI B;  3DDP B;  3TNH B;  4BCN B;  1JST B;  3QZ5 B;  4ELJ A;  1AIS B;  2ZPH B;  3DL1 A;  1FKM A;  1OGU B;  4OB1 B;  2JGZ B;  3QHR B;  2F2C A;  4CRL B;  4MIM A;  2QDJ A;  3MY5 B;  2C5O B;  5EFQ B;  4HLQ A;  3EOC B;  3RGF B;  4F7J B;  2ZPE B;  1H26 B;  1VOL A;  3HBL A;  2R7G A;  1JOW A;  4ZGD B;  4KRC B;  3HB9 A;  3WVE B;  4ROE A;  1H1R B;  4AKH A;  5CEI B;  3BHU B;  5HQ0 B;  1H28 B;  3PO3 S;  4BCK B;  4YOZ A;  5BNJ B;  1KXU A;  5IF1 B;  2C6T B;  1IRE B;  1FIN B;  1OL1 B;  4BCQ D;  1V29 B;  1OKV B;  2WMB B;  3EID B;  1GY3 B;  5ACB A;  4F7S B;  4BBR M;  5HBE B;  2WMA B;  1UNH D;  3QYE A;  2IW8 B;  4JX6 A;  4MFD A;  4CFW B;  4ELL A;  2DME A;  4JX4 A;  3A8L B;  3POM A;  4BCF B;  2W2H A;  3HHT B;  4EOO B;  4YOS A;  4ROC A;  2BS3 A;  2PK9 B;  3A8O B;  1ENW A;  3O0G D;  4AI6 A;  1PKD B;  2PK2 A;  1AHJ B;  4EOI B;  4EOK B;  4BCH B;  3QHW B;  1JSU B;  2CCI B;  3DJB A;  4BXX X;  1QLB A;  3DOG B;  1QMZ B;  3HO8 A;  2ZCF B;  2BS2 A;  3BLQ B;  4FX3 B;  4F7N B;  2CZ1 B;  2PHG A;  4FM4 B;  2UUE B;  1UNG D;  5L2W B;  3VKG A;  3TNW B;  2CZ7 B;  5FGK B;  5DQW A;  4BCM D;  4CFM B;  2C5N B;  2IW6 B;  4EOP B;  4OGR B;  4M6V A;  2LW4 A;  1VIN A;  4F70 B;  2W9Z A;  1UGS B;  4OR5 B;  2WFY B;  5EJC A;  4EON B;  1C9B A;  3DTO A;  1TFB A;  2I40 B;  4OB0 B;  4CFU D;  1UNL D;  4BCQ B;  2X1N B;  4G6L B;  2WJ9 A;  5HBH B;  4YOO A;  3H4C A;  4OB3 B;  4ZGJ B;  4BBS M;  1H1S B;  2QDY B;  3X20 B;  3QYB A;  3VYG B;  1H1Q B;  2D0Q B;  4EOJ B;  4HNV A;  2IN3 A;  4CXA B;  2CYZ B;  1F5Q B;  2G77 A;  1TD6 A;  4QSH A;  5I5Z B;  4EOS B;  2CCH B;  1GUX B;  2BPM B;  3K7A M;  1W98 B;  4NC6 A;  1G3N C;  4LOC A;  1ZP2 A;  3BHT B;  3TNI B;  2WEV B;  2DD5 B;  1GH6 B;  3QZ9 B;  2CZ0 B;  4Z6Y A;  5HVY B;  3EJ1 B;  5HBJ B;  2PJQ A;  4EOM B;  2ZPF B;  3HZJ A;  3BG9 A;  1BU2 A;  1URC B;  2EUF A;  4F6U B;  1AD6 A;  2DPP B;  2QGS A;  4JX5 A;  4EOL B;  1OIU B;  1GUX A;  3TW6 A;  3G33 B;  4TTH A;  3NDQ A;  4ROD A;  2C5V B;  1UGQ B;  2BKZ B;  1UGP B;  4ZGE B;  4BCM B;  1H25 B;  1H24 B;  5HNB B;  4BCI B;  1OL2 B; 
#chains in the Genus database with same CATH homology
 4EON B;  1C9B A;  2WPA B;  5CYI B;  1OKV B;  2WMB B;  1TFB A;  4BCO B;  2I40 B;  2WIH B;  2IVX A;  3EID B;  5LMK B;  4CFU D;  1GY3 B;  2W96 A;  1UNL D;  1O9K A;  2WXV B;  5ACB A;  4EOR B;  4BCQ B;  4F7S B;  2X1N B;  5HBE B;  3M03 A;  4G6L B;  2WMA B;  1UNH D;  1VYW B;  1H4L D;  3BLR B;  4YOO A;  5HBH B;  3H4C A;  1FVV B;  4BCG B;  2UZE B;  1H1S B;  2IW8 B;  4CFW B;  4ELL A;  2WIP B;  2W9F A;  4CFU B;  4I3Z B;  1H1Q B;  1XO2 A;  3POM A;  4EOQ B;  4CFN B;  2UZL B;  4BCF B;  2C5X B;  4EOJ B;  3BLH B;  1JKW A;  4CXA B;  2W2H A;  1N4M A;  1OIY B;  4EOO B;  1F5Q B;  3MY1 B;  4YOS A;  4ROC A;  5LQF B;  2UZD B;  2V22 B;  2C4G B;  2PK9 B;  3MI9 B;  2I53 A;  4BCN D;  4CFX B;  2WHB B;  3LQ5 B;  5I5Z B;  3O0G D;  1OKW B;  4EOS B;  2CCH B;  1GUX B;  1PKD B;  2PK2 A;  2BPM B;  2UZB B;  4F6W B;  4EOI B;  3K7A M;  4EOK B;  1W98 B;  2PMI B;  4BCH B;  3DDP B;  3TNH B;  3QHW B;  4BCN B;  1G3N C;  1JST B;  4ELJ A;  1JSU B;  2CCI B;  4BCP B;  1ZP2 A;  3BHT B;  1E9H B;  1AIS B;  3TNI B;  1OGU B;  2WEV B;  1GH6 B;  2JGZ B;  3QHR B;  1H1P B;  4KRD B;  2F2C A;  4CRL B;  3DOG B;  5HVY B;  4IMY B;  4NST B;  1QMZ B;  3EJ1 B;  5HBJ B;  3TN8 B;  2QDJ A;  2B9R A;  4F7L B;  3MY5 B;  2C5O B;  5EFQ B;  4EOM B;  1H27 B;  3EOC B;  3RGF B;  4F7J B;  1H26 B;  1VOL A;  1BU2 A;  3BLQ B;  4FX3 B;  4Y72 B;  1URC B;  2EUF A;  4F7N B;  4F6S B;  4F6U B;  1AD6 A;  2R7G A;  2PHG A;  2IW9 B;  3F5X B;  2W99 A;  2UUE B;  1UNG D;  2CJM B;  1JOW A;  3MIA B;  3TNW B;  4UN0 A;  5L2W B;  4KRC B;  1P5E B;  5FGK B;  4BCM D;  4CFM B;  4EOL B;  4ROE A;  1H1R B;  1OIU B;  5CEI B;  1GUX A;  1OI9 B;  3BHU B;  2C5N B;  5HQ0 B;  3G33 B;  1H28 B;  4TTH A;  2IW6 B;  2G9X B;  5ICP B;  4ROD A;  4BCK B;  4EOP B;  2C5V B;  4YOZ A;  4OGR B;  5BNJ B;  2BKZ B;  4YC3 B;  1KXU A;  1VIN A;  5IDP B;  4II5 B;  4F70 B;  5IF1 B;  4BCM B;  2C6T B;  1H25 B;  3DDQ B;  4EC8 B;  1FIN B;  2W9Z A;  1O9K B;  4OR5 B;  1D3U B;  2WFY B;  1H24 B;  3BHV B;  4BCJ B;  4CFV B;  5HNB B;  1OL1 B;  4BCQ D;  1OL2 B;  4BCI B;  4EC9 B;  5IDN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...