2C5ZA

Structure and ctd binding of the set2 sri domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VSQSQRLEHNWNKFFASFVPNLIKKNPQSKQFDHENIKQCAKDIVKILTTKELKKDSSRAPPDDLTKGKRHKVKEFINSYMDKIILKKKQKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and carboxyl-terminal domain (CTD) binding of the Set2 SRI domain that couples histone H3 Lys36 methylation to transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SET DOMAIN PROTEIN 2
total genus 35
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08236 SRI SRI (Set2 Rpb1 interacting) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.100 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2c5zA00
2C5ZA 2A7OA
chains in the Genus database with same CATH superfamily
3FUMA 3Q44A 3ANMA 5JAZA 2PL5A 4ZN6A 4ZQEA 4MS6A 4FLQA 2JV7A 2HPTA 4PU2A 4XO3A 4ZX3A 4JNDA 4FLRA 4XMTA 2JD1A 4XNBA 1T1SA 1MW1A 1K5HA 2WZGA 3FUJA 1Q0QA 3CZEA 4K5LA 4R7LA 4XMXA 3B7TA 4XN9A 2FFLA 1H19A 1MW3A 1R0KA 4XMZA 2XQ0A 3AU8A 4XO5A 3T8VA 4ARFA 3CHPA 4ZX6A 4R5XA 2JCXA 4Q4EA 3FTSA 3JSZA 3RC3A 3ZHZA 4AICA 1T1RA 5HNHA 1MW2A 3B3BA 3ZI0A 2VJ8A 4ZW3A 5DLLA 3QJXA 3AU9A 3CZGA 5FWQA 1JG9A 1X3WA 3VVMA 1SC5A 3B7SA 4Y6PA 3B37A 1ONOA 3KEDA 4AR9A 4A03A 3RASA 4ZW8A 2ZXGA 2R70A 4QHPA 3UCQA 4XMUA 2WPGA 2B61A 1X3ZA 4ZW5A 4ZQTA 5JC1A 2MAOA 3A14A 3FUFA 3U9WA 3HW2A 4L2LA 4RSYA 5JNLA 1SG7A 2GTQA 4OOFA 2EGHA 2C5ZA 2R59A 5DULA 3WQSB 4GAAA 2C82A 1GW6A 4XNAA 1MVYA 2XPYA 4QPEA 3CIAA 2HPOA 4MKTA 4Y6RA 3FTWA 1HS6A 3A06A 2JD0A 3RC8A 4XN8A 3FUNA 5JMPA 3R0IA 4ZX5A 3UERA 1JVSA 5JO0A 1MW0A 3EBIA 2PUSA 4XMWA 2PGGA 3FUDA 4FLOA 5JMWA 2O7GA 4ZW7A 3FU5A 4KP7A 1H3LA 2JD2A 1SQMA 3CHQA 4R5TA 4XN5A 4AR1A 3FH5A 4R5VA 2Y1FA 4RVBA 5JBIA 3FTYA 3ANLA 3CHRA 5DYFA 4Q4IA 4XMVA 3ZHYA 4QMEA 1ONNA 4BKXA 2RJIA 3FU3A 1G5AA 3Q43A 4FCAA 4Y6SA 2JCVA 3B2XA 3FU0A 4RCVA 4CXFA 2QJ1A 1OR7A 3ZHXA 4ZX4A 4ZW6A 3B7UX 4K5PA 3FUIA 4XN1A 3AUAA 3FTVA 1ONPA 4ZQFA 3EBGA 1ZS2A 5HLTA 3UEQA 3VVLA 1R0LA 3FTXA 2Y1DA 3ANNA 3FTZA 1Q0HA 2MAPA 2R72A 3FTUA 3IIEA 3CHOA 4J3BA 2DQMA 3B2PA 4LUPA 1Q0LA 3CHSA 3FUHA 4XN4A 2Y1CA 2WZFA 2Y1EA 3FH7A 3CZKA 4OOEA 2DQ6A 2JCYA 4AR8A 4K5MA 3JT1A 4K5NA 3FH8A 4XO4A 2Y1GA 4FLSA 3CXBA 4AYSA 4QIRA 2XPZA 3B7RL 5BPPA 4K5OA 4XNDA 5AENA 5HNFA 3B34A 4DPRA 3T0YA 4PVBA 4XN7A 4GAEA 3FU6A 3FUEA 4NQWA 4ZQHA 3WQRA 2VLAA 2A7OA 1JGIA 2QVWA 3FHEA 4PW4A 4ZQGA 4X2UA 3EBHA 4Y67A 5EV7A 1RP3A 3WQQA 3CZLA 3FULA 1S46A 4XN2A 3FUKA 3PUUA 4QUOA
chains in the Genus database with same CATH topology
3FUMA 3Q44A 3ANMA 5JAZA 2PL5A 4ZN6A 4ZQEA 4MS6A 4FLQA 2JV7A 2HPTA 4PU2A 4XO3A 4ZX3A 4JNDA 4FLRA 4XMTA 2JD1A 4XNBA 1T1SA 1MW1A 1K5HA 2WZGA 3FUJA 1Q0QA 3CZEA 4K5LA 4R7LA 4XMXA 3B7TA 4XN9A 2FFLA 1H19A 1MW3A 1R0KA 4XMZA 2XQ0A 3AU8A 4XO5A 3T8VA 4ARFA 3CHPA 4ZX6A 4R5XA 2JCXA 4Q4EA 3FTSA 3JSZA 3RC3A 3ZHZA 4AICA 1T1RA 5HNHA 1MW2A 3B3BA 3ZI0A 2VJ8A 4ZW3A 5DLLA 3QJXA 3AU9A 3CZGA 5FWQA 1JG9A 1X3WA 3VVMA 1SC5A 3B7SA 4Y6PA 3B37A 1ONOA 3KEDA 4AR9A 4A03A 3RASA 4ZW8A 2ZXGA 2R70A 4QHPA 3UCQA 4XMUA 2WPGA 2B61A 1X3ZA 4ZW5A 4ZQTA 5JC1A 2MAOA 3A14A 3FUFA 3U9WA 4L2LA 4RSYA 5JNLA 1SG7A 2GTQA 4OOFA 2EGHA 2C5ZA 2R59A 5DULA 3WQSB 4GAAA 2C82A 1GW6A 4XNAA 1MVYA 2XPYA 4QPEA 3CIAA 2HPOA 4MKTA 4Y6RA 3FTWA 1HS6A 3A06A 2JD0A 3RC8A 4XN8A 3FUNA 5JMPA 3R0IA 4ZX5A 3UERA 1JVSA 5JO0A 1MW0A 3EBIA 2PUSA 4XMWA 2PGGA 3FUDA 4FLOA 5JMWA 2O7GA 4ZW7A 3FU5A 4KP7A 1H3LA 2JD2A 1SQMA 3CHQA 4R5TA 4XN5A 4AR1A 3FH5A 4R5VA 2Y1FA 4RVBA 5JBIA 3FTYA 3ANLA 3CHRA 5DYFA 4Q4IA 4XMVA 3ZHYA 4QMEA 1ONNA 4BKXA 2RJIA 3FU3A 1G5AA 3Q43A 4FCAA 4Y6SA 2JCVA 3B2XA 3FU0A 4RCVA 4CXFA 2QJ1A 1OR7A 3ZHXA 4ZX4A 4ZW6A 3B7UX 4K5PA 3FUIA 4XN1A 3AUAA 3FTVA 1ONPA 4ZQFA 3EBGA 1ZS2A 5HLTA 3UEQA 3VVLA 1R0LA 3FTXA 2Y1DA 3ANNA 3FTZA 1Q0HA 2MAPA 2R72A 3FTUA 3IIEA 3CHOA 4J3BA 2DQMA 3B2PA 4LUPA 1Q0LA 3CHSA 3FUHA 4XN4A 2Y1CA 2WZFA 2Y1EA 3FH7A 3CZKA 4OOEA 2DQ6A 2JCYA 4AR8A 4K5MA 3JT1A 4K5NA 3FH8A 4XO4A 2Y1GA 4FLSA 4AYSA 4QIRA 2XPZA 3B7RL 5BPPA 4K5OA 4XNDA 5AENA 5HNFA 3B34A 4DPRA 3T0YA 4PVBA 4XN7A 4GAEA 3FU6A 3FUEA 4NQWA 4ZQHA 3WQRA 2VLAA 2A7OA 1JGIA 2QVWA 3FHEA 4PW4A 4ZQGA 4X2UA 3EBHA 4Y67A 5EV7A 1RP3A 3WQQA 3CZLA 3FULA 1S46A 4XN2A 3FUKA 3PUUA 4QUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Z A;  2A7O A; 
#chains in the Genus database with same CATH topology
 3FUM A;  3Q44 A;  3ANM A;  5JAZ A;  2PL5 A;  4ZN6 A;  4ZQE A;  4MS6 A;  4FLQ A;  2JV7 A;  2HPT A;  4PU2 A;  4XO3 A;  4ZX3 A;  4JND A;  4FLR A;  4XMT A;  2JD1 A;  4XNB A;  1T1S A;  1MW1 A;  1K5H A;  2WZG A;  3FUJ A;  1Q0Q A;  3CZE A;  4K5L A;  4R7L A;  4XMX A;  3B7T A;  4XN9 A;  2FFL A;  1H19 A;  1MW3 A;  1R0K A;  4XMZ A;  2XQ0 A;  3AU8 A;  4XO5 A;  3T8V A;  4ARF A;  3CHP A;  4ZX6 A;  4R5X A;  2JCX A;  4Q4E A;  3FTS A;  3JSZ A;  3RC3 A;  3ZHZ A;  4AIC A;  1T1R A;  5HNH A;  1MW2 A;  3B3B A;  3ZI0 A;  2VJ8 A;  4ZW3 A;  5DLL A;  3QJX A;  3AU9 A;  3CZG A;  5FWQ A;  1JG9 A;  1X3W A;  3VVM A;  1SC5 A;  3B7S A;  4Y6P A;  3B37 A;  1ONO A;  3KED A;  4AR9 A;  4A03 A;  3RAS A;  4ZW8 A;  2ZXG A;  2R70 A;  4QHP A;  3UCQ A;  4XMU A;  2WPG A;  2B61 A;  1X3Z A;  4ZW5 A;  4ZQT A;  5JC1 A;  2MAO A;  3A14 A;  3FUF A;  3U9W A;  3HW2 A;  4L2L A;  4RSY A;  5JNL A;  1SG7 A;  2GTQ A;  4OOF A;  2EGH A;  2C5Z A;  2R59 A;  5DUL A;  3WQS B;  4GAA A;  2C82 A;  1GW6 A;  4XNA A;  1MVY A;  2XPY A;  4QPE A;  3CIA A;  2HPO A;  4MKT A;  4Y6R A;  3FTW A;  1HS6 A;  3A06 A;  2JD0 A;  3RC8 A;  4XN8 A;  3FUN A;  5JMP A;  3R0I A;  4ZX5 A;  3UER A;  1JVS A;  5JO0 A;  1MW0 A;  3EBI A;  2PUS A;  4XMW A;  2PGG A;  3FUD A;  4FLO A;  5JMW A;  2O7G A;  4ZW7 A;  3FU5 A;  4KP7 A;  1H3L A;  2JD2 A;  1SQM A;  3CHQ A;  4R5T A;  4XN5 A;  4AR1 A;  3FH5 A;  4R5V A;  2Y1F A;  4RVB A;  5JBI A;  3FTY A;  3ANL A;  3CHR A;  5DYF A;  4Q4I A;  4XMV A;  3ZHY A;  4QME A;  1ONN A;  4BKX A;  2RJI A;  3FU3 A;  1G5A A;  3Q43 A;  4FCA A;  4Y6S A;  2JCV A;  3B2X A;  3FU0 A;  4RCV A;  4CXF A;  2QJ1 A;  1OR7 A;  3ZHX A;  4ZX4 A;  4ZW6 A;  3B7U X;  4K5P A;  3FUI A;  4XN1 A;  3AUA A;  3FTV A;  1ONP A;  4ZQF A;  3EBG A;  1ZS2 A;  5HLT A;  3UEQ A;  3VVL A;  1R0L A;  3FTX A;  2Y1D A;  3ANN A;  3FTZ A;  1Q0H A;  2MAP A;  2R72 A;  3FTU A;  3IIE A;  3CHO A;  4J3B A;  2DQM A;  3B2P A;  4LUP A;  1Q0L A;  3CHS A;  3FUH A;  4XN4 A;  2Y1C A;  2WZF A;  2Y1E A;  3FH7 A;  3CZK A;  4OOE A;  2DQ6 A;  2JCY A;  4AR8 A;  4K5M A;  3JT1 A;  4K5N A;  3FH8 A;  4XO4 A;  2Y1G A;  4FLS A;  3CXB A;  4AYS A;  4QIR A;  2XPZ A;  3B7R L;  5BPP A;  4K5O A;  4XND A;  5AEN A;  5HNF A;  3B34 A;  4DPR A;  3T0Y A;  4PVB A;  4XN7 A;  4GAE A;  3FU6 A;  3FUE A;  4NQW A;  4ZQH A;  3WQR A;  2VLA A;  2A7O A;  1JGI A;  2QVW A;  3FHE A;  4PW4 A;  4ZQG A;  4X2U A;  3EBH A;  4Y67 A;  5EV7 A;  1RP3 A;  3WQQ A;  3CZL A;  3FUL A;  1S46 A;  4XN2 A;  3FUK A;  3PUU A;  4QUO A; 
#chains in the Genus database with same CATH homology
 3FUM A;  3Q44 A;  3ANM A;  5JAZ A;  2PL5 A;  4ZN6 A;  4ZQE A;  4MS6 A;  4FLQ A;  2JV7 A;  2HPT A;  4PU2 A;  4XO3 A;  4ZX3 A;  4JND A;  4FLR A;  4XMT A;  2JD1 A;  4XNB A;  1T1S A;  1MW1 A;  1K5H A;  2WZG A;  3FUJ A;  1Q0Q A;  3CZE A;  4K5L A;  4R7L A;  4XMX A;  3B7T A;  4XN9 A;  2FFL A;  1H19 A;  1MW3 A;  1R0K A;  4XMZ A;  2XQ0 A;  3AU8 A;  4XO5 A;  3T8V A;  4ARF A;  3CHP A;  4ZX6 A;  4R5X A;  2JCX A;  4Q4E A;  3FTS A;  3JSZ A;  3RC3 A;  3ZHZ A;  4AIC A;  1T1R A;  5HNH A;  1MW2 A;  3B3B A;  3ZI0 A;  2VJ8 A;  4ZW3 A;  5DLL A;  3QJX A;  3AU9 A;  3CZG A;  5FWQ A;  1JG9 A;  1X3W A;  3VVM A;  1SC5 A;  3B7S A;  4Y6P A;  3B37 A;  1ONO A;  3KED A;  4AR9 A;  4A03 A;  3RAS A;  4ZW8 A;  2ZXG A;  2R70 A;  4QHP A;  3UCQ A;  4XMU A;  2WPG A;  2B61 A;  1X3Z A;  4ZW5 A;  4ZQT A;  5JC1 A;  2MAO A;  3A14 A;  3FUF A;  3U9W A;  4L2L A;  4RSY A;  5JNL A;  1SG7 A;  2GTQ A;  4OOF A;  2EGH A;  2C5Z A;  2R59 A;  5DUL A;  3WQS B;  4GAA A;  2C82 A;  1GW6 A;  4XNA A;  1MVY A;  2XPY A;  4QPE A;  3CIA A;  2HPO A;  4MKT A;  4Y6R A;  3FTW A;  1HS6 A;  3A06 A;  2JD0 A;  3RC8 A;  4XN8 A;  3FUN A;  5JMP A;  3R0I A;  4ZX5 A;  3UER A;  1JVS A;  5JO0 A;  1MW0 A;  3EBI A;  2PUS A;  4XMW A;  2PGG A;  3FUD A;  4FLO A;  5JMW A;  2O7G A;  4ZW7 A;  3FU5 A;  4KP7 A;  1H3L A;  2JD2 A;  1SQM A;  3CHQ A;  4R5T A;  4XN5 A;  4AR1 A;  3FH5 A;  4R5V A;  2Y1F A;  4RVB A;  5JBI A;  3FTY A;  3ANL A;  3CHR A;  5DYF A;  4Q4I A;  4XMV A;  3ZHY A;  4QME A;  1ONN A;  4BKX A;  2RJI A;  3FU3 A;  1G5A A;  3Q43 A;  4FCA A;  4Y6S A;  2JCV A;  3B2X A;  3FU0 A;  4RCV A;  4CXF A;  2QJ1 A;  1OR7 A;  3ZHX A;  4ZX4 A;  4ZW6 A;  3B7U X;  4K5P A;  3FUI A;  4XN1 A;  3AUA A;  3FTV A;  1ONP A;  4ZQF A;  3EBG A;  1ZS2 A;  5HLT A;  3UEQ A;  3VVL A;  1R0L A;  3FTX A;  2Y1D A;  3ANN A;  3FTZ A;  1Q0H A;  2MAP A;  2R72 A;  3FTU A;  3IIE A;  3CHO A;  4J3B A;  2DQM A;  3B2P A;  4LUP A;  1Q0L A;  3CHS A;  3FUH A;  4XN4 A;  2Y1C A;  2WZF A;  2Y1E A;  3FH7 A;  3CZK A;  4OOE A;  2DQ6 A;  2JCY A;  4AR8 A;  4K5M A;  3JT1 A;  4K5N A;  3FH8 A;  4XO4 A;  2Y1G A;  4FLS A;  4AYS A;  4QIR A;  2XPZ A;  3B7R L;  5BPP A;  4K5O A;  4XND A;  5AEN A;  5HNF A;  3B34 A;  4DPR A;  3T0Y A;  4PVB A;  4XN7 A;  4GAE A;  3FU6 A;  3FUE A;  4NQW A;  4ZQH A;  3WQR A;  2VLA A;  2A7O A;  1JGI A;  2QVW A;  3FHE A;  4PW4 A;  4ZQG A;  4X2U A;  3EBH A;  4Y67 A;  5EV7 A;  1RP3 A;  3WQQ A;  3CZL A;  3FUL A;  1S46 A;  4XN2 A;  3FUK A;  3PUU A;  4QUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...