2C5ZA

Structure and ctd binding of the set2 sri domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
VSQSQRLEHNWNKFFASFVPNLIKKNPQSKQFDHENIKQCAKDIVKILTTKELKKDSSRAPPDDLTKGKRHKVKEFINSYMDKIILKKKQKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and carboxyl-terminal domain (CTD) binding of the Set2 SRI domain that couples histone H3 Lys36 methylation to transcription.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SET DOMAIN PROTEIN 2
total genus 35
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08236 SRI SRI (Set2 Rpb1 interacting) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.100 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 2c5zA00
2C5ZA 2A7OA
chains in the Genus database with same CATH superfamily
4XNAA 4K5OA 3WQRA 4ZW3A 2C5ZA 3R0IA 4ZX5A 3IIEA 1X3WA 4K5NA 2Y1DA 2Y1FA 3FUNA 1H3LA 4XN9A 3RC3A 3VVMA 3ANNA 4X2UA 1Q0HA 3CHPA 2RJIA 2B61A 3U9WA 4ZX3A 5HLTA 3CZLA 3FU0A 2JCVA 1R0LA 3ANLA 3B2PA 3FUIA 3HW2A 5JC1A 5JMWA 4AR1A 4K5PA 3FUJA 2JCYA 3EBGA 4XN2A 3T0YA 3FUDA 2QVWA 1JVSA 4RVBA 2R72A 1ONOA 1S46A 4ZW5A 3B7TA 5FWQA 2R70A 4XO5A 4ZW7A 4KP7A 1MW0A 3FU3A 1MW1A 2GTQA 3WQSB 2XQ0A 3B37A 4PU2A 4Q4IA 4XMZA 4Y6RA 4PW4A 4BKXA 1MW2A 5DULA 5JBIA 4ZW8A 4AYSA 5JAZA 3VVLA 5JO0A 4R7LA 4ZW6A 4XO4A 1T1RA 4RCVA 3FULA 3B7UX 3FTWA 3ZHXA 3FHEA 3FUEA 1T1SA 3B7RL 3JSZA 4XNDA 3FUFA 3AU9A 4A03A 2PUSA 3FU5A 4XMWA 3CHRA 4OOEA 4ZQTA 4PVBA 3QJXA 3FTXA 3CIAA 3CZKA 4Q4EA 4GAEA 4LUPA 2QJ1A 2C82A 2XPYA 1SQMA 3CXBA 1ONPA 3JT1A 2XPZA 1ZS2A 4FLSA 1JG9A 3FTSA 4ZX4A 5HNHA 2WPGA 4AR9A 2HPTA 2JD1A 5HNFA 3RASA 4QHPA 4MKTA 4OOFA 3ZHYA 2JV7A 4XO3A 5DYFA 4ARFA 4ZX6A 3UEQA 1X3ZA 2FFLA 3RC8A 3ZI0A 3WQQA 3EBHA 5JMPA 2EGHA 1H19A 2O7GA 1HS6A 4R5TA 4RSYA 4ZQHA 3FTUA 3AU8A 3FTZA 3CHQA 3Q44A 5BPPA 2Y1GA 3CHSA 4FCAA 4XMVA 4FLRA 3EBIA 3FH7A 3Q43A 3B3BA 4Y6SA 5JNLA 3FH8A 3CZEA 3UCQA 3FUHA 4MS6A 3B2XA 3UERA 2Y1EA 4GAAA 1JGIA 4K5LA 4NQWA 2MAOA 5AENA 4XMUA 4ZQFA 3T8VA 4AR8A 4XMTA 3AUAA 1Q0QA 3FTYA 4AICA 4XN1A 4CXFA 3ZHZA 2WZGA 2R59A 3FU6A 1SC5A 1GW6A 4R5VA 5EV7A 2VJ8A 1K5HA 2ZXGA 1MVYA 4QIRA 2DQ6A 4XN5A 5DLLA 3B7SA 2A7OA 2JD2A 1OR7A 1G5AA 3FUMA 2VLAA 2PGGA 4QMEA 4XN7A 4R5XA 4QUOA 4J3BA 3A06A 4XMXA 4K5MA 3FH5A 2WZFA 4XN8A 4FLQA 3PUUA 3A14A 1RP3A 1SG7A 2JCXA 3B34A 3FUKA 4ZN6A 4JNDA 3FTVA 1R0KA 1MW3A 4XN4A 4ZQEA 3ANMA 3CZGA 1Q0LA 4QPEA 2HPOA 4Y67A 2MAPA 4ZQGA 4XNBA 1ONNA 2DQMA 3CHOA 4L2LA 4DPRA 3KEDA 2JD0A 4Y6PA 2Y1CA 2PL5A 4FLOA
chains in the Genus database with same CATH topology
4XNAA 4K5OA 3WQRA 4ZW3A 2C5ZA 3R0IA 4ZX5A 3IIEA 1X3WA 4K5NA 2Y1DA 2Y1FA 3FUNA 1H3LA 4XN9A 3RC3A 3VVMA 3ANNA 4X2UA 1Q0HA 3CHPA 2RJIA 2B61A 3U9WA 4ZX3A 5HLTA 3CZLA 3FU0A 2JCVA 1R0LA 3ANLA 3B2PA 3FUIA 5JC1A 5JMWA 4AR1A 4K5PA 3FUJA 2JCYA 3EBGA 4XN2A 3T0YA 3FUDA 2QVWA 1JVSA 4RVBA 2R72A 1ONOA 1S46A 4ZW5A 3B7TA 5FWQA 2R70A 4XO5A 4ZW7A 4KP7A 1MW0A 3FU3A 1MW1A 2GTQA 3WQSB 2XQ0A 3B37A 4PU2A 4Q4IA 4XMZA 4Y6RA 4PW4A 4BKXA 1MW2A 5DULA 5JBIA 4ZW8A 4AYSA 5JAZA 3VVLA 5JO0A 4R7LA 4ZW6A 4XO4A 1T1RA 4RCVA 3FULA 3B7UX 3FTWA 3ZHXA 3FHEA 3FUEA 1T1SA 3B7RL 3JSZA 4XNDA 3FUFA 3AU9A 4A03A 2PUSA 3FU5A 4XMWA 3CHRA 4OOEA 4ZQTA 4PVBA 3QJXA 3FTXA 3CIAA 3CZKA 4Q4EA 4GAEA 4LUPA 2QJ1A 2C82A 2XPYA 1SQMA 1ONPA 3JT1A 2XPZA 1ZS2A 4FLSA 1JG9A 3FTSA 4ZX4A 5HNHA 2WPGA 4AR9A 2HPTA 2JD1A 5HNFA 3RASA 4QHPA 4MKTA 4OOFA 3ZHYA 2JV7A 4XO3A 5DYFA 4ARFA 4ZX6A 3UEQA 1X3ZA 2FFLA 3RC8A 3ZI0A 3WQQA 3EBHA 5JMPA 2EGHA 1H19A 2O7GA 1HS6A 4R5TA 4RSYA 4ZQHA 3FTUA 3AU8A 3FTZA 3CHQA 3Q44A 5BPPA 2Y1GA 3CHSA 4FCAA 4XMVA 4FLRA 3EBIA 3FH7A 3Q43A 3B3BA 4Y6SA 5JNLA 3FH8A 3CZEA 3UCQA 3FUHA 4MS6A 3B2XA 3UERA 2Y1EA 4GAAA 1JGIA 4K5LA 4NQWA 2MAOA 5AENA 4XMUA 4ZQFA 3T8VA 4AR8A 4XMTA 3AUAA 1Q0QA 3FTYA 4AICA 4XN1A 4CXFA 3ZHZA 2WZGA 2R59A 3FU6A 1SC5A 1GW6A 4R5VA 5EV7A 2VJ8A 1K5HA 2ZXGA 1MVYA 4QIRA 2DQ6A 4XN5A 5DLLA 3B7SA 2A7OA 2JD2A 1OR7A 1G5AA 3FUMA 2VLAA 2PGGA 4QMEA 4XN7A 4R5XA 4QUOA 4J3BA 3A06A 4XMXA 4K5MA 3FH5A 2WZFA 4XN8A 4FLQA 3PUUA 3A14A 1RP3A 1SG7A 2JCXA 3B34A 3FUKA 4ZN6A 4JNDA 3FTVA 1R0KA 1MW3A 4XN4A 4ZQEA 3ANMA 3CZGA 1Q0LA 4QPEA 2HPOA 4Y67A 2MAPA 4ZQGA 4XNBA 1ONNA 2DQMA 3CHOA 4L2LA 4DPRA 3KEDA 2JD0A 4Y6PA 2Y1CA 2PL5A 4FLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5Z A;  2A7O A; 
#chains in the Genus database with same CATH topology
 4XNA A;  4K5O A;  3WQR A;  4ZW3 A;  2C5Z A;  3R0I A;  4ZX5 A;  3IIE A;  1X3W A;  4K5N A;  2Y1D A;  2Y1F A;  3FUN A;  1H3L A;  4XN9 A;  3RC3 A;  3VVM A;  3ANN A;  4X2U A;  1Q0H A;  3CHP A;  2RJI A;  2B61 A;  3U9W A;  4ZX3 A;  5HLT A;  3CZL A;  3FU0 A;  2JCV A;  1R0L A;  3ANL A;  3B2P A;  3FUI A;  3HW2 A;  5JC1 A;  5JMW A;  4AR1 A;  4K5P A;  3FUJ A;  2JCY A;  3EBG A;  4XN2 A;  3T0Y A;  3FUD A;  2QVW A;  1JVS A;  4RVB A;  2R72 A;  1ONO A;  1S46 A;  4ZW5 A;  3B7T A;  5FWQ A;  2R70 A;  4XO5 A;  4ZW7 A;  4KP7 A;  1MW0 A;  3FU3 A;  1MW1 A;  2GTQ A;  3WQS B;  2XQ0 A;  3B37 A;  4PU2 A;  4Q4I A;  4XMZ A;  4Y6R A;  4PW4 A;  4BKX A;  1MW2 A;  5DUL A;  5JBI A;  4ZW8 A;  4AYS A;  5JAZ A;  3VVL A;  5JO0 A;  4R7L A;  4ZW6 A;  4XO4 A;  1T1R A;  4RCV A;  3FUL A;  3B7U X;  3FTW A;  3ZHX A;  3FHE A;  3FUE A;  1T1S A;  3B7R L;  3JSZ A;  4XND A;  3FUF A;  3AU9 A;  4A03 A;  2PUS A;  3FU5 A;  4XMW A;  3CHR A;  4OOE A;  4ZQT A;  4PVB A;  3QJX A;  3FTX A;  3CIA A;  3CZK A;  4Q4E A;  4GAE A;  4LUP A;  2QJ1 A;  2C82 A;  2XPY A;  1SQM A;  3CXB A;  1ONP A;  3JT1 A;  2XPZ A;  1ZS2 A;  4FLS A;  1JG9 A;  3FTS A;  4ZX4 A;  5HNH A;  2WPG A;  4AR9 A;  2HPT A;  2JD1 A;  5HNF A;  3RAS A;  4QHP A;  4MKT A;  4OOF A;  3ZHY A;  2JV7 A;  4XO3 A;  5DYF A;  4ARF A;  4ZX6 A;  3UEQ A;  1X3Z A;  2FFL A;  3RC8 A;  3ZI0 A;  3WQQ A;  3EBH A;  5JMP A;  2EGH A;  1H19 A;  2O7G A;  1HS6 A;  4R5T A;  4RSY A;  4ZQH A;  3FTU A;  3AU8 A;  3FTZ A;  3CHQ A;  3Q44 A;  5BPP A;  2Y1G A;  3CHS A;  4FCA A;  4XMV A;  4FLR A;  3EBI A;  3FH7 A;  3Q43 A;  3B3B A;  4Y6S A;  5JNL A;  3FH8 A;  3CZE A;  3UCQ A;  3FUH A;  4MS6 A;  3B2X A;  3UER A;  2Y1E A;  4GAA A;  1JGI A;  4K5L A;  4NQW A;  2MAO A;  5AEN A;  4XMU A;  4ZQF A;  3T8V A;  4AR8 A;  4XMT A;  3AUA A;  1Q0Q A;  3FTY A;  4AIC A;  4XN1 A;  4CXF A;  3ZHZ A;  2WZG A;  2R59 A;  3FU6 A;  1SC5 A;  1GW6 A;  4R5V A;  5EV7 A;  2VJ8 A;  1K5H A;  2ZXG A;  1MVY A;  4QIR A;  2DQ6 A;  4XN5 A;  5DLL A;  3B7S A;  2A7O A;  2JD2 A;  1OR7 A;  1G5A A;  3FUM A;  2VLA A;  2PGG A;  4QME A;  4XN7 A;  4R5X A;  4QUO A;  4J3B A;  3A06 A;  4XMX A;  4K5M A;  3FH5 A;  2WZF A;  4XN8 A;  4FLQ A;  3PUU A;  3A14 A;  1RP3 A;  1SG7 A;  2JCX A;  3B34 A;  3FUK A;  4ZN6 A;  4JND A;  3FTV A;  1R0K A;  1MW3 A;  4XN4 A;  4ZQE A;  3ANM A;  3CZG A;  1Q0L A;  4QPE A;  2HPO A;  4Y67 A;  2MAP A;  4ZQG A;  4XNB A;  1ONN A;  2DQM A;  3CHO A;  4L2L A;  4DPR A;  3KED A;  2JD0 A;  4Y6P A;  2Y1C A;  2PL5 A;  4FLO A; 
#chains in the Genus database with same CATH homology
 4XNA A;  4K5O A;  3WQR A;  4ZW3 A;  2C5Z A;  3R0I A;  4ZX5 A;  3IIE A;  1X3W A;  4K5N A;  2Y1D A;  2Y1F A;  3FUN A;  1H3L A;  4XN9 A;  3RC3 A;  3VVM A;  3ANN A;  4X2U A;  1Q0H A;  3CHP A;  2RJI A;  2B61 A;  3U9W A;  4ZX3 A;  5HLT A;  3CZL A;  3FU0 A;  2JCV A;  1R0L A;  3ANL A;  3B2P A;  3FUI A;  5JC1 A;  5JMW A;  4AR1 A;  4K5P A;  3FUJ A;  2JCY A;  3EBG A;  4XN2 A;  3T0Y A;  3FUD A;  2QVW A;  1JVS A;  4RVB A;  2R72 A;  1ONO A;  1S46 A;  4ZW5 A;  3B7T A;  5FWQ A;  2R70 A;  4XO5 A;  4ZW7 A;  4KP7 A;  1MW0 A;  3FU3 A;  1MW1 A;  2GTQ A;  3WQS B;  2XQ0 A;  3B37 A;  4PU2 A;  4Q4I A;  4XMZ A;  4Y6R A;  4PW4 A;  4BKX A;  1MW2 A;  5DUL A;  5JBI A;  4ZW8 A;  4AYS A;  5JAZ A;  3VVL A;  5JO0 A;  4R7L A;  4ZW6 A;  4XO4 A;  1T1R A;  4RCV A;  3FUL A;  3B7U X;  3FTW A;  3ZHX A;  3FHE A;  3FUE A;  1T1S A;  3B7R L;  3JSZ A;  4XND A;  3FUF A;  3AU9 A;  4A03 A;  2PUS A;  3FU5 A;  4XMW A;  3CHR A;  4OOE A;  4ZQT A;  4PVB A;  3QJX A;  3FTX A;  3CIA A;  3CZK A;  4Q4E A;  4GAE A;  4LUP A;  2QJ1 A;  2C82 A;  2XPY A;  1SQM A;  1ONP A;  3JT1 A;  2XPZ A;  1ZS2 A;  4FLS A;  1JG9 A;  3FTS A;  4ZX4 A;  5HNH A;  2WPG A;  4AR9 A;  2HPT A;  2JD1 A;  5HNF A;  3RAS A;  4QHP A;  4MKT A;  4OOF A;  3ZHY A;  2JV7 A;  4XO3 A;  5DYF A;  4ARF A;  4ZX6 A;  3UEQ A;  1X3Z A;  2FFL A;  3RC8 A;  3ZI0 A;  3WQQ A;  3EBH A;  5JMP A;  2EGH A;  1H19 A;  2O7G A;  1HS6 A;  4R5T A;  4RSY A;  4ZQH A;  3FTU A;  3AU8 A;  3FTZ A;  3CHQ A;  3Q44 A;  5BPP A;  2Y1G A;  3CHS A;  4FCA A;  4XMV A;  4FLR A;  3EBI A;  3FH7 A;  3Q43 A;  3B3B A;  4Y6S A;  5JNL A;  3FH8 A;  3CZE A;  3UCQ A;  3FUH A;  4MS6 A;  3B2X A;  3UER A;  2Y1E A;  4GAA A;  1JGI A;  4K5L A;  4NQW A;  2MAO A;  5AEN A;  4XMU A;  4ZQF A;  3T8V A;  4AR8 A;  4XMT A;  3AUA A;  1Q0Q A;  3FTY A;  4AIC A;  4XN1 A;  4CXF A;  3ZHZ A;  2WZG A;  2R59 A;  3FU6 A;  1SC5 A;  1GW6 A;  4R5V A;  5EV7 A;  2VJ8 A;  1K5H A;  2ZXG A;  1MVY A;  4QIR A;  2DQ6 A;  4XN5 A;  5DLL A;  3B7S A;  2A7O A;  2JD2 A;  1OR7 A;  1G5A A;  3FUM A;  2VLA A;  2PGG A;  4QME A;  4XN7 A;  4R5X A;  4QUO A;  4J3B A;  3A06 A;  4XMX A;  4K5M A;  3FH5 A;  2WZF A;  4XN8 A;  4FLQ A;  3PUU A;  3A14 A;  1RP3 A;  1SG7 A;  2JCX A;  3B34 A;  3FUK A;  4ZN6 A;  4JND A;  3FTV A;  1R0K A;  1MW3 A;  4XN4 A;  4ZQE A;  3ANM A;  3CZG A;  1Q0L A;  4QPE A;  2HPO A;  4Y67 A;  2MAP A;  4ZQG A;  4XNB A;  1ONN A;  2DQM A;  3CHO A;  4L2L A;  4DPR A;  3KED A;  2JD0 A;  4Y6P A;  2Y1C A;  2PL5 A;  4FLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...