2C60A

Crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
85
Chain Sequence
GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFO
total genus 20
structure length 85
sequence length 96
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c60A01
1C3TA 5L83A 3L16A 4ANWA 1WJ4A 2AEHA 4FULA 4DK5A 4WJNA 2A5UA 2LGDA 1LQBA 2RPQA 3ZW3A 4K7SA 1NBFC 2C7MB 4DHZE 2J0KA 2EMTA 4EKUA 4IWOA 4PS8A 1WJNA 3GOEA 3WA0A 2L7RA 4HJKA 3ZRFA 3K9OB 4WQOB 4EUTA 2MA9B 2BYEA 4ICUA 4BVUC 4MSQB 3DVNU 3DBHI 2LRUA 4URKA 4DDID 1SE9A 1XQQA 2Z59B 4AUQC 1M94A 4EEWA 2IY0B 2ZPYA 3VUXA 4ZRKA 3NHEB 1WZ3A 2M0XA 1V80A 1RLFA 3ECIA 2UYZB 1IPGA 2JPHA 2KDIA 3TL5A 1WRDB 5CHWA 2DYOA 4A3OA 2DZJA 4I6NB 2FUHB 4AOFA 3QARA 1WY8A 3AU4A 2NS5A 4YL8A 1D3ZA 4JLCA 4CYEA 4PS7A 1WMHA 3PV1A 2IZVB 2K39A 3ZO5B 5D6JB 3PHWB 2IO1B 4PYZA 3ZLZA 2MWSB 3VTUA 4IG7B 3N32A 4GDKA 4FBJB 3KH0A 4G0NB 5LXIB 2GMIC 4NAWB 5JH5C 3RZWC 4XX5A 4KVGB 1GJZA 4MJSB 4N9F4 3TJPA 2KFKB 2FCMA 4A20A 4WWPA 3V6CB 2KZRA 3L13A 3N3KB 4OVVA 1L7YA 3ENEA 1L2NA 2L0TA 4GDLA 4GB9A 1WE6A 3PPAA 4LDTD 2NPTA 2KMCA 4IWPA 2N4FA 2WX1A 3A1QA 1TGZB 2M4NA 2K1FA 4KSKC 4ANUA 1EF1A 4HLEA 4DWFA 3KUCB 1UGMA 4W9GA 3LDZE 3MTNB 2KWCA 4GU2A 1GNUA 3QK0A 3QCAA 2BYVE 1E8WA 1LXDA 4DHJB 3PT2B 3AULA 4JQWC 3QWZB 4BBNC 3DOWA 5AZGA 2N1VA 2MBQA 1H8CA 1RFAA 1YJ1A 2AL6A 2KX3A 5G55A 2EMSA 2DZKA 4AJYB 1P3QU 3VFKA 1GC7A 2KDEB 5E6PA 4BKGA 1UZXB 2MX2A 1UBQA 2DZIA 2NPTB 3ZNID 4GDLB 3UQAA 4AJWA 3L08A 4ZRJA 1WFYA 2PE9A 2ZPNA 4NNJB 3RUIB 3D32A 3MHSD 1C1YB 5J17A 2MLBA 3TCAA 2G4DB 3UINB 1JRUA 1WXSA 4WJOA 1GC6A 4B6WA 4IM0A 2JUOA 3VUYA 1E7UA 2KDBA 2DHZA 2K8HA 3M62B 2LXCA 3VH3B 3H9DA 4JGHB 4K7UA 2RR9A 1KM7A 1EO6A 4FA6A 3DVNV 3GZNI 4MM3A 1X1MA 1UELA 2D3GA 2CS4A 2I1KA 3UGBB 3ZTDA 3T8MA 3W1SC 4K7WA 1WI0A 4FHJA 3IVFA 2ZZPB 2QHOA 2KKCA 4GN1A 2IY1B 3DPDA 3BINA 2O6VB 2PJHA 1WIAA 1R4MI 3H6NA 1T0YA 4TV3A 1TBEA 4EOYA 5AZHA 1EF5A 1EUVB 1QZEA 4KDIC 1UD7A 4GSWA 4W9IA 3NZSA 2Y5BB 1SIFA 4RM8A 4KV2A 1WXMA 1S3SG 2J0JA 4GOCA 3QC8B 2BGFA 5DPTA 1LFDA 2ZNVC 3NOBA 3KVFB 3PRPB 2ZJDA 3RYTA 2L00B 4M8MA 4ZRIA 1WR1A 4IWQA 1UH6A 2NCNA 4W9JA 4EZKA 2K8CA 2C7NB 3JW0X 4II3B 4NJ6A 2KK8A 2GOWA 2KOXA 2V3SA 2W9NA 1V5OA 3U30A 1VCBA 1YX6B 2GBJA 4LDTB 3H1UA 2KMAA 2WWZA 3IG3A 2REXA 2V4LA 2I1JA 1Z2MA 2LJ5A 2KXJA 3L17A 3S2AA 2FAZA 4J6IA 1E8XA 1WXVA 2LASA 3UQBA 2XK5A 3P2BA 5L95C 4DHJD 3NY5A 3WANA 2HTHA 2ZCBA 1AARA 1YD8U 3L54A 2FIFA 2KTRA 2M17A 3VUWA 2BKRB 3CSTA 4IM3A 1KOTA 3SDLC 2MBOA 1UBIA 3OJ3A 1H4RA 1XT9B 2MBBB 3RD2A 4ANXA 2DENB 3QAQA 2L3ZA 4IW0A 2NBVB 2K6QA 3ZTCA 5JHAA 2CHWA 4MGYE 3R7QA 3ALBA 3PRMB 4BKSD 5C23A 4EZLA 1TTNA 2L76A 1OGWA 2VRRB 4PS3A 2HJ8A 3M3JA 5C1ZA 2C60A 3AI5A 3EHVA 3VVWB 1NI2A 2K6DB 2XEWA 3VAWA 3RULA 2K25A 1WGGA 3DBRI 4FLHA 4FHKA 2DYBA 2Z0EB 3LJ3A 1RRBA 3X0WA 4KZCA 2M8SA 3PLVA 2D07B 2DYMA 4HK2A 1ZKHA 1GUAB 2WDTB 2Z0DB 3EC8A 1P9DU 2D10A 3APFA 4WJQA 2N7EA 1LM8B 4W9HA 2IO3B 3C0RB 2KLCA 2R2OA 2N9XA 4DDGD 4HCNB 4NQLB 2O6VD 3N30A 4RMAA 3R7RA 3R3MA 2KO3A 2MP2B 3M63B 2BKFA 2KWVB 3APDA 4M8NA 5CHFA 3VQIA 4KIKA 2MBEA 3VH4B 3WAOA 4WWNA 2XK5B 2O2VB 4JL9A 4NPNA 4BKSA 5E6OA 3VXWA 2KFJA 3A4SC 3AU5A 2MCNB 5J18A 3O65B 2NR2A 2FCNA 2OOBB 3QJZA 5DPSA 1BT0A 2M1MA 3NS8A 4F1SA 1J19A 3RCZA 3ZNHB 3H7PA 2HD5B 2G4SA 4F8CB 1WE7A 2FCSA 4W9EA 3QQ8B 2JT4B 3Q3JA 4WJPA 4DXAB 1ZW7A 3VTVA 1WM3A 1NDDA 1WGRA 2OJRA 3JYUA 4K1RB 2KJRA 4MSMB 2J7QB 4FJYA 1WM2A 1V9JA 5KHQA 4BBNF 4XC2A 2KJ6A 5G2NA 3ML9A 2EKEC 5DPRA 3VHTC 2LVQA 5CX3A 5D94A 4IUMB 4MELA 4GIVA 1OEYJ 3KW5B 3HM6X 3VTWA 2KNBA 4W9LA 4IM2A 3U7DA 3PVLA 2DAFA 4HWIB 2NBUA 3OLMD 2BWES 2ZVNA 3QA8A 2DAJA 3KUZA 2KTRB 3ZDMC 2JRIB 4LCDE 1V5TA 2GBRA 3JSVB 2K8BA 2WX0A 5D2MB 3HM3A 4HCPB 2HE7A 4MDKE 2YVCA 5AZFA 1R4NI 1OQYA 1WYWB 1KLVA 2KD0A 4ZDVA 3PZDA 3DBSA 2ASQA 2IO2B 4B95A 3A1QB 5J2RA 1A5RA 3UF8A 2KHWB 5BO4B 4TQ0A 3DVGY 4BOZB 2WYQA 5KHOA 2R2QA 1WR6E 3A9KB 4EFOA 4TKNA 4E74A 5JHBA 2LXAA 3A9JA 3ZNGC 3M95A 3APCA 3ZKJC 2KWUB 3WAPA 1KJTA 3A9JB 4CHKA 1V2YA 3DCGA 3V60A 1VD2A 5AEKB 1J0GA 2LGYA 4NY0A 1WJUA 2NVUI 3A9KA 3Q3FA 3VDZA 1GG3A 4KSLC 2JWZA 4HDOA 2ZVOA 2V1YA 2JVCA 1E7VA 2CHZA 3OAWA 2LZ6A 4NAWA 4GDKB 3UIOB 2MBHA 2FNJB 2ZCCA 3L10B 4GGQA 4I6LB 4BFRA 3WALA 3A33B 3DBLI 4GXBA 3PTFC 3SHQA 3BY4B 4HVBA 4FJZA 3HK0A 3PSEB 3JSVA 4K81A 4KZ0A 2L8JA 4BOSC 1Q0WB 1WGYA 2DZMA 3V61A 2KQSA 4A3PA 4ASWC 3K9PB 2IYDB 3ZVVA 2KC2A 3ZDTA 5TR5A 3KYCD 4LJOB 1WH3A 2AWTA 1OTRB 3DVGX 2O6VA 2A4ZA 3X23A 1WXAA 3B0AA 2LVOA 1YIWA 2MP2A 3L0WB 4G50A 2N9PC 3R66C 2ZEQA 3KYDD 1OEYA 5E6NA 3MJWA 2KLGA 2B3AA 1SGHA 5GMVA 4ZYNA 2KJHB 1F9JA 4ANVA 2LVPA 5CHVC 1XD3B 1WX9A 4DBGA 2GBNA 3QHTA 4PYUA 1V81A 2KFKA 3WIMA 1S1QB 2D2QA 4W9FA 4HDQA 4BKTA 3A4RA 2N7DA 3WAMA 1RAXA 1I42A 2KTFA 2KANA 3JVZX 3PHXB 4HPMB 4II2B 4G11A 3SU8X 2L0FA 3ZIMA 1Q5WB 1V86A 4WAAA 3ONSA 2DX5B 2PE6B 3HIZA 4TUUA 2RD0A 1TZ1A 3W1YA 1WJ6A 3V62A 2LUEA 2JY6A 3PREA 3H7PB 1Y8RC 2MQJA 2PEAA 5DPWA 4FADA 3QIJA 3TBLD 4LJPB 3DDCB 5LLIA 2BWFA 2C5LC 3CMMB 3NZUA 2G45B 2KN5A 2MRPA 2KDFB 3IBEA 2JXXA 1WX7A 3RT3B 1K8RB 3EFUA 3PS6A 3B08A 4KIKB 2KVRA 1G6JA 4F7ZA 3T9LA 2LRWA 3U8ZA 3AXCA 2PPHA 2ZNVB 2L05A 1MG8A 1V6EA 2MSED 2D11A 3ZRCA 1P1AA 4B9KA 2MW5A 1E5WA 4MEMA 2FCQA 4NJ7A 4W9KA 2RSUA 5FR6A 4XZ4A 2CKHB 5DCNA 3PGEA 3IHPC 1E8YA 3KUDB 2RGFA 4M0WB 1ZGUB 3SD5A 5D7GA 2JZ3B 2YLMA 3QX1A 2BF8B 1J8CA 2AL3A 4E71A 1WGDA 2JZZA 4NQKE 2JF5A 4CO7A 4E3CA 1Z5SB 2CHXA 4JIOU 1WZ0A 4MGKE 4HXDA 2IBIB 1P0RA 5JZEB 2KQ7A 1P98A 1U4AA 3RZFA 2C7HA 3I3TB 4WWOA 1WGHA 1WF9A 4MGIE 2LGXA 5IAAC 1I35A 3ZNZB 3IFWB 1PQSA 4X57B 4MGZE 1E8ZA 2CR5A 4GMVA 2AYOB 2JRHA 1E90A 1CMXB 5EDSA 4DHZB 2LWPA 1WMHB 1YX5B 3DQVA 2CU1A 1FXTB 1WX8A 4FJVB 4W9CA 1IP9A 1Q1OA 4IC7B 4TQ1A 3ZUNA 2G3QB 3OJ4B 2GBMA 1ISNA 2KC1A 2GBKA 2NBWB 3EECA 2UWQA 4FN2A 3UIPB 3CSFA 2N1WA 4W9DA 2KX0A 2XBBC 4ICVA 4P7IA 2C9WB 4AWJA 4MH0E 3PRZA 4G3XB 2O2VA 1V49A 5CTRC 3CF6E 2IO0B 3ML8A 4KDLB 4EZJA 2J0MA 3B1LX 4HPLB 4OVUA 2BPSA 5HKHA 4I6PA 2BYFA 4AP4C 1IYFA 1HE8A 2LD9A 3PLUA 5IA7A 4RM9A 3TMPB 2FIDA 5LXHA 3W1SA 3V6EB 4MJSA 1YQBA 2LI5A 3HHMA 3TIXA 3H7SA 2N9EB
chains in the Genus database with same CATH superfamily
4ANWA 4XE0A 4FULA 4DK5A 1L5PA 4WJNA 1LQBA 2RPQA 2C7MB 4DHZE 4PS8A 1WJNA 1FFUA 4HJKA 3K9OB 2MA9B 2BYEA 3ZGZA 4ICUA 1SE9A 2PVOD 1XQQA 3LB8C 5H8YE 2GB1A 1TJEA 2ZPYA 4ZRKA 3N9YC 2M0XA 4CQNA 3U4EG 3MC0B 3RMKC 1L4ZB 1MHHE 1WRDB 2GLSA 4OHJA 3TL5A 2NS5A 3AMZA 3PV1A 5D6JB 2IO1B 4ZOHC 5G5HA 3VTUA 3N32A 4UDUC 3KH0A 1YJJA 5JH5C 4KVGB 1GJZA 2FCMA 2L0TA 4GDLA 4GB9A 1WE6A 2KMCA 4IWPA 1PFDA 3A1QA 1TGZB 4L23A 1TY2A 1VR9A 4HLEA 3DBRB 4C80A 2XN9C 3W5VB 2JU6X 4GU2A 4DHJB 1LXDA 3BVGA 3QWZB 5AZGA 1AN8A 2MBQA 3VR9B 1KF6B 1RFAA 3AE7B 3ZQ4A 2KX3A 5G55A 2DZKA 2L52A 1QKZA 1UZXB 1XO3A 2MX2A 1OQQA 3ZNID 3RNEC 4ZRJA 1WFYA 3RUIB 4NNJB 4FXCA 5HHDG 1N6ZA 3VUYA 2DBYA 2DHZA 2LXCA 2WXHA 1SEBD 3VH3B 2INPE 1I4PA 4K7UA 1KM7A 5BMGA 1ZDXA 4MM3A 2D3GA 1B9RA 1WYGA 3W1SC 3I63C 2QHOA 3H6NA 2QCZA 4EOYA 1TBEA 3E9SA 4GSWA 2ICIA 4RM8A 4WAFA 4KV2A 4YSZB 1N5WA 3NOBA 4M8MA 4ZRIA 1ZDVA 1F0ZA 1WR1A 1UH6A 1RM6C 1JWSD 2C7NB 4II3B 4NJ6A 2V3SA 2GOWA 4KGSA 4S17A 4WURA 2KMAA 2WWZA 2REXA 2V4LA 4J6IA 1D5ZC 3GE3C 2XK5A 4M0WA 3NY5A 1NVID 1YD8U 4C56C 1I4QA 2D3AA 3SDLC 2MBOA 1KOTA 3RPFC 1H4RA 2LHEA 1EM7A 2MBBB 3MP9A 4C4VA 4IW0A 3ZTCA 5JHAA 1OQRA 2CHWA 3PRMB 4PS3A 2HJ8A 5C1ZA 2LHDA 4YTPB 3EHVA 2NTSA 1NI2A 3VVWB 3ZXVA 3TEZA 4ZHPA 1MJDA 4FHKA 2DYBA 4C4VB 2Z0EB 2M8SA 3PLVA 2DYMA 2JXTA 1F77A 4RNAA 3HRDD 4DDGD 2MP2B 3VQIA 1IGDA 1AWDA 1SJED 2IGGA 2XK5B 1FRDA 2O2VB 4JL9A 1V97A 3MC9A 2K0PA 3A4SC 3NJTA 3Q14C 2MCNB 1ZUD2 5J18A 3O65B 2NR2A 2OOBB 3NS8A 3C19A 3RCZA 3ZNHB 2HD5B 4F8CB 1WE7A 2QIEB 1ZE3D 2MHJA 4RGOS 3QQ8B 4WJPA 3LXFA 5BMIA 1OFFA 4HEA1 3BYTB 1V9JA 5KHQA 1E10A 4BBNF 2KJ6A 1XCQL 5HFYA 2EKEC 2LVQA 1QQRA 2BB5A 1OEYJ 3KW5B 4LNIA 3MFGA 3PVLA 2DAFA 2NBUA 3OLMD 5FK9C 2BWES 2RDGA 4DXFA 4LCDE 2K8BA 2WX0A 1NEKB 3P4QB 4ARCA 4MDKE 1R4NI 1OQYA 1KLVA 4ZDVA 3A1QB 5J2RA 1QLBB 2PW9A 4BOZB 1T0SC 3A9KB 3APCA 4XYCA 3DCGA 2AQ1B 1WJUA 2NVUI 4HKQA 4KSLC 1UGJA 3A33B 4GXBA 3SHQA 4HVBA 3PSEB 2WDRB 3DHGC 4B0EA 2IDYA 2KQSA 3K9PB 5LNK1 5TR5A 1ACCA 3KYCD 1WH3A 1F52A 1FCCC 3B0AA 2ON8A 4US9A 2B3AA 2KJHB 5CHVC 1XD3B 3WIMA 1V81A 3J9CA 1GOZA 3A4RA 2PVGC 2INNE 4G11A 1TS2A 4RGNA 2QC8A 1Q5WB 2PE6B 1FCLA 2LUEA 3PREA 1TIFA 1Y8RC 3AECB 4NZLB 3GP7A 3RNFC 1HTQA 1ENFA 1N61A 5LLIA 3CMMB 3NZUA 2G45B 3IBEA 5C3JB 2Y5CA 1WX7A 1G6JA 2PLPA 2ZNVB 2L05A 2D11A 2MW5A 5E6JA 3V05A 1E5WA 1JWUD 4MEMA 2FCQA 5FR6A 3EGRA 2RGFA 3SD5A 3QX1A 2AL3A 1SE3A 3VRAB 4MGKE 1P0RA 2FE8A 4PT5A 3RZFA 2C7HA 1WF9A 1CJEA 1DYQA 5TSSA 4MGZE 1GB4A 4N58A 3ZYYX 1E90A 1VZ6A 4DHZB 3W5UB 1J7AA 4OZAA 2BB6A 3HUIA 1Q1OA 1XCTL 4LNOA 2WXNA 2G3QB 1ZXIA 3OJ4B 3EECA 2NBWB 3UIPB 2XBBC 4ICVA 3GS2A 2O2VA 1K50A 2IO0B 3IAS1 3BVMA 4KDLB 4EZJA 2NTTA 2J0MA 3IT6B 2RDBC 4LNKA 1RFKA 4MACA 3PLUA 4RM9A 5LXHA 1YQBA 3HHMA 2HTME 1JMLA 3DPDA 2N9EB 5L83A 1K53A 2WXQA 2AEHA 2A5UA 4K7SA 4C00A 1NBFC 2J0KA 2EMTA 2MJ3A 3AE1B 3WA0A 4O1NA 2JQRB 3Q8BA 4MSQB 3DVNU 2KYWA 4DDID 3CWIA 2IY0B 4YTMB 3VUXA 3NHEB 1WZ3A 2UYZB 4JWUC 4YT0B 4JX1C 5CHWA 2M56B 4A3OA 1JWMD 4I6NB 2FUHB 4YL8A 4JLCA 3P42A 2IZVB 2K3UA 5EE9A 2MJEA 4NAWB 5JXVA 2DLBA 2J4XA 2WHIA 2KFKB 2KZRA 3N3KB 1BUIC 1KLUD 3I5JC 3PPAA 1C9FA 2N4FA 2WX1A 4AQ7A 4KSKC 5C2TB 1Y56A 2W3SA 2KACA 2KWCA 1FM0D 3QCAA 4L2YA 1E8WA 4QAYA 2HJ1A 3HVZA 3AULA 4JE3B 4BBNC 3DOWA 1H8CA 3ZJUA 2AL6A 5T8IA 4AJYB 2K5PA 1KTKA 2NPTB 1UBQA 2DZIA 1ROEA 4BAXA 4P1CC 5D3DA 2EELA 4AJWA 3MHSD 1C1YB 5J17A 3TCAA 2XNAC 4WJOA 1GC6A 2M19A 3B2FA 2KDBA 3U7ZA 1EWYC 4JWSC 1QT9A 4JGHB 1EO6A 4JPSA 3UGBB 2L32A 1C78A 2PMVA 3VRBB 1SXTA 3AEGB 2IY1B 4TV3A 3BINA 2PJHA 1R4MI 4Q2JA 1EUVB 1QZEA 1UD7A 4W9IA 3NZSA 3RNBC 4WIPA 1GAQB 2J0JA 3QC8B 2BGFA 5DPTA 2ZNVC 2L00B 4IWQA 4RCOA 1FNUA 4N59A 3JW0X 1T0QC 2OJWA 2W9NA 2FBWB 3U30A 1VCBA 1YX6B 4LDTB 3H1UA 3IG3A 1K52A 1TZOA 3BK2A 2WXRA 3L17A 4AS1A 2INDC 3TEXA 1DOYA 1WXVA 1QILA 3P2BA 4KGTA 4USAA 1ZXHA 3WANA 5BMHA 2FIFA 2V3NA 3VUWA 1RYJA 4YSYB 1FXAA 4WH4A 2JZPA 2WP9B 3TUOA 4RGMA 3RD2A 2LFIA 1BMLC 3QAQA 2L3ZA 2NBVB 4MGYE 3R7QA 5C23A 3Q8EA 1YN4A 2VRRB 3M3JA 3P4RB 2K6DB 2XEWA 3SFDB 3RULA 3DBRI 4H2AA 3LJ3A 1RRBA 3N1ZC 1YJIA 2YEPF 2Z0DB 1FO4A 1LM8B 2IO3B 1EWCA 2KLCA 2MEKA 2N9XA 1JCKB 4NQLB 3N30A 3R3MA 2KO3A 3M63B 2BKFA 2KWVB 2MBEA 2IGDA 4BKSA 1STEA 5E6OA 3VXWA 2KFJA 3R8BA 3QJZA 1BT0A 2M1MA 2Q5WD 2R61A 3Q3NC 2WDQB 3O13A 1VLBA 2G4SA 2I2YA 3T3OA 2QSDA 1HA5A 4NAMA 4P1BC 2SAKA 1CK1A 3ABVB 1ZW7A 3VTVA 1NDDA 3JYUA 2KJRA 4FJYA 2LGSA 3TSSA 4MELA 3HM6X 3VTWA 3U7DA 4KX6B 2WXJA 4A55A 1V5TA 2GBRA 1PUTA 5AZFA 5MPOA 1N62A 3PZDA 3DBSA 2IO2B 4TQ0A 3DVGY 2WYQA 3NG0A 2W82A 4US8A 5JHBA 1WRIA 2RPVA 2KWUB 1JWBD 1KJTA 3VDZA 1IUEA 4XWWA 2JVCA 1E7VA 2LZ6A 2MBHA 2FNJB 3L10B 2V9HA 3U52E 1LGRA 3PTFC 3EUB2 3HK0A 4IOIE 2J52A 1WGYA 4ASWC 3ZDTA 1MG4A 3HVDA 1I4HA 3X23A 2GI9A 1YIWA 3P1MA 4G50A 2N9PC 3R66C 2ZEQA 1OEYA 4S0RA 1MPEA 4DBGA 1WX9A 4RF1A 3BVZA 2D2QA 4HDQA 3I9V1 3NZ3A 2KTFA 1N63A 3ZIMA 4N6EB 2WXFA 2WU5B 3ONSA 2RD0A 3R2IA 2MQJA 1SB3C 5DPWA 2DNFA 3QIJA 2C5LC 3DWMA 2V0GA 1K8RB 4B0MA 2KVRA 1LO5D 2LRWA 2QMTA 3N1YC 1V6EA 1XLQA 4NJ7A 2N9KA 4WWMA 3IHPC 1E8YA 1HZ6A 1ZGUB 3DWGC 2BF8B 2IPKD 4E71A 1WGDA 1KH0A 3AH7A 5FR3A 4E3CA 1Z5SB 4HXDA 2IBIB 4HKZE 4IDIA 1P98A 3U2SC 4LLGM 1WGHA 4MGIE 1FNWA 1D5MC 2KQ4X 2CR5A 3DBLB 4GMVA 5BYRA 1SF0A 1YN5A 3DQVA 1FXTB 5AUIA 1IP9A 4IC7B 4MH8A 3B9JA 4PK1A 2INCC 3PRZA 2FUG1 4G3XB 1V49A 5CTRC 3CF6E 4ZRQA 2LEKA 1HEZE 1JALA 2FIDA 1N60A 3W1SA 4MJSA 3TIXA 3H7SA 2OHFA 1FXIA 3BK1A 1WJ4A 3AB5A 2LGDA 1A70A 1E9MA 4REZA 4EKUA 3AE6B 4IWOA 4GLSC 1IBXA 3GOEA 4BZAA 2L7RA 1SBBB 3DBHI 2LRUA 4K3CA 2RDHA 4AUQC 1M94A 4TMAB 3RNGC 1RLFA 3PZ8A 4TSSA 2JPHA 1DOIA 2KDIA 1P7FA 2QILA 3QARA 4AOFA 1WY8A 1T5XD 4CYEA 2N9LA 2K39A 4YXDB 3ZO5B 3WCQA 3PHWB 5IKCM 4PYZA 3ZLZA 1F1HA 2MWSB 4FBJB 4G0NB 2GMIC 3ZJTA 3RZWC 4XX5A 2LJIA 2JSVX 4N9F4 3TJPA 3BYYB 3AE4B 3V6CB 3AE5B 3L13A 2WDVB 2NPTA 1F2RI 3BIID 3KUCB 1UGMA 4W9GA 3LDZE 2L83A 3TEYA 4JQWC 1YJ1A 2GRIA 1MHXA 4LNFA 1SJHD 1WSPA 1GC7A 3VFKA 2KDEB 4BKGA 3AEDB 3URYA 2KVZA 4GDLB 2ZW1A 2ZPNA 2AQ2B 3D32A 1CQVA 3MC8A 3RI7C 5HG2A 2G4DB 3UINB 3ZXRA 1ET6A 1JRUA 1WXSA 4B6WA 1QOGA 2JUOA 1I4GA 2BS4B 3H9DA 3AE3B 4RF0A 1UELA 3ZTDA 2CS4A 1EU3A 2I1KA 3T8MA 2J42A 2VZKD 3IVFA 3PO0A 2ZZPB 2HDEA 1MI0A 4XDCA 1XEEA 1T0YA 3IAM1 5AZHA 1ZP0B 2Y5BB 3IXSA 1WXMA 4GOCA 1LFDA 3KVFB 3I57A 3RYTA 2Y3AA 2QDFA 1TY0A 1T0RC 2NCNA 1TS3A 1NI3A 4EZKA 2K8CA 2N0SB 2KK8A 2KOXA 1FD6A 1HTOA 2KAJA 1V5OA 1BXTA 2X38A 1PGBA 1TS4A 3BZDB 1Z2MA 2KXJA 3S2AA 2FAZA 2BBCA 2JWUA 2LASA 4OZBA 3UQBA 1FMAD 4XGAB 4DHJD 2WXPA 2HTHA 3L54A 2M17A 1JWAD 2BKRB 3CSTA 4A6QA 1UBIA 3OJ3A 3NVWA 1XT9B 1HQRD 2JYEA 2DENB 1GPXA 2K6QA 2PIAA 4EZLA 3ALBA 4IKGA 4A9AA 3FILB 2L76A 1OGWA 1UF0A 4J3OD 1EU4A 2C60A 3AI5A 3N20C 1I4RA 3VAWA 1B1ZA 3W2DA 1R4MB 2K25A 3X0WA 2WXLA 1I4XA 2D07B 1ZKHA 1GUAB 2WDTB 3EC8A 3LYYA 3APFA 2WLBA 3C0RB 1C76A 2R2OA 4HCNB 2VH2A 4KIKA 3ETRA 3WAOA 4WWNA 5IOIA 2MJDA 1L0VB 3N1XC 2W3RA 3SEBA 3AU5A 3Q6BA 4R3DA 1TKEA 3KWLA 2BTEA 1IBXB 2FCSA 1FIQA 3Q3JA 3AEFB 1FEHA 2D3CA 1HZ5A 1WM3A 4K1RB 1TKYA 4KKIA 3T3NA 1WM2A 3VR8B 2WXOA 1L4DB 5DPRA 3VHTC 1T3QA 1SSNA 5D94A 4IUMB 1V1PB 4GIVA 4W9LA 4IM2A 2K22A 2ACZB 1ZOYB 4HWIB 3QA8A 2DAJA 3KUZA 2BS3B 2V3PA 2HE7A 4RH6A 3AN1A 1WYWB 2AX5A 4B95A 1A5RA 2KHWB 5BO4B 5KHOA 4EFOA 1FPYA 2X8XX 3AEEB 3A9JA 2VZKB 3FC4A 3M95A 5AEKB 1V2YA 1VD2A 3V3XA 2LGYA 3A9KA 3FILA 1GG3A 2WNMA 2JWZA 4HDOA 4GDKB 3UIOB 2ZCCA 4DQOC 2WS3B 3WALA 2E3TA 4FJZA 3RN9C 4K81A 1CZPA 4KGRA 1WGKA 2DZMA 4A3PA 2KC2A 2AWTA 5GXGB 1OTRB 3DVGX 2E6XA 2O6VA 1WXAA 4NJCA 2MP2A 2W54A 3KYDD 1WWTA 2KLGA 1WXQA 3MJWA 5GMVA 2BYTA 4L1BA 1D5XC 4ANVA 2LVPA 2PKOA 2GBNA 4PYUA 1R7SA 4W9FA 4MT5A 4BKTA 1PGXA 2RMMA 3JVZX 3PHXB 1QF6A 3SU8X 1R4NB 1V86A 4WAAA 3HIZA 4TUUA 1TZ1A 1WJ6A 1VDVA 1GB1A 1TKGA 2JY6A 1HXYD 2PEAA 4FADA 3TBLD 1XF5L 1XXGA 2BWFA 2KN5A 2KDFB 2JXXA 3NRZA 3PS6A 3B08A 2NMQA 4F7ZA 2WXKA 3MHZA 2ZW0A 4B9KA 1P1AA 4RFBA 2J53A 2H88B 1E6EB 2RSUA 4ZRPA 2CKHB 3KUDB 3P4SB 2JZ3B 2YLMA 1J8CA 1AW7A 2JZZA 4NQKE 2JF5A 4CO7A 2CHXA 1WZ0A 3DHIC 1JQ4A 4HPPA 4WWOA 2LGXA 1I35A 1L0YB 5IO9A 1PQSA 4X57B 4RGTA 2JRHA 1CMXB 1TYGB 5EDSA 2LWPA 1YX5B 2CU1A 2CJOA 1WX8A 4W9CA 3ZUNA 1ISNA 2GBKA 4P16A 4W9DA 4LTUA 4P7IA 4MH0E 1FRRA 1QOBA 2D5GA 3EA6A 3AV8A 2V4IB 4A8XC 4HPLB 4OVUA 2BPSA 5HKHA 2BYFA 2LD9A 4EE2A 5IA7A 3TMPB 2B76B 2LI5A 1D6EC 1YQ3B 2SEBD 3Q8AA 1C3TA 2UU7A 3L16A 3MJ5A 1E7PB 3AM9A 3ZW3A 4YWGG 4HRSA 1XLOA 5BYQA 3ZRFA 4EUTA 4WQOB 2WU2B 4BVUC 1FNVA 4XDDA 2WXIA 4URKA 1M4VA 2Z59B 1P7EA 4LK0M 4EEWA 1NYQA 1C4PA 1V80A 3ECIA 1IPGA 3RNCC 1PYWD 1ZPSA 1VZ7A 3DBHB 2DYOA 3NS1A 2DZJA 2MH7A 4M02A 3NUHB 4DXGA 3AU4A 1D3ZA 4PS7A 1WMHA 2K9XA 1YMHE 2WGSA 4IG7B 4ZHOA 4GDKA 5LXIB 1L6VA 4OW0A 2LGIA 3OWEB 4MJSB 1J7BA 2OEDA 4A20A 4WWPA 4C7ZA 1L2NA 4OVVA 1L7YA 3ENEA 3UI3A 4HROA 2BQQA 1ET9A 4LDTD 5FKAC 2AQ3B 1VRAB 2K1FA 2M4NA 4ANUA 1EF1A 4DWFA 1JROA 3MTNB 1GNUA 3QK0A 2KWDA 2BYVE 3PT2B 3EFCA 1N5XA 1L6UA 1QOFA 2N1VA 3FAHA 3RFZB 1K51A 2EMSA 3IT4B 1P3QU 5HI1A 5E6PA 2IGHA 4OZCA 3UQAA 3L08A 3P4PB 2PE9A 4ITKA 1PGAA 3NVYA 2MLBA 4IM0A 1E7UA 2K8HA 3M62B 2RR9A 4FA6A 3DVNV 3GZNI 1X1MA 4A90A 3OG5A 2YEPB 1SIJA 4K7WA 1WI0A 4FHJA 4K3BA 1SE2A 2H89B 2KKCA 1IGCA 4GN1A 1UWXA 2O6VB 1WIAA 2EKIA 1EF5A 4KDIC 4M00A 1SIFA 1YOVB 1KRHA 3AE8B 5H92C 3Q3MC 1S3SG 3PRPB 2ZJDA 4C7YA 1Q10A 4W9JA 2QJLA 3W9CB 3RNAC 1V8CA 2GBJA 1VZ8A 1F2RC 2I1JA 2LJ5A 3PZ7A 1E8XA 2TSSA 2CJNA 3AE2B 5IN7A 5L95C 2ZCBA 1AARA 2KTRA 4XWTA 2KN4A 4IM3A 3P63A 2ONQA 3AE9B 3Q69A 4ANXA 3FKYA 1ESFA 2CU3A 1V1PA 1JW9D 1T6BX 4BKSD 1TTNA 4HJGE 2KT7A 3BWUD 1WGGA 4FLHA 4KZCA 3C8YA 1UWMA 4HK2A 3KLSX 1P9DU 2D10A 4WJQA 2N7EA 1FFVA 4W9HA 1DGJA 2WQYB 2O6VD 4RMAA 3R7RA 5G5GA 3APDA 5CHFA 4M8NA 3VH4B 2PTLA 4NPNA 3TEWA 1PDXA 2FCNA 1UUPA 5DPSA 1C79A 4F1SA 1AYFA 1J19A 3R2TA 3H7PA 1TS5A 1V1OA 4ARIA 4W9EA 2IJ0A 2JT4B 2BVCA 2KMMA 4DXAB 2D3BA 1WGRA 2OJRA 1VJKA 1QOAA 4MSMB 2J7QB 2KDMA 1KLGD 4XC2A 5G2NA 3ML9A 2I38A 5CX3A 1C77A 1D4BA 5IP4D 3E56A 2KNBA 4WQMA 4P6VF 1RWSA 1E0ZA 2ZVNA 3Q3OC 3ZJVA 1KFYB 4KKJA 3GB1A 2Y5PA 2KTRB 1MFWA 3ZDMC 2JRIB 3KWVA 4ACFA 3JSVB 5D2MB 3HM3A 4HCPB 2YVCA 3AEBB 2G1EA 2KD0A 2ASQA 1L0XB 3UF8A 2R2QA 1WR6E 3Q2AC 4TKNA 4E74A 2LXAA 3ZNGC 3ZKJC 2DWQA 3WAPA 1JRPA 3A9JB 4CHKA 3V60A 1J0GA 4NY0A 3Q3FA 2ZVOA 2BS2B 2V1YA 2CHZA 3OAWA 4NAWA 3H8HA 4GGQA 4I6LB 2G9HD 4BFRA 3DBLI 3BY4B 3JSVA 4KZ0A 2L8JA 3L4PA 4BOSC 2JYTA 1Q0WB 3V61A 2IYDB 3Q8FA 3ZVVA 4LJOB 1NYRA 2A4ZA 2LVOA 3DHHC 1YQ4B 3SR6A 1C4CA 3L0WB 5E6NA 1SGHA 4ZYNA 1F9JA 2WXMA 5BYSA 3NVVA 3QHTA 2KFKA 1S1QB 2N7DA 4ZYSA 3WAMA 1RAXA 1I42A 2KANA 4HPMB 4II2B 1UNSA 2L0FA 4M01A 1TT5B 4LNNA 2DX5B 1MVKA 3W1YA 5I4DA 3V62A 1XLNA 3NVZA 3CIRB 3H7PB 2LUMA 1J7CA 2LMCA 4LJPB 3DDCB 4OVZA 2MRPA 2JX5A 1SE4A 2QEJC 2N7JA 3RT3B 3EFUA 4KIKB 2WXGA 3T9LA 3U8ZA 3AXCA 2PPHA 3ZRCA 1MG8A 2MSED 5EE1A 4W9KA 3AEAB 4XZ4A 3SFEB 5D3IB 3GZNB 5DCNA 3PGEA 4YTNB 4M0WB 2BT6A 1DOXA 5D7GA 1I7HA 5AUKA 4JIOU 3GE8C 5JZEB 2KQ7A 1U4AA 3I3TB 5IAAC 1YNTE 3ZNZB 2W55A 3IFWB 1NENB 1E8ZA 2M0AA 2AYOB 4D2KA 1WMHB 4FJVB 4YSXB 3B2GA 4TQ1A 2GBMA 2KC1A 3Q8CA 4FN2A 2UWQA 3CSFA 2N1WA 2KX0A 2C9WB 4AWJA 1C4AA 1YN3A 3KQ4A 3ML8A 2Z8LA 5EE3A 1XLPA 2VH1A 5EE0A 2BW2A 3B1LX 2L1AA 4I6PA 4MM3B 4AP4C 1IYFA 1HE8A 3V6EB
chains in the Genus database with same CATH topology
1C3TA 5L83A 3L16A 4ANWA 1WJ4A 2AEHA 4FULA 4DK5A 4WJNA 2A5UA 2LGDA 1LQBA 2RPQA 3ZW3A 4K7SA 1NBFC 2C7MB 4DHZE 2J0KA 2EMTA 4EKUA 4IWOA 4PS8A 1WJNA 3GOEA 3WA0A 2L7RA 4HJKA 3ZRFA 3K9OB 4WQOB 4EUTA 2MA9B 2BYEA 4ICUA 4BVUC 4MSQB 3DVNU 3DBHI 2LRUA 4URKA 4DDID 1SE9A 1XQQA 2Z59B 4AUQC 1M94A 4EEWA 2IY0B 2ZPYA 3VUXA 4ZRKA 3NHEB 1WZ3A 2M0XA 1V80A 1RLFA 3ECIA 2UYZB 1IPGA 2JPHA 2KDIA 3TL5A 1WRDB 5CHWA 2DYOA 4A3OA 2DZJA 4I6NB 2FUHB 4AOFA 3QARA 1WY8A 3AU4A 2NS5A 4YL8A 1D3ZA 4JLCA 4CYEA 4PS7A 1WMHA 3PV1A 2IZVB 2K39A 3ZO5B 5D6JB 3PHWB 2IO1B 4PYZA 3ZLZA 2MWSB 3VTUA 4IG7B 3N32A 4GDKA 4FBJB 3KH0A 4G0NB 5LXIB 2GMIC 4NAWB 5JH5C 3RZWC 4XX5A 4KVGB 1GJZA 4MJSB 4N9F4 3TJPA 2KFKB 2FCMA 4A20A 4WWPA 3V6CB 2KZRA 3L13A 3N3KB 4OVVA 1L7YA 3ENEA 1L2NA 2L0TA 4GDLA 4GB9A 1WE6A 3PPAA 4LDTD 2NPTA 2KMCA 4IWPA 2N4FA 2WX1A 3A1QA 1TGZB 2M4NA 2K1FA 4KSKC 4ANUA 1EF1A 4HLEA 4DWFA 3KUCB 1UGMA 4W9GA 3LDZE 3MTNB 2KWCA 4GU2A 1GNUA 3QK0A 3QCAA 2BYVE 1E8WA 1LXDA 4DHJB 3PT2B 3AULA 4JQWC 3QWZB 4BBNC 3DOWA 5AZGA 2N1VA 2MBQA 1H8CA 1RFAA 1YJ1A 2AL6A 2KX3A 5G55A 2EMSA 2DZKA 4AJYB 1P3QU 3VFKA 1GC7A 2KDEB 5E6PA 4BKGA 1UZXB 2MX2A 1UBQA 2DZIA 2NPTB 3ZNID 4GDLB 3UQAA 4AJWA 3L08A 4ZRJA 1WFYA 2PE9A 2ZPNA 4NNJB 3RUIB 3D32A 3MHSD 1C1YB 5J17A 2MLBA 3TCAA 2G4DB 3UINB 1JRUA 1WXSA 4WJOA 1GC6A 4B6WA 4IM0A 2JUOA 3VUYA 1E7UA 2KDBA 2DHZA 2K8HA 3M62B 2LXCA 3VH3B 3H9DA 4JGHB 4K7UA 2RR9A 1KM7A 1EO6A 4FA6A 3DVNV 3GZNI 4MM3A 1X1MA 1UELA 2D3GA 2CS4A 2I1KA 3UGBB 3ZTDA 3T8MA 3W1SC 4K7WA 1WI0A 4FHJA 3IVFA 2ZZPB 2QHOA 2KKCA 4GN1A 2IY1B 3DPDA 3BINA 2O6VB 2PJHA 1WIAA 1R4MI 3H6NA 1T0YA 4TV3A 1TBEA 4EOYA 5AZHA 1EF5A 1EUVB 1QZEA 4KDIC 1UD7A 4GSWA 4W9IA 3NZSA 2Y5BB 1SIFA 4RM8A 4KV2A 1WXMA 1S3SG 2J0JA 4GOCA 3QC8B 2BGFA 5DPTA 1LFDA 2ZNVC 3NOBA 3KVFB 3PRPB 2ZJDA 3RYTA 2L00B 4M8MA 4ZRIA 1WR1A 4IWQA 1UH6A 2NCNA 4W9JA 4EZKA 2K8CA 2C7NB 3JW0X 4II3B 4NJ6A 2KK8A 2GOWA 2KOXA 2V3SA 2W9NA 1V5OA 3U30A 1VCBA 1YX6B 2GBJA 4LDTB 3H1UA 2KMAA 2WWZA 3IG3A 2REXA 2V4LA 2I1JA 1Z2MA 2LJ5A 2KXJA 3L17A 3S2AA 2FAZA 4J6IA 1E8XA 1WXVA 2LASA 3UQBA 2XK5A 3P2BA 5L95C 4DHJD 3NY5A 3WANA 2HTHA 2ZCBA 1AARA 1YD8U 3L54A 2FIFA 2KTRA 2M17A 3VUWA 2BKRB 3CSTA 4IM3A 1KOTA 3SDLC 2MBOA 1UBIA 3OJ3A 1H4RA 1XT9B 2MBBB 3RD2A 4ANXA 2DENB 3QAQA 2L3ZA 4IW0A 2NBVB 2K6QA 3ZTCA 5JHAA 2CHWA 4MGYE 3R7QA 3ALBA 3PRMB 4BKSD 5C23A 4EZLA 1TTNA 2L76A 1OGWA 2VRRB 4PS3A 2HJ8A 3M3JA 5C1ZA 2C60A 3AI5A 3EHVA 3VVWB 1NI2A 2K6DB 2XEWA 3VAWA 3RULA 2K25A 1WGGA 3DBRI 4FLHA 4FHKA 2DYBA 2Z0EB 3LJ3A 1RRBA 3X0WA 4KZCA 2M8SA 3PLVA 2D07B 2DYMA 4HK2A 1ZKHA 1GUAB 2WDTB 2Z0DB 3EC8A 1P9DU 2D10A 3APFA 4WJQA 2N7EA 1LM8B 4W9HA 2IO3B 3C0RB 2KLCA 2R2OA 2N9XA 4DDGD 4HCNB 4NQLB 2O6VD 3N30A 4RMAA 3R7RA 3R3MA 2KO3A 2MP2B 3M63B 2BKFA 2KWVB 3APDA 4M8NA 5CHFA 3VQIA 4KIKA 2MBEA 3VH4B 3WAOA 4WWNA 2XK5B 2O2VB 4JL9A 4NPNA 4BKSA 5E6OA 3VXWA 2KFJA 3A4SC 3AU5A 2MCNB 5J18A 3O65B 2NR2A 2FCNA 2OOBB 3QJZA 5DPSA 1BT0A 2M1MA 3NS8A 4F1SA 1J19A 3RCZA 3ZNHB 3H7PA 2HD5B 2G4SA 4F8CB 1WE7A 2FCSA 4W9EA 3QQ8B 2JT4B 3Q3JA 4WJPA 4DXAB 1ZW7A 3VTVA 1WM3A 1NDDA 1WGRA 2OJRA 3JYUA 4K1RB 2KJRA 4MSMB 2J7QB 4FJYA 1WM2A 1V9JA 5KHQA 4BBNF 4XC2A 2KJ6A 5G2NA 3ML9A 2EKEC 5DPRA 3VHTC 2LVQA 5CX3A 5D94A 4IUMB 4MELA 4GIVA 1OEYJ 3KW5B 3HM6X 3VTWA 2KNBA 4W9LA 4IM2A 3U7DA 3PVLA 2DAFA 4HWIB 2NBUA 3OLMD 2BWES 2ZVNA 3QA8A 2DAJA 3KUZA 2KTRB 3ZDMC 2JRIB 4LCDE 1V5TA 2GBRA 3JSVB 2K8BA 2WX0A 5D2MB 3HM3A 4HCPB 2HE7A 4MDKE 2YVCA 5AZFA 1R4NI 1OQYA 1WYWB 1KLVA 2KD0A 4ZDVA 3PZDA 3DBSA 2ASQA 2IO2B 4B95A 3A1QB 5J2RA 1A5RA 3UF8A 2KHWB 5BO4B 4TQ0A 3DVGY 4BOZB 2WYQA 5KHOA 2R2QA 1WR6E 3A9KB 4EFOA 4TKNA 4E74A 5JHBA 2LXAA 3A9JA 3ZNGC 3M95A 3APCA 3ZKJC 2KWUB 3WAPA 1KJTA 3A9JB 4CHKA 1V2YA 3DCGA 3V60A 1VD2A 5AEKB 1J0GA 2LGYA 4NY0A 1WJUA 2NVUI 3A9KA 3Q3FA 3VDZA 1GG3A 4KSLC 2JWZA 4HDOA 2ZVOA 2V1YA 2JVCA 1E7VA 2CHZA 3OAWA 2LZ6A 4NAWA 4GDKB 3UIOB 2MBHA 2FNJB 2ZCCA 3L10B 4GGQA 4I6LB 4BFRA 3WALA 3A33B 3DBLI 4GXBA 3PTFC 3SHQA 3BY4B 4HVBA 4FJZA 3HK0A 3PSEB 3JSVA 4K81A 4KZ0A 2L8JA 4BOSC 1Q0WB 1WGYA 2DZMA 3V61A 2KQSA 4A3PA 4ASWC 3K9PB 2IYDB 3ZVVA 2KC2A 3ZDTA 5TR5A 3KYCD 4LJOB 1WH3A 2AWTA 1OTRB 3DVGX 2O6VA 2A4ZA 3X23A 1WXAA 3B0AA 2LVOA 1YIWA 2MP2A 3L0WB 4G50A 2N9PC 3R66C 2ZEQA 3KYDD 1OEYA 5E6NA 3MJWA 2KLGA 2B3AA 1SGHA 5GMVA 4ZYNA 2KJHB 1F9JA 4ANVA 2LVPA 5CHVC 1XD3B 1WX9A 4DBGA 2GBNA 3QHTA 4PYUA 1V81A 2KFKA 3WIMA 1S1QB 2D2QA 4W9FA 4HDQA 4BKTA 3A4RA 2N7DA 3WAMA 1RAXA 1I42A 2KTFA 2KANA 3JVZX 3PHXB 4HPMB 4II2B 4G11A 3SU8X 2L0FA 3ZIMA 1Q5WB 1V86A 4WAAA 3ONSA 2DX5B 2PE6B 3HIZA 4TUUA 2RD0A 1TZ1A 3W1YA 1WJ6A 3V62A 2LUEA 2JY6A 3PREA 3H7PB 1Y8RC 2MQJA 2PEAA 5DPWA 4FADA 3QIJA 3TBLD 4LJPB 3DDCB 5LLIA 2BWFA 2C5LC 3CMMB 3NZUA 2G45B 2KN5A 2MRPA 2KDFB 3IBEA 2JXXA 1WX7A 3RT3B 1K8RB 3EFUA 3PS6A 3B08A 4KIKB 2KVRA 1G6JA 4F7ZA 3T9LA 2LRWA 3U8ZA 3AXCA 2PPHA 2ZNVB 2L05A 1MG8A 1V6EA 2MSED 2D11A 3ZRCA 1P1AA 4B9KA 2MW5A 1E5WA 4MEMA 2FCQA 4NJ7A 4W9KA 2RSUA 5FR6A 4XZ4A 2CKHB 5DCNA 3PGEA 3IHPC 1E8YA 3KUDB 2RGFA 4M0WB 1ZGUB 3SD5A 5D7GA 2JZ3B 2YLMA 3QX1A 2BF8B 1J8CA 2AL3A 4E71A 1WGDA 2JZZA 4NQKE 2JF5A 4CO7A 4E3CA 1Z5SB 2CHXA 4JIOU 1WZ0A 4MGKE 4HXDA 2IBIB 1P0RA 5JZEB 2KQ7A 1P98A 1U4AA 3RZFA 2C7HA 3I3TB 4WWOA 1WGHA 1WF9A 4MGIE 2LGXA 5IAAC 1I35A 3ZNZB 3IFWB 1PQSA 4X57B 4MGZE 1E8ZA 2CR5A 4GMVA 2AYOB 2JRHA 1E90A 1CMXB 5EDSA 4DHZB 2LWPA 1WMHB 1YX5B 3DQVA 2CU1A 1FXTB 1WX8A 4FJVB 4W9CA 1IP9A 1Q1OA 4IC7B 4TQ1A 3ZUNA 2G3QB 3OJ4B 2GBMA 1ISNA 2KC1A 2GBKA 2NBWB 3EECA 2UWQA 4FN2A 3UIPB 3CSFA 2N1WA 4W9DA 2KX0A 2XBBC 4ICVA 4P7IA 2C9WB 4AWJA 4MH0E 3PRZA 4G3XB 2O2VA 1V49A 5CTRC 3CF6E 2IO0B 3ML8A 4KDLB 4EZJA 2J0MA 3B1LX 4HPLB 4OVUA 2BPSA 5HKHA 4I6PA 2BYFA 4AP4C 1IYFA 1HE8A 2LD9A 3PLUA 5IA7A 4RM9A 3TMPB 2FIDA 5LXHA 3W1SA 3V6EB 4MJSA 1YQBA 2LI5A 3HHMA 3TIXA 3H7SA 2N9EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C3T A;  5L83 A;  3L16 A;  4ANW A;  1WJ4 A;  2AEH A;  4FUL A;  4DK5 A;  4WJN A;  2A5U A;  2LGD A;  1LQB A;  2RPQ A;  3ZW3 A;  4K7S A;  1NBF C;  2C7M B;  4DHZ E;  2J0K A;  2EMT A;  4EKU A;  4IWO A;  4PS8 A;  1WJN A;  3GOE A;  3WA0 A;  2L7R A;  4HJK A;  3ZRF A;  3K9O B;  4WQO B;  4EUT A;  2MA9 B;  2BYE A;  4ICU A;  4BVU C;  4MSQ B;  3DVN U;  3DBH I;  2LRU A;  4URK A;  4DDI D;  1SE9 A;  1XQQ A;  2Z59 B;  4AUQ C;  1M94 A;  4EEW A;  2IY0 B;  2ZPY A;  3VUX A;  4ZRK A;  3NHE B;  1WZ3 A;  2M0X A;  1V80 A;  1RLF A;  3ECI A;  2UYZ B;  1IPG A;  2JPH A;  2KDI A;  3TL5 A;  1WRD B;  5CHW A;  2DYO A;  4A3O A;  2DZJ A;  4I6N B;  2FUH B;  4AOF A;  3QAR A;  1WY8 A;  3AU4 A;  2NS5 A;  4YL8 A;  1D3Z A;  4JLC A;  4CYE A;  4PS7 A;  1WMH A;  3PV1 A;  2IZV B;  2K39 A;  3ZO5 B;  5D6J B;  3PHW B;  2IO1 B;  4PYZ A;  3ZLZ A;  2MWS B;  3VTU A;  4IG7 B;  3N32 A;  4GDK A;  4FBJ B;  3KH0 A;  4G0N B;  5LXI B;  2GMI C;  4NAW B;  5JH5 C;  3RZW C;  4XX5 A;  4KVG B;  1GJZ A;  4MJS B;  4N9F 4;  3TJP A;  2KFK B;  2FCM A;  4A20 A;  4WWP A;  3V6C B;  2KZR A;  3L13 A;  3N3K B;  4OVV A;  1L7Y A;  3ENE A;  1L2N A;  2L0T A;  4GDL A;  4GB9 A;  1WE6 A;  3PPA A;  4LDT D;  2NPT A;  2KMC A;  4IWP A;  2N4F A;  2WX1 A;  3A1Q A;  1TGZ B;  2M4N A;  2K1F A;  4KSK C;  4ANU A;  1EF1 A;  4HLE A;  4DWF A;  3KUC B;  1UGM A;  4W9G A;  3LDZ E;  3MTN B;  2KWC A;  4GU2 A;  1GNU A;  3QK0 A;  3QCA A;  2BYV E;  1E8W A;  1LXD A;  4DHJ B;  3PT2 B;  3AUL A;  4JQW C;  3QWZ B;  4BBN C;  3DOW A;  5AZG A;  2N1V A;  2MBQ A;  1H8C A;  1RFA A;  1YJ1 A;  2AL6 A;  2KX3 A;  5G55 A;  2EMS A;  2DZK A;  4AJY B;  1P3Q U;  3VFK A;  1GC7 A;  2KDE B;  5E6P A;  4BKG A;  1UZX B;  2MX2 A;  1UBQ A;  2DZI A;  2NPT B;  3ZNI D;  4GDL B;  3UQA A;  4AJW A;  3L08 A;  4ZRJ A;  1WFY A;  2PE9 A;  2ZPN A;  4NNJ B;  3RUI B;  3D32 A;  3MHS D;  1C1Y B;  5J17 A;  2MLB A;  3TCA A;  2G4D B;  3UIN B;  1JRU A;  1WXS A;  4WJO A;  1GC6 A;  4B6W A;  4IM0 A;  2JUO A;  3VUY A;  1E7U A;  2KDB A;  2DHZ A;  2K8H A;  3M62 B;  2LXC A;  3VH3 B;  3H9D A;  4JGH B;  4K7U A;  2RR9 A;  1KM7 A;  1EO6 A;  4FA6 A;  3DVN V;  3GZN I;  4MM3 A;  1X1M A;  1UEL A;  2D3G A;  2CS4 A;  2I1K A;  3UGB B;  3ZTD A;  3T8M A;  3W1S C;  4K7W A;  1WI0 A;  4FHJ A;  3IVF A;  2ZZP B;  2QHO A;  2KKC A;  4GN1 A;  2IY1 B;  3DPD A;  3BIN A;  2O6V B;  2PJH A;  1WIA A;  1R4M I;  3H6N A;  1T0Y A;  4TV3 A;  1TBE A;  4EOY A;  5AZH A;  1EF5 A;  1EUV B;  1QZE A;  4KDI C;  1UD7 A;  4GSW A;  4W9I A;  3NZS A;  2Y5B B;  1SIF A;  4RM8 A;  4KV2 A;  1WXM A;  1S3S G;  2J0J A;  4GOC A;  3QC8 B;  2BGF A;  5DPT A;  1LFD A;  2ZNV C;  3NOB A;  3KVF B;  3PRP B;  2ZJD A;  3RYT A;  2L00 B;  4M8M A;  4ZRI A;  1WR1 A;  4IWQ A;  1UH6 A;  2NCN A;  4W9J A;  4EZK A;  2K8C A;  2C7N B;  3JW0 X;  4II3 B;  4NJ6 A;  2KK8 A;  2GOW A;  2KOX A;  2V3S A;  2W9N A;  1V5O A;  3U30 A;  1VCB A;  1YX6 B;  2GBJ A;  4LDT B;  3H1U A;  2KMA A;  2WWZ A;  3IG3 A;  2REX A;  2V4L A;  2I1J A;  1Z2M A;  2LJ5 A;  2KXJ A;  3L17 A;  3S2A A;  2FAZ A;  4J6I A;  1E8X A;  1WXV A;  2LAS A;  3UQB A;  2XK5 A;  3P2B A;  5L95 C;  4DHJ D;  3NY5 A;  3WAN A;  2HTH A;  2ZCB A;  1AAR A;  1YD8 U;  3L54 A;  2FIF A;  2KTR A;  2M17 A;  3VUW A;  2BKR B;  3CST A;  4IM3 A;  1KOT A;  3SDL C;  2MBO A;  1UBI A;  3OJ3 A;  1H4R A;  1XT9 B;  2MBB B;  3RD2 A;  4ANX A;  2DEN B;  3QAQ A;  2L3Z A;  4IW0 A;  2NBV B;  2K6Q A;  3ZTC A;  5JHA A;  2CHW A;  4MGY E;  3R7Q A;  3ALB A;  3PRM B;  4BKS D;  5C23 A;  4EZL A;  1TTN A;  2L76 A;  1OGW A;  2VRR B;  4PS3 A;  2HJ8 A;  3M3J A;  5C1Z A;  2C60 A;  3AI5 A;  3EHV A;  3VVW B;  1NI2 A;  2K6D B;  2XEW A;  3VAW A;  3RUL A;  2K25 A;  1WGG A;  3DBR I;  4FLH A;  4FHK A;  2DYB A;  2Z0E B;  3LJ3 A;  1RRB A;  3X0W A;  4KZC A;  2M8S A;  3PLV A;  2D07 B;  2DYM A;  4HK2 A;  1ZKH A;  1GUA B;  2WDT B;  2Z0D B;  3EC8 A;  1P9D U;  2D10 A;  3APF A;  4WJQ A;  2N7E A;  1LM8 B;  4W9H A;  2IO3 B;  3C0R B;  2KLC A;  2R2O A;  2N9X A;  4DDG D;  4HCN B;  4NQL B;  2O6V D;  3N30 A;  4RMA A;  3R7R A;  3R3M A;  2KO3 A;  2MP2 B;  3M63 B;  2BKF A;  2KWV B;  3APD A;  4M8N A;  5CHF A;  3VQI A;  4KIK A;  2MBE A;  3VH4 B;  3WAO A;  4WWN A;  2XK5 B;  2O2V B;  4JL9 A;  4NPN A;  4BKS A;  5E6O A;  3VXW A;  2KFJ A;  3A4S C;  3AU5 A;  2MCN B;  5J18 A;  3O65 B;  2NR2 A;  2FCN A;  2OOB B;  3QJZ A;  5DPS A;  1BT0 A;  2M1M A;  3NS8 A;  4F1S A;  1J19 A;  3RCZ A;  3ZNH B;  3H7P A;  2HD5 B;  2G4S A;  4F8C B;  1WE7 A;  2FCS A;  4W9E A;  3QQ8 B;  2JT4 B;  3Q3J A;  4WJP A;  4DXA B;  1ZW7 A;  3VTV A;  1WM3 A;  1NDD A;  1WGR A;  2OJR A;  3JYU A;  4K1R B;  2KJR A;  4MSM B;  2J7Q B;  4FJY A;  1WM2 A;  1V9J A;  5KHQ A;  4BBN F;  4XC2 A;  2KJ6 A;  5G2N A;  3ML9 A;  2EKE C;  5DPR A;  3VHT C;  2LVQ A;  5CX3 A;  5D94 A;  4IUM B;  4MEL A;  4GIV A;  1OEY J;  3KW5 B;  3HM6 X;  3VTW A;  2KNB A;  4W9L A;  4IM2 A;  3U7D A;  3PVL A;  2DAF A;  4HWI B;  2NBU A;  3OLM D;  2BWE S;  2ZVN A;  3QA8 A;  2DAJ A;  3KUZ A;  2KTR B;  3ZDM C;  2JRI B;  4LCD E;  1V5T A;  2GBR A;  3JSV B;  2K8B A;  2WX0 A;  5D2M B;  3HM3 A;  4HCP B;  2HE7 A;  4MDK E;  2YVC A;  5AZF A;  1R4N I;  1OQY A;  1WYW B;  1KLV A;  2KD0 A;  4ZDV A;  3PZD A;  3DBS A;  2ASQ A;  2IO2 B;  4B95 A;  3A1Q B;  5J2R A;  1A5R A;  3UF8 A;  2KHW B;  5BO4 B;  4TQ0 A;  3DVG Y;  4BOZ B;  2WYQ A;  5KHO A;  2R2Q A;  1WR6 E;  3A9K B;  4EFO A;  4TKN A;  4E74 A;  5JHB A;  2LXA A;  3A9J A;  3ZNG C;  3M95 A;  3APC A;  3ZKJ C;  2KWU B;  3WAP A;  1KJT A;  3A9J B;  4CHK A;  1V2Y A;  3DCG A;  3V60 A;  1VD2 A;  5AEK B;  1J0G A;  2LGY A;  4NY0 A;  1WJU A;  2NVU I;  3A9K A;  3Q3F A;  3VDZ A;  1GG3 A;  4KSL C;  2JWZ A;  4HDO A;  2ZVO A;  2V1Y A;  2JVC A;  1E7V A;  2CHZ A;  3OAW A;  2LZ6 A;  4NAW A;  4GDK B;  3UIO B;  2MBH A;  2FNJ B;  2ZCC A;  3L10 B;  4GGQ A;  4I6L B;  4BFR A;  3WAL A;  3A33 B;  3DBL I;  4GXB A;  3PTF C;  3SHQ A;  3BY4 B;  4HVB A;  4FJZ A;  3HK0 A;  3PSE B;  3JSV A;  4K81 A;  4KZ0 A;  2L8J A;  4BOS C;  1Q0W B;  1WGY A;  2DZM A;  3V61 A;  2KQS A;  4A3P A;  4ASW C;  3K9P B;  2IYD B;  3ZVV A;  2KC2 A;  3ZDT A;  5TR5 A;  3KYC D;  4LJO B;  1WH3 A;  2AWT A;  1OTR B;  3DVG X;  2O6V A;  2A4Z A;  3X23 A;  1WXA A;  3B0A A;  2LVO A;  1YIW A;  2MP2 A;  3L0W B;  4G50 A;  2N9P C;  3R66 C;  2ZEQ A;  3KYD D;  1OEY A;  5E6N A;  3MJW A;  2KLG A;  2B3A A;  1SGH A;  5GMV A;  4ZYN A;  2KJH B;  1F9J A;  4ANV A;  2LVP A;  5CHV C;  1XD3 B;  1WX9 A;  4DBG A;  2GBN A;  3QHT A;  4PYU A;  1V81 A;  2KFK A;  3WIM A;  1S1Q B;  2D2Q A;  4W9F A;  4HDQ A;  4BKT A;  3A4R A;  2N7D A;  3WAM A;  1RAX A;  1I42 A;  2KTF A;  2KAN A;  3JVZ X;  3PHX B;  4HPM B;  4II2 B;  4G11 A;  3SU8 X;  2L0F A;  3ZIM A;  1Q5W B;  1V86 A;  4WAA A;  3ONS A;  2DX5 B;  2PE6 B;  3HIZ A;  4TUU A;  2RD0 A;  1TZ1 A;  3W1Y A;  1WJ6 A;  3V62 A;  2LUE A;  2JY6 A;  3PRE A;  3H7P B;  1Y8R C;  2MQJ A;  2PEA A;  5DPW A;  4FAD A;  3QIJ A;  3TBL D;  4LJP B;  3DDC B;  5LLI A;  2BWF A;  2C5L C;  3CMM B;  3NZU A;  2G45 B;  2KN5 A;  2MRP A;  2KDF B;  3IBE A;  2JXX A;  1WX7 A;  3RT3 B;  1K8R B;  3EFU A;  3PS6 A;  3B08 A;  4KIK B;  2KVR A;  1G6J A;  4F7Z A;  3T9L A;  2LRW A;  3U8Z A;  3AXC A;  2PPH A;  2ZNV B;  2L05 A;  1MG8 A;  1V6E A;  2MSE D;  2D11 A;  3ZRC A;  1P1A A;  4B9K A;  2MW5 A;  1E5W A;  4MEM A;  2FCQ A;  4NJ7 A;  4W9K A;  2RSU A;  5FR6 A;  4XZ4 A;  2CKH B;  5DCN A;  3PGE A;  3IHP C;  1E8Y A;  3KUD B;  2RGF A;  4M0W B;  1ZGU B;  3SD5 A;  5D7G A;  2JZ3 B;  2YLM A;  3QX1 A;  2BF8 B;  1J8C A;  2AL3 A;  4E71 A;  1WGD A;  2JZZ A;  4NQK E;  2JF5 A;  4CO7 A;  4E3C A;  1Z5S B;  2CHX A;  4JIO U;  1WZ0 A;  4MGK E;  4HXD A;  2IBI B;  1P0R A;  5JZE B;  2KQ7 A;  1P98 A;  1U4A A;  3RZF A;  2C7H A;  3I3T B;  4WWO A;  1WGH A;  1WF9 A;  4MGI E;  2LGX A;  5IAA C;  1I35 A;  3ZNZ B;  3IFW B;  1PQS A;  4X57 B;  4MGZ E;  1E8Z A;  2CR5 A;  4GMV A;  2AYO B;  2JRH A;  1E90 A;  1CMX B;  5EDS A;  4DHZ B;  2LWP A;  1WMH B;  1YX5 B;  3DQV A;  2CU1 A;  1FXT B;  1WX8 A;  4FJV B;  4W9C A;  1IP9 A;  1Q1O A;  4IC7 B;  4TQ1 A;  3ZUN A;  2G3Q B;  3OJ4 B;  2GBM A;  1ISN A;  2KC1 A;  2GBK A;  2NBW B;  3EEC A;  2UWQ A;  4FN2 A;  3UIP B;  3CSF A;  2N1W A;  4W9D A;  2KX0 A;  2XBB C;  4ICV A;  4P7I A;  2C9W B;  4AWJ A;  4MH0 E;  3PRZ A;  4G3X B;  2O2V A;  1V49 A;  5CTR C;  3CF6 E;  2IO0 B;  3ML8 A;  4KDL B;  4EZJ A;  2J0M A;  3B1L X;  4HPL B;  4OVU A;  2BPS A;  5HKH A;  4I6P A;  2BYF A;  4AP4 C;  1IYF A;  1HE8 A;  2LD9 A;  3PLU A;  5IA7 A;  4RM9 A;  3TMP B;  2FID A;  5LXH A;  3W1S A;  3V6E B;  4MJS A;  1YQB A;  2LI5 A;  3HHM A;  3TIX A;  3H7S A;  2N9E B; 
#chains in the Genus database with same CATH topology
 4ANW A;  4XE0 A;  4FUL A;  4DK5 A;  1L5P A;  4WJN A;  1LQB A;  2RPQ A;  2C7M B;  4DHZ E;  4PS8 A;  1WJN A;  1FFU A;  4HJK A;  3K9O B;  2MA9 B;  2BYE A;  3ZGZ A;  4ICU A;  1SE9 A;  2PVO D;  1XQQ A;  3LB8 C;  5H8Y E;  2GB1 A;  1TJE A;  2ZPY A;  4ZRK A;  3N9Y C;  2M0X A;  4CQN A;  3U4E G;  3MC0 B;  3RMK C;  1L4Z B;  1MHH E;  1WRD B;  2GLS A;  4OHJ A;  3TL5 A;  2NS5 A;  3AMZ A;  3PV1 A;  5D6J B;  2IO1 B;  4ZOH C;  5G5H A;  3VTU A;  3N32 A;  4UDU C;  3KH0 A;  1YJJ A;  5JH5 C;  4KVG B;  1GJZ A;  2FCM A;  2L0T A;  4GDL A;  4GB9 A;  1WE6 A;  2KMC A;  4IWP A;  1PFD A;  3A1Q A;  1TGZ B;  4L23 A;  1TY2 A;  1VR9 A;  4HLE A;  3DBR B;  4C80 A;  2XN9 C;  3W5V B;  2JU6 X;  4GU2 A;  4DHJ B;  1LXD A;  3BVG A;  3QWZ B;  5AZG A;  1AN8 A;  2MBQ A;  3VR9 B;  1KF6 B;  1RFA A;  3AE7 B;  3ZQ4 A;  2KX3 A;  5G55 A;  2DZK A;  2L52 A;  1QKZ A;  1UZX B;  1XO3 A;  2MX2 A;  1OQQ A;  3ZNI D;  3RNE C;  4ZRJ A;  1WFY A;  3RUI B;  4NNJ B;  4FXC A;  5HHD G;  1N6Z A;  3VUY A;  2DBY A;  2DHZ A;  2LXC A;  2WXH A;  1SEB D;  3VH3 B;  2INP E;  1I4P A;  4K7U A;  1KM7 A;  5BMG A;  1ZDX A;  4MM3 A;  2D3G A;  1B9R A;  1WYG A;  3W1S C;  3I63 C;  2QHO A;  3H6N A;  2QCZ A;  4EOY A;  1TBE A;  3E9S A;  4GSW A;  2ICI A;  4RM8 A;  4WAF A;  4KV2 A;  4YSZ B;  1N5W A;  3NOB A;  4M8M A;  4ZRI A;  1ZDV A;  1F0Z A;  1WR1 A;  1UH6 A;  1RM6 C;  1JWS D;  2C7N B;  4II3 B;  4NJ6 A;  2V3S A;  2GOW A;  4KGS A;  4S17 A;  4WUR A;  2KMA A;  2WWZ A;  2REX A;  2V4L A;  4J6I A;  1D5Z C;  3GE3 C;  2XK5 A;  4M0W A;  3NY5 A;  1NVI D;  1YD8 U;  4C56 C;  1I4Q A;  2D3A A;  3SDL C;  2MBO A;  1KOT A;  3RPF C;  1H4R A;  2LHE A;  1EM7 A;  2MBB B;  3MP9 A;  4C4V A;  4IW0 A;  3ZTC A;  5JHA A;  1OQR A;  2CHW A;  3PRM B;  4PS3 A;  2HJ8 A;  5C1Z A;  2LHD A;  4YTP B;  3EHV A;  2NTS A;  1NI2 A;  3VVW B;  3ZXV A;  3TEZ A;  4ZHP A;  1MJD A;  4FHK A;  2DYB A;  4C4V B;  2Z0E B;  2M8S A;  3PLV A;  2DYM A;  2JXT A;  1F77 A;  4RNA A;  3HRD D;  4DDG D;  2MP2 B;  3VQI A;  1IGD A;  1AWD A;  1SJE D;  2IGG A;  2XK5 B;  1FRD A;  2O2V B;  4JL9 A;  1V97 A;  3MC9 A;  2K0P A;  3A4S C;  3NJT A;  3Q14 C;  2MCN B;  1ZUD 2;  5J18 A;  3O65 B;  2NR2 A;  2OOB B;  3NS8 A;  3C19 A;  3RCZ A;  3ZNH B;  2HD5 B;  4F8C B;  1WE7 A;  2QIE B;  1ZE3 D;  2MHJ A;  4RGO S;  3QQ8 B;  4WJP A;  3LXF A;  5BMI A;  1OFF A;  4HEA 1;  3BYT B;  1V9J A;  5KHQ A;  1E10 A;  4BBN F;  2KJ6 A;  1XCQ L;  5HFY A;  2EKE C;  2LVQ A;  1QQR A;  2BB5 A;  1OEY J;  3KW5 B;  4LNI A;  3MFG A;  3PVL A;  2DAF A;  2NBU A;  3OLM D;  5FK9 C;  2BWE S;  2RDG A;  4DXF A;  4LCD E;  2K8B A;  2WX0 A;  1NEK B;  3P4Q B;  4ARC A;  4MDK E;  1R4N I;  1OQY A;  1KLV A;  4ZDV A;  3A1Q B;  5J2R A;  1QLB B;  2PW9 A;  4BOZ B;  1T0S C;  3A9K B;  3APC A;  4XYC A;  3DCG A;  2AQ1 B;  1WJU A;  2NVU I;  4HKQ A;  4KSL C;  1UGJ A;  3A33 B;  4GXB A;  3SHQ A;  4HVB A;  3PSE B;  2WDR B;  3DHG C;  4B0E A;  2IDY A;  2KQS A;  3K9P B;  5LNK 1;  5TR5 A;  1ACC A;  3KYC D;  1WH3 A;  1F52 A;  1FCC C;  3B0A A;  2ON8 A;  4US9 A;  2B3A A;  2KJH B;  5CHV C;  1XD3 B;  3WIM A;  1V81 A;  3J9C A;  1GOZ A;  3A4R A;  2PVG C;  2INN E;  4G11 A;  1TS2 A;  4RGN A;  2QC8 A;  1Q5W B;  2PE6 B;  1FCL A;  2LUE A;  3PRE A;  1TIF A;  1Y8R C;  3AEC B;  4NZL B;  3GP7 A;  3RNF C;  1HTQ A;  1ENF A;  1N61 A;  5LLI A;  3CMM B;  3NZU A;  2G45 B;  3IBE A;  5C3J B;  2Y5C A;  1WX7 A;  1G6J A;  2PLP A;  2ZNV B;  2L05 A;  2D11 A;  2MW5 A;  5E6J A;  3V05 A;  1E5W A;  1JWU D;  4MEM A;  2FCQ A;  5FR6 A;  3EGR A;  2RGF A;  3SD5 A;  3QX1 A;  2AL3 A;  1SE3 A;  3VRA B;  4MGK E;  1P0R A;  2FE8 A;  4PT5 A;  3RZF A;  2C7H A;  1WF9 A;  1CJE A;  1DYQ A;  5TSS A;  4MGZ E;  1GB4 A;  4N58 A;  3ZYY X;  1E90 A;  1VZ6 A;  4DHZ B;  3W5U B;  1J7A A;  4OZA A;  2BB6 A;  3HUI A;  1Q1O A;  1XCT L;  4LNO A;  2WXN A;  2G3Q B;  1ZXI A;  3OJ4 B;  3EEC A;  2NBW B;  3UIP B;  2XBB C;  4ICV A;  3GS2 A;  2O2V A;  1K50 A;  2IO0 B;  3IAS 1;  3BVM A;  4KDL B;  4EZJ A;  2NTT A;  2J0M A;  3IT6 B;  2RDB C;  4LNK A;  1RFK A;  4MAC A;  3PLU A;  4RM9 A;  5LXH A;  1YQB A;  3HHM A;  2HTM E;  1JML A;  3DPD A;  2N9E B;  5L83 A;  1K53 A;  2WXQ A;  2AEH A;  2A5U A;  4K7S A;  4C00 A;  1NBF C;  2J0K A;  2EMT A;  2MJ3 A;  3AE1 B;  3WA0 A;  4O1N A;  2JQR B;  3Q8B A;  4MSQ B;  3DVN U;  2KYW A;  4DDI D;  3CWI A;  2IY0 B;  4YTM B;  3VUX A;  3NHE B;  1WZ3 A;  2UYZ B;  4JWU C;  4YT0 B;  4JX1 C;  5CHW A;  2M56 B;  4A3O A;  1JWM D;  4I6N B;  2FUH B;  4YL8 A;  4JLC A;  3P42 A;  2IZV B;  2K3U A;  5EE9 A;  2MJE A;  4NAW B;  5JXV A;  2DLB A;  2J4X A;  2WHI A;  2KFK B;  2KZR A;  3N3K B;  1BUI C;  1KLU D;  3I5J C;  3PPA A;  1C9F A;  2N4F A;  2WX1 A;  4AQ7 A;  4KSK C;  5C2T B;  1Y56 A;  2W3S A;  2KAC A;  2KWC A;  1FM0 D;  3QCA A;  4L2Y A;  1E8W A;  4QAY A;  2HJ1 A;  3HVZ A;  3AUL A;  4JE3 B;  4BBN C;  3DOW A;  1H8C A;  3ZJU A;  2AL6 A;  5T8I A;  4AJY B;  2K5P A;  1KTK A;  2NPT B;  1UBQ A;  2DZI A;  1ROE A;  4BAX A;  4P1C C;  5D3D A;  2EEL A;  4AJW A;  3MHS D;  1C1Y B;  5J17 A;  3TCA A;  2XNA C;  4WJO A;  1GC6 A;  2M19 A;  3B2F A;  2KDB A;  3U7Z A;  1EWY C;  4JWS C;  1QT9 A;  4JGH B;  1EO6 A;  4JPS A;  3UGB B;  2L32 A;  1C78 A;  2PMV A;  3VRB B;  1SXT A;  3AEG B;  2IY1 B;  4TV3 A;  3BIN A;  2PJH A;  1R4M I;  4Q2J A;  1EUV B;  1QZE A;  1UD7 A;  4W9I A;  3NZS A;  3RNB C;  4WIP A;  1GAQ B;  2J0J A;  3QC8 B;  2BGF A;  5DPT A;  2ZNV C;  2L00 B;  4IWQ A;  4RCO A;  1FNU A;  4N59 A;  3JW0 X;  1T0Q C;  2OJW A;  2W9N A;  2FBW B;  3U30 A;  1VCB A;  1YX6 B;  4LDT B;  3H1U A;  3IG3 A;  1K52 A;  1TZO A;  3BK2 A;  2WXR A;  3L17 A;  4AS1 A;  2IND C;  3TEX A;  1DOY A;  1WXV A;  1QIL A;  3P2B A;  4KGT A;  4USA A;  1ZXH A;  3WAN A;  5BMH A;  2FIF A;  2V3N A;  3VUW A;  1RYJ A;  4YSY B;  1FXA A;  4WH4 A;  2JZP A;  2WP9 B;  3TUO A;  4RGM A;  3RD2 A;  2LFI A;  1BML C;  3QAQ A;  2L3Z A;  2NBV B;  4MGY E;  3R7Q A;  5C23 A;  3Q8E A;  1YN4 A;  2VRR B;  3M3J A;  3P4R B;  2K6D B;  2XEW A;  3SFD B;  3RUL A;  3DBR I;  4H2A A;  3LJ3 A;  1RRB A;  3N1Z C;  1YJI A;  2YEP F;  2Z0D B;  1FO4 A;  1LM8 B;  2IO3 B;  1EWC A;  2KLC A;  2MEK A;  2N9X A;  1JCK B;  4NQL B;  3N30 A;  3R3M A;  2KO3 A;  3M63 B;  2BKF A;  2KWV B;  2MBE A;  2IGD A;  4BKS A;  1STE A;  5E6O A;  3VXW A;  2KFJ A;  3R8B A;  3QJZ A;  1BT0 A;  2M1M A;  2Q5W D;  2R61 A;  3Q3N C;  2WDQ B;  3O13 A;  1VLB A;  2G4S A;  2I2Y A;  3T3O A;  2QSD A;  1HA5 A;  4NAM A;  4P1B C;  2SAK A;  1CK1 A;  3ABV B;  1ZW7 A;  3VTV A;  1NDD A;  3JYU A;  2KJR A;  4FJY A;  2LGS A;  3TSS A;  4MEL A;  3HM6 X;  3VTW A;  3U7D A;  4KX6 B;  2WXJ A;  4A55 A;  1V5T A;  2GBR A;  1PUT A;  5AZF A;  5MPO A;  1N62 A;  3PZD A;  3DBS A;  2IO2 B;  4TQ0 A;  3DVG Y;  2WYQ A;  3NG0 A;  2W82 A;  4US8 A;  5JHB A;  1WRI A;  2RPV A;  2KWU B;  1JWB D;  1KJT A;  3VDZ A;  1IUE A;  4XWW A;  2JVC A;  1E7V A;  2LZ6 A;  2MBH A;  2FNJ B;  3L10 B;  2V9H A;  3U52 E;  1LGR A;  3PTF C;  3EUB 2;  3HK0 A;  4IOI E;  2J52 A;  1WGY A;  4ASW C;  3ZDT A;  1MG4 A;  3HVD A;  1I4H A;  3X23 A;  2GI9 A;  1YIW A;  3P1M A;  4G50 A;  2N9P C;  3R66 C;  2ZEQ A;  1OEY A;  4S0R A;  1MPE A;  4DBG A;  1WX9 A;  4RF1 A;  3BVZ A;  2D2Q A;  4HDQ A;  3I9V 1;  3NZ3 A;  2KTF A;  1N63 A;  3ZIM A;  4N6E B;  2WXF A;  2WU5 B;  3ONS A;  2RD0 A;  3R2I A;  2MQJ A;  1SB3 C;  5DPW A;  2DNF A;  3QIJ A;  2C5L C;  3DWM A;  2V0G A;  1K8R B;  4B0M A;  2KVR A;  1LO5 D;  2LRW A;  2QMT A;  3N1Y C;  1V6E A;  1XLQ A;  4NJ7 A;  2N9K A;  4WWM A;  3IHP C;  1E8Y A;  1HZ6 A;  1ZGU B;  3DWG C;  2BF8 B;  2IPK D;  4E71 A;  1WGD A;  1KH0 A;  3AH7 A;  5FR3 A;  4E3C A;  1Z5S B;  4HXD A;  2IBI B;  4HKZ E;  4IDI A;  1P98 A;  3U2S C;  4LLG M;  1WGH A;  4MGI E;  1FNW A;  1D5M C;  2KQ4 X;  2CR5 A;  3DBL B;  4GMV A;  5BYR A;  1SF0 A;  1YN5 A;  3DQV A;  1FXT B;  5AUI A;  1IP9 A;  4IC7 B;  4MH8 A;  3B9J A;  4PK1 A;  2INC C;  3PRZ A;  2FUG 1;  4G3X B;  1V49 A;  5CTR C;  3CF6 E;  4ZRQ A;  2LEK A;  1HEZ E;  1JAL A;  2FID A;  1N60 A;  3W1S A;  4MJS A;  3TIX A;  3H7S A;  2OHF A;  1FXI A;  3BK1 A;  1WJ4 A;  3AB5 A;  2LGD A;  1A70 A;  1E9M A;  4REZ A;  4EKU A;  3AE6 B;  4IWO A;  4GLS C;  1IBX A;  3GOE A;  4BZA A;  2L7R A;  1SBB B;  3DBH I;  2LRU A;  4K3C A;  2RDH A;  4AUQ C;  1M94 A;  4TMA B;  3RNG C;  1RLF A;  3PZ8 A;  4TSS A;  2JPH A;  1DOI A;  2KDI A;  1P7F A;  2QIL A;  3QAR A;  4AOF A;  1WY8 A;  1T5X D;  4CYE A;  2N9L A;  2K39 A;  4YXD B;  3ZO5 B;  3WCQ A;  3PHW B;  5IKC M;  4PYZ A;  3ZLZ A;  1F1H A;  2MWS B;  4FBJ B;  4G0N B;  2GMI C;  3ZJT A;  3RZW C;  4XX5 A;  2LJI A;  2JSV X;  4N9F 4;  3TJP A;  3BYY B;  3AE4 B;  3V6C B;  3AE5 B;  3L13 A;  2WDV B;  2NPT A;  1F2R I;  3BII D;  3KUC B;  1UGM A;  4W9G A;  3LDZ E;  2L83 A;  3TEY A;  4JQW C;  1YJ1 A;  2GRI A;  1MHX A;  4LNF A;  1SJH D;  1WSP A;  1GC7 A;  3VFK A;  2KDE B;  4BKG A;  3AED B;  3URY A;  2KVZ A;  4GDL B;  2ZW1 A;  2ZPN A;  2AQ2 B;  3D32 A;  1CQV A;  3MC8 A;  3RI7 C;  5HG2 A;  2G4D B;  3UIN B;  3ZXR A;  1ET6 A;  1JRU A;  1WXS A;  4B6W A;  1QOG A;  2JUO A;  1I4G A;  2BS4 B;  3H9D A;  3AE3 B;  4RF0 A;  1UEL A;  3ZTD A;  2CS4 A;  1EU3 A;  2I1K A;  3T8M A;  2J42 A;  2VZK D;  3IVF A;  3PO0 A;  2ZZP B;  2HDE A;  1MI0 A;  4XDC A;  1XEE A;  1T0Y A;  3IAM 1;  5AZH A;  1ZP0 B;  2Y5B B;  3IXS A;  1WXM A;  4GOC A;  1LFD A;  3KVF B;  3I57 A;  3RYT A;  2Y3A A;  2QDF A;  1TY0 A;  1T0R C;  2NCN A;  1TS3 A;  1NI3 A;  4EZK A;  2K8C A;  2N0S B;  2KK8 A;  2KOX A;  1FD6 A;  1HTO A;  2KAJ A;  1V5O A;  1BXT A;  2X38 A;  1PGB A;  1TS4 A;  3BZD B;  1Z2M A;  2KXJ A;  3S2A A;  2FAZ A;  2BBC A;  2JWU A;  2LAS A;  4OZB A;  3UQB A;  1FMA D;  4XGA B;  4DHJ D;  2WXP A;  2HTH A;  3L54 A;  2M17 A;  1JWA D;  2BKR B;  3CST A;  4A6Q A;  1UBI A;  3OJ3 A;  3NVW A;  1XT9 B;  1HQR D;  2JYE A;  2DEN B;  1GPX A;  2K6Q A;  2PIA A;  4EZL A;  3ALB A;  4IKG A;  4A9A A;  3FIL B;  2L76 A;  1OGW A;  1UF0 A;  4J3O D;  1EU4 A;  2C60 A;  3AI5 A;  3N20 C;  1I4R A;  3VAW A;  1B1Z A;  3W2D A;  1R4M B;  2K25 A;  3X0W A;  2WXL A;  1I4X A;  2D07 B;  1ZKH A;  1GUA B;  2WDT B;  3EC8 A;  3LYY A;  3APF A;  2WLB A;  3C0R B;  1C76 A;  2R2O A;  4HCN B;  2VH2 A;  4KIK A;  3ETR A;  3WAO A;  4WWN A;  5IOI A;  2MJD A;  1L0V B;  3N1X C;  2W3R A;  3SEB A;  3AU5 A;  3Q6B A;  4R3D A;  1TKE A;  3KWL A;  2BTE A;  1IBX B;  2FCS A;  1FIQ A;  3Q3J A;  3AEF B;  1FEH A;  2D3C A;  1HZ5 A;  1WM3 A;  4K1R B;  1TKY A;  4KKI A;  3T3N A;  1WM2 A;  3VR8 B;  2WXO A;  1L4D B;  5DPR A;  3VHT C;  1T3Q A;  1SSN A;  5D94 A;  4IUM B;  1V1P B;  4GIV A;  4W9L A;  4IM2 A;  2K22 A;  2ACZ B;  1ZOY B;  4HWI B;  3QA8 A;  2DAJ A;  3KUZ A;  2BS3 B;  2V3P A;  2HE7 A;  4RH6 A;  3AN1 A;  1WYW B;  2AX5 A;  4B95 A;  1A5R A;  2KHW B;  5BO4 B;  5KHO A;  4EFO A;  1FPY A;  2X8X X;  3AEE B;  3A9J A;  2VZK B;  3FC4 A;  3M95 A;  5AEK B;  1V2Y A;  1VD2 A;  3V3X A;  2LGY A;  3A9K A;  3FIL A;  1GG3 A;  2WNM A;  2JWZ A;  4HDO A;  4GDK B;  3UIO B;  2ZCC A;  4DQO C;  2WS3 B;  3WAL A;  2E3T A;  4FJZ A;  3RN9 C;  4K81 A;  1CZP A;  4KGR A;  1WGK A;  2DZM A;  4A3P A;  2KC2 A;  2AWT A;  5GXG B;  1OTR B;  3DVG X;  2E6X A;  2O6V A;  1WXA A;  4NJC A;  2MP2 A;  2W54 A;  3KYD D;  1WWT A;  2KLG A;  1WXQ A;  3MJW A;  5GMV A;  2BYT A;  4L1B A;  1D5X C;  4ANV A;  2LVP A;  2PKO A;  2GBN A;  4PYU A;  1R7S A;  4W9F A;  4MT5 A;  4BKT A;  1PGX A;  2RMM A;  3JVZ X;  3PHX B;  1QF6 A;  3SU8 X;  1R4N B;  1V86 A;  4WAA A;  3HIZ A;  4TUU A;  1TZ1 A;  1WJ6 A;  1VDV A;  1GB1 A;  1TKG A;  2JY6 A;  1HXY D;  2PEA A;  4FAD A;  3TBL D;  1XF5 L;  1XXG A;  2BWF A;  2KN5 A;  2KDF B;  2JXX A;  3NRZ A;  3PS6 A;  3B08 A;  2NMQ A;  4F7Z A;  2WXK A;  3MHZ A;  2ZW0 A;  4B9K A;  1P1A A;  4RFB A;  2J53 A;  2H88 B;  1E6E B;  2RSU A;  4ZRP A;  2CKH B;  3KUD B;  3P4S B;  2JZ3 B;  2YLM A;  1J8C A;  1AW7 A;  2JZZ A;  4NQK E;  2JF5 A;  4CO7 A;  2CHX A;  1WZ0 A;  3DHI C;  1JQ4 A;  4HPP A;  4WWO A;  2LGX A;  1I35 A;  1L0Y B;  5IO9 A;  1PQS A;  4X57 B;  4RGT A;  2JRH A;  1CMX B;  1TYG B;  5EDS A;  2LWP A;  1YX5 B;  2CU1 A;  2CJO A;  1WX8 A;  4W9C A;  3ZUN A;  1ISN A;  2GBK A;  4P16 A;  4W9D A;  4LTU A;  4P7I A;  4MH0 E;  1FRR A;  1QOB A;  2D5G A;  3EA6 A;  3AV8 A;  2V4I B;  4A8X C;  4HPL B;  4OVU A;  2BPS A;  5HKH A;  2BYF A;  2LD9 A;  4EE2 A;  5IA7 A;  3TMP B;  2B76 B;  2LI5 A;  1D6E C;  1YQ3 B;  2SEB D;  3Q8A A;  1C3T A;  2UU7 A;  3L16 A;  3MJ5 A;  1E7P B;  3AM9 A;  3ZW3 A;  4YWG G;  4HRS A;  1XLO A;  5BYQ A;  3ZRF A;  4EUT A;  4WQO B;  2WU2 B;  4BVU C;  1FNV A;  4XDD A;  2WXI A;  4URK A;  1M4V A;  2Z59 B;  1P7E A;  4LK0 M;  4EEW A;  1NYQ A;  1C4P A;  1V80 A;  3ECI A;  1IPG A;  3RNC C;  1PYW D;  1ZPS A;  1VZ7 A;  3DBH B;  2DYO A;  3NS1 A;  2DZJ A;  2MH7 A;  4M02 A;  3NUH B;  4DXG A;  3AU4 A;  1D3Z A;  4PS7 A;  1WMH A;  2K9X A;  1YMH E;  2WGS A;  4IG7 B;  4ZHO A;  4GDK A;  5LXI B;  1L6V A;  4OW0 A;  2LGI A;  3OWE B;  4MJS B;  1J7B A;  2OED A;  4A20 A;  4WWP A;  4C7Z A;  1L2N A;  4OVV A;  1L7Y A;  3ENE A;  3UI3 A;  4HRO A;  2BQQ A;  1ET9 A;  4LDT D;  5FKA C;  2AQ3 B;  1VRA B;  2K1F A;  2M4N A;  4ANU A;  1EF1 A;  4DWF A;  1JRO A;  3MTN B;  1GNU A;  3QK0 A;  2KWD A;  2BYV E;  3PT2 B;  3EFC A;  1N5X A;  1L6U A;  1QOF A;  2N1V A;  3FAH A;  3RFZ B;  1K51 A;  2EMS A;  3IT4 B;  1P3Q U;  5HI1 A;  5E6P A;  2IGH A;  4OZC A;  3UQA A;  3L08 A;  3P4P B;  2PE9 A;  4ITK A;  1PGA A;  3NVY A;  2MLB A;  4IM0 A;  1E7U A;  2K8H A;  3M62 B;  2RR9 A;  4FA6 A;  3DVN V;  3GZN I;  1X1M A;  4A90 A;  3OG5 A;  2YEP B;  1SIJ A;  4K7W A;  1WI0 A;  4FHJ A;  4K3B A;  1SE2 A;  2H89 B;  2KKC A;  1IGC A;  4GN1 A;  1UWX A;  2O6V B;  1WIA A;  2EKI A;  1EF5 A;  4KDI C;  4M00 A;  1SIF A;  1YOV B;  1KRH A;  3AE8 B;  5H92 C;  3Q3M C;  1S3S G;  3PRP B;  2ZJD A;  4C7Y A;  1Q10 A;  4W9J A;  2QJL A;  3W9C B;  3RNA C;  1V8C A;  2GBJ A;  1VZ8 A;  1F2R C;  2I1J A;  2LJ5 A;  3PZ7 A;  1E8X A;  2TSS A;  2CJN A;  3AE2 B;  5IN7 A;  5L95 C;  2ZCB A;  1AAR A;  2KTR A;  4XWT A;  2KN4 A;  4IM3 A;  3P63 A;  2ONQ A;  3AE9 B;  3Q69 A;  4ANX A;  3FKY A;  1ESF A;  2CU3 A;  1V1P A;  1JW9 D;  1T6B X;  4BKS D;  1TTN A;  4HJG E;  2KT7 A;  3BWU D;  1WGG A;  4FLH A;  4KZC A;  3C8Y A;  1UWM A;  4HK2 A;  3KLS X;  1P9D U;  2D10 A;  4WJQ A;  2N7E A;  1FFV A;  4W9H A;  1DGJ A;  2WQY B;  2O6V D;  4RMA A;  3R7R A;  5G5G A;  3APD A;  5CHF A;  4M8N A;  3VH4 B;  2PTL A;  4NPN A;  3TEW A;  1PDX A;  2FCN A;  1UUP A;  5DPS A;  1C79 A;  4F1S A;  1AYF A;  1J19 A;  3R2T A;  3H7P A;  1TS5 A;  1V1O A;  4ARI A;  4W9E A;  2IJ0 A;  2JT4 B;  2BVC A;  2KMM A;  4DXA B;  2D3B A;  1WGR A;  2OJR A;  1VJK A;  1QOA A;  4MSM B;  2J7Q B;  2KDM A;  1KLG D;  4XC2 A;  5G2N A;  3ML9 A;  2I38 A;  5CX3 A;  1C77 A;  1D4B A;  5IP4 D;  3E56 A;  2KNB A;  4WQM A;  4P6V F;  1RWS A;  1E0Z A;  2ZVN A;  3Q3O C;  3ZJV A;  1KFY B;  4KKJ A;  3GB1 A;  2Y5P A;  2KTR B;  1MFW A;  3ZDM C;  2JRI B;  3KWV A;  4ACF A;  3JSV B;  5D2M B;  3HM3 A;  4HCP B;  2YVC A;  3AEB B;  2G1E A;  2KD0 A;  2ASQ A;  1L0X B;  3UF8 A;  2R2Q A;  1WR6 E;  3Q2A C;  4TKN A;  4E74 A;  2LXA A;  3ZNG C;  3ZKJ C;  2DWQ A;  3WAP A;  1JRP A;  3A9J B;  4CHK A;  3V60 A;  1J0G A;  4NY0 A;  3Q3F A;  2ZVO A;  2BS2 B;  2V1Y A;  2CHZ A;  3OAW A;  4NAW A;  3H8H A;  4GGQ A;  4I6L B;  2G9H D;  4BFR A;  3DBL I;  3BY4 B;  3JSV A;  4KZ0 A;  2L8J A;  3L4P A;  4BOS C;  2JYT A;  1Q0W B;  3V61 A;  2IYD B;  3Q8F A;  3ZVV A;  4LJO B;  1NYR A;  2A4Z A;  2LVO A;  3DHH C;  1YQ4 B;  3SR6 A;  1C4C A;  3L0W B;  5E6N A;  1SGH A;  4ZYN A;  1F9J A;  2WXM A;  5BYS A;  3NVV A;  3QHT A;  2KFK A;  1S1Q B;  2N7D A;  4ZYS A;  3WAM A;  1RAX A;  1I42 A;  2KAN A;  4HPM B;  4II2 B;  1UNS A;  2L0F A;  4M01 A;  1TT5 B;  4LNN A;  2DX5 B;  1MVK A;  3W1Y A;  5I4D A;  3V62 A;  1XLN A;  3NVZ A;  3CIR B;  3H7P B;  2LUM A;  1J7C A;  2LMC A;  4LJP B;  3DDC B;  4OVZ A;  2MRP A;  2JX5 A;  1SE4 A;  2QEJ C;  2N7J A;  3RT3 B;  3EFU A;  4KIK B;  2WXG A;  3T9L A;  3U8Z A;  3AXC A;  2PPH A;  3ZRC A;  1MG8 A;  2MSE D;  5EE1 A;  4W9K A;  3AEA B;  4XZ4 A;  3SFE B;  5D3I B;  3GZN B;  5DCN A;  3PGE A;  4YTN B;  4M0W B;  2BT6 A;  1DOX A;  5D7G A;  1I7H A;  5AUK A;  4JIO U;  3GE8 C;  5JZE B;  2KQ7 A;  1U4A A;  3I3T B;  5IAA C;  1YNT E;  3ZNZ B;  2W55 A;  3IFW B;  1NEN B;  1E8Z A;  2M0A A;  2AYO B;  4D2K A;  1WMH B;  4FJV B;  4YSX B;  3B2G A;  4TQ1 A;  2GBM A;  2KC1 A;  3Q8C A;  4FN2 A;  2UWQ A;  3CSF A;  2N1W A;  2KX0 A;  2C9W B;  4AWJ A;  1C4A A;  1YN3 A;  3KQ4 A;  3ML8 A;  2Z8L A;  5EE3 A;  1XLP A;  2VH1 A;  5EE0 A;  2BW2 A;  3B1L X;  2L1A A;  4I6P A;  4MM3 B;  4AP4 C;  1IYF A;  1HE8 A;  3V6E B; 
#chains in the Genus database with same CATH homology
 1C3T A;  5L83 A;  3L16 A;  4ANW A;  1WJ4 A;  2AEH A;  4FUL A;  4DK5 A;  4WJN A;  2A5U A;  2LGD A;  1LQB A;  2RPQ A;  3ZW3 A;  4K7S A;  1NBF C;  2C7M B;  4DHZ E;  2J0K A;  2EMT A;  4EKU A;  4IWO A;  4PS8 A;  1WJN A;  3GOE A;  3WA0 A;  2L7R A;  4HJK A;  3ZRF A;  3K9O B;  4WQO B;  4EUT A;  2MA9 B;  2BYE A;  4ICU A;  4BVU C;  4MSQ B;  3DVN U;  3DBH I;  2LRU A;  4URK A;  4DDI D;  1SE9 A;  1XQQ A;  2Z59 B;  4AUQ C;  1M94 A;  4EEW A;  2IY0 B;  2ZPY A;  3VUX A;  4ZRK A;  3NHE B;  1WZ3 A;  2M0X A;  1V80 A;  1RLF A;  3ECI A;  2UYZ B;  1IPG A;  2JPH A;  2KDI A;  3TL5 A;  1WRD B;  5CHW A;  2DYO A;  4A3O A;  2DZJ A;  4I6N B;  2FUH B;  4AOF A;  3QAR A;  1WY8 A;  3AU4 A;  2NS5 A;  4YL8 A;  1D3Z A;  4JLC A;  4CYE A;  4PS7 A;  1WMH A;  3PV1 A;  2IZV B;  2K39 A;  3ZO5 B;  5D6J B;  3PHW B;  2IO1 B;  4PYZ A;  3ZLZ A;  2MWS B;  3VTU A;  4IG7 B;  3N32 A;  4GDK A;  4FBJ B;  3KH0 A;  4G0N B;  5LXI B;  2GMI C;  4NAW B;  5JH5 C;  3RZW C;  4XX5 A;  4KVG B;  1GJZ A;  4MJS B;  4N9F 4;  3TJP A;  2KFK B;  2FCM A;  4A20 A;  4WWP A;  3V6C B;  2KZR A;  3L13 A;  3N3K B;  4OVV A;  1L7Y A;  3ENE A;  1L2N A;  2L0T A;  4GDL A;  4GB9 A;  1WE6 A;  3PPA A;  4LDT D;  2NPT A;  2KMC A;  4IWP A;  2N4F A;  2WX1 A;  3A1Q A;  1TGZ B;  2M4N A;  2K1F A;  4KSK C;  4ANU A;  1EF1 A;  4HLE A;  4DWF A;  3KUC B;  1UGM A;  4W9G A;  3LDZ E;  3MTN B;  2KWC A;  4GU2 A;  1GNU A;  3QK0 A;  3QCA A;  2BYV E;  1E8W A;  1LXD A;  4DHJ B;  3PT2 B;  3AUL A;  4JQW C;  3QWZ B;  4BBN C;  3DOW A;  5AZG A;  2N1V A;  2MBQ A;  1H8C A;  1RFA A;  1YJ1 A;  2AL6 A;  2KX3 A;  5G55 A;  2EMS A;  2DZK A;  4AJY B;  1P3Q U;  3VFK A;  1GC7 A;  2KDE B;  5E6P A;  4BKG A;  1UZX B;  2MX2 A;  1UBQ A;  2DZI A;  2NPT B;  3ZNI D;  4GDL B;  3UQA A;  4AJW A;  3L08 A;  4ZRJ A;  1WFY A;  2PE9 A;  2ZPN A;  4NNJ B;  3RUI B;  3D32 A;  3MHS D;  1C1Y B;  5J17 A;  2MLB A;  3TCA A;  2G4D B;  3UIN B;  1JRU A;  1WXS A;  4WJO A;  1GC6 A;  4B6W A;  4IM0 A;  2JUO A;  3VUY A;  1E7U A;  2KDB A;  2DHZ A;  2K8H A;  3M62 B;  2LXC A;  3VH3 B;  3H9D A;  4JGH B;  4K7U A;  2RR9 A;  1KM7 A;  1EO6 A;  4FA6 A;  3DVN V;  3GZN I;  4MM3 A;  1X1M A;  1UEL A;  2D3G A;  2CS4 A;  2I1K A;  3UGB B;  3ZTD A;  3T8M A;  3W1S C;  4K7W A;  1WI0 A;  4FHJ A;  3IVF A;  2ZZP B;  2QHO A;  2KKC A;  4GN1 A;  2IY1 B;  3DPD A;  3BIN A;  2O6V B;  2PJH A;  1WIA A;  1R4M I;  3H6N A;  1T0Y A;  4TV3 A;  1TBE A;  4EOY A;  5AZH A;  1EF5 A;  1EUV B;  1QZE A;  4KDI C;  1UD7 A;  4GSW A;  4W9I A;  3NZS A;  2Y5B B;  1SIF A;  4RM8 A;  4KV2 A;  1WXM A;  1S3S G;  2J0J A;  4GOC A;  3QC8 B;  2BGF A;  5DPT A;  1LFD A;  2ZNV C;  3NOB A;  3KVF B;  3PRP B;  2ZJD A;  3RYT A;  2L00 B;  4M8M A;  4ZRI A;  1WR1 A;  4IWQ A;  1UH6 A;  2NCN A;  4W9J A;  4EZK A;  2K8C A;  2C7N B;  3JW0 X;  4II3 B;  4NJ6 A;  2KK8 A;  2GOW A;  2KOX A;  2V3S A;  2W9N A;  1V5O A;  3U30 A;  1VCB A;  1YX6 B;  2GBJ A;  4LDT B;  3H1U A;  2KMA A;  2WWZ A;  3IG3 A;  2REX A;  2V4L A;  2I1J A;  1Z2M A;  2LJ5 A;  2KXJ A;  3L17 A;  3S2A A;  2FAZ A;  4J6I A;  1E8X A;  1WXV A;  2LAS A;  3UQB A;  2XK5 A;  3P2B A;  5L95 C;  4DHJ D;  3NY5 A;  3WAN A;  2HTH A;  2ZCB A;  1AAR A;  1YD8 U;  3L54 A;  2FIF A;  2KTR A;  2M17 A;  3VUW A;  2BKR B;  3CST A;  4IM3 A;  1KOT A;  3SDL C;  2MBO A;  1UBI A;  3OJ3 A;  1H4R A;  1XT9 B;  2MBB B;  3RD2 A;  4ANX A;  2DEN B;  3QAQ A;  2L3Z A;  4IW0 A;  2NBV B;  2K6Q A;  3ZTC A;  5JHA A;  2CHW A;  4MGY E;  3R7Q A;  3ALB A;  3PRM B;  4BKS D;  5C23 A;  4EZL A;  1TTN A;  2L76 A;  1OGW A;  2VRR B;  4PS3 A;  2HJ8 A;  3M3J A;  5C1Z A;  2C60 A;  3AI5 A;  3EHV A;  3VVW B;  1NI2 A;  2K6D B;  2XEW A;  3VAW A;  3RUL A;  2K25 A;  1WGG A;  3DBR I;  4FLH A;  4FHK A;  2DYB A;  2Z0E B;  3LJ3 A;  1RRB A;  3X0W A;  4KZC A;  2M8S A;  3PLV A;  2D07 B;  2DYM A;  4HK2 A;  1ZKH A;  1GUA B;  2WDT B;  2Z0D B;  3EC8 A;  1P9D U;  2D10 A;  3APF A;  4WJQ A;  2N7E A;  1LM8 B;  4W9H A;  2IO3 B;  3C0R B;  2KLC A;  2R2O A;  2N9X A;  4DDG D;  4HCN B;  4NQL B;  2O6V D;  3N30 A;  4RMA A;  3R7R A;  3R3M A;  2KO3 A;  2MP2 B;  3M63 B;  2BKF A;  2KWV B;  3APD A;  4M8N A;  5CHF A;  3VQI A;  4KIK A;  2MBE A;  3VH4 B;  3WAO A;  4WWN A;  2XK5 B;  2O2V B;  4JL9 A;  4NPN A;  4BKS A;  5E6O A;  3VXW A;  2KFJ A;  3A4S C;  3AU5 A;  2MCN B;  5J18 A;  3O65 B;  2NR2 A;  2FCN A;  2OOB B;  3QJZ A;  5DPS A;  1BT0 A;  2M1M A;  3NS8 A;  4F1S A;  1J19 A;  3RCZ A;  3ZNH B;  3H7P A;  2HD5 B;  2G4S A;  4F8C B;  1WE7 A;  2FCS A;  4W9E A;  3QQ8 B;  2JT4 B;  3Q3J A;  4WJP A;  4DXA B;  1ZW7 A;  3VTV A;  1WM3 A;  1NDD A;  1WGR A;  2OJR A;  3JYU A;  4K1R B;  2KJR A;  4MSM B;  2J7Q B;  4FJY A;  1WM2 A;  1V9J A;  5KHQ A;  4BBN F;  4XC2 A;  2KJ6 A;  5G2N A;  3ML9 A;  2EKE C;  5DPR A;  3VHT C;  2LVQ A;  5CX3 A;  5D94 A;  4IUM B;  4MEL A;  4GIV A;  1OEY J;  3KW5 B;  3HM6 X;  3VTW A;  2KNB A;  4W9L A;  4IM2 A;  3U7D A;  3PVL A;  2DAF A;  4HWI B;  2NBU A;  3OLM D;  2BWE S;  2ZVN A;  3QA8 A;  2DAJ A;  3KUZ A;  2KTR B;  3ZDM C;  2JRI B;  4LCD E;  1V5T A;  2GBR A;  3JSV B;  2K8B A;  2WX0 A;  5D2M B;  3HM3 A;  4HCP B;  2HE7 A;  4MDK E;  2YVC A;  5AZF A;  1R4N I;  1OQY A;  1WYW B;  1KLV A;  2KD0 A;  4ZDV A;  3PZD A;  3DBS A;  2ASQ A;  2IO2 B;  4B95 A;  3A1Q B;  5J2R A;  1A5R A;  3UF8 A;  2KHW B;  5BO4 B;  4TQ0 A;  3DVG Y;  4BOZ B;  2WYQ A;  5KHO A;  2R2Q A;  1WR6 E;  3A9K B;  4EFO A;  4TKN A;  4E74 A;  5JHB A;  2LXA A;  3A9J A;  3ZNG C;  3M95 A;  3APC A;  3ZKJ C;  2KWU B;  3WAP A;  1KJT A;  3A9J B;  4CHK A;  1V2Y A;  3DCG A;  3V60 A;  1VD2 A;  5AEK B;  1J0G A;  2LGY A;  4NY0 A;  1WJU A;  2NVU I;  3A9K A;  3Q3F A;  3VDZ A;  1GG3 A;  4KSL C;  2JWZ A;  4HDO A;  2ZVO A;  2V1Y A;  2JVC A;  1E7V A;  2CHZ A;  3OAW A;  2LZ6 A;  4NAW A;  4GDK B;  3UIO B;  2MBH A;  2FNJ B;  2ZCC A;  3L10 B;  4GGQ A;  4I6L B;  4BFR A;  3WAL A;  3A33 B;  3DBL I;  4GXB A;  3PTF C;  3SHQ A;  3BY4 B;  4HVB A;  4FJZ A;  3HK0 A;  3PSE B;  3JSV A;  4K81 A;  4KZ0 A;  2L8J A;  4BOS C;  1Q0W B;  1WGY A;  2DZM A;  3V61 A;  2KQS A;  4A3P A;  4ASW C;  3K9P B;  2IYD B;  3ZVV A;  2KC2 A;  3ZDT A;  5TR5 A;  3KYC D;  4LJO B;  1WH3 A;  2AWT A;  1OTR B;  3DVG X;  2O6V A;  2A4Z A;  3X23 A;  1WXA A;  3B0A A;  2LVO A;  1YIW A;  2MP2 A;  3L0W B;  4G50 A;  2N9P C;  3R66 C;  2ZEQ A;  3KYD D;  1OEY A;  5E6N A;  3MJW A;  2KLG A;  2B3A A;  1SGH A;  5GMV A;  4ZYN A;  2KJH B;  1F9J A;  4ANV A;  2LVP A;  5CHV C;  1XD3 B;  1WX9 A;  4DBG A;  2GBN A;  3QHT A;  4PYU A;  1V81 A;  2KFK A;  3WIM A;  1S1Q B;  2D2Q A;  4W9F A;  4HDQ A;  4BKT A;  3A4R A;  2N7D A;  3WAM A;  1RAX A;  1I42 A;  2KTF A;  2KAN A;  3JVZ X;  3PHX B;  4HPM B;  4II2 B;  4G11 A;  3SU8 X;  2L0F A;  3ZIM A;  1Q5W B;  1V86 A;  4WAA A;  3ONS A;  2DX5 B;  2PE6 B;  3HIZ A;  4TUU A;  2RD0 A;  1TZ1 A;  3W1Y A;  1WJ6 A;  3V62 A;  2LUE A;  2JY6 A;  3PRE A;  3H7P B;  1Y8R C;  2MQJ A;  2PEA A;  5DPW A;  4FAD A;  3QIJ A;  3TBL D;  4LJP B;  3DDC B;  5LLI A;  2BWF A;  2C5L C;  3CMM B;  3NZU A;  2G45 B;  2KN5 A;  2MRP A;  2KDF B;  3IBE A;  2JXX A;  1WX7 A;  3RT3 B;  1K8R B;  3EFU A;  3PS6 A;  3B08 A;  4KIK B;  2KVR A;  1G6J A;  4F7Z A;  3T9L A;  2LRW A;  3U8Z A;  3AXC A;  2PPH A;  2ZNV B;  2L05 A;  1MG8 A;  1V6E A;  2MSE D;  2D11 A;  3ZRC A;  1P1A A;  4B9K A;  2MW5 A;  1E5W A;  4MEM A;  2FCQ A;  4NJ7 A;  4W9K A;  2RSU A;  5FR6 A;  4XZ4 A;  2CKH B;  5DCN A;  3PGE A;  3IHP C;  1E8Y A;  3KUD B;  2RGF A;  4M0W B;  1ZGU B;  3SD5 A;  5D7G A;  2JZ3 B;  2YLM A;  3QX1 A;  2BF8 B;  1J8C A;  2AL3 A;  4E71 A;  1WGD A;  2JZZ A;  4NQK E;  2JF5 A;  4CO7 A;  4E3C A;  1Z5S B;  2CHX A;  4JIO U;  1WZ0 A;  4MGK E;  4HXD A;  2IBI B;  1P0R A;  5JZE B;  2KQ7 A;  1P98 A;  1U4A A;  3RZF A;  2C7H A;  3I3T B;  4WWO A;  1WGH A;  1WF9 A;  4MGI E;  2LGX A;  5IAA C;  1I35 A;  3ZNZ B;  3IFW B;  1PQS A;  4X57 B;  4MGZ E;  1E8Z A;  2CR5 A;  4GMV A;  2AYO B;  2JRH A;  1E90 A;  1CMX B;  5EDS A;  4DHZ B;  2LWP A;  1WMH B;  1YX5 B;  3DQV A;  2CU1 A;  1FXT B;  1WX8 A;  4FJV B;  4W9C A;  1IP9 A;  1Q1O A;  4IC7 B;  4TQ1 A;  3ZUN A;  2G3Q B;  3OJ4 B;  2GBM A;  1ISN A;  2KC1 A;  2GBK A;  2NBW B;  3EEC A;  2UWQ A;  4FN2 A;  3UIP B;  3CSF A;  2N1W A;  4W9D A;  2KX0 A;  2XBB C;  4ICV A;  4P7I A;  2C9W B;  4AWJ A;  4MH0 E;  3PRZ A;  4G3X B;  2O2V A;  1V49 A;  5CTR C;  3CF6 E;  2IO0 B;  3ML8 A;  4KDL B;  4EZJ A;  2J0M A;  3B1L X;  4HPL B;  4OVU A;  2BPS A;  5HKH A;  4I6P A;  2BYF A;  4AP4 C;  1IYF A;  1HE8 A;  2LD9 A;  3PLU A;  5IA7 A;  4RM9 A;  3TMP B;  2FID A;  5LXH A;  3W1S A;  3V6E B;  4MJS A;  1YQB A;  2LI5 A;  3HHM A;  3TIX A;  3H7S A;  2N9E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...