2C60A

Crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
85
Chain Sequence
GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFO
total genus 20
structure length 85
sequence length 96
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c60A01
3A33B 2KQSA 2NPTB 3EECA 5JH5C 3HHMA 2KVRA 3DBHI 3V6EB 3ZUNA 4ICUA 2N1WA 2W9NA 4GGQA 1V5TA 1ISNA 2A5UA 3KVFB 2DENB 2LASA 3ZTDA 3L16A 3L08A 2WX1A 3VXWA 3ML9A 4HPLB 4K7UA 1MG8A 4K81A 3K9PB 5D2MB 3V62A 1P0RA 1UH6A 4IWOA 2CHWA 2R2QA 2K25A 3WAMA 1WYWB 4BFRA 2OOBB 3PPAA 2UYZB 1P3QU 2KANA 2N9EB 4EFOA 3A1QA 4G11A 2MRPA 3DVNV 4GDKB 3WA0A 1WZ3A 4TV3A 3SHQA 2K8BA 2LVOA 2KX0A 1RRBA 4MELA 4IM3A 1OEYA 2DZIA 2O2VB 2J7QB 3ZNZB 4A3OA 5DPWA 3R3MA 2MX2A 1WGRA 2DX5B 4XX5A 3VTWA 2WX0A 3M3JA 1J0GA 3QARA 4GOCA 4MDKE 5E6OA 2FNJB 1WMHB 2DYBA 3B0AA 4B6WA 4EZLA 5CTRC 4A20A 1NDDA 2KJHB 1KOTA 1WE6A 4OVVA 1IP9A 4LJOB 4TUUA 2MBHA 5BO4B 3PVLA 4WAAA 1YD8U 2WDTB 2BYEA 2DYOA 2J0JA 3NZUA 3QCAA 1WFYA 4LCDE 3VH3B 2D3GA 4TQ0A 2KK8A 3QC8B 4DXAB 2DYMA 2KWCA 2BGFA 1VD2A 4GDLB 5LXIB 2KHWB 2DZKA 1Z5SB 1P1AA 4B9KA 3RT3B 2L76A 4HVBA 3UINB 2D11A 3TBLD 3R7QA 1L7YA 2K8CA 4HDQA 1WGYA 2XK5B 2GBKA 3A9KA 2MSED 2N7DA 4W9FA 1UBQA 5CHWA 4W9LA 2LUEA 2MBEA 4W9CA 2M0XA 3LJ3A 4BKTA 3VHTC 3AI5A 1V80A 2CS4A 1Q5WB 2BPSA 4NPNA 4FHJA 2GBNA 2KFKB 5DPRA 2NVUI 3UQAA 2KJ6A 3M62B 3RUIB 2ZNVB 2LI5A 2JZZA 3KYDD 4IWQA 4K1RB 4LDTD 3A9JA 4KIKA 4XC2A 1J8CA 4BOSC 2MBOA 3PHWB 4FLHA 1WJUA 1WE7A 3QHTA 5EDSA 1V49A 1WGHA 3UQBA 3IG3A 4TQ1A 1E5WA 3PGEA 3OJ4B 3IBEA 4ASWC 5IA7A 3ZDTA 1OQYA 3IHPC 3Q3JA 4GU2A 2BWES 4HXDA 1NBFC 1V86A 2KWVB 3ZW3A 4FA6A 3ZNID 2RSUA 3ML8A 4TKNA 5JHBA 3ZLZA 2CU1A 4IW0A 3CSFA 4CHKA 3T8MA 3PRMB 1R4MI 1UD7A 4WJOA 2NS5A 3HM6X 2RPQA 1D3ZA 1SE9A 1TTNA 3B08A 2EKEC 3W1SA 1ZW7A 1WRDB 3DBSA 2OJRA 1E8YA 2LVQA 3AULA 3H7SA 3PS6A 3A4RA 3MTNB 3N32A 4P7IA 4MJSA 3W1SC 1E8WA 2KC2A 2REXA 1TBEA 2VRRB 4WJPA 4BBNF 4I6PA 3JSVB 2A4ZA 2EMTA 2ZPYA 4HK2A 4W9KA 4E3CA 3D32A 2D07B 3AU5A 3VAWA 1WF9A 2K6QA 3DQVA 3QAQA 1CMXB 1Q1OA 4MM3A 2ASQA 2MBBB 2KZRA 1XT9B 2G4SA 1V81A 3DDCB 1XD3B 1Z2MA 4XZ4A 2BKRB 3APFA 4E71A 3KUZA 4DWFA 1YIWA 2FIDA 2CR5A 3ZTCA 2M4NA 3QK0A 4PS3A 4KZ0A 3KUCB 2I1KA 2JZ3B 2YVCA 4F8CB 4EZKA 4NAWB 5CHVC 5DPTA 3N30A 4FJZA 1I35A 3UIOB 2N1VA 1EUVB 1E8XA 4G0NB 4EOYA 2G3QB 4YL8A 4DHJB 2XEWA 3DBLI 4BVUC 3H7PA 2L7RA 4K7WA 4JIOU 3ONSA 2GBMA 4M8NA 3GZNI 2D2QA 4AJWA 4PS8A 2ZVNA 1WXAA 2RR9A 2L3ZA 2BYVE 2AYOB 3JW0X 3PSEB 3PZDA 4IM0A 5C1ZA 3VUWA 1EF5A 2N9XA 4WQOB 4CO7A 4IG7B 2KDFB 2KMAA 2HD5B 3BY4B 4HPMB 2V1YA 3TIXA 1UGMA 3KUDB 4I6LB 3HIZA 2KD0A 4G50A 2IO2B 2XBBC 1WI0A 3V61A 3UF8A 1WX7A 3OAWA 2LXCA 5AZGA 3RZFA 2IO0B 3TCAA 4W9DA 2KN5A 3N3KB 3DPDA 1WH3A 2IBIB 2NBWB 3PT2B 4GSWA 1OEYJ 3MJWA 3CSTA 2K8HA 2FCMA 4FHKA 2IZVB 4LJPB 5AZHA 4ICVA 1XQQA 5J18A 3EHVA 3SU8X 2C60A 4IM2A 1HE8A 3WIMA 1I42A 2L8JA 1SGHA 3OJ3A 4AWJA 2HJ8A 2KDBA 3DVGY 1OGWA 2CHXA 4G3XB 2EMSA 2L0TA 3A4SC 3IFWB 3L17A 4FULA 4GB9A 2NPTA 4M0WB 4W9GA 2FCSA 3TMPB 4ANXA 2ZCCA 2R2OA 2GBJA 4OVUA 3VTUA 2YLMA 3ALBA 5DPSA 2PE9A 3UIPB 1UZXB 2N9PC 1YX5B 4A3PA 2KTRA 1IPGA 2KDIA 4KIKB 2L05A 3V6CB 2FCNA 4KDLB 1P9DU 2ZJDA 2JRHA 4HDOA 5G2NA 1J19A 2JPHA 4N9F4 5L83A 2O6VD 3U8ZA 4ZRKA 3AXCA 1YJ1A 2MQJA 5KHOA 5CHFA 2N4FA 3M63B 2JXXA 1LM8B 4EEWA 2JT4B 3C0RB 3PREA 2BYFA 4DHJD 1V2YA 2IY1B 3L0WB 3PV1A 3ECIA 4HWIB 3VVWB 2DZJA 4F7ZA 3OLMD 4MGZE 4ZDVA 4MGIE 3L10B 3QQ8B 4AJYB 2CKHB 1WJ6A 2KLCA 2B3AA 2KO3A 2KTFA 5J2RA 1TGZB 1WMHA 2J0MA 4HCNB 1RAXA 2KX3A 2O6VB 3ZNHB 4DHZE 4GMVA 5JHAA 4IWPA 5AEKB 2MBQA 3I3TB 1WJNA 5C23A 2JF5A 1WJ4A 2D10A 4FJYA 5LLIA 4LDTB 4W9JA 1C1YB 1KM7A 3VDZA 1EF1A 3KW5B 2M8SA 2KC1A 3ENEA 3JSVA 2GOWA 2AEHA 1V9JA 3A1QB 3DVGX 4NY0A 3GOEA 4KVGB 4WWOA 3WAOA 4CYEA 3NHEB 3W1YA 1E7VA 2LGYA 4PS7A 5E6PA 4FBJB 2MCNB 5LXHA 3QJZA 4FN2A 1E8ZA 4HLEA 2IYDB 3K9OB 4HJKA 2PJHA 3A9KB 3TL5A 3KH0A 4IUMB 4NJ6A 3RD2A 1UBIA 1E7UA 4MH0E 3RULA 2LRUA 2O2VA 5D6JB 2M1MA 3BINA 3PLUA 1WZ0A 1SIFA 2C9WB 1A5RA 1WR1A 4KV2A 2MWSB 4BKGA 3DOWA 1F9JA 2Z0EB 2KFKA 4IC7B 1V5OA 3H9DA 2LD9A 2BF8B 3H6NA 4FJVB 1WIAA 1FXTB 2DZMA 2L0FA 2LVPA 1UELA 3A9JB 3AU4A 2ZNVC 3IVFA 4MGYE 4PYUA 4JQWC 4WWNA 4WWPA 2MA9B 1TZ1A 2MP2B 1WXVA 2LJ5A 4MSQB 3L13A 1G6JA 4ANVA 3ZRFA 1WX9A 3MHSD 4BKSA 4E74A 4BBNC 3CF6E 4JGHB 2JY6A 3PRPB 2KFJA 3R7RA 4FADA 3APCA 2KJRA 3WALA 2IY0B 2KNBA 4KSLC 1P98A 4K7SA 2FCQA 3VQIA 4AOFA 3U30A 2Z59B 3DBRI 3ZDMC 1WY8A 4B95A 1GNUA 2GBRA 4DHZB 3UGBB 2GMIC 5E6NA 5D7GA 1K8RB 3R66C 2WWZA 4ZRIA 4ZYNA 3X0WA 1S3SG 2G45B 2JRIB 2RD0A 3NZSA 2J0KA 3QA8A 4NJ7A 1H8CA 3VFKA 4MJSB 5DCNA 3HK0A 3VTVA 1GC7A 2IO3B 2KXJA 3SDLC 2C7NB 3DVNU 1LXDA 4GDKA 2HTHA 4F1SA 4NQKE 1X1MA 4BKSD 1GG3A 1NI2A 2NCNA 1WXSA 4ANWA 2NBUA 2Z0DB 3VUYA 1WGGA 2AL3A 2JUOA 3U7DA 1KJTA 2LXAA 2ZVOA 3VH4B 1L2NA 3T9LA 3RYTA 3O65B 3QWZB 4EUTA 3HM3A 5JZEB 1GUAB 1Y8RC 3JVZX 1S1QB 2RGFA 2PEAA 3ZIMA 2FAZA 2DAFA 1RFAA 3S2AA 3B1LX 2LGDA 4MEMA 4NNJB 4GXBA 3ZO5B 2C7MB 2AWTA 3EC8A 3M95A 4NAWA 4AUQC 4KSKC 4GN1A 3X23A 3TJPA 2FIFA 3PLVA 3PRZA 3APDA 1OTRB 1Q0WB 1C3TA 2FUHB 4GDLA 1GJZA 3P2BA 2NR2A 2HE7A 5CX3A 4URKA 4AP4C 3ZVVA 4JLCA 3H7PB 2KLGA 4KZCA 4DBGA 1WM2A 2BWFA 2K1FA 2XK5A 4X57B 3LDZE 2L00B 1QZEA 3DCGA 2MW5A 3VUXA 4GIVA 3WAPA 4BOZB 2ZPNA 2PPHA 1AARA 2K6DB 2I1JA 3CMMB 3SD5A 2KKCA 2ZZPB 2LGXA 2K39A 2KWUB 4M8MA 2O6VA 2QHOA 3NOBA 4II2B 5HKHA 1ZKHA 1LFDA 4KDIC 1R4NI 3RZWC 3NY5A 2DHZA 1PQSA 2KMCA 5TR5A 2UWQA 3Q3FA 1WGDA 2NBVB 5GMVA 2C5LC 2JVCA 4HCPB 4DDID 5KHQA 4DK5A 4WJQA 2AL6A 4I6NB 3ZRCA 3L54A 4J6IA 1JRUA 4EZJA 1YX6B 3EFUA 2WYQA 4RM9A 1ZGUB 2LWPA 2MLBA 3PTFC 1U4AA 2LRWA 5G55A 5IAAC 1KLVA 5AZFA 1EO6A 4ANUA 3PHXB 4RM8A 2C7HA 2LZ6A 4PYZA 2G4DB 4W9HA 4WJNA 3ZNGC 4EKUA 1VCBA 1M94A 5J17A 1BT0A 3H1UA 2V4LA 3V60A 3QIJA 1WM3A 4MSMB 1WXMA 1LQBA 4II3B 2KTRB 2ZEQA 3NS8A 1T0YA 2KDEB 4NQLB 3WANA 2PE6B 2BKFA 4W9IA 1H4RA 3KYCD 3QX1A 1WR6E 3JYUA 1IYFA 2MP2A 2KOXA 1V6EA 2JWZA 4W9EA 2CHZA 4ZRJA 2IO1B 4RMAA 1YQBA 1WX8A 2N7EA 3ZKJC 2V3SA 1E90A 2KQ7A 5FR6A 4MGKE 3RCZA 2ZCBA 2DAJA 2Y5BB 5D94A 1RLFA 5L95C 2M17A 4DDGD 1GC6A 4JL9A
chains in the Genus database with same CATH superfamily
2N1WA 1V5TA 1ISNA 1TY0A 3L16A 2WX1A 3DHGC 2FE8A 4K7UA 3BYTB 2CHWA 2W3RA 4G11A 2MRPA 3SR6A 3W9CB 4TV3A 2FUG1 2Y3AA 1OEYA 4IM3A 3R3MA 2MX2A 4XX5A 3VTWA 3AB5A 2HDEA 1J0GA 2IGDA 1BUIC 4GOCA 2J42A 5E6OA 4C56C 2DYBA 4EZLA 3ZJTA 2WGSA 4LJOB 3IT6B 2JU6X 2WDTB 2DYOA 1XF5L 3VH3B 1FRRA 2KK8A 3R2TA 4MT5A 1N63A 2GLSA 4IOIE 2AX5A 1Z5SB 2W82A 1AYFA 2D11A 1TJEA 5EE0A 3R7QA 1L7YA 4HDQA 3A9KA 5CHWA 4W9LA 4NJCA 2BTEA 2MBEA 1BXTA 1QF6A 2M0XA 1LO5D 1V80A 5FK9C 2BPSA 1QQRA 2GBNA 2K3UA 2K9XA 2KJ6A 3M62B 2ZNVB 2LI5A 1A70A 4IWQA 2G1EA 3A9JA 3EUB2 1DYQA 4XC2A 1L4DB 1J8CA 4BOSC 4FLHA 5EDSA 4ARCA 1E5WA 3J9CA 3IBEA 4ASWC 4RH6A 2KWVB 3ZW3A 5JHBA 4A8XC 2CU1A 3ZJUA 4CHKA 3T8MA 3ZYYX 1WRIA 1R4MI 2RPQA 1TS2A 2WDQB 2EKEC 3W1SA 2OJRA 2LVQA 3AULA 3H7SA 3N32A 2KC2A 1TBEA 3BVZA 3JSVB 3D32A 1I4GA 3DQVA 1Q1OA 2G4SA 1SEBD 4E71A 3KUZA 2GB1A 1JWBD 2CR5A 3QK0A 4PS3A 4KZ0A 1HTQA 2JZ3B 2YVCA 1XLQA 4EZKA 3W5VB 3LYYA 3N30A 3UIOB 1EUVB 2KAJA 2G3QB 3DBLI 1VDVA 2N9KA 4K7WA 1YOVB 1AW7A 1FCLA 3GZNI 2ZVNA 3PSEB 2RR9A 2AYOB 3ETRA 5MPOA 2AQ3B 1T0QC 2D5GA 4CO7A 2KDFB 2HD5B 1I4RA 1P7FA 2BW2A 2IO2B 1WI0A 3V61A 1ZP0B 1WX7A 5AZGA 2IO0B 4ZYSA 4M01A 5BMIA 2L52A 3CSTA 5AZHA 4ICVA 5J18A 2WP9B 4D2KA 1YJIA 1WXQA 4IM2A 1HE8A 2L8JA 1C76A 5HI1A 2W55A 2KDBA 4G3XB 4KGTA 3A4SC 4GB9A 4W9GA 2J52A 3TMPB 4ANXA 3VTUA 3Q8AA 1ACCA 3ALBA 5DPSA 1UZXB 1MJDA 1YX5B 2MHJA 5D3IB 4KIKB 1DGJA 1YN4A 2ZJDA 5C2TB 4HDOA 2JPHA 3AE1B 1OQQA 2JYTA 2BB5A 3AXCA 5KHOA 2ZW1A 1KRHA 2WNMA 2WXJA 2JXXA 1LM8B 1QKZA 2N9LA 3AECB 2JT4B 3PREA 4DHJD 3L0WB 3PV1A 4F7ZA 1HZ5A 4MGZE 1WJ6A 3RNAC 2J0MA 3FC4A 3MFGA 4IDIA 5H8YE 4UDUC 1N62A 2NTSA 1WJ4A 2D10A 2M0AA 2ACZB 1NVID 5LLIA 4ACFA 1C1YB 1PGAA 2M8SA 2KC1A 3V05A 2GOWA 3A1QB 2WDRB 4CYEA 2MCNB 4FN2A 4HLEA 2IYDB 2PJHA 3A9KB 2MJDA 2WXQA 4BAXA 1R4NB 1UBIA 4MH0E 4DXFA 2LGIA 4XDDA 2JX5A 3E9SA 1SIFA 2C9WB 5EE1A 2FBWB 2KFKA 2BBCA 3N20C 4US8A 1V5OA 4M02A 3H6NA 3AE5B 1FXTB 4A55A 4WWNA 4A90A 1WXVA 1XXGA 3Q8EA 5HFYA 2KMMA 1JCKB 2WS3B 4JGHB 3PRPB 2KFJA 3N9YC 3B2GA 1YMHE 3APCA 2KNBA 3VQIA 3U30A 4B0MA 3ZDMC 4N58A 2GBRA 3RN9C 1L6VA 2YEPF 4O1NA 3ZGZA 3NZSA 2J0KA 1JRPA 2RDGA 3AE6B 1QOGA 4L2YA 2K5PA 3DHIC 4KGSA 1KF6B 4F1SA 3LB8C 1TT5B 2BS3B 1NI2A 1E7PB 3VUYA 2AL3A 1KJTA 2LXAA 2WXKA 2ZVOA 1L0XB 3GB1A 3HM3A 3IT4B 2PEAA 3ZIMA 1RFAA 2XNAC 4GXBA 3BK1A 3M95A 3AMZA 4P1BC 1YN5A 2FIFA 5TSSA 1Q10A 1JROA 1V1PB 3APDA 1Q0WB 2FUHB 4GDLA 2NR2A 2HE7A 4JLCA 3NS1A 3PZ8A 2QIEB 2KLGA 3AEGB 2G9HD 4DBGA 1WM2A 2WU2B 1OFFA 4X57B 3LDZE 1HTOA 5AUIA 3WAPA 4BOZB 2PPHA 2WXGA 3BIID 1DOXA 3Q69A 2J53A 3DHHC 2I1JA 2WDVB 3BZDB 3CMMB 4AQ7A 1L4ZB 2KKCA 1FEHA 2KWUB 1YQ4B 2QHOA 3Q8FA 5HKHA 3RZWC 1ET6A 2UWQA 1WGDA 2NBVB 3NVZA 2I2YA 2LHDA 4I6NB 3ZRCA 3L54A 1SE3A 2Q5WD 1NENB 4B0EA 2LRWA 4ANUA 2DWQA 3MC0B 2LZ6A 4PYZA 3ZNGC 1C4PA 4ITKA 1VCBA 1M94A 1IGCA 3H1UA 3QIJA 3N1ZC 1RFKA 1T0YA 4OW0A 3KWLA 2KN4A 2KOXA 4W9EA 2V3SA 1E90A 3RCZA 1RLFA 4DDGD 1FD6A 2BT6A 1ZE3D 3A33B 2KQSA 3ZXRA 3HHMA 3DBHI 3ZUNA 2PMVA 2W9NA 1VJKA 1QILA 2DENB 3ZTDA 3VXWA 3ML9A 3TEZA 4ZOHC 4MH8A 1I4QA 1JALA 5D2MB 1P0RA 1FM0D 3MC8A 4IWOA 2R2QA 2K25A 2MEKA 2WHIA 2OOBB 2UYZB 4C4VB 4EFOA 3NVYA 2W3SA 4Q2JA 1JMLA 2V4IB 2KX0A 4MELA 4R3DA 3I57A 2WX0A 3IAS1 2FNJB 4B6WA 1N61A 5CTRC 2NTTA 2KJHB 3Q3OC 5BO4B 1YD8U 3QCAA 3NZUA 4TQ0A 1WFYA 1PUTA 2DYMA 1SF0A 4GDLB 2V9HA 2DZKA 3TBLD 3OG5A 3N1XC 1WGYA 2XK5B 4NZLB 3AE2B 3NZ3A 4W9CA 1T0SC 4NPNA 2LUMA 3RUIB 3FAHA 4LDTD 1GPXA 2RDBC 4C80A 3PHWB 1WJUA 3QHTA 2N0SB 2K22A 3OJ4B 3ZDTA 3IHPC 3Q3JA 4GU2A 2BWES 2RPVA 1V86A 2VH1A 3HVZA 2SAKA 4FA6A 4TKNA 3CSFA 1V1OA 4WJOA 1ROEA 2NS5A 1D3ZA 5BMGA 2DLBA 2LJIA 1TTNA 1ZW7A 1WRDB 3DBSA 1E8YA 4HKZE 4N59A 4P7IA 2REXA 2VRRB 1YNTE 4I6PA 4W9KA 2D07B 3AU5A 2TSSA 1SIJA 4H2AA 3DBHB 1CMXB 4YSZB 4CQNA 2ASQA 2MBBB 1XT9B 1GB4A 3DDCB 1Z2MA 1YIWA 3N1YC 2M4NA 1ENFA 3KUCB 2CU3A 2I1KA 3Q6BA 2X38A 4NAWB 5CHVC 3HUIA 5C3JB 3URYA 1I35A 1V1PA 3AEFB 2HTME 3DBRB 2PLPA 5EE9A 2INNE 2L7RA 3T3NA 2WXMA 2D2QA 2L3ZA 2BYVE 4IM0A 2Y5CA 3PZDA 2J4XA 3B9JA 4LNOA 5C1ZA 1PYWD 3Q8BA 4J3OD 3KLSX 2KMAA 3NVVA 4TSSA 2JYEA 4HPMB 2V1YA 3TIXA 3KUDB 4I6LB 5IN7A 4G50A 2KWDA 4OZBA 3UF8A 2LXCA 1MHXA 5HG2A 3FILA 3N3KB 3MJWA 3ZXVA 1GAQB 2K8HA 2FCMA 1HQRD 4WURA 1XQQA 1CQVA 2CHXA 3L17A 3AEBB 2MJ3A 2ZCCA 2GBJA 1N5XA 1QOFA 4RFBA 3UIPB 1MI0A 1IPGA 2KDIA 2CJOA 2BS2B 5AUKA 3V6CB 3FKYA 2FCNA 2JRHA 2OJWA 3U8ZA 4PT5A 1FNUA 3C0RB 2KQ4X 5JXVA 1DOYA 3L10B 3QQ8B 4AJYB 5J2RA 1TGZB 2D3CA 4DHZE 4JPSA 4IWPA 1FFVA 3I3TB 5C23A 5AEKB 4FJYA 1J7CA 2QDFA 3GE8C 4LTUA 3KW5B 2VZKB 3AV8A 3DVGX 4WWOA 3NHEB 5LXHA 3QJZA 4ARIA 2BQQA 4WAFA 3K9OB 3VR8B 3KH0A 3RD2A 3MJ5A 3AEEB 3RULA 3BINA 1ZDVA 2RMMA 3PLUA 1WR1A 1F9JA 2VZKD 1YN3A 3P4PB 1FFUA 4IC7B 1C77A 2LD9A 2BF8B 4FJVB 2DZMA 2LVPA 2HJ1A 3IVFA 2MJEA 1B1ZA 4JQWC 1QT9A 2INPE 4XWTA 4ANVA 2D3BA 4E74A 4BBNC 2JY6A 4OZCA 3R7RA 1WWTA 2KJRA 4K7SA 3W2DA 2FCQA 1WY8A 4B95A 1GNUA 3UGBB 2WXIA 1ZPSA 2WWZA 4ZRIA 3NVWA 3X0WA 2IGHA 1WSPA 3QA8A 4NJ7A 2KXJA 1B9RA 2C7NB 1F2RC 1EWYC 2HTHA 1WXSA 2DBYA 2Z0DB 4ZHPA 3VH4B 2JUOA 3QWZB 3AEDB 5JZEB 1Y8RC 4PK1A 2IGGA 4HJGE 2FAZA 1EWCA 3AE7B 4C7ZA 5G5HA 4NNJB 2BB6A 1TS3A 2AWTA 3EC8A 4NAWA 4AUQC 1E9MA 3PLVA 1OTRB 2V3PA 4C00A 3ZVVA 1RM6C 2WXRA 3ZJVA 1N5WA 1SE2A 4HROA 3TEWA 1N60A 1QOBA 1YQ3B 3DCGA 1ZDXA 1TS5A 2MW5A 3VUXA 1L6UA 2K6DB 1RWSA 2LGXA 1MFWA 4LNKA 3NOBA 1FRDA 4RF0A 1LFDA 1R4NI 2KMCA 3Q3FA 5GMVA 5KHQA 4DK5A 4WJQA 3CWIA 4EZJA 1TYGB 1YX6B 1EM7A 3EFUA 2WYQA 2IDYA 3RNFC 5G55A 1EO6A 4W9HA 1F2RI 2G4DB 4XE0A 4M0WA 1PFDA 5J17A 1L0VB 3V60A 2JZPA 1KTKA 1WM3A 1WXMA 1FCCC 1LQBA 4KGRA 3PO0A 2KDEB 4YTPB 3WANA 2BKFA 4W9IA 1IYFA 1K51A 2MP2A 1E6EB 4ZRJA 4RMAA 1YQBA 4GLSC 2QC8A 3DBLB 5FR6A 2Y5BB 5L95C 1V97A 4JL9A 1FMAD 3EECA 2NPTB 1TS4A 3V6EB 4LLGM 4GGQA 1FO4A 2A5UA 2LASA 4RGOS 3L08A 3Q14C 3P4QB 3MC9A 4K81A 3K9PB 3V62A 1UH6A 1VRAB 1GOZA 1WYWB 1GB1A 3NRZA 1P3QU 2KANA 2N9EB 1ESFA 3A1QA 1E0ZA 3WA0A 1J7BA 1WZ3A 4S17A 4N6EB 3SHQA 1RRBA 2DZIA 4A3OA 5DPWA 2DX5B 4HEA1 3QARA 1R7SA 1WMHB 3B0AA 1J7AA 1NDDA 1KOTA 1TZOA 1WE6A 4OVVA 4TUUA 3PVLA 4WAAA 2BYEA 4LCDE 5BYSA 1SSNA 1VD2A 1MPEA 5LXIB 2KHWB 3RT3B 2L76A 3AN1A 4HVBA 3UINB 2PVOD 4XDCA 1K53A 2K8CA 2MSED 1UBQA 3MP9A 3P1MA 2LUEA 3IAM1 3AI5A 4FXCA 2CS4A 1Q5WB 1BMLC 4FHJA 2QSDA 2KFKB 5DPRA 2NVUI 3UQAA 3NUHB 2W54A 4TMAB 2MBOA 1V49A 1WGHA 1FXIA 1C9FA 4TQ1A 3AE3B 5IOIA 1D4BA 5IA7A 1IBXA 1OQYA 3SEBA 4HXDA 1NBFC 1SXTA 3ZNID 2RSUA 3ML8A 4JWUC 3ZLZA 1I4HA 4RGNA 4IW0A 3PRMB 3GZNB 3HM6X 1SE9A 3DWGC 3B08A 3PZ7A 4L23A 4MJSA 3W1SC 1E8WA 4WJPA 2WXOA 4L1BA 2A4ZA 2JSVX 4E3CA 3VAWA 3HVDA 1FNVA 2K6QA 3SFEB 3QAQA 4MM3A 4C7YA 2WXNA 2KZRA 1V81A 1XD3B 3APFA 4DWFA 2FIDA 5H92C 3ZTCA 2ICIA 4LNIA 4F8CB 3GE3C 3Q3NC 5DPTA 2LMCA 2WXPA 1C4CA 2N1VA 1E8XA 4EOYA 4YL8A 5BMHA 3C19A 4JIOU 3ONSA 4M8NA 1R4MB 1YJJA 2PVGC 1WXAA 3E56A 3VUWA 1EF5A 2N9XA 4WQOB 4IG7B 1JW9D 4JWSC 1AWDA 3BY4B 3HIZA 2KD0A 4US9A 1EU4A 2V0GA 3RZFA 3TCAA 4W9DA 2KT7A 3TEYA 2IBIB 4GSWA 4RNAA 1NYRA 4USAA 1JWUD 4LJPB 3I5JC 1XCTL 1I4PA 3EHVA 3WIMA 2PW9A 4P6VF 2HJ8A 3DVGY 3SFDB 2L0TA 4FULA 2NPTA 2FCSA 2WU5B 3U2SC 1WYGA 4A6QA 3C8YA 3RI7C 2YLMA 4LNFA 2PE9A 2N9PC 1PDXA 2L05A 2QILA 2EKIA 3L4PA 1E10A 1KH0A 2WXLA 5G2NA 1J19A 5L83A 3P42A 4ZRKA 1YJ1A 5CHFA 1D6EC 3M63B 1UNSA 2H89B 2BYFA 3MHZA 4HWIB 2BYTA 3T3OA 3OLMD 4MGIE 2KLCA 1T0RC 2B3AA 2KTFA 2MH7A 1WMHA 1SBBB 4HCNB 3ZNHB 4GMVA 4RCOA 5JHAA 2MBQA 2NMQA 4YWGG 5BYRA 2JF5A 2LEKA 4LDTB 5E6JA 1C79A 3CIRB 1KM7A 3RPFC 3VDZA 5IP4D 3ENEA 3JSVA 4REZA 2AEHA 3WAOA 4KVGB 3TEXA 4ZRPA 3W1YA 3P4SB 1L5PA 2LGSA 3TL5A 4IUMB 3EA6A 1E7UA 1XEEA 2O2VA 5D6JB 2KDMA 1WZ0A 1TKEA 2QCZA 4YTNB 3DOWA 2Z0EB 3AEAB 3H9DA 2PKOA 4OVZA 5LNK1 1QLBB 3AU4A 3A9JB 4MGYE 1STEA 5I4DA 2MA9B 2MP2B 2LJ5A 4MSQB 2OEDA 3ZRFA 4BKSA 4LNNA 1MG4A 1RYJA 1T3QA 4FADA 4XWWA 4WIPA 4KSLC 1P98A 3HRDD 3BWUD 4AOFA 2WXHA 2BVCA 1V8CA 2GMIC 1K8RB 3ZQ4A 3R66C 2G45B 2JRIB 2RD0A 3FILB 4YT0B 1H8CA 4MJSB 5DCNA 3HK0A 3VTVA 1GC7A 2IO3B 1HZ6A 3DVNU 1LXDA 4GDKA 3VRBB 4NQKE 4BKSD 1GG3A 3R8BA 2LFIA 2NBUA 3U7DA 1L2NA 1ET9A 3T9LA 1FPYA 3RYTA 1S1QB 2RGFA 2DAFA 3B1LX 4KSKC 4YSYB 5HHDG 2WXFA 3BK2A 1GJZA 1P7EA 3BVMA 4RGTA 3H7PB 1I4XA 4P16A 4K3CA 4KZCA 3TUOA 2K1FA 2XK5A 1TY2A 4GIVA 3IXSA 1IGDA 1NYQA 2IJ0A 3SD5A 2ZZPB 2K39A 2Y5PA 4II2B 3RNEC 2DHZA 3RMKC 1JQ4A 2C5LC 2JVCA 4DDID 3P4RB 1JRUA 2UU7A 5D3DA 1VZ8A 2X8XX 4RM9A 3VRAB 2LWPA 1XLOA 3TSSA 1U4AA 5AZFA 3PHXB 4RM8A 2ONQA 4EKUA 1L0YB 3GP7A 4MSMB 4II3B 2KTRB 2ZEQA 3NS8A 2DNFA 2V3NA 5FR3A 2PE6B 1H4RA 1WR6E 1XCQL 1V6EA 2IO1B 3NJTA 3ZKJC 2KQ7A 1XLNA 4MGKE 1UWMA 5D94A 2M17A 3AE4B 3U4EG 4XYCA 5JH5C 2KVRA 4ICUA 4ZHOA 2E3TA 3KVFB 4HPLB 1MG8A 2VH2A 3AM9A 1Y56A 3WAMA 1XO3A 4BFRA 3PPAA 4IKGA 3DVNV 4GDKB 1MVKA 4MACA 1PGBA 1ZXHA 2K8BA 2LVOA 2O2VB 3ZNZB 2J7QB 2R61A 1WGRA 1HA5A 3M3JA 4MDKE 1F77A 4A20A 1C4AA 5G5GA 1IP9A 1UWXA 2MBHA 2J0JA 2D3GA 3QC8B 4DXAB 2KWCA 2BGFA 2RDHA 3GS2A 1WGKA 1P1AA 4B9KA 1N6ZA 3P63A 3I63C 2GBKA 2KYWA 2JXTA 2N7DA 4W9FA 3U52E 4M00A 2YEPB 4JX1C 3W5UB 1C78A 3LJ3A 4BKTA 3VHTC 1FNWA 4KX6B 2JZZA 3DWMA 1UF0A 3KYDD 4K1RB 2K0PA 4KIKA 2PIAA 1WE7A 3UQBA 3LXFA 4BZAA 3IG3A 1FXAA 3PGEA 1VR9A 4JE3B 1DOIA 1T5XD 1UD7A 1HEZE 3PS6A 3KWVA 3A4RA 3MTNB 4EE2A 4S0RA 4BBNF 2EMTA 2ZPYA 4HK2A 2L1AA 1WF9A 1OQRA 1TIFA 3O13A 2JWUA 4XZ4A 2BKRB 2M56B 2IPKD 1SJED 1CK1A 1PGXA 4KKIA 1CZPA 4AS1A 2QJLA 4FJZA 1D5XC 4G0NB 4DHJB 2XEWA 4WWMA 4LK0M 4BVUC 3H7PA 1KLGD 2GBMA 1TKYA 4AJWA 4PS8A 3JW0X 2INDC 1UUPA 2XN9C 2Z8LA 1KFYB 1UGMA 1KLUD 2XBBC 2CJNA 3OAWA 2KN5A 4P1CC 3DPDA 1WH3A 2NBWB 3PT2B 1K52A 1OEYJ 3V3XA 3NG0A 1TKGA 2EELA 2GI9A 4ZRQA 4FHKA 2IZVB 3SU8X 2C60A 1I42A 1K50A 1SGHA 3OJ3A 4AWJA 1OGWA 2EMSA 3IFWB 4M0WB 3Q3MC 2R2OA 4OVUA 1I7HA 2SEBD 2OHFA 4A3PA 4A9AA 2KTRA 4WH4A 1SB3C 4KDLB 1P9DU 1SE4A 1EU3A 3Q2AC 4N9F4 2O6VD 2B76B 2MQJA 1IBXB 1ZUD2 2N4FA 3AE8B 4EEWA 4HPPA 1CJEA 1F52A 1V2YA 2IY1B 3VVWB 3BVGA 3ECIA 2DZJA 4ZDVA 3RFZB 1VZ7A 2CKHB 2KO3A 3RNGC 4YTMB 3RNCC 1RAXA 2KX3A 2O6VB 1WJNA 4QAYA 2H88B 4W9JA 1EF1A 1VZ6A 1V9JA 4NY0A 2JQRB 3GOEA 1E7VA 2LGYA 4PS7A 5E6PA 4FBJB 2PTLA 4HKQA 1JWSD 1E8ZA 5T8IA 2GRIA 4HJKA 2KACA 2ON8A 4NJ6A 2WLBA 2LRUA 2M1MA 1A5RA 4KV2A 2MWSB 4BKGA 3AH7A 2QEJC 1NEKB 1WIAA 3ABVB 2L0FA 1UELA 2ZNVC 4PYUA 4WWPA 3WCQA 2BS4B 1TZ1A 1G6JA 4OHJA 3L13A 1WX9A 3MHSD 3CF6E 1M4VA 2D3AA 3H8HA 4DXGA 2L32A 3WALA 2E6XA 2IY0B 4KKJA 1UGJA 3RNBC 1D5MC 2Z59B 3DBRI 4DHZB 2I38A 5E6NA 5D7GA 4ZYNA 1S3SG 2LHEA 1XLPA 1SJHD 4WQMA 4K3BA 5FKAC 3VFKA 4C4VA 3SDLC 1X1MA 2NCNA 4ANWA 4MM3B 1WGGA 3OWEB 4EUTA 3O65B 1GUAB 2ZW0A 1JWMD 3JVZX 3S2AA 2LGDA 1VLBA 4MEMA 3ZO5B 2C7MB 1MHHE 4GN1A 3BYYB 3U7ZA 3X23A 3TJPA 2M19A 3PRZA 3UI3A 1C3TA 3P2BA 5CX3A 4URKA 1NI3A 4AP4C 4RGMA 1ZXIA 3I9V1 2BWFA 1F0ZA 2L00B 1QZEA 1ZOYB 5IO9A 2QMTA 2ZPNA 3AE9B 5BYQA 1AARA 1FIQA 3EGRA 5IKCM 3KQ4A 4M8MA 2INCC 3EFCA 2O6VA 1ZKHA 4KDIC 3NY5A 1PQSA 5TR5A 2AQ1B 4HCPB 2AL6A 4NAMA 3VR9B 4J6IA 1D5ZC 1HXYD 1ZGUB 2MLBA 3PTFC 5IAAC 1KLVA 4HRSA 2C7HA 4WJNA 2WQYB 1IUEA 1BT0A 1JWAD 2V4LA 4XGAB 5EE3A 2N7JA 4DQOC 3B2FA 4YXDB 1LGRA 4NQLB 1F1HA 2L83A 3QX1A 3KYCD 1T6BX 3JYUA 2AQ2B 2KVZA 4YSXB 3Q8CA 1AN8A 2JWZA 4RF1A 2CHZA 5GXGB 4OZAA 1WX8A 2N7EA 3R2IA 1QOAA 2ZCBA 2DAJA 1GC6A
chains in the Genus database with same CATH topology
3A33B 2KQSA 2NPTB 3EECA 5JH5C 3HHMA 2KVRA 3DBHI 3V6EB 3ZUNA 4ICUA 2N1WA 2W9NA 4GGQA 1V5TA 1ISNA 2A5UA 3KVFB 2DENB 2LASA 3ZTDA 3L16A 3L08A 2WX1A 3VXWA 3ML9A 4HPLB 4K7UA 1MG8A 4K81A 3K9PB 5D2MB 3V62A 1P0RA 1UH6A 4IWOA 2CHWA 2R2QA 2K25A 3WAMA 1WYWB 4BFRA 2OOBB 3PPAA 2UYZB 1P3QU 2KANA 2N9EB 4EFOA 3A1QA 4G11A 2MRPA 3DVNV 4GDKB 3WA0A 1WZ3A 4TV3A 3SHQA 2K8BA 2LVOA 2KX0A 1RRBA 4MELA 4IM3A 1OEYA 2DZIA 2O2VB 2J7QB 3ZNZB 4A3OA 5DPWA 3R3MA 2MX2A 1WGRA 2DX5B 4XX5A 3VTWA 2WX0A 3M3JA 1J0GA 3QARA 4GOCA 4MDKE 5E6OA 2FNJB 1WMHB 2DYBA 3B0AA 4B6WA 4EZLA 5CTRC 4A20A 1NDDA 2KJHB 1KOTA 1WE6A 4OVVA 1IP9A 4LJOB 4TUUA 2MBHA 5BO4B 3PVLA 4WAAA 1YD8U 2WDTB 2BYEA 2DYOA 2J0JA 3NZUA 3QCAA 1WFYA 4LCDE 3VH3B 2D3GA 4TQ0A 2KK8A 3QC8B 4DXAB 2DYMA 2KWCA 2BGFA 1VD2A 4GDLB 5LXIB 2KHWB 2DZKA 1Z5SB 1P1AA 4B9KA 3RT3B 2L76A 4HVBA 3UINB 2D11A 3TBLD 3R7QA 1L7YA 2K8CA 4HDQA 1WGYA 2XK5B 2GBKA 3A9KA 2MSED 2N7DA 4W9FA 1UBQA 5CHWA 4W9LA 2LUEA 2MBEA 4W9CA 2M0XA 3LJ3A 4BKTA 3VHTC 3AI5A 1V80A 2CS4A 1Q5WB 2BPSA 4NPNA 4FHJA 2GBNA 2KFKB 5DPRA 2NVUI 3UQAA 2KJ6A 3M62B 3RUIB 2ZNVB 2LI5A 2JZZA 3KYDD 4IWQA 4K1RB 4LDTD 3A9JA 4KIKA 4XC2A 1J8CA 4BOSC 2MBOA 3PHWB 4FLHA 1WJUA 1WE7A 3QHTA 5EDSA 1V49A 1WGHA 3UQBA 3IG3A 4TQ1A 1E5WA 3PGEA 3OJ4B 3IBEA 4ASWC 5IA7A 3ZDTA 1OQYA 3IHPC 3Q3JA 4GU2A 2BWES 4HXDA 1NBFC 1V86A 2KWVB 3ZW3A 4FA6A 3ZNID 2RSUA 3ML8A 4TKNA 5JHBA 3ZLZA 2CU1A 4IW0A 3CSFA 4CHKA 3T8MA 3PRMB 1R4MI 1UD7A 4WJOA 2NS5A 3HM6X 2RPQA 1D3ZA 1SE9A 1TTNA 3B08A 2EKEC 3W1SA 1ZW7A 1WRDB 3DBSA 2OJRA 1E8YA 2LVQA 3AULA 3H7SA 3PS6A 3A4RA 3MTNB 3N32A 4P7IA 4MJSA 3W1SC 1E8WA 2KC2A 2REXA 1TBEA 2VRRB 4WJPA 4BBNF 4I6PA 3JSVB 2A4ZA 2EMTA 2ZPYA 4HK2A 4W9KA 4E3CA 3D32A 2D07B 3AU5A 3VAWA 1WF9A 2K6QA 3DQVA 3QAQA 1CMXB 1Q1OA 4MM3A 2ASQA 2MBBB 2KZRA 1XT9B 2G4SA 1V81A 3DDCB 1XD3B 1Z2MA 4XZ4A 2BKRB 3APFA 4E71A 3KUZA 4DWFA 1YIWA 2FIDA 2CR5A 3ZTCA 2M4NA 3QK0A 4PS3A 4KZ0A 3KUCB 2I1KA 2JZ3B 2YVCA 4F8CB 4EZKA 4NAWB 5CHVC 5DPTA 3N30A 4FJZA 1I35A 3UIOB 2N1VA 1EUVB 1E8XA 4G0NB 4EOYA 2G3QB 4YL8A 4DHJB 2XEWA 3DBLI 4BVUC 3H7PA 2L7RA 4K7WA 4JIOU 3ONSA 2GBMA 4M8NA 3GZNI 2D2QA 4AJWA 4PS8A 2ZVNA 1WXAA 2RR9A 2L3ZA 2BYVE 2AYOB 3JW0X 3PSEB 3PZDA 4IM0A 5C1ZA 3VUWA 1EF5A 2N9XA 4WQOB 4CO7A 4IG7B 2KDFB 2KMAA 2HD5B 3BY4B 4HPMB 2V1YA 3TIXA 1UGMA 3KUDB 4I6LB 3HIZA 2KD0A 4G50A 2IO2B 2XBBC 1WI0A 3V61A 3UF8A 1WX7A 3OAWA 2LXCA 5AZGA 3RZFA 2IO0B 3TCAA 4W9DA 2KN5A 3N3KB 3DPDA 1WH3A 2IBIB 2NBWB 3PT2B 4GSWA 1OEYJ 3MJWA 3CSTA 2K8HA 2FCMA 4FHKA 2IZVB 4LJPB 5AZHA 4ICVA 1XQQA 5J18A 3EHVA 3SU8X 2C60A 4IM2A 1HE8A 3WIMA 1I42A 2L8JA 1SGHA 3OJ3A 4AWJA 2HJ8A 2KDBA 3DVGY 1OGWA 2CHXA 4G3XB 2EMSA 2L0TA 3A4SC 3IFWB 3L17A 4FULA 4GB9A 2NPTA 4M0WB 4W9GA 2FCSA 3TMPB 4ANXA 2ZCCA 2R2OA 2GBJA 4OVUA 3VTUA 2YLMA 3ALBA 5DPSA 2PE9A 3UIPB 1UZXB 2N9PC 1YX5B 4A3PA 2KTRA 1IPGA 2KDIA 4KIKB 2L05A 3V6CB 2FCNA 4KDLB 1P9DU 2ZJDA 2JRHA 4HDOA 5G2NA 1J19A 2JPHA 4N9F4 5L83A 2O6VD 3U8ZA 4ZRKA 3AXCA 1YJ1A 2MQJA 5KHOA 5CHFA 2N4FA 3M63B 2JXXA 1LM8B 4EEWA 2JT4B 3C0RB 3PREA 2BYFA 4DHJD 1V2YA 2IY1B 3L0WB 3PV1A 3ECIA 4HWIB 3VVWB 2DZJA 4F7ZA 3OLMD 4MGZE 4ZDVA 4MGIE 3L10B 3QQ8B 4AJYB 2CKHB 1WJ6A 2KLCA 2B3AA 2KO3A 2KTFA 5J2RA 1TGZB 1WMHA 2J0MA 4HCNB 1RAXA 2KX3A 2O6VB 3ZNHB 4DHZE 4GMVA 5JHAA 4IWPA 5AEKB 2MBQA 3I3TB 1WJNA 5C23A 2JF5A 1WJ4A 2D10A 4FJYA 5LLIA 4LDTB 4W9JA 1C1YB 1KM7A 3VDZA 1EF1A 3KW5B 2M8SA 2KC1A 3ENEA 3JSVA 2GOWA 2AEHA 1V9JA 3A1QB 3DVGX 4NY0A 3GOEA 4KVGB 4WWOA 3WAOA 4CYEA 3NHEB 3W1YA 1E7VA 2LGYA 4PS7A 5E6PA 4FBJB 2MCNB 5LXHA 3QJZA 4FN2A 1E8ZA 4HLEA 2IYDB 3K9OB 4HJKA 2PJHA 3A9KB 3TL5A 3KH0A 4IUMB 4NJ6A 3RD2A 1UBIA 1E7UA 4MH0E 3RULA 2LRUA 2O2VA 5D6JB 2M1MA 3BINA 3PLUA 1WZ0A 1SIFA 2C9WB 1A5RA 1WR1A 4KV2A 2MWSB 4BKGA 3DOWA 1F9JA 2Z0EB 2KFKA 4IC7B 1V5OA 3H9DA 2LD9A 2BF8B 3H6NA 4FJVB 1WIAA 1FXTB 2DZMA 2L0FA 2LVPA 1UELA 3A9JB 3AU4A 2ZNVC 3IVFA 4MGYE 4PYUA 4JQWC 4WWNA 4WWPA 2MA9B 1TZ1A 2MP2B 1WXVA 2LJ5A 4MSQB 3L13A 1G6JA 4ANVA 3ZRFA 1WX9A 3MHSD 4BKSA 4E74A 4BBNC 3CF6E 4JGHB 2JY6A 3PRPB 2KFJA 3R7RA 4FADA 3APCA 2KJRA 3WALA 2IY0B 2KNBA 4KSLC 1P98A 4K7SA 2FCQA 3VQIA 4AOFA 3U30A 2Z59B 3DBRI 3ZDMC 1WY8A 4B95A 1GNUA 2GBRA 4DHZB 3UGBB 2GMIC 5E6NA 5D7GA 1K8RB 3R66C 2WWZA 4ZRIA 4ZYNA 3X0WA 1S3SG 2G45B 2JRIB 2RD0A 3NZSA 2J0KA 3QA8A 4NJ7A 1H8CA 3VFKA 4MJSB 5DCNA 3HK0A 3VTVA 1GC7A 2IO3B 2KXJA 3SDLC 2C7NB 3DVNU 1LXDA 4GDKA 2HTHA 4F1SA 4NQKE 1X1MA 4BKSD 1GG3A 1NI2A 2NCNA 1WXSA 4ANWA 2NBUA 2Z0DB 3VUYA 1WGGA 2AL3A 2JUOA 3U7DA 1KJTA 2LXAA 2ZVOA 3VH4B 1L2NA 3T9LA 3RYTA 3O65B 3QWZB 4EUTA 3HM3A 5JZEB 1GUAB 1Y8RC 3JVZX 1S1QB 2RGFA 2PEAA 3ZIMA 2FAZA 2DAFA 1RFAA 3S2AA 3B1LX 2LGDA 4MEMA 4NNJB 4GXBA 3ZO5B 2C7MB 2AWTA 3EC8A 3M95A 4NAWA 4AUQC 4KSKC 4GN1A 3X23A 3TJPA 2FIFA 3PLVA 3PRZA 3APDA 1OTRB 1Q0WB 1C3TA 2FUHB 4GDLA 1GJZA 3P2BA 2NR2A 2HE7A 5CX3A 4URKA 4AP4C 3ZVVA 4JLCA 3H7PB 2KLGA 4KZCA 4DBGA 1WM2A 2BWFA 2K1FA 2XK5A 4X57B 3LDZE 2L00B 1QZEA 3DCGA 2MW5A 3VUXA 4GIVA 3WAPA 4BOZB 2ZPNA 2PPHA 1AARA 2K6DB 2I1JA 3CMMB 3SD5A 2KKCA 2ZZPB 2LGXA 2K39A 2KWUB 4M8MA 2O6VA 2QHOA 3NOBA 4II2B 5HKHA 1ZKHA 1LFDA 4KDIC 1R4NI 3RZWC 3NY5A 2DHZA 1PQSA 2KMCA 5TR5A 2UWQA 3Q3FA 1WGDA 2NBVB 5GMVA 2C5LC 2JVCA 4HCPB 4DDID 5KHQA 4DK5A 4WJQA 2AL6A 4I6NB 3ZRCA 3L54A 4J6IA 1JRUA 4EZJA 1YX6B 3EFUA 2WYQA 4RM9A 1ZGUB 2LWPA 2MLBA 3PTFC 1U4AA 2LRWA 5G55A 5IAAC 1KLVA 5AZFA 1EO6A 4ANUA 3PHXB 4RM8A 2C7HA 2LZ6A 4PYZA 2G4DB 4W9HA 4WJNA 3ZNGC 4EKUA 1VCBA 1M94A 5J17A 1BT0A 3H1UA 2V4LA 3V60A 3QIJA 1WM3A 4MSMB 1WXMA 1LQBA 4II3B 2KTRB 2ZEQA 3NS8A 1T0YA 2KDEB 4NQLB 3WANA 2PE6B 2BKFA 4W9IA 1H4RA 3KYCD 3QX1A 1WR6E 3JYUA 1IYFA 2MP2A 2KOXA 1V6EA 2JWZA 4W9EA 2CHZA 4ZRJA 2IO1B 4RMAA 1YQBA 1WX8A 2N7EA 3ZKJC 2V3SA 1E90A 2KQ7A 5FR6A 4MGKE 3RCZA 2ZCBA 2DAJA 2Y5BB 5D94A 1RLFA 5L95C 2M17A 4DDGD 1GC6A 4JL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A33 B;  2KQS A;  2NPT B;  3EEC A;  5JH5 C;  3HHM A;  2KVR A;  3DBH I;  3V6E B;  3ZUN A;  4ICU A;  2N1W A;  2W9N A;  4GGQ A;  1V5T A;  1ISN A;  2A5U A;  3KVF B;  2DEN B;  2LAS A;  3ZTD A;  3L16 A;  3L08 A;  2WX1 A;  3VXW A;  3ML9 A;  4HPL B;  4K7U A;  1MG8 A;  4K81 A;  3K9P B;  5D2M B;  3V62 A;  1P0R A;  1UH6 A;  4IWO A;  2CHW A;  2R2Q A;  2K25 A;  3WAM A;  1WYW B;  4BFR A;  2OOB B;  3PPA A;  2UYZ B;  1P3Q U;  2KAN A;  2N9E B;  4EFO A;  3A1Q A;  4G11 A;  2MRP A;  3DVN V;  4GDK B;  3WA0 A;  1WZ3 A;  4TV3 A;  3SHQ A;  2K8B A;  2LVO A;  2KX0 A;  1RRB A;  4MEL A;  4IM3 A;  1OEY A;  2DZI A;  2O2V B;  2J7Q B;  3ZNZ B;  4A3O A;  5DPW A;  3R3M A;  2MX2 A;  1WGR A;  2DX5 B;  4XX5 A;  3VTW A;  2WX0 A;  3M3J A;  1J0G A;  3QAR A;  4GOC A;  4MDK E;  5E6O A;  2FNJ B;  1WMH B;  2DYB A;  3B0A A;  4B6W A;  4EZL A;  5CTR C;  4A20 A;  1NDD A;  2KJH B;  1KOT A;  1WE6 A;  4OVV A;  1IP9 A;  4LJO B;  4TUU A;  2MBH A;  5BO4 B;  3PVL A;  4WAA A;  1YD8 U;  2WDT B;  2BYE A;  2DYO A;  2J0J A;  3NZU A;  3QCA A;  1WFY A;  4LCD E;  3VH3 B;  2D3G A;  4TQ0 A;  2KK8 A;  3QC8 B;  4DXA B;  2DYM A;  2KWC A;  2BGF A;  1VD2 A;  4GDL B;  5LXI B;  2KHW B;  2DZK A;  1Z5S B;  1P1A A;  4B9K A;  3RT3 B;  2L76 A;  4HVB A;  3UIN B;  2D11 A;  3TBL D;  3R7Q A;  1L7Y A;  2K8C A;  4HDQ A;  1WGY A;  2XK5 B;  2GBK A;  3A9K A;  2MSE D;  2N7D A;  4W9F A;  1UBQ A;  5CHW A;  4W9L A;  2LUE A;  2MBE A;  4W9C A;  2M0X A;  3LJ3 A;  4BKT A;  3VHT C;  3AI5 A;  1V80 A;  2CS4 A;  1Q5W B;  2BPS A;  4NPN A;  4FHJ A;  2GBN A;  2KFK B;  5DPR A;  2NVU I;  3UQA A;  2KJ6 A;  3M62 B;  3RUI B;  2ZNV B;  2LI5 A;  2JZZ A;  3KYD D;  4IWQ A;  4K1R B;  4LDT D;  3A9J A;  4KIK A;  4XC2 A;  1J8C A;  4BOS C;  2MBO A;  3PHW B;  4FLH A;  1WJU A;  1WE7 A;  3QHT A;  5EDS A;  1V49 A;  1WGH A;  3UQB A;  3IG3 A;  4TQ1 A;  1E5W A;  3PGE A;  3OJ4 B;  3IBE A;  4ASW C;  5IA7 A;  3ZDT A;  1OQY A;  3IHP C;  3Q3J A;  4GU2 A;  2BWE S;  4HXD A;  1NBF C;  1V86 A;  2KWV B;  3ZW3 A;  4FA6 A;  3ZNI D;  2RSU A;  3ML8 A;  4TKN A;  5JHB A;  3ZLZ A;  2CU1 A;  4IW0 A;  3CSF A;  4CHK A;  3T8M A;  3PRM B;  1R4M I;  1UD7 A;  4WJO A;  2NS5 A;  3HM6 X;  2RPQ A;  1D3Z A;  1SE9 A;  1TTN A;  3B08 A;  2EKE C;  3W1S A;  1ZW7 A;  1WRD B;  3DBS A;  2OJR A;  1E8Y A;  2LVQ A;  3AUL A;  3H7S A;  3PS6 A;  3A4R A;  3MTN B;  3N32 A;  4P7I A;  4MJS A;  3W1S C;  1E8W A;  2KC2 A;  2REX A;  1TBE A;  2VRR B;  4WJP A;  4BBN F;  4I6P A;  3JSV B;  2A4Z A;  2EMT A;  2ZPY A;  4HK2 A;  4W9K A;  4E3C A;  3D32 A;  2D07 B;  3AU5 A;  3VAW A;  1WF9 A;  2K6Q A;  3DQV A;  3QAQ A;  1CMX B;  1Q1O A;  4MM3 A;  2ASQ A;  2MBB B;  2KZR A;  1XT9 B;  2G4S A;  1V81 A;  3DDC B;  1XD3 B;  1Z2M A;  4XZ4 A;  2BKR B;  3APF A;  4E71 A;  3KUZ A;  4DWF A;  1YIW A;  2FID A;  2CR5 A;  3ZTC A;  2M4N A;  3QK0 A;  4PS3 A;  4KZ0 A;  3KUC B;  2I1K A;  2JZ3 B;  2YVC A;  4F8C B;  4EZK A;  4NAW B;  5CHV C;  5DPT A;  3N30 A;  4FJZ A;  1I35 A;  3UIO B;  2N1V A;  1EUV B;  1E8X A;  4G0N B;  4EOY A;  2G3Q B;  4YL8 A;  4DHJ B;  2XEW A;  3DBL I;  4BVU C;  3H7P A;  2L7R A;  4K7W A;  4JIO U;  3ONS A;  2GBM A;  4M8N A;  3GZN I;  2D2Q A;  4AJW A;  4PS8 A;  2ZVN A;  1WXA A;  2RR9 A;  2L3Z A;  2BYV E;  2AYO B;  3JW0 X;  3PSE B;  3PZD A;  4IM0 A;  5C1Z A;  3VUW A;  1EF5 A;  2N9X A;  4WQO B;  4CO7 A;  4IG7 B;  2KDF B;  2KMA A;  2HD5 B;  3BY4 B;  4HPM B;  2V1Y A;  3TIX A;  1UGM A;  3KUD B;  4I6L B;  3HIZ A;  2KD0 A;  4G50 A;  2IO2 B;  2XBB C;  1WI0 A;  3V61 A;  3UF8 A;  1WX7 A;  3OAW A;  2LXC A;  5AZG A;  3RZF A;  2IO0 B;  3TCA A;  4W9D A;  2KN5 A;  3N3K B;  3DPD A;  1WH3 A;  2IBI B;  2NBW B;  3PT2 B;  4GSW A;  1OEY J;  3MJW A;  3CST A;  2K8H A;  2FCM A;  4FHK A;  2IZV B;  4LJP B;  5AZH A;  4ICV A;  1XQQ A;  5J18 A;  3EHV A;  3SU8 X;  2C60 A;  4IM2 A;  1HE8 A;  3WIM A;  1I42 A;  2L8J A;  1SGH A;  3OJ3 A;  4AWJ A;  2HJ8 A;  2KDB A;  3DVG Y;  1OGW A;  2CHX A;  4G3X B;  2EMS A;  2L0T A;  3A4S C;  3IFW B;  3L17 A;  4FUL A;  4GB9 A;  2NPT A;  4M0W B;  4W9G A;  2FCS A;  3TMP B;  4ANX A;  2ZCC A;  2R2O A;  2GBJ A;  4OVU A;  3VTU A;  2YLM A;  3ALB A;  5DPS A;  2PE9 A;  3UIP B;  1UZX B;  2N9P C;  1YX5 B;  4A3P A;  2KTR A;  1IPG A;  2KDI A;  4KIK B;  2L05 A;  3V6C B;  2FCN A;  4KDL B;  1P9D U;  2ZJD A;  2JRH A;  4HDO A;  5G2N A;  1J19 A;  2JPH A;  4N9F 4;  5L83 A;  2O6V D;  3U8Z A;  4ZRK A;  3AXC A;  1YJ1 A;  2MQJ A;  5KHO A;  5CHF A;  2N4F A;  3M63 B;  2JXX A;  1LM8 B;  4EEW A;  2JT4 B;  3C0R B;  3PRE A;  2BYF A;  4DHJ D;  1V2Y A;  2IY1 B;  3L0W B;  3PV1 A;  3ECI A;  4HWI B;  3VVW B;  2DZJ A;  4F7Z A;  3OLM D;  4MGZ E;  4ZDV A;  4MGI E;  3L10 B;  3QQ8 B;  4AJY B;  2CKH B;  1WJ6 A;  2KLC A;  2B3A A;  2KO3 A;  2KTF A;  5J2R A;  1TGZ B;  1WMH A;  2J0M A;  4HCN B;  1RAX A;  2KX3 A;  2O6V B;  3ZNH B;  4DHZ E;  4GMV A;  5JHA A;  4IWP A;  5AEK B;  2MBQ A;  3I3T B;  1WJN A;  5C23 A;  2JF5 A;  1WJ4 A;  2D10 A;  4FJY A;  5LLI A;  4LDT B;  4W9J A;  1C1Y B;  1KM7 A;  3VDZ A;  1EF1 A;  3KW5 B;  2M8S A;  2KC1 A;  3ENE A;  3JSV A;  2GOW A;  2AEH A;  1V9J A;  3A1Q B;  3DVG X;  4NY0 A;  3GOE A;  4KVG B;  4WWO A;  3WAO A;  4CYE A;  3NHE B;  3W1Y A;  1E7V A;  2LGY A;  4PS7 A;  5E6P A;  4FBJ B;  2MCN B;  5LXH A;  3QJZ A;  4FN2 A;  1E8Z A;  4HLE A;  2IYD B;  3K9O B;  4HJK A;  2PJH A;  3A9K B;  3TL5 A;  3KH0 A;  4IUM B;  4NJ6 A;  3RD2 A;  1UBI A;  1E7U A;  4MH0 E;  3RUL A;  2LRU A;  2O2V A;  5D6J B;  2M1M A;  3BIN A;  3PLU A;  1WZ0 A;  1SIF A;  2C9W B;  1A5R A;  1WR1 A;  4KV2 A;  2MWS B;  4BKG A;  3DOW A;  1F9J A;  2Z0E B;  2KFK A;  4IC7 B;  1V5O A;  3H9D A;  2LD9 A;  2BF8 B;  3H6N A;  4FJV B;  1WIA A;  1FXT B;  2DZM A;  2L0F A;  2LVP A;  1UEL A;  3A9J B;  3AU4 A;  2ZNV C;  3IVF A;  4MGY E;  4PYU A;  4JQW C;  4WWN A;  4WWP A;  2MA9 B;  1TZ1 A;  2MP2 B;  1WXV A;  2LJ5 A;  4MSQ B;  3L13 A;  1G6J A;  4ANV A;  3ZRF A;  1WX9 A;  3MHS D;  4BKS A;  4E74 A;  4BBN C;  3CF6 E;  4JGH B;  2JY6 A;  3PRP B;  2KFJ A;  3R7R A;  4FAD A;  3APC A;  2KJR A;  3WAL A;  2IY0 B;  2KNB A;  4KSL C;  1P98 A;  4K7S A;  2FCQ A;  3VQI A;  4AOF A;  3U30 A;  2Z59 B;  3DBR I;  3ZDM C;  1WY8 A;  4B95 A;  1GNU A;  2GBR A;  4DHZ B;  3UGB B;  2GMI C;  5E6N A;  5D7G A;  1K8R B;  3R66 C;  2WWZ A;  4ZRI A;  4ZYN A;  3X0W A;  1S3S G;  2G45 B;  2JRI B;  2RD0 A;  3NZS A;  2J0K A;  3QA8 A;  4NJ7 A;  1H8C A;  3VFK A;  4MJS B;  5DCN A;  3HK0 A;  3VTV A;  1GC7 A;  2IO3 B;  2KXJ A;  3SDL C;  2C7N B;  3DVN U;  1LXD A;  4GDK A;  2HTH A;  4F1S A;  4NQK E;  1X1M A;  4BKS D;  1GG3 A;  1NI2 A;  2NCN A;  1WXS A;  4ANW A;  2NBU A;  2Z0D B;  3VUY A;  1WGG A;  2AL3 A;  2JUO A;  3U7D A;  1KJT A;  2LXA A;  2ZVO A;  3VH4 B;  1L2N A;  3T9L A;  3RYT A;  3O65 B;  3QWZ B;  4EUT A;  3HM3 A;  5JZE B;  1GUA B;  1Y8R C;  3JVZ X;  1S1Q B;  2RGF A;  2PEA A;  3ZIM A;  2FAZ A;  2DAF A;  1RFA A;  3S2A A;  3B1L X;  2LGD A;  4MEM A;  4NNJ B;  4GXB A;  3ZO5 B;  2C7M B;  2AWT A;  3EC8 A;  3M95 A;  4NAW A;  4AUQ C;  4KSK C;  4GN1 A;  3X23 A;  3TJP A;  2FIF A;  3PLV A;  3PRZ A;  3APD A;  1OTR B;  1Q0W B;  1C3T A;  2FUH B;  4GDL A;  1GJZ A;  3P2B A;  2NR2 A;  2HE7 A;  5CX3 A;  4URK A;  4AP4 C;  3ZVV A;  4JLC A;  3H7P B;  2KLG A;  4KZC A;  4DBG A;  1WM2 A;  2BWF A;  2K1F A;  2XK5 A;  4X57 B;  3LDZ E;  2L00 B;  1QZE A;  3DCG A;  2MW5 A;  3VUX A;  4GIV A;  3WAP A;  4BOZ B;  2ZPN A;  2PPH A;  1AAR A;  2K6D B;  2I1J A;  3CMM B;  3SD5 A;  2KKC A;  2ZZP B;  2LGX A;  2K39 A;  2KWU B;  4M8M A;  2O6V A;  2QHO A;  3NOB A;  4II2 B;  5HKH A;  1ZKH A;  1LFD A;  4KDI C;  1R4N I;  3RZW C;  3NY5 A;  2DHZ A;  1PQS A;  2KMC A;  5TR5 A;  2UWQ A;  3Q3F A;  1WGD A;  2NBV B;  5GMV A;  2C5L C;  2JVC A;  4HCP B;  4DDI D;  5KHQ A;  4DK5 A;  4WJQ A;  2AL6 A;  4I6N B;  3ZRC A;  3L54 A;  4J6I A;  1JRU A;  4EZJ A;  1YX6 B;  3EFU A;  2WYQ A;  4RM9 A;  1ZGU B;  2LWP A;  2MLB A;  3PTF C;  1U4A A;  2LRW A;  5G55 A;  5IAA C;  1KLV A;  5AZF A;  1EO6 A;  4ANU A;  3PHX B;  4RM8 A;  2C7H A;  2LZ6 A;  4PYZ A;  2G4D B;  4W9H A;  4WJN A;  3ZNG C;  4EKU A;  1VCB A;  1M94 A;  5J17 A;  1BT0 A;  3H1U A;  2V4L A;  3V60 A;  3QIJ A;  1WM3 A;  4MSM B;  1WXM A;  1LQB A;  4II3 B;  2KTR B;  2ZEQ A;  3NS8 A;  1T0Y A;  2KDE B;  4NQL B;  3WAN A;  2PE6 B;  2BKF A;  4W9I A;  1H4R A;  3KYC D;  3QX1 A;  1WR6 E;  3JYU A;  1IYF A;  2MP2 A;  2KOX A;  1V6E A;  2JWZ A;  4W9E A;  2CHZ A;  4ZRJ A;  2IO1 B;  4RMA A;  1YQB A;  1WX8 A;  2N7E A;  3ZKJ C;  2V3S A;  1E90 A;  2KQ7 A;  5FR6 A;  4MGK E;  3RCZ A;  2ZCB A;  2DAJ A;  2Y5B B;  5D94 A;  1RLF A;  5L95 C;  2M17 A;  4DDG D;  1GC6 A;  4JL9 A; 
#chains in the Genus database with same CATH topology
 2N1W A;  1V5T A;  1ISN A;  1TY0 A;  3L16 A;  2WX1 A;  3DHG C;  2FE8 A;  4K7U A;  3BYT B;  2CHW A;  2W3R A;  4G11 A;  2MRP A;  3SR6 A;  3W9C B;  4TV3 A;  2FUG 1;  2Y3A A;  1OEY A;  4IM3 A;  3R3M A;  2MX2 A;  4XX5 A;  3VTW A;  3AB5 A;  2HDE A;  1J0G A;  2IGD A;  1BUI C;  4GOC A;  2J42 A;  5E6O A;  4C56 C;  2DYB A;  4EZL A;  3ZJT A;  2WGS A;  4LJO B;  3IT6 B;  2JU6 X;  2WDT B;  2DYO A;  1XF5 L;  3VH3 B;  1FRR A;  2KK8 A;  3R2T A;  4MT5 A;  1N63 A;  2GLS A;  4IOI E;  2AX5 A;  1Z5S B;  2W82 A;  1AYF A;  2D11 A;  1TJE A;  5EE0 A;  3R7Q A;  1L7Y A;  4HDQ A;  3A9K A;  5CHW A;  4W9L A;  4NJC A;  2BTE A;  2MBE A;  1BXT A;  1QF6 A;  2M0X A;  1LO5 D;  1V80 A;  5FK9 C;  2BPS A;  1QQR A;  2GBN A;  2K3U A;  2K9X A;  2KJ6 A;  3M62 B;  2ZNV B;  2LI5 A;  1A70 A;  4IWQ A;  2G1E A;  3A9J A;  3EUB 2;  1DYQ A;  4XC2 A;  1L4D B;  1J8C A;  4BOS C;  4FLH A;  5EDS A;  4ARC A;  1E5W A;  3J9C A;  3IBE A;  4ASW C;  4RH6 A;  2KWV B;  3ZW3 A;  5JHB A;  4A8X C;  2CU1 A;  3ZJU A;  4CHK A;  3T8M A;  3ZYY X;  1WRI A;  1R4M I;  2RPQ A;  1TS2 A;  2WDQ B;  2EKE C;  3W1S A;  2OJR A;  2LVQ A;  3AUL A;  3H7S A;  3N32 A;  2KC2 A;  1TBE A;  3BVZ A;  3JSV B;  3D32 A;  1I4G A;  3DQV A;  1Q1O A;  2G4S A;  1SEB D;  4E71 A;  3KUZ A;  2GB1 A;  1JWB D;  2CR5 A;  3QK0 A;  4PS3 A;  4KZ0 A;  1HTQ A;  2JZ3 B;  2YVC A;  1XLQ A;  4EZK A;  3W5V B;  3LYY A;  3N30 A;  3UIO B;  1EUV B;  2KAJ A;  2G3Q B;  3DBL I;  1VDV A;  2N9K A;  4K7W A;  1YOV B;  1AW7 A;  1FCL A;  3GZN I;  2ZVN A;  3PSE B;  2RR9 A;  2AYO B;  3ETR A;  5MPO A;  2AQ3 B;  1T0Q C;  2D5G A;  4CO7 A;  2KDF B;  2HD5 B;  1I4R A;  1P7F A;  2BW2 A;  2IO2 B;  1WI0 A;  3V61 A;  1ZP0 B;  1WX7 A;  5AZG A;  2IO0 B;  4ZYS A;  4M01 A;  5BMI A;  2L52 A;  3CST A;  5AZH A;  4ICV A;  5J18 A;  2WP9 B;  4D2K A;  1YJI A;  1WXQ A;  4IM2 A;  1HE8 A;  2L8J A;  1C76 A;  5HI1 A;  2W55 A;  2KDB A;  4G3X B;  4KGT A;  3A4S C;  4GB9 A;  4W9G A;  2J52 A;  3TMP B;  4ANX A;  3VTU A;  3Q8A A;  1ACC A;  3ALB A;  5DPS A;  1UZX B;  1MJD A;  1YX5 B;  2MHJ A;  5D3I B;  4KIK B;  1DGJ A;  1YN4 A;  2ZJD A;  5C2T B;  4HDO A;  2JPH A;  3AE1 B;  1OQQ A;  2JYT A;  2BB5 A;  3AXC A;  5KHO A;  2ZW1 A;  1KRH A;  2WNM A;  2WXJ A;  2JXX A;  1LM8 B;  1QKZ A;  2N9L A;  3AEC B;  2JT4 B;  3PRE A;  4DHJ D;  3L0W B;  3PV1 A;  4F7Z A;  1HZ5 A;  4MGZ E;  1WJ6 A;  3RNA C;  2J0M A;  3FC4 A;  3MFG A;  4IDI A;  5H8Y E;  4UDU C;  1N62 A;  2NTS A;  1WJ4 A;  2D10 A;  2M0A A;  2ACZ B;  1NVI D;  5LLI A;  4ACF A;  1C1Y B;  1PGA A;  2M8S A;  2KC1 A;  3V05 A;  2GOW A;  3A1Q B;  2WDR B;  4CYE A;  2MCN B;  4FN2 A;  4HLE A;  2IYD B;  2PJH A;  3A9K B;  2MJD A;  2WXQ A;  4BAX A;  1R4N B;  1UBI A;  4MH0 E;  4DXF A;  2LGI A;  4XDD A;  2JX5 A;  3E9S A;  1SIF A;  2C9W B;  5EE1 A;  2FBW B;  2KFK A;  2BBC A;  3N20 C;  4US8 A;  1V5O A;  4M02 A;  3H6N A;  3AE5 B;  1FXT B;  4A55 A;  4WWN A;  4A90 A;  1WXV A;  1XXG A;  3Q8E A;  5HFY A;  2KMM A;  1JCK B;  2WS3 B;  4JGH B;  3PRP B;  2KFJ A;  3N9Y C;  3B2G A;  1YMH E;  3APC A;  2KNB A;  3VQI A;  3U30 A;  4B0M A;  3ZDM C;  4N58 A;  2GBR A;  3RN9 C;  1L6V A;  2YEP F;  4O1N A;  3ZGZ A;  3NZS A;  2J0K A;  1JRP A;  2RDG A;  3AE6 B;  1QOG A;  4L2Y A;  2K5P A;  3DHI C;  4KGS A;  1KF6 B;  4F1S A;  3LB8 C;  1TT5 B;  2BS3 B;  1NI2 A;  1E7P B;  3VUY A;  2AL3 A;  1KJT A;  2LXA A;  2WXK A;  2ZVO A;  1L0X B;  3GB1 A;  3HM3 A;  3IT4 B;  2PEA A;  3ZIM A;  1RFA A;  2XNA C;  4GXB A;  3BK1 A;  3M95 A;  3AMZ A;  4P1B C;  1YN5 A;  2FIF A;  5TSS A;  1Q10 A;  1JRO A;  1V1P B;  3APD A;  1Q0W B;  2FUH B;  4GDL A;  2NR2 A;  2HE7 A;  4JLC A;  3NS1 A;  3PZ8 A;  2QIE B;  2KLG A;  3AEG B;  2G9H D;  4DBG A;  1WM2 A;  2WU2 B;  1OFF A;  4X57 B;  3LDZ E;  1HTO A;  5AUI A;  3WAP A;  4BOZ B;  2PPH A;  2WXG A;  3BII D;  1DOX A;  3Q69 A;  2J53 A;  3DHH C;  2I1J A;  2WDV B;  3BZD B;  3CMM B;  4AQ7 A;  1L4Z B;  2KKC A;  1FEH A;  2KWU B;  1YQ4 B;  2QHO A;  3Q8F A;  5HKH A;  3RZW C;  1ET6 A;  2UWQ A;  1WGD A;  2NBV B;  3NVZ A;  2I2Y A;  2LHD A;  4I6N B;  3ZRC A;  3L54 A;  1SE3 A;  2Q5W D;  1NEN B;  4B0E A;  2LRW A;  4ANU A;  2DWQ A;  3MC0 B;  2LZ6 A;  4PYZ A;  3ZNG C;  1C4P A;  4ITK A;  1VCB A;  1M94 A;  1IGC A;  3H1U A;  3QIJ A;  3N1Z C;  1RFK A;  1T0Y A;  4OW0 A;  3KWL A;  2KN4 A;  2KOX A;  4W9E A;  2V3S A;  1E90 A;  3RCZ A;  1RLF A;  4DDG D;  1FD6 A;  2BT6 A;  1ZE3 D;  3A33 B;  2KQS A;  3ZXR A;  3HHM A;  3DBH I;  3ZUN A;  2PMV A;  2W9N A;  1VJK A;  1QIL A;  2DEN B;  3ZTD A;  3VXW A;  3ML9 A;  3TEZ A;  4ZOH C;  4MH8 A;  1I4Q A;  1JAL A;  5D2M B;  1P0R A;  1FM0 D;  3MC8 A;  4IWO A;  2R2Q A;  2K25 A;  2MEK A;  2WHI A;  2OOB B;  2UYZ B;  4C4V B;  4EFO A;  3NVY A;  2W3S A;  4Q2J A;  1JML A;  2V4I B;  2KX0 A;  4MEL A;  4R3D A;  3I57 A;  2WX0 A;  3IAS 1;  2FNJ B;  4B6W A;  1N61 A;  5CTR C;  2NTT A;  2KJH B;  3Q3O C;  5BO4 B;  1YD8 U;  3QCA A;  3NZU A;  4TQ0 A;  1WFY A;  1PUT A;  2DYM A;  1SF0 A;  4GDL B;  2V9H A;  2DZK A;  3TBL D;  3OG5 A;  3N1X C;  1WGY A;  2XK5 B;  4NZL B;  3AE2 B;  3NZ3 A;  4W9C A;  1T0S C;  4NPN A;  2LUM A;  3RUI B;  3FAH A;  4LDT D;  1GPX A;  2RDB C;  4C80 A;  3PHW B;  1WJU A;  3QHT A;  2N0S B;  2K22 A;  3OJ4 B;  3ZDT A;  3IHP C;  3Q3J A;  4GU2 A;  2BWE S;  2RPV A;  1V86 A;  2VH1 A;  3HVZ A;  2SAK A;  4FA6 A;  4TKN A;  3CSF A;  1V1O A;  4WJO A;  1ROE A;  2NS5 A;  1D3Z A;  5BMG A;  2DLB A;  2LJI A;  1TTN A;  1ZW7 A;  1WRD B;  3DBS A;  1E8Y A;  4HKZ E;  4N59 A;  4P7I A;  2REX A;  2VRR B;  1YNT E;  4I6P A;  4W9K A;  2D07 B;  3AU5 A;  2TSS A;  1SIJ A;  4H2A A;  3DBH B;  1CMX B;  4YSZ B;  4CQN A;  2ASQ A;  2MBB B;  1XT9 B;  1GB4 A;  3DDC B;  1Z2M A;  1YIW A;  3N1Y C;  2M4N A;  1ENF A;  3KUC B;  2CU3 A;  2I1K A;  3Q6B A;  2X38 A;  4NAW B;  5CHV C;  3HUI A;  5C3J B;  3URY A;  1I35 A;  1V1P A;  3AEF B;  2HTM E;  3DBR B;  2PLP A;  5EE9 A;  2INN E;  2L7R A;  3T3N A;  2WXM A;  2D2Q A;  2L3Z A;  2BYV E;  4IM0 A;  2Y5C A;  3PZD A;  2J4X A;  3B9J A;  4LNO A;  5C1Z A;  1PYW D;  3Q8B A;  4J3O D;  3KLS X;  2KMA A;  3NVV A;  4TSS A;  2JYE A;  4HPM B;  2V1Y A;  3TIX A;  3KUD B;  4I6L B;  5IN7 A;  4G50 A;  2KWD A;  4OZB A;  3UF8 A;  2LXC A;  1MHX A;  5HG2 A;  3FIL A;  3N3K B;  3MJW A;  3ZXV A;  1GAQ B;  2K8H A;  2FCM A;  1HQR D;  4WUR A;  1XQQ A;  1CQV A;  2CHX A;  3L17 A;  3AEB B;  2MJ3 A;  2ZCC A;  2GBJ A;  1N5X A;  1QOF A;  4RFB A;  3UIP B;  1MI0 A;  1IPG A;  2KDI A;  2CJO A;  2BS2 B;  5AUK A;  3V6C B;  3FKY A;  2FCN A;  2JRH A;  2OJW A;  3U8Z A;  4PT5 A;  1FNU A;  3C0R B;  2KQ4 X;  5JXV A;  1DOY A;  3L10 B;  3QQ8 B;  4AJY B;  5J2R A;  1TGZ B;  2D3C A;  4DHZ E;  4JPS A;  4IWP A;  1FFV A;  3I3T B;  5C23 A;  5AEK B;  4FJY A;  1J7C A;  2QDF A;  3GE8 C;  4LTU A;  3KW5 B;  2VZK B;  3AV8 A;  3DVG X;  4WWO A;  3NHE B;  5LXH A;  3QJZ A;  4ARI A;  2BQQ A;  4WAF A;  3K9O B;  3VR8 B;  3KH0 A;  3RD2 A;  3MJ5 A;  3AEE B;  3RUL A;  3BIN A;  1ZDV A;  2RMM A;  3PLU A;  1WR1 A;  1F9J A;  2VZK D;  1YN3 A;  3P4P B;  1FFU A;  4IC7 B;  1C77 A;  2LD9 A;  2BF8 B;  4FJV B;  2DZM A;  2LVP A;  2HJ1 A;  3IVF A;  2MJE A;  1B1Z A;  4JQW C;  1QT9 A;  2INP E;  4XWT A;  4ANV A;  2D3B A;  4E74 A;  4BBN C;  2JY6 A;  4OZC A;  3R7R A;  1WWT A;  2KJR A;  4K7S A;  3W2D A;  2FCQ A;  1WY8 A;  4B95 A;  1GNU A;  3UGB B;  2WXI A;  1ZPS A;  2WWZ A;  4ZRI A;  3NVW A;  3X0W A;  2IGH A;  1WSP A;  3QA8 A;  4NJ7 A;  2KXJ A;  1B9R A;  2C7N B;  1F2R C;  1EWY C;  2HTH A;  1WXS A;  2DBY A;  2Z0D B;  4ZHP A;  3VH4 B;  2JUO A;  3QWZ B;  3AED B;  5JZE B;  1Y8R C;  4PK1 A;  2IGG A;  4HJG E;  2FAZ A;  1EWC A;  3AE7 B;  4C7Z A;  5G5H A;  4NNJ B;  2BB6 A;  1TS3 A;  2AWT A;  3EC8 A;  4NAW A;  4AUQ C;  1E9M A;  3PLV A;  1OTR B;  2V3P A;  4C00 A;  3ZVV A;  1RM6 C;  2WXR A;  3ZJV A;  1N5W A;  1SE2 A;  4HRO A;  3TEW A;  1N60 A;  1QOB A;  1YQ3 B;  3DCG A;  1ZDX A;  1TS5 A;  2MW5 A;  3VUX A;  1L6U A;  2K6D B;  1RWS A;  2LGX A;  1MFW A;  4LNK A;  3NOB A;  1FRD A;  4RF0 A;  1LFD A;  1R4N I;  2KMC A;  3Q3F A;  5GMV A;  5KHQ A;  4DK5 A;  4WJQ A;  3CWI A;  4EZJ A;  1TYG B;  1YX6 B;  1EM7 A;  3EFU A;  2WYQ A;  2IDY A;  3RNF C;  5G55 A;  1EO6 A;  4W9H A;  1F2R I;  2G4D B;  4XE0 A;  4M0W A;  1PFD A;  5J17 A;  1L0V B;  3V60 A;  2JZP A;  1KTK A;  1WM3 A;  1WXM A;  1FCC C;  1LQB A;  4KGR A;  3PO0 A;  2KDE B;  4YTP B;  3WAN A;  2BKF A;  4W9I A;  1IYF A;  1K51 A;  2MP2 A;  1E6E B;  4ZRJ A;  4RMA A;  1YQB A;  4GLS C;  2QC8 A;  3DBL B;  5FR6 A;  2Y5B B;  5L95 C;  1V97 A;  4JL9 A;  1FMA D;  3EEC A;  2NPT B;  1TS4 A;  3V6E B;  4LLG M;  4GGQ A;  1FO4 A;  2A5U A;  2LAS A;  4RGO S;  3L08 A;  3Q14 C;  3P4Q B;  3MC9 A;  4K81 A;  3K9P B;  3V62 A;  1UH6 A;  1VRA B;  1GOZ A;  1WYW B;  1GB1 A;  3NRZ A;  1P3Q U;  2KAN A;  2N9E B;  1ESF A;  3A1Q A;  1E0Z A;  3WA0 A;  1J7B A;  1WZ3 A;  4S17 A;  4N6E B;  3SHQ A;  1RRB A;  2DZI A;  4A3O A;  5DPW A;  2DX5 B;  4HEA 1;  3QAR A;  1R7S A;  1WMH B;  3B0A A;  1J7A A;  1NDD A;  1KOT A;  1TZO A;  1WE6 A;  4OVV A;  4TUU A;  3PVL A;  4WAA A;  2BYE A;  4LCD E;  5BYS A;  1SSN A;  1VD2 A;  1MPE A;  5LXI B;  2KHW B;  3RT3 B;  2L76 A;  3AN1 A;  4HVB A;  3UIN B;  2PVO D;  4XDC A;  1K53 A;  2K8C A;  2MSE D;  1UBQ A;  3MP9 A;  3P1M A;  2LUE A;  3IAM 1;  3AI5 A;  4FXC A;  2CS4 A;  1Q5W B;  1BML C;  4FHJ A;  2QSD A;  2KFK B;  5DPR A;  2NVU I;  3UQA A;  3NUH B;  2W54 A;  4TMA B;  2MBO A;  1V49 A;  1WGH A;  1FXI A;  1C9F A;  4TQ1 A;  3AE3 B;  5IOI A;  1D4B A;  5IA7 A;  1IBX A;  1OQY A;  3SEB A;  4HXD A;  1NBF C;  1SXT A;  3ZNI D;  2RSU A;  3ML8 A;  4JWU C;  3ZLZ A;  1I4H A;  4RGN A;  4IW0 A;  3PRM B;  3GZN B;  3HM6 X;  1SE9 A;  3DWG C;  3B08 A;  3PZ7 A;  4L23 A;  4MJS A;  3W1S C;  1E8W A;  4WJP A;  2WXO A;  4L1B A;  2A4Z A;  2JSV X;  4E3C A;  3VAW A;  3HVD A;  1FNV A;  2K6Q A;  3SFE B;  3QAQ A;  4MM3 A;  4C7Y A;  2WXN A;  2KZR A;  1V81 A;  1XD3 B;  3APF A;  4DWF A;  2FID A;  5H92 C;  3ZTC A;  2ICI A;  4LNI A;  4F8C B;  3GE3 C;  3Q3N C;  5DPT A;  2LMC A;  2WXP A;  1C4C A;  2N1V A;  1E8X A;  4EOY A;  4YL8 A;  5BMH A;  3C19 A;  4JIO U;  3ONS A;  4M8N A;  1R4M B;  1YJJ A;  2PVG C;  1WXA A;  3E56 A;  3VUW A;  1EF5 A;  2N9X A;  4WQO B;  4IG7 B;  1JW9 D;  4JWS C;  1AWD A;  3BY4 B;  3HIZ A;  2KD0 A;  4US9 A;  1EU4 A;  2V0G A;  3RZF A;  3TCA A;  4W9D A;  2KT7 A;  3TEY A;  2IBI B;  4GSW A;  4RNA A;  1NYR A;  4USA A;  1JWU D;  4LJP B;  3I5J C;  1XCT L;  1I4P A;  3EHV A;  3WIM A;  2PW9 A;  4P6V F;  2HJ8 A;  3DVG Y;  3SFD B;  2L0T A;  4FUL A;  2NPT A;  2FCS A;  2WU5 B;  3U2S C;  1WYG A;  4A6Q A;  3C8Y A;  3RI7 C;  2YLM A;  4LNF A;  2PE9 A;  2N9P C;  1PDX A;  2L05 A;  2QIL A;  2EKI A;  3L4P A;  1E10 A;  1KH0 A;  2WXL A;  5G2N A;  1J19 A;  5L83 A;  3P42 A;  4ZRK A;  1YJ1 A;  5CHF A;  1D6E C;  3M63 B;  1UNS A;  2H89 B;  2BYF A;  3MHZ A;  4HWI B;  2BYT A;  3T3O A;  3OLM D;  4MGI E;  2KLC A;  1T0R C;  2B3A A;  2KTF A;  2MH7 A;  1WMH A;  1SBB B;  4HCN B;  3ZNH B;  4GMV A;  4RCO A;  5JHA A;  2MBQ A;  2NMQ A;  4YWG G;  5BYR A;  2JF5 A;  2LEK A;  4LDT B;  5E6J A;  1C79 A;  3CIR B;  1KM7 A;  3RPF C;  3VDZ A;  5IP4 D;  3ENE A;  3JSV A;  4REZ A;  2AEH A;  3WAO A;  4KVG B;  3TEX A;  4ZRP A;  3W1Y A;  3P4S B;  1L5P A;  2LGS A;  3TL5 A;  4IUM B;  3EA6 A;  1E7U A;  1XEE A;  2O2V A;  5D6J B;  2KDM A;  1WZ0 A;  1TKE A;  2QCZ A;  4YTN B;  3DOW A;  2Z0E B;  3AEA B;  3H9D A;  2PKO A;  4OVZ A;  5LNK 1;  1QLB B;  3AU4 A;  3A9J B;  4MGY E;  1STE A;  5I4D A;  2MA9 B;  2MP2 B;  2LJ5 A;  4MSQ B;  2OED A;  3ZRF A;  4BKS A;  4LNN A;  1MG4 A;  1RYJ A;  1T3Q A;  4FAD A;  4XWW A;  4WIP A;  4KSL C;  1P98 A;  3HRD D;  3BWU D;  4AOF A;  2WXH A;  2BVC A;  1V8C A;  2GMI C;  1K8R B;  3ZQ4 A;  3R66 C;  2G45 B;  2JRI B;  2RD0 A;  3FIL B;  4YT0 B;  1H8C A;  4MJS B;  5DCN A;  3HK0 A;  3VTV A;  1GC7 A;  2IO3 B;  1HZ6 A;  3DVN U;  1LXD A;  4GDK A;  3VRB B;  4NQK E;  4BKS D;  1GG3 A;  3R8B A;  2LFI A;  2NBU A;  3U7D A;  1L2N A;  1ET9 A;  3T9L A;  1FPY A;  3RYT A;  1S1Q B;  2RGF A;  2DAF A;  3B1L X;  4KSK C;  4YSY B;  5HHD G;  2WXF A;  3BK2 A;  1GJZ A;  1P7E A;  3BVM A;  4RGT A;  3H7P B;  1I4X A;  4P16 A;  4K3C A;  4KZC A;  3TUO A;  2K1F A;  2XK5 A;  1TY2 A;  4GIV A;  3IXS A;  1IGD A;  1NYQ A;  2IJ0 A;  3SD5 A;  2ZZP B;  2K39 A;  2Y5P A;  4II2 B;  3RNE C;  2DHZ A;  3RMK C;  1JQ4 A;  2C5L C;  2JVC A;  4DDI D;  3P4R B;  1JRU A;  2UU7 A;  5D3D A;  1VZ8 A;  2X8X X;  4RM9 A;  3VRA B;  2LWP A;  1XLO A;  3TSS A;  1U4A A;  5AZF A;  3PHX B;  4RM8 A;  2ONQ A;  4EKU A;  1L0Y B;  3GP7 A;  4MSM B;  4II3 B;  2KTR B;  2ZEQ A;  3NS8 A;  2DNF A;  2V3N A;  5FR3 A;  2PE6 B;  1H4R A;  1WR6 E;  1XCQ L;  1V6E A;  2IO1 B;  3NJT A;  3ZKJ C;  2KQ7 A;  1XLN A;  4MGK E;  1UWM A;  5D94 A;  2M17 A;  3AE4 B;  3U4E G;  4XYC A;  5JH5 C;  2KVR A;  4ICU A;  4ZHO A;  2E3T A;  3KVF B;  4HPL B;  1MG8 A;  2VH2 A;  3AM9 A;  1Y56 A;  3WAM A;  1XO3 A;  4BFR A;  3PPA A;  4IKG A;  3DVN V;  4GDK B;  1MVK A;  4MAC A;  1PGB A;  1ZXH A;  2K8B A;  2LVO A;  2O2V B;  3ZNZ B;  2J7Q B;  2R61 A;  1WGR A;  1HA5 A;  3M3J A;  4MDK E;  1F77 A;  4A20 A;  1C4A A;  5G5G A;  1IP9 A;  1UWX A;  2MBH A;  2J0J A;  2D3G A;  3QC8 B;  4DXA B;  2KWC A;  2BGF A;  2RDH A;  3GS2 A;  1WGK A;  1P1A A;  4B9K A;  1N6Z A;  3P63 A;  3I63 C;  2GBK A;  2KYW A;  2JXT A;  2N7D A;  4W9F A;  3U52 E;  4M00 A;  2YEP B;  4JX1 C;  3W5U B;  1C78 A;  3LJ3 A;  4BKT A;  3VHT C;  1FNW A;  4KX6 B;  2JZZ A;  3DWM A;  1UF0 A;  3KYD D;  4K1R B;  2K0P A;  4KIK A;  2PIA A;  1WE7 A;  3UQB A;  3LXF A;  4BZA A;  3IG3 A;  1FXA A;  3PGE A;  1VR9 A;  4JE3 B;  1DOI A;  1T5X D;  1UD7 A;  1HEZ E;  3PS6 A;  3KWV A;  3A4R A;  3MTN B;  4EE2 A;  4S0R A;  4BBN F;  2EMT A;  2ZPY A;  4HK2 A;  2L1A A;  1WF9 A;  1OQR A;  1TIF A;  3O13 A;  2JWU A;  4XZ4 A;  2BKR B;  2M56 B;  2IPK D;  1SJE D;  1CK1 A;  1PGX A;  4KKI A;  1CZP A;  4AS1 A;  2QJL A;  4FJZ A;  1D5X C;  4G0N B;  4DHJ B;  2XEW A;  4WWM A;  4LK0 M;  4BVU C;  3H7P A;  1KLG D;  2GBM A;  1TKY A;  4AJW A;  4PS8 A;  3JW0 X;  2IND C;  1UUP A;  2XN9 C;  2Z8L A;  1KFY B;  1UGM A;  1KLU D;  2XBB C;  2CJN A;  3OAW A;  2KN5 A;  4P1C C;  3DPD A;  1WH3 A;  2NBW B;  3PT2 B;  1K52 A;  1OEY J;  3V3X A;  3NG0 A;  1TKG A;  2EEL A;  2GI9 A;  4ZRQ A;  4FHK A;  2IZV B;  3SU8 X;  2C60 A;  1I42 A;  1K50 A;  1SGH A;  3OJ3 A;  4AWJ A;  1OGW A;  2EMS A;  3IFW B;  4M0W B;  3Q3M C;  2R2O A;  4OVU A;  1I7H A;  2SEB D;  2OHF A;  4A3P A;  4A9A A;  2KTR A;  4WH4 A;  1SB3 C;  4KDL B;  1P9D U;  1SE4 A;  1EU3 A;  3Q2A C;  4N9F 4;  2O6V D;  2B76 B;  2MQJ A;  1IBX B;  1ZUD 2;  2N4F A;  3AE8 B;  4EEW A;  4HPP A;  1CJE A;  1F52 A;  1V2Y A;  2IY1 B;  3VVW B;  3BVG A;  3ECI A;  2DZJ A;  4ZDV A;  3RFZ B;  1VZ7 A;  2CKH B;  2KO3 A;  3RNG C;  4YTM B;  3RNC C;  1RAX A;  2KX3 A;  2O6V B;  1WJN A;  4QAY A;  2H88 B;  4W9J A;  1EF1 A;  1VZ6 A;  1V9J A;  4NY0 A;  2JQR B;  3GOE A;  1E7V A;  2LGY A;  4PS7 A;  5E6P A;  4FBJ B;  2PTL A;  4HKQ A;  1JWS D;  1E8Z A;  5T8I A;  2GRI A;  4HJK A;  2KAC A;  2ON8 A;  4NJ6 A;  2WLB A;  2LRU A;  2M1M A;  1A5R A;  4KV2 A;  2MWS B;  4BKG A;  3AH7 A;  2QEJ C;  1NEK B;  1WIA A;  3ABV B;  2L0F A;  1UEL A;  2ZNV C;  4PYU A;  4WWP A;  3WCQ A;  2BS4 B;  1TZ1 A;  1G6J A;  4OHJ A;  3L13 A;  1WX9 A;  3MHS D;  3CF6 E;  1M4V A;  2D3A A;  3H8H A;  4DXG A;  2L32 A;  3WAL A;  2E6X A;  2IY0 B;  4KKJ A;  1UGJ A;  3RNB C;  1D5M C;  2Z59 B;  3DBR I;  4DHZ B;  2I38 A;  5E6N A;  5D7G A;  4ZYN A;  1S3S G;  2LHE A;  1XLP A;  1SJH D;  4WQM A;  4K3B A;  5FKA C;  3VFK A;  4C4V A;  3SDL C;  1X1M A;  2NCN A;  4ANW A;  4MM3 B;  1WGG A;  3OWE B;  4EUT A;  3O65 B;  1GUA B;  2ZW0 A;  1JWM D;  3JVZ X;  3S2A A;  2LGD A;  1VLB A;  4MEM A;  3ZO5 B;  2C7M B;  1MHH E;  4GN1 A;  3BYY B;  3U7Z A;  3X23 A;  3TJP A;  2M19 A;  3PRZ A;  3UI3 A;  1C3T A;  3P2B A;  5CX3 A;  4URK A;  1NI3 A;  4AP4 C;  4RGM A;  1ZXI A;  3I9V 1;  2BWF A;  1F0Z A;  2L00 B;  1QZE A;  1ZOY B;  5IO9 A;  2QMT A;  2ZPN A;  3AE9 B;  5BYQ A;  1AAR A;  1FIQ A;  3EGR A;  5IKC M;  3KQ4 A;  4M8M A;  2INC C;  3EFC A;  2O6V A;  1ZKH A;  4KDI C;  3NY5 A;  1PQS A;  5TR5 A;  2AQ1 B;  4HCP B;  2AL6 A;  4NAM A;  3VR9 B;  4J6I A;  1D5Z C;  1HXY D;  1ZGU B;  2MLB A;  3PTF C;  5IAA C;  1KLV A;  4HRS A;  2C7H A;  4WJN A;  2WQY B;  1IUE A;  1BT0 A;  1JWA D;  2V4L A;  4XGA B;  5EE3 A;  2N7J A;  4DQO C;  3B2F A;  4YXD B;  1LGR A;  4NQL B;  1F1H A;  2L83 A;  3QX1 A;  3KYC D;  1T6B X;  3JYU A;  2AQ2 B;  2KVZ A;  4YSX B;  3Q8C A;  1AN8 A;  2JWZ A;  4RF1 A;  2CHZ A;  5GXG B;  4OZA A;  1WX8 A;  2N7E A;  3R2I A;  1QOA A;  2ZCB A;  2DAJ A;  1GC6 A; 
#chains in the Genus database with same CATH homology
 3A33 B;  2KQS A;  2NPT B;  3EEC A;  5JH5 C;  3HHM A;  2KVR A;  3DBH I;  3V6E B;  3ZUN A;  4ICU A;  2N1W A;  2W9N A;  4GGQ A;  1V5T A;  1ISN A;  2A5U A;  3KVF B;  2DEN B;  2LAS A;  3ZTD A;  3L16 A;  3L08 A;  2WX1 A;  3VXW A;  3ML9 A;  4HPL B;  4K7U A;  1MG8 A;  4K81 A;  3K9P B;  5D2M B;  3V62 A;  1P0R A;  1UH6 A;  4IWO A;  2CHW A;  2R2Q A;  2K25 A;  3WAM A;  1WYW B;  4BFR A;  2OOB B;  3PPA A;  2UYZ B;  1P3Q U;  2KAN A;  2N9E B;  4EFO A;  3A1Q A;  4G11 A;  2MRP A;  3DVN V;  4GDK B;  3WA0 A;  1WZ3 A;  4TV3 A;  3SHQ A;  2K8B A;  2LVO A;  2KX0 A;  1RRB A;  4MEL A;  4IM3 A;  1OEY A;  2DZI A;  2O2V B;  2J7Q B;  3ZNZ B;  4A3O A;  5DPW A;  3R3M A;  2MX2 A;  1WGR A;  2DX5 B;  4XX5 A;  3VTW A;  2WX0 A;  3M3J A;  1J0G A;  3QAR A;  4GOC A;  4MDK E;  5E6O A;  2FNJ B;  1WMH B;  2DYB A;  3B0A A;  4B6W A;  4EZL A;  5CTR C;  4A20 A;  1NDD A;  2KJH B;  1KOT A;  1WE6 A;  4OVV A;  1IP9 A;  4LJO B;  4TUU A;  2MBH A;  5BO4 B;  3PVL A;  4WAA A;  1YD8 U;  2WDT B;  2BYE A;  2DYO A;  2J0J A;  3NZU A;  3QCA A;  1WFY A;  4LCD E;  3VH3 B;  2D3G A;  4TQ0 A;  2KK8 A;  3QC8 B;  4DXA B;  2DYM A;  2KWC A;  2BGF A;  1VD2 A;  4GDL B;  5LXI B;  2KHW B;  2DZK A;  1Z5S B;  1P1A A;  4B9K A;  3RT3 B;  2L76 A;  4HVB A;  3UIN B;  2D11 A;  3TBL D;  3R7Q A;  1L7Y A;  2K8C A;  4HDQ A;  1WGY A;  2XK5 B;  2GBK A;  3A9K A;  2MSE D;  2N7D A;  4W9F A;  1UBQ A;  5CHW A;  4W9L A;  2LUE A;  2MBE A;  4W9C A;  2M0X A;  3LJ3 A;  4BKT A;  3VHT C;  3AI5 A;  1V80 A;  2CS4 A;  1Q5W B;  2BPS A;  4NPN A;  4FHJ A;  2GBN A;  2KFK B;  5DPR A;  2NVU I;  3UQA A;  2KJ6 A;  3M62 B;  3RUI B;  2ZNV B;  2LI5 A;  2JZZ A;  3KYD D;  4IWQ A;  4K1R B;  4LDT D;  3A9J A;  4KIK A;  4XC2 A;  1J8C A;  4BOS C;  2MBO A;  3PHW B;  4FLH A;  1WJU A;  1WE7 A;  3QHT A;  5EDS A;  1V49 A;  1WGH A;  3UQB A;  3IG3 A;  4TQ1 A;  1E5W A;  3PGE A;  3OJ4 B;  3IBE A;  4ASW C;  5IA7 A;  3ZDT A;  1OQY A;  3IHP C;  3Q3J A;  4GU2 A;  2BWE S;  4HXD A;  1NBF C;  1V86 A;  2KWV B;  3ZW3 A;  4FA6 A;  3ZNI D;  2RSU A;  3ML8 A;  4TKN A;  5JHB A;  3ZLZ A;  2CU1 A;  4IW0 A;  3CSF A;  4CHK A;  3T8M A;  3PRM B;  1R4M I;  1UD7 A;  4WJO A;  2NS5 A;  3HM6 X;  2RPQ A;  1D3Z A;  1SE9 A;  1TTN A;  3B08 A;  2EKE C;  3W1S A;  1ZW7 A;  1WRD B;  3DBS A;  2OJR A;  1E8Y A;  2LVQ A;  3AUL A;  3H7S A;  3PS6 A;  3A4R A;  3MTN B;  3N32 A;  4P7I A;  4MJS A;  3W1S C;  1E8W A;  2KC2 A;  2REX A;  1TBE A;  2VRR B;  4WJP A;  4BBN F;  4I6P A;  3JSV B;  2A4Z A;  2EMT A;  2ZPY A;  4HK2 A;  4W9K A;  4E3C A;  3D32 A;  2D07 B;  3AU5 A;  3VAW A;  1WF9 A;  2K6Q A;  3DQV A;  3QAQ A;  1CMX B;  1Q1O A;  4MM3 A;  2ASQ A;  2MBB B;  2KZR A;  1XT9 B;  2G4S A;  1V81 A;  3DDC B;  1XD3 B;  1Z2M A;  4XZ4 A;  2BKR B;  3APF A;  4E71 A;  3KUZ A;  4DWF A;  1YIW A;  2FID A;  2CR5 A;  3ZTC A;  2M4N A;  3QK0 A;  4PS3 A;  4KZ0 A;  3KUC B;  2I1K A;  2JZ3 B;  2YVC A;  4F8C B;  4EZK A;  4NAW B;  5CHV C;  5DPT A;  3N30 A;  4FJZ A;  1I35 A;  3UIO B;  2N1V A;  1EUV B;  1E8X A;  4G0N B;  4EOY A;  2G3Q B;  4YL8 A;  4DHJ B;  2XEW A;  3DBL I;  4BVU C;  3H7P A;  2L7R A;  4K7W A;  4JIO U;  3ONS A;  2GBM A;  4M8N A;  3GZN I;  2D2Q A;  4AJW A;  4PS8 A;  2ZVN A;  1WXA A;  2RR9 A;  2L3Z A;  2BYV E;  2AYO B;  3JW0 X;  3PSE B;  3PZD A;  4IM0 A;  5C1Z A;  3VUW A;  1EF5 A;  2N9X A;  4WQO B;  4CO7 A;  4IG7 B;  2KDF B;  2KMA A;  2HD5 B;  3BY4 B;  4HPM B;  2V1Y A;  3TIX A;  1UGM A;  3KUD B;  4I6L B;  3HIZ A;  2KD0 A;  4G50 A;  2IO2 B;  2XBB C;  1WI0 A;  3V61 A;  3UF8 A;  1WX7 A;  3OAW A;  2LXC A;  5AZG A;  3RZF A;  2IO0 B;  3TCA A;  4W9D A;  2KN5 A;  3N3K B;  3DPD A;  1WH3 A;  2IBI B;  2NBW B;  3PT2 B;  4GSW A;  1OEY J;  3MJW A;  3CST A;  2K8H A;  2FCM A;  4FHK A;  2IZV B;  4LJP B;  5AZH A;  4ICV A;  1XQQ A;  5J18 A;  3EHV A;  3SU8 X;  2C60 A;  4IM2 A;  1HE8 A;  3WIM A;  1I42 A;  2L8J A;  1SGH A;  3OJ3 A;  4AWJ A;  2HJ8 A;  2KDB A;  3DVG Y;  1OGW A;  2CHX A;  4G3X B;  2EMS A;  2L0T A;  3A4S C;  3IFW B;  3L17 A;  4FUL A;  4GB9 A;  2NPT A;  4M0W B;  4W9G A;  2FCS A;  3TMP B;  4ANX A;  2ZCC A;  2R2O A;  2GBJ A;  4OVU A;  3VTU A;  2YLM A;  3ALB A;  5DPS A;  2PE9 A;  3UIP B;  1UZX B;  2N9P C;  1YX5 B;  4A3P A;  2KTR A;  1IPG A;  2KDI A;  4KIK B;  2L05 A;  3V6C B;  2FCN A;  4KDL B;  1P9D U;  2ZJD A;  2JRH A;  4HDO A;  5G2N A;  1J19 A;  2JPH A;  4N9F 4;  5L83 A;  2O6V D;  3U8Z A;  4ZRK A;  3AXC A;  1YJ1 A;  2MQJ A;  5KHO A;  5CHF A;  2N4F A;  3M63 B;  2JXX A;  1LM8 B;  4EEW A;  2JT4 B;  3C0R B;  3PRE A;  2BYF A;  4DHJ D;  1V2Y A;  2IY1 B;  3L0W B;  3PV1 A;  3ECI A;  4HWI B;  3VVW B;  2DZJ A;  4F7Z A;  3OLM D;  4MGZ E;  4ZDV A;  4MGI E;  3L10 B;  3QQ8 B;  4AJY B;  2CKH B;  1WJ6 A;  2KLC A;  2B3A A;  2KO3 A;  2KTF A;  5J2R A;  1TGZ B;  1WMH A;  2J0M A;  4HCN B;  1RAX A;  2KX3 A;  2O6V B;  3ZNH B;  4DHZ E;  4GMV A;  5JHA A;  4IWP A;  5AEK B;  2MBQ A;  3I3T B;  1WJN A;  5C23 A;  2JF5 A;  1WJ4 A;  2D10 A;  4FJY A;  5LLI A;  4LDT B;  4W9J A;  1C1Y B;  1KM7 A;  3VDZ A;  1EF1 A;  3KW5 B;  2M8S A;  2KC1 A;  3ENE A;  3JSV A;  2GOW A;  2AEH A;  1V9J A;  3A1Q B;  3DVG X;  4NY0 A;  3GOE A;  4KVG B;  4WWO A;  3WAO A;  4CYE A;  3NHE B;  3W1Y A;  1E7V A;  2LGY A;  4PS7 A;  5E6P A;  4FBJ B;  2MCN B;  5LXH A;  3QJZ A;  4FN2 A;  1E8Z A;  4HLE A;  2IYD B;  3K9O B;  4HJK A;  2PJH A;  3A9K B;  3TL5 A;  3KH0 A;  4IUM B;  4NJ6 A;  3RD2 A;  1UBI A;  1E7U A;  4MH0 E;  3RUL A;  2LRU A;  2O2V A;  5D6J B;  2M1M A;  3BIN A;  3PLU A;  1WZ0 A;  1SIF A;  2C9W B;  1A5R A;  1WR1 A;  4KV2 A;  2MWS B;  4BKG A;  3DOW A;  1F9J A;  2Z0E B;  2KFK A;  4IC7 B;  1V5O A;  3H9D A;  2LD9 A;  2BF8 B;  3H6N A;  4FJV B;  1WIA A;  1FXT B;  2DZM A;  2L0F A;  2LVP A;  1UEL A;  3A9J B;  3AU4 A;  2ZNV C;  3IVF A;  4MGY E;  4PYU A;  4JQW C;  4WWN A;  4WWP A;  2MA9 B;  1TZ1 A;  2MP2 B;  1WXV A;  2LJ5 A;  4MSQ B;  3L13 A;  1G6J A;  4ANV A;  3ZRF A;  1WX9 A;  3MHS D;  4BKS A;  4E74 A;  4BBN C;  3CF6 E;  4JGH B;  2JY6 A;  3PRP B;  2KFJ A;  3R7R A;  4FAD A;  3APC A;  2KJR A;  3WAL A;  2IY0 B;  2KNB A;  4KSL C;  1P98 A;  4K7S A;  2FCQ A;  3VQI A;  4AOF A;  3U30 A;  2Z59 B;  3DBR I;  3ZDM C;  1WY8 A;  4B95 A;  1GNU A;  2GBR A;  4DHZ B;  3UGB B;  2GMI C;  5E6N A;  5D7G A;  1K8R B;  3R66 C;  2WWZ A;  4ZRI A;  4ZYN A;  3X0W A;  1S3S G;  2G45 B;  2JRI B;  2RD0 A;  3NZS A;  2J0K A;  3QA8 A;  4NJ7 A;  1H8C A;  3VFK A;  4MJS B;  5DCN A;  3HK0 A;  3VTV A;  1GC7 A;  2IO3 B;  2KXJ A;  3SDL C;  2C7N B;  3DVN U;  1LXD A;  4GDK A;  2HTH A;  4F1S A;  4NQK E;  1X1M A;  4BKS D;  1GG3 A;  1NI2 A;  2NCN A;  1WXS A;  4ANW A;  2NBU A;  2Z0D B;  3VUY A;  1WGG A;  2AL3 A;  2JUO A;  3U7D A;  1KJT A;  2LXA A;  2ZVO A;  3VH4 B;  1L2N A;  3T9L A;  3RYT A;  3O65 B;  3QWZ B;  4EUT A;  3HM3 A;  5JZE B;  1GUA B;  1Y8R C;  3JVZ X;  1S1Q B;  2RGF A;  2PEA A;  3ZIM A;  2FAZ A;  2DAF A;  1RFA A;  3S2A A;  3B1L X;  2LGD A;  4MEM A;  4NNJ B;  4GXB A;  3ZO5 B;  2C7M B;  2AWT A;  3EC8 A;  3M95 A;  4NAW A;  4AUQ C;  4KSK C;  4GN1 A;  3X23 A;  3TJP A;  2FIF A;  3PLV A;  3PRZ A;  3APD A;  1OTR B;  1Q0W B;  1C3T A;  2FUH B;  4GDL A;  1GJZ A;  3P2B A;  2NR2 A;  2HE7 A;  5CX3 A;  4URK A;  4AP4 C;  3ZVV A;  4JLC A;  3H7P B;  2KLG A;  4KZC A;  4DBG A;  1WM2 A;  2BWF A;  2K1F A;  2XK5 A;  4X57 B;  3LDZ E;  2L00 B;  1QZE A;  3DCG A;  2MW5 A;  3VUX A;  4GIV A;  3WAP A;  4BOZ B;  2ZPN A;  2PPH A;  1AAR A;  2K6D B;  2I1J A;  3CMM B;  3SD5 A;  2KKC A;  2ZZP B;  2LGX A;  2K39 A;  2KWU B;  4M8M A;  2O6V A;  2QHO A;  3NOB A;  4II2 B;  5HKH A;  1ZKH A;  1LFD A;  4KDI C;  1R4N I;  3RZW C;  3NY5 A;  2DHZ A;  1PQS A;  2KMC A;  5TR5 A;  2UWQ A;  3Q3F A;  1WGD A;  2NBV B;  5GMV A;  2C5L C;  2JVC A;  4HCP B;  4DDI D;  5KHQ A;  4DK5 A;  4WJQ A;  2AL6 A;  4I6N B;  3ZRC A;  3L54 A;  4J6I A;  1JRU A;  4EZJ A;  1YX6 B;  3EFU A;  2WYQ A;  4RM9 A;  1ZGU B;  2LWP A;  2MLB A;  3PTF C;  1U4A A;  2LRW A;  5G55 A;  5IAA C;  1KLV A;  5AZF A;  1EO6 A;  4ANU A;  3PHX B;  4RM8 A;  2C7H A;  2LZ6 A;  4PYZ A;  2G4D B;  4W9H A;  4WJN A;  3ZNG C;  4EKU A;  1VCB A;  1M94 A;  5J17 A;  1BT0 A;  3H1U A;  2V4L A;  3V60 A;  3QIJ A;  1WM3 A;  4MSM B;  1WXM A;  1LQB A;  4II3 B;  2KTR B;  2ZEQ A;  3NS8 A;  1T0Y A;  2KDE B;  4NQL B;  3WAN A;  2PE6 B;  2BKF A;  4W9I A;  1H4R A;  3KYC D;  3QX1 A;  1WR6 E;  3JYU A;  1IYF A;  2MP2 A;  2KOX A;  1V6E A;  2JWZ A;  4W9E A;  2CHZ A;  4ZRJ A;  2IO1 B;  4RMA A;  1YQB A;  1WX8 A;  2N7E A;  3ZKJ C;  2V3S A;  1E90 A;  2KQ7 A;  5FR6 A;  4MGK E;  3RCZ A;  2ZCB A;  2DAJ A;  2Y5B B;  5D94 A;  1RLF A;  5L95 C;  2M17 A;  4DDG D;  1GC6 A;  4JL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...