2C60A

Crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
85
Chain Sequence
GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFO
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 20
structure length 85
sequence length 96
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c60A01
1WZ3A 4BKGA 2Y5BB 2Z0DB 1UZXB 4F8CB 3SDLC 2N9XA 2K25A 4RM9A 3TCAA 2FCMA 3VAWA 4BVUC 4TQ0A 3UIOB 1WX8A 3VUYA 5DPTA 1WE6A 1X1MA 5J2RA 2HJ8A 4KVGB 1KOTA 1LM8B 2C7HA 3CSTA 3U7DA 4GSWA 3VUWA 4DDID 4FA6A 2O6VA 2JXXA 3PHXB 3ALBA 2FNJB 5HKHA 2RSUA 3PPAA 1M94A 3OJ4B 3SD5A 2GBMA 1Y8RC 4EFOA 4JQWC 4NJ6A 2FCQA 1FXTB 3QA8A 3ZVVA 3ZRFA 2EMTA 4BBNC 3ONSA 1U4AA 4K7WA 3R7RA 2N7EA 2JWZA 3N30A 1ISNA 1S3SG 5L95C 4LJOB 1WJ6A 2DAFA 2BYFA 2IBIB 2KDEB 3TIXA 1WMHB 2O2VB 2BYEA 1VD2A 2KWUB 4MGYE 2MLBA 3VTUA 4B95A 4E71A 3RZFA 3GOEA 4ANUA 2PEAA 3NZUA 4IM3A 3M63B 5E6NA 3QARA 1I42A 4LJPB 1WM3A 2MQJA 2NVUI 3K9OB 1V5OA 2KMCA 2RPQA 2WYQA 3JSVA 4FJVB 3NZSA 5E6OA 3EHVA 2K8CA 3PSEB 3UQAA 1GC7A 2C7MB 3VTVA 3H7PA 4HK2A 1WRDB 3QK0A 2XEWA 2JUOA 2G45B 5JH5C 1H8CA 2DZJA 3JYUA 2AEHA 2HD5B 3BINA 1WI0A 5FR6A 5KHOA 1UBQA 1OEYJ 3L08A 3SU8X 4AJYB 2QHOA 1E8ZA 1WH3A 3PVLA 4JGHB 4MJSA 3V6CB 3Q3FA 1WGDA 1IP9A 2LXCA 1P0RA 1Q5WB 4KSKC 1XQQA 3TMPB 3WAOA 1TZ1A 4LDTB 2R2OA 2C5LC 3T9LA 3ZTCA 4DK5A 5IA7A 1K8RB 2IY1B 1S1QB 2ZJDA 3C0RB 1XD3B 2CHXA 4AOFA 3GZNI 2O6VB 2PE9A 1WR1A 2KXJA 3KH0A 4MM3A 1WJUA 2D11A 3P2BA 1WIAA 3QX1A 4FHJA 4GXBA 2DX5B 2G3QB 3AU4A 3JVZX 2LUEA 1AARA 2MBEA 2JF5A 3A33B 4TQ1A 1EO6A 1WX7A 3ZDTA 1UELA 1EF1A 4EZKA 1KM7A 2KVRA 3DBSA 4HCNB 4HPMB 1WR6E 3ENEA 2PPHA 1WXVA 2XK5B 1RAXA 1ZGUB 5D6JB 2L8JA 4BOSC 3PZDA 3CF6E 4GDLA 4M8MA 1WXSA 3TL5A 3WALA 3S2AA 3DBRI 2ZPNA 2FCSA 1UH6A 3PT2B 3VXWA 5TR5A 4AP4C 2KHWB 2NPTA 2GBJA 2LVPA 4GDKA 4I6LB 5KHQA 2BWES 1WE7A 3A1QA 2FUHB 4HXDA 1WXAA 4K81A 4ANWA 3JSVB 2KMAA 2WDTB 1TBEA 4W9LA 3QAQA 3B08A 1E8XA 3HIZA 3RUIB 4ANVA 2KFKB 3HK0A 4EUTA 4FHKA 2G4SA 3ZLZA 4MELA 2KX3A 3H7PB 3CSFA 3IFWB 5JHBA 2D07B 4HJKA 4ANXA 2CKHB 5C1ZA 4TV3A 2LXAA 2KZRA 5CTRC 3VTWA 3I3TB 4KIKA 2XBBC 3PTFC 1J8CA 2AWTA 5D2MB 5AZGA 4MJSB 1WXMA 4FJZA 3OAWA 1CMXB 4RMAA 4BKSA 4FADA 1LQBA 2KD0A 3L13A 4KV2A 4A20A 3QCAA 3QHTA 3O65B 3RCZA 2WX1A 2B3AA 1ZW7A 3KUZA 3H9DA 3ZUNA 1P3QU 3D32A 5DPRA 1EF5A 4HLEA 1YD8U 2PJHA 3A4RA 2CHZA 4WJQA 3APCA 2JPHA 4MSQB 3VDZA 3ZDMC 2L3ZA 2ZEQA 4HPLB 3U8ZA 1RFAA 4NAWA 1RLFA 4PYZA 1OTRB 4E3CA 2K6QA 3VHTC 4HDQA 3U30A 1UBIA 2Z0EB 3WAMA 2KWCA 4MGZE 4E74A 2YVCA 3DOWA 3UIPB 2DHZA 3IVFA 3PRZA 2M8SA 3ECIA 2NBWB 1JRUA 1Z2MA 2V3SA 2DZMA 3DBLI 2BKFA 2NBVB 2MBOA 4GOCA 2OOBB 1NI2A 2MBQA 2L7RA 2XK5A 3H7SA 1EUVB 4DHJD 1ZKHA 3HM6X 5JHAA 2IO2B 2GBKA 2L05A 2CHWA 3N32A 3WANA 3PS6A 4GDLB 3APFA 3ZTDA 1J19A 4HCPB 5DCNA 3NHEB 2I1JA 2KANA 4I6PA 2NPTB 1A5RA 4GDKB 4ZYNA 1PQSA 3PREA 3DQVA 3LJ3A 4P7IA 3VUXA 3A1QB 2NR2A 1IPGA 1C1YB 3B0AA 3H1UA 1TTNA 3ZKJC 1QZEA 2KFKA 2LVOA 4HVBA 3L54A 4F7ZA 2FCNA 2IO1B 1WJNA 2AL3A 2DENB 1KJTA 1RRBA 2LVQA 2MW5A 3NS8A 1R4MI 3M95A 4W9HA 2KQ7A 3DBHI 4GGQA 4B6WA 2KLGA 1NBFC 3PLVA 2I1KA 4AWJA 5LXIB 2MSED 1WF9A 4KIKB 2K1FA 2FIDA 3KW5B 2DZIA 2JY6A 4HWIB 5DPSA 4G3XB 3AULA 3MJWA 4NQLB 4DBGA 2KJRA 4DXAB 4W9CA 3JW0X 2LGYA 2GBNA 2BYVE 1KLVA 5CHVC 4BFRA 4HDOA 3WIMA 3EC8A 4WJPA 1GJZA 4JIOU 4TKNA 2HTHA 1IYFA 4EOYA 5DPWA 3ZRCA 4F1SA 1V80A 4MGKE 4W9GA 4W9JA 2ZPYA 2MBBB 3R3MA 4FULA 2ZCCA 4NAWB 2LGDA 2NCNA 4B9KA 3B1LX 3NOBA 3A4SC 1L7YA 3PRMB 2KC2A 3VQIA 2AL6A 4W9DA 3RZWC 2KX0A 2KTRA 3IG3A 4WWPA 1YQBA 1J0GA 2JZZA 1OGWA 4DHZE 3RD2A 4NQKE 4KDIC 5AZFA 3WA0A 2JZ3B 4G11A 4IWPA 2LRUA 3MHSD 3OJ3A 5EDSA 2N9PC 4XX5A 3R7QA 4ZDVA 4AUQC 5AZHA 1P98A 4XC2A 4K1RB 1P9DU 3K9PB 2EKEC 1YJ1A 2RR9A 3L16A 3PLUA 2GOWA 2MX2A 2A4ZA 2LJ5A 4KZCA 4W9KA 2G4DB 4ICUA 1GC6A 4KZ0A 1UD7A 4MH0E 2IZVB 3KUDB 4URKA 4WAAA 4WQOB 1WGHA 1E90A 1YX6B 2J0JA 3TBLD 4M0WB 1V86A 2V1YA 5GMVA 5G55A 3EECA 2KLCA 3A9KA 3AXCA 1V6EA 2N1VA 1Z5SB 3V60A 3W1SC 1LFDA 3W1SA 3L0WB 1WZ0A 2KTFA 4NNJB 4DHJB 2K6DB 2FAZA 2WX0A 3L10B 4K7UA 1C3TA 4WJNA 4IUMB 4FLHA 3LDZE 3X0WA 1E7VA 4IWOA 3N3KB 4N9F4 1H4RA 4A3PA 4ASWC 2EMSA 4NPNA 1R4NI 2N4FA 4JL9A 1V5TA 4W9EA 5D94A 3UINB 2KDBA 4PS7A 1YX5B 2LI5A 2KN5A 2KDIA 2GMIC 3X23A 4G0NB 3WAPA 1MG8A 4WJOA 2Z59B 2LRWA 3ZNHB 4FN2A 4FJYA 1E5WA 1GG3A 2LZ6A 4II3B 4K7SA 4WWOA 1WYWB 3DDCB 4M8NA 2KO3A 1VCBA 2D2QA 2LD9A 2VRRB 2N9EB 4BBNF 3DVNV 2KTRB 2L76A 5IAAC 2BPSA 1TGZB 4GIVA 3TJPA 1L2NA 2L0FA 1V9JA 5CHFA 2LGXA 4GN1A 5G2NA 2KFJA 3M62B 4YL8A 4GMVA 3HM3A 4KSLC 3APDA 2K8HA 3R66C 1WX9A 5JZEB 2M4NA 5D7GA 1BT0A 1SE9A 4NJ7A 1V49A 3KUCB 3W1YA 4IG7B 3ZNZB 2K39A 1WGRA 2D10A 2N1WA 3V62A 3ZW3A 2ZCBA 4IWQA 5J17A 4JLCA 2BF8B 2LWPA 3DPDA 2IY0B 1WJ4A 3RT3B 3A9JA 3NY5A 4PS3A 4EKUA 1YIWA 3VH4B 2JRIB 3V61A 3M3JA 3VVWB 2KDFB 3VFKA 2KQSA 2PE6B 3A9KB 4RM8A 4FBJB 2KOXA 3MTNB 3KYCD 1WGYA 4J6IA 2ASQA 2HE7A 1Q1OA 3PV1A 4AJWA 3QWZB 2IO0B 4IM2A 4G50A 1I35A 2M17A 2JVCA 2WWZA 3H6NA 1OEYA 3ML9A 1XT9B 2KC1A 1SIFA 3PGEA 1T0YA 1Q0WB 1F9JA 2IO3B 3PHWB 2ZNVC 2KK8A 3CMMB 4X57B 1V2YA 2J0KA 2MBHA 2UWQA 4DWFA 2J7QB 2K8BA 2KJ6A 3UF8A 3QJZA 3VH3B 3PRPB 1E8YA 3IHPC 3UQBA 2L00B 4OVUA 5BO4B 2BKRB 2MP2A 4MGIE 5C23A 4MSMB 4PS8A 3Q3JA 4MEMA 2JT4B 3IBEA 1WFYA 4A3OA 2W9NA 1SGHA 2FIFA 2MWSB 2KNBA 4EZJA 1WGGA 2C7NB 4ZRJA 4CYEA 2V4LA 4II2B 4W9FA 3ZNGC 2JRHA 4WWNA 4DHZB 3V6EB 2DZKA 2R2QA 2IYDB 3ML8A 4BOZB 4ICVA 3AU5A 2BWFA 2KJHB 2NS5A 2DYOA 1NDDA 4I6NB 2ZZPB 2REXA 4CO7A 2ZVOA 1GNUA 2YLMA 2MCNB 3DVGX 2CR5A 3DCGA 1D3ZA 4EEWA 4OVVA 5CX3A 2BGFA 4ZRIA 2L0TA 4IW0A 5J18A 3L17A 3ZIMA 4CHKA 4KDLB 1LXDA 3QC8B 3RYTA 3UGBB 3T8MA 4TUUA 3SHQA 2RGFA 4IM0A 4MDKE 1WY8A 4PYUA 3A9JB 5E6PA 3RULA 5L83A 1WMHA 3ZNID 2O2VA 4NY0A 5LXHA 2A5UA 4BKSD 2J0MA 4XZ4A 1OQYA 1G6JA 2DAJA 2MRPA 4LDTD 2D3GA 2M1MA 1E7UA 2OJRA 2UYZB 1P1AA 2CS4A 1E8WA 2KWVB 5AEKB 2MA9B 1V81A 2RD0A 3KVFB 2CU1A 2NBUA 3QIJA 4W9IA 3ZO5B 2M0XA 2O6VD 3HHMA 2KKCA 3DVGY 2ZVNA 5CHWA 4EZLA 2AYOB 2N7DA 2ZNVB 3AI5A 2DYMA 5LLIA 1WM2A 2GBRA 4ZRKA 2C9WB 4GU2A 4GB9A 3BY4B 3DVNU 1GUAB 2DYBA 1UGMA 1HE8A 2MP2B 4LCDE 3OLMD 4BKTA 4DDGD 2C60A 3QQ8B 2LASA 4IC7B 3EFUA 3KYDD
chains in the Genus database with same CATH superfamily
1NEKB 4BKGA 2Y5BB 2WXQA 4R3DA 2N9XA 2SEBD 4RM9A 4BVUC 3UIOB 1X1MA 1YJIA 1KOTA 4ZYSA 4C4VB 4P1BC 3VUWA 4FA6A 1TZOA 5HKHA 3TEYA 2VZKD 2GBMA 4JQWC 1K53A 2IDYA 2FCQA 3R7RA 1L4ZB 2BVCA 3ZJVA 1S3SG 2INNE 2IBIB 2PTLA 1XCTL 2KWUB 4B95A 2MLBA 3DHIC 3RZFA 3GOEA 4KKJA 1YN5A 3QARA 1WM3A 4JWUC 3K9OB 4MT5A 1V5OA 1AWDA 4YSYB 4N59A 3PSEB 4B0EA 4WAFA 1GC7A 2C7MB 3H7PA 2DZJA 4LLGM 5KHOA 1OEYJ 5BYQA 3L08A 4AJYB 2QHOA 1E8ZA 1PYWD 1HTQA 3PVLA 4MJSA 3MC8A 1P7EA 1TS5A 2XN9C 3TMPB 4MACA 2BW2A 3WAOA 3AE6B 2R2OA 3ZTCA 3T9LA 2E3TA 1K8RB 1YMHE 2DNFA 2KXJA 1VR9A 4WURA 1WJUA 1WIAA 4GXBA 2AQ1B 3AN1A 3JVZX 2LUEA 1WYGA 1AARA 1WX7A 3ZDTA 2JZPA 2WXRA 1UELA 1QILA 1SE2A 1EF1A 4EZKA 1KM7A 4HPMB 1WR6E 3ENEA 2PPHA 1RAXA 3PZDA 1MPEA 2PIAA 2X38A 3W5UB 3VXWA 4AP4C 2LVPA 3A1QA 2FUHB 4RNAA 1I4HA 1GPXA 1TBEA 1EM7A 4C56C 5C2TB 4HJKA 4ANXA 2D3AA 4D2KA 5C1ZA 2XBBC 2AWTA 1M4VA 4KX6B 4RMAA 4FADA 3ABVB 3O65B 1ZW7A 3C19A 4US8A 2N0SB 1TJEA 1EF5A 4HLEA 1YD8U 2RMMA 4RGTA 2CHZA 1NYRA 4MSQB 4US9A 2AQ2B 4IOIE 3ETRA 2MJ3A 3DOWA 2DHZA 2WXFA 2AX5A 3DBLI 4GOCA 2IO2B 2GBKA 2CHWA 3N32A 3WANA 1L0XB 3PS6A 4GDLB 1JWAD 3ZTDA 1J19A 2J53A 4HCPB 5G5GA 1F2RI 1I4QA 2I1JA 3DHGC 3Q2AC 1A5RA 4ZYNA 3LJ3A 1NENB 3FC4A 3P42A 1TS4A 3H1UA 3IT4B 1QOAA 1ZDXA 2W55A 3R2IA 3PHXB 1DOYA 2LVQA 3NS8A 3M95A 2KQ7A 3DBHI 1VJKA 5IP4D 1NBFC 3PLVA 5LXIB 1LGRA 2KACA 1T0QC 2FIDA 4HWIB 4G3XB 3MJWA 2H88B 4DBGA 3OG5A 1GJZA 1P7FA 4JIOU 2HTHA 1IYFA 4EOYA 2KN4A 2RDHA 4MGKE 3RNAC 1YN4A 1TKGA 2ZPYA 4NAWB 4B9KA 3NOBA 3A4SC 2AL6A 2BS2B 4W9DA 2KTRA 3L4PA 1YQBA 2FUG1 2JZZA 3NVZA 3Q8AA 3N1ZC 4KDIC 1I4XA 2JZ3B 4IWPA 3MHSD 2GLSA 4XX5A 5AZHA 1P98A 4LNOA 4XC2A 3GP7A 2LJ5A 4W9KA 2G4DB 4KZ0A 5IO9A 3Q8EA 4XWTA 2V1YA 1QLBB 3NJTA 1SIJA 3PZ7A 3EA6A 4DHJB 1JWSD 2FAZA 4IUMB 3LDZE 4IWOA 4XDCA 1C77A 1H4RA 3NS1A 4A3PA 1V5TA 5D94A 3GE8C 2LRWA 5D3IB 3N1YC 4K7SA 4M8NA 2KO3A 2D2QA 4TSSA 4N58A 2N9EB 3DVNV 2AQ3B 3RPFC 3TJPA 4YTPB 5CHFA 1XLNA 2WXMA 1R4NB 3HVDA 3APDA 1WX9A 1UWXA 1ZOYB 2M4NA 2W3SA 3KUCB 2K39A 1HA5A 2N1WA 2LUMA 1CJEA 1C79A 2BF8B 3DPDA 1VDVA 1ESFA 3VH4B 3CWIA 4RF0A 2MHJA 3A9KB 2WDRB 2KOXA 3MTNB 1WGYA 4LNKA 2IO0B 4G50A 2DWQA 4HEA1 2IO3B 4EE2A 3CMMB 1V2YA 2UWQA 3IHPC 3UQBA 4OVUA 4A3OA 4AQ7A 1C4CA 2DBYA 4O1NA 1WGGA 3HRDD 4CYEA 3W2DA 4II2B 2MJDA 4WWNA 2YEPF 2ACZB 3TEZA 3MHZA 3ML8A 4OHJA 4HROA 5C3JB 2NS5A 1EU3A 2ZVOA 1PGXA 2MCNB 2CR5A 4EEWA 2BGFA 3NRZA 4ITKA 3L17A 1E9MA 1IGDA 2RGFA 3RNBC 4MH8A 2Z8LA 3A9JB 2O2VA 4NY0A 5LXHA 4B0MA 3P4SB 4XZ4A 1OQYA 1G6JA 2Q5WD 1E8WA 2KWVB 5AEKB 5E6JA 1SE4A 4W9IA 4ZHOA 4XDDA 2M0XA 2M56B 1TKYA 1Y56A 3IAM1 2RPVA 1WM2A 1FXAA 3KQ4A 4CQNA 2GBRA 4ZRKA 2C9WB 3R2TA 4ZOHC 4DDGD 2C60A 1EWYC 2GBJA 1B1ZA 4JX1C 2Z0DB 3AE4B 2B76B 3DBRB 3SDLC 3TCAA 4TQ0A 5DPTA 1WE6A 3N9YC 5J2RA 4S17A 1LM8B 1D5ZC 2JXXA 3AEDB 3PPAA 3OJ4B 1Y8RC 3KLSX 1FXIA 4A8XC 3DWGC 3ZRFA 4BBNC 1U4AA 2JWZA 4LJOB 2BYFA 1WMHB 1J7BA 4MGYE 2KYWA 4ANUA 2PEAA 1UGJA 2PKOA 3M63B 4GLSC 4YTMB 2RPQA 2TSSA 1NVID 3QK0A 1E10A 1MHXA 3AECB 2AEHA 1WI0A 1WGDA 1IP9A 4OZAA 3FILB 2L52A 4DK5A 1TYGB 1V1PA 2IY1B 3C0RB 5MPOA 2O6VB 1QOBA 4MM3A 1BUIC 2D11A 3AU4A 3E9SA 1XLPA 1EO6A 4ARIA 2V3NA 2KVRA 3DBSA 2WS3B 1T0RC 1WXVA 5D6JB 2L8JA 4BOSC 2VH2A 1F77A 1WGKA 3TL5A 3WALA 3S2AA 2N9KA 3TEWA 2ZPNA 2QJLA 2KHWB 2CJOA 2NPTA 4I6LB 3CIRB 1WE7A 3GZNB 2RDBC 4HKQA 3IT6B 1DOXA 4IKGA 3JSVB 2KMAA 4ANVA 3B08A 3AE9B 3HK0A 4DXGA 4FHKA 2JXTA 2G4SA 4MELA 3P4RB 2CKHB 3VTWA 3I3TB 3PTFC 1J8CA 3FAHA 1LO5D 4FJZA 1PFDA 2OEDA 1FRDA 1E6EB 1EU4A 1LQBA 1F2RC 3RCZA 3KUZA 3H9DA 4PK1A 2PJHA 1ZP0B 4HPLB 1GB1A 1RFAA 1HTOA 4PYZA 1JWUD 4K3BA 4MGZE 2YVCA 3UIPB 3IVFA 3PRZA 2M8SA 3ECIA 2NBWB 1PGBA 5HHDG 2NBVB 5FR3A 1NI2A 2L7RA 3H7SA 2K22A 1ZKHA 3HM6X 5JHAA 4HJGE 2NMQA 1ZUD2 2WP9B 5DCNA 1YQ3B 2K0PA 1OQRA 4I6PA 4M02A 3RMKC 1D6EC 4GDKB 1PQSA 4P7IA 4ZHPA 2WXLA 1C1YB 3B0AA 4RFBA 3ZKJC 2LVOA 4HVBA 4M0WA 3QJZA 2AL3A 1RRBA 3KWLA 1TIFA 2Y5PA 4J3OD 2KWDA 2MSED 4KIKB 5DPSA 3AULA 3URYA 3Q3NC 2JU6X 2KJRA 4W9CA 3JW0X 2GBNA 2BYVE 1KLVA 1YOVB 4WJPA 5DPWA 3ZRCA 4F1SA 4W9GA 3BIID 2MBBB 3Q3MC 2ZCCA 3B1LX 3PRMB 2KC2A 3VQIA 4LK0M 4A90A 3RZWC 3IG3A 1R7SA 4JWSC 1J0GA 4HRSA 4DHZE 3RD2A 4NQKE 5AZFA 2ON8A 3WA0A 1FO4A 1ET6A 1IBXB 5EDSA 2N9PC 1FD6A 4AUQC 2K9XA 5TSSA 4K1RB 1TS3A 1ENFA 1YJ1A 3L16A 3NZ3A 2R61A 5IKCM 4KZCA 3VRAB 3KUDB 1JROA 1WGHA 1E90A 2J0JA 1VZ6A 3SEBA 1FEHA 5G55A 3DWMA 2GI9A 4Q2JA 4OW0A 1V6EA 1SSNA 3V60A 4NNJB 2K6DB 2WX0A 3L10B 4DXFA 1C3TA 2K5PA 3MJ5A 3X0WA 1AN8A 4N9F4 2M19A 2ZW1A 1R4NI 3IXSA 3UINB 4PS7A 1YX5B 3RFZB 2KDIA 3WAPA 2Z59B 3ZNHB 2LZ6A 3RN9C 3E56A 4WWOA 1ACCA 1K50A 1JMLA 1SF0A 2GB1A 3OWEB 3V3XA 3BVGA 4BBNF 1DYQA 1FM0D 1VRAB 2L76A 1C76A 4GIVA 1L2NA 1V9JA 5BMHA 3HM3A 4NJCA 3W9CB 4KSLC 3ZJUA 5JZEB 1V49A 3ZNZB 4IG7B 1WGRA 2INCC 1FIQA 2ZCBA 4IWQA 2LWPA 2IY0B 1WJ4A 1J7CA 3V61A 3HUIA 3M3JA 2KDFB 3EUB2 3VFKA 2KQSA 4FBJB 3KYCD 3Q69A 4J6IA 3LB8C 3P63A 3QWZB 4IM2A 5FKAC 1OEYA 4LNIA 1QF6A 1XT9B 2N7JA 1T6BX 2BB5A 3PHWB 2ZNVC 3ZXVA 4LNFA 4X57B 2J0KA 4S0RA 1CZPA 3UF8A 1V97A 3PRPB 1L4DB 2M0AA 2BKRB 4MGIE 3PO0A 5C23A 4PS8A 4MEMA 1KLGD 2JT4B 3IBEA 2W3RA 4EZJA 2MH7A 1V1OA 3HVZA 5I4DA 1RM6C 2V4LA 3ZNGC 2QILA 3AE8B 4DHZB 3SR6A 3MFGA 2R2QA 2WXPA 2HTME 4C4VA 2KJHB 2BBCA 3LXFA 1GNUA 2YLMA 1D3ZA 4IW0A 3ZIMA 5BMGA 3RYTA 2ZW0A 3SFDB 3SHQA 4MDKE 2LJIA 3DHHC 2INDC 5BYSA 5E6PA 2L1AA 3P4QB 5L83A 4BKSD 4KGTA 3AV8A 4JE3B 2MRPA 4LDTD 2INPE 2M1MA 1E7UA 2OJRA 3KVFB 1PGAA 2NBUA 5H8YE 1FCCC 2ZVNA 2AYOB 5EE1A 2DYMA 2MP2B 4BKTA 2LASA 1HXYD 3KYDD 1UZXB 2DLBA 2K25A 3VAWA 1F1HA 2HJ8A 1YNTE 1KFYB 2C7HA 3CSTA 3U7DA 3AE5B 4A55A 1QQRA 4DDID 3ALBA 2RSUA 1M94A 3SD5A 4BAXA 1C9FA 1FXTB 3QA8A 1MFWA 2QCZA 3ONSA 2N7EA 2K3UA 3N30A 1ISNA 1N61A 1WJ6A 2DAFA 4YXDB 2KDEB 5HG2A 3BVMA 4E71A 2LFIA 2WLBA 2WQYB 4OZBA 3SFEB 5E6NA 2MQJA 2BT6A 4P16A 4FJVB 3EHVA 3BZDB 3VTVA 1F0ZA 4HK2A 1WRDB 3DBLB 2XEWA 5JH5C 1H8CA 1L6UA 2HD5B 5FR6A 3SU8X 1CK1A 1C4PA 1WH3A 3V6CB 2KAJA 3Q3FA 4KSKC 1XQQA 3BWUD 1TS2A 1FNUA 1JWBD 1TZ1A 2N9LA 5IA7A 1SBBB 3TUOA 4YT0B 3BYYB 2CHXA 4AOFA 3GZNI 2PE9A 1WR1A 1IUEA 4QAYA 3QX1A 2G3QB 1ROEA 2V4IB 2MBEA 1IGCA 1MJDA 2WXNA 4TQ1A 1BMLC 1N60A 5G5HA 4OZCA 2VH1A 1KRHA 1ZGUB 2PLPA 2OJWA 1GOZA 3CF6E 5EE3A 4GDLA 1WXSA 2FCSA 4C7ZA 3VR8B 5KHQA 1YN3A 3AEAB 2BWES 5HI1A 1E7PB 1QT9A 5FK9C 1WXAA 4M01A 2BTEA 2I38A 4K81A 4ANWA 3RUIB 4W9LA 3QAQA 1E8XA 3HIZA 3U52E 3ZLZA 1ZPSA 2KX3A 3H7PB 3CSFA 1HEZE 3B2FA 2LXAA 3NVVA 3RNEC 2JWUA 1D5XC 4MJSB 1WXMA 2CJNA 4BKSA 4KGRA 3ZGZA 2WX1A 1T3QA 3GB1A 1P3QU 3D32A 2WHIA 1QKZA 4WJQA 2JPHA 2D3CA 2L3ZA 3U8ZA 4NAWA 1RLFA 5IOIA 3U30A 2Z0EB 4E74A 2RDGA 5D3DA 2QDFA 4P1CC 2DZMA 2XK5A 4XE0A 2L05A 2YEPB 1HZ6A 3APFA 3P1MA 2IGDA 2V3PA 3A1QB 1FNVA 2FBWB 3P4PB 1QZEA 2KFKA 4KGSA 3L54A 1WJNA 4W9HA 1L0YB 1KJTA 2MW5A 4ZRPA 4GGQA 4B6WA 2KLGA 4AWJA 2I1KA 2QC8A 3KW5B 2DZIA 2JY6A 4NQLB 3J9CA 5CHVC 3WIMA 3EC8A 1MI0A 2KDMA 3NG0A 3T3NA 1V80A 1YQ4B 1KH0A 3R3MA 1L5PA 2LEKA 2G9HD 2LGDA 2NCNA 2W82A 1VZ7A 2J52A 5EE0A 1R4MB 2KX0A 4WWPA 1UWMA 4HKZE 4G11A 2LRUA 3ZXRA 4ZDVA 1ZDVA 1P9DU 3K9PB 2RR9A 3PLUA 2GOWA 2MX2A 2PW9A 2A4ZA 3O13A 2WDQB 4MH0E 1WSPA 4URKA 1FCLA 1UUPA 2VZKB 4JPSA 3TBLD 3A9KA 3W1SC 3W1SA 1WZ0A 2KTFA 3BYTB 4WJNA 1FRRA 4FLHA 3EGRA 2EMSA 4NPNA 4JL9A 2N4FA 4W9EA 4A6QA 2KDBA 2GMIC 2LHEA 3X23A 4G0NB 1MG8A 4WJOA 1FPYA 4FJYA 3AE1B 4II3B 3AE7B 1PDXA 2CU3A 1EWCA 1K51A 4N6EB 3Q8FA 2KTRB 5IAAC 2BPSA 1TGZB 2L0FA 1VLBA 3M62B 4YL8A 4GMVA 3ZQ4A 3R66C 5D7GA 1TT5B 5H92C 1OFFA 3I63C 2WDVB 3AEEB 4KKIA 4RGOS 3V62A 2HJ1A 2PVGC 4JLCA 1L0VB 2LGIA 1JCKB 2JYTA 2WXGA 3A9JA 4PS3A 4EKUA 1YIWA 2JRIB 3VVWB 3AE2B 4YWGG 2PE6B 1MVKA 2ASQA 2L32A 2V0GA 1I35A 5LNK1 2M17A 2JVCA 2WWZA 3ML9A 2IGGA 1SIFA 3PGEA 4ACFA 1XF5L 2KK8A 2J7QB 2K8BA 3VH3B 5BO4B 2BS3B 1CQVA 4MSMB 3T3OA 1SGHA 2NTTA 2WXJA 1B9RA 1ZXIA 1KF6B 2WU5B 1N5XA 3WCQA 4BOZB 4ICVA 3AU5A 2X8XX 4DQOC 1UF0A 2DYOA 3BK1A 4I6NB 2ZZPB 4M00A 2REXA 2V9HA 4CO7A 1A70A 3DVGX 1UNSA 1T0SC 4OVVA 5CX3A 2LHDA 2HDEA 4CHKA 1XEEA 1LXDA 3Q3OC 3QC8B 1JRPA 3UGBB 3T8MA 3NVYA 2OHFA 4IM0A 4PYUA 3RULA 1WMHA 3ZNID 2A5UA 2J42A 2J0MA 1C4AA 3BVZA 2DAJA 2D3GA 1JALA 1SXTA 5JXVA 1T5XD 5T8IA 4RH6A 1D4BA 2MA9B 2RD0A 3Q14C 3QIJA 4ARCA 2KKCA 3DVGY 4EZLA 2FE8A 3U7ZA 2N7DA 5LLIA 3AEGB 3MC9A 4GU2A 3BY4B 3DVNU 1UGMA 1HE8A 3N1XC 4WIPA 3QQ8B 4IC7B 2KMMA 3EFUA 3U4EG 4IDIA 1WZ3A 2WXKA 3RNCC 1N62A 4K3CA 1NYQA 4F8CB 1RFKA 2IJ0A 2FCMA 3FILA 5HFYA 1WX8A 2J4XA 3VUYA 4KVGB 4GSWA 2O6VA 3ZJTA 2FNJB 1SJED 4NZLB 1PUTA 4EFOA 4NJ6A 1K52A 1I4RA 2QSDA 3VR9B 3ZVVA 2EMTA 1WRIA 4K7WA 2E6XA 2W54A 4YTNB 5L95C 1KLUD 3TIXA 1YJJA 2MJEA 3R8BA 2O2VB 2BYEA 4HPPA 1NI3A 1VD2A 3VTUA 3W5VB 3ZYYX 1FFUA 3NZUA 4IM3A 2KT7A 1I42A 4LJPB 2NVUI 3AE3B 2KMCA 5E6OA 2WYQA 3JSVA 3NZSA 2K8CA 2ICIA 1XO3A 1SJHD 3B2GA 3UQAA 2Y3AA 1JWMD 2UU7A 2WGSA 2JUOA 2G45B 2WXIA 3JYUA 3BINA 1UBQA 3TSSA 4JGHB 2LXCA 1P0RA 1Q5WB 2EELA 4ZRQA 4LDTB 2C5LC 5AUKA 4USAA 1FFVA 1S1QB 2ZJDA 1XD3B 3KH0A 3P2BA 4FHJA 1I7HA 2DX5B 2LMCA 3A33B 2JF5A 1RWSA 4HCNB 2XK5B 4RF1A 2WU2B 1XCQL 3BK2A 4M8MA 3DBRI 1KTKA 1UH6A 3PT2B 5TR5A 3RNFC 4RCOA 4GDKA 4YSZB 1I4PA 4HXDA 3LYYA 2WDTB 4EUTA 2KFKB 1L6VA 4NAMA 3IFWB 5JHBA 4UDUC 2D07B 1FMAD 4TV3A 5CTRC 2KZRA 2KQ4X 4KIKA 2JSVX 5D2MB 5AZGA 3OAWA 1CMXB 1TY2A 3H8HA 2KD0A 3L13A 4KV2A 3TEXA 4A20A 3QCAA 3QHTA 2B3AA 1HZ5A 3ZUNA 1V1PB 5DPRA 3AEBB 3A4RA 1AW7A 3APCA 1DGJA 2BB6A 3VDZA 3ZDMC 2ZEQA 4REZA 1OTRB 2IPKD 2K6QA 3VHTC 4HDQA 4E3CA 1UBIA 4MM3B 4XWWA 3WAMA 2KWCA 2I2YA 1HQRD 1JRUA 1OQQA 1Z2MA 2V3SA 2BKFA 2MBOA 1DOIA 2OOBB 4P6VF 2MBQA 4DHJD 1EUVB 3EFCA 1IBXA 1MHHE 4TMAB 2QMTA 3NHEB 2JYEA 2KANA 3VRBB 2NPTB 3MP9A 3PREA 3DQVA 3VUXA 1TY0A 4RGMA 3I57A 2NR2A 1IPGA 2QEJC 3Q8BA 2WNMA 1TTNA 2IGHA 4F7ZA 5BMIA 2FCNA 3NUHB 2IO1B 2DENB 1STEA 1R4MI 1J7AA 4WQMA 1F52A 2WXOA 4BZAA 1WF9A 2K1FA 3AMZA 3AEFB 1AYFA 3I5JC 4DXAB 2D3BA 2LGYA 4LTUA 4BFRA 1I4GA 4HDOA 4L2YA 3Q6BA 1RYJA 4TKNA 1C78A 4RGNA 3AB5A 3N20C 4W9JA 1MG4A 4FULA 1L7YA 4OVZA 2LGSA 2JX5A 3DBHB 4C7YA 5IN7A 1OGWA 3RNGC 5BYRA 3OJ3A 4FXCA 3R7QA 2EKEC 2Y5CA 1JW9D 2PVOD 4ICUA 1GC6A 3Q8CA 1UD7A 2IZVB 3PZ8A 4C80A 3NVWA 4WAAA 4WQOB 1FNWA 1YX6B 4M0WB 1V86A 5GMVA 3EECA 2KLCA 3AXCA 2N1VA 1Z5SB 1LFDA 3B9JA 3L0WB 4K7UA 1SEBD 1XXGA 1E7VA 1WWTA 3N3KB 4ASWC 1ZE3D 2LI5A 3U2SC 1JQ4A 1BXTA 2KN5A 3GS2A 1SB3C 1QOFA 4FN2A 1E5WA 1GG3A 4A9AA 4L23A 1WYWB 3DDCB 1VCBA 1N5WA 2LD9A 2VRRB 2G1EA 3KWVA 2MEKA 3RI7C 2LGXA 4GN1A 4PT5A 5G2NA 2KFJA 4XGAB 3FKYA 2K8HA 4C00A 1BT0A 1SE9A 4NJ7A 3W1YA 3UI3A 2D5GA 3MC0B 5GXGB 2D10A 2GRIA 2NTSA 3ZW3A 4H2AA 5J17A 1WXQA 1ZXHA 3RT3B 3NY5A 1SE3A 4RM8A 1N63A 2HE7A 1Q1OA 3PV1A 4AJWA 4LNNA 3AH7A 3I9V1 3H6NA 2PMVA 1ET9A 1V8CA 2KC1A 1T0YA 1Q0WB 1F9JA 3C8YA 2MBHA 2WXHA 4XYCA 4DWFA 2KJ6A 2ONQA 2JQRB 1E8YA 2L00B 2MP2A 3V05A 1D5MC 3Q3JA 1WFYA 2W9NA 2FIFA 2MWSB 2BQQA 2QIEB 2KNBA 2XNAC 5AUIA 4ZRJA 2C7NB 4W9FA 1QOGA 2JRHA 3V6EB 2DZKA 4L1BA 2IYDB 1XLQA 2BWFA 3IAS1 1GB4A 1NDDA 2SAKA 2L83A 1GAQB 2KVZA 2BS4B 1E0ZA 1VZ8A 2H89B 3DCGA 4ZRIA 2L0TA 5J18A 4KDLB 4TUUA 3AM9A 1WY8A 1Q10A 4YSXB 2BYTA 2UYZB 4WWMA 1P1AA 2CS4A 1V81A 2EKIA 1N6ZA 3GE3C 2CU1A 3ZO5B 2O6VD 3HHMA 5EE9A 5CHWA 2ZNVB 4AS1A 3AI5A 4WH4A 1TKEA 4GB9A 1GUAB 2DYBA 4LCDE 3OLMD 1XLOA
chains in the Genus database with same CATH topology
1WZ3A 4BKGA 2Y5BB 2Z0DB 1UZXB 4F8CB 3SDLC 2N9XA 2K25A 4RM9A 3TCAA 2FCMA 3VAWA 4BVUC 4TQ0A 3UIOB 1WX8A 3VUYA 5DPTA 1WE6A 1X1MA 5J2RA 2HJ8A 4KVGB 1KOTA 1LM8B 2C7HA 3CSTA 3U7DA 4GSWA 3VUWA 4DDID 4FA6A 2O6VA 2JXXA 3PHXB 3ALBA 2FNJB 5HKHA 2RSUA 3PPAA 1M94A 3OJ4B 3SD5A 2GBMA 1Y8RC 4EFOA 4JQWC 4NJ6A 2FCQA 1FXTB 3QA8A 3ZVVA 3ZRFA 2EMTA 4BBNC 3ONSA 1U4AA 4K7WA 3R7RA 2N7EA 2JWZA 3N30A 1ISNA 1S3SG 5L95C 4LJOB 1WJ6A 2DAFA 2BYFA 2IBIB 2KDEB 3TIXA 1WMHB 2O2VB 2BYEA 1VD2A 2KWUB 4MGYE 2MLBA 3VTUA 4B95A 4E71A 3RZFA 3GOEA 4ANUA 2PEAA 3NZUA 4IM3A 3M63B 5E6NA 3QARA 1I42A 4LJPB 1WM3A 2MQJA 2NVUI 3K9OB 1V5OA 2KMCA 2RPQA 2WYQA 3JSVA 4FJVB 3NZSA 5E6OA 3EHVA 2K8CA 3PSEB 3UQAA 1GC7A 2C7MB 3VTVA 3H7PA 4HK2A 1WRDB 3QK0A 2XEWA 2JUOA 2G45B 5JH5C 1H8CA 2DZJA 3JYUA 2AEHA 2HD5B 3BINA 1WI0A 5FR6A 5KHOA 1UBQA 1OEYJ 3L08A 3SU8X 4AJYB 2QHOA 1E8ZA 1WH3A 3PVLA 4JGHB 4MJSA 3V6CB 3Q3FA 1WGDA 1IP9A 2LXCA 1P0RA 1Q5WB 4KSKC 1XQQA 3TMPB 3WAOA 1TZ1A 4LDTB 2R2OA 2C5LC 3T9LA 3ZTCA 4DK5A 5IA7A 1K8RB 2IY1B 1S1QB 2ZJDA 3C0RB 1XD3B 2CHXA 4AOFA 3GZNI 2O6VB 2PE9A 1WR1A 2KXJA 3KH0A 4MM3A 1WJUA 2D11A 3P2BA 1WIAA 3QX1A 4FHJA 4GXBA 2DX5B 2G3QB 3AU4A 3JVZX 2LUEA 1AARA 2MBEA 2JF5A 3A33B 4TQ1A 1EO6A 1WX7A 3ZDTA 1UELA 1EF1A 4EZKA 1KM7A 2KVRA 3DBSA 4HCNB 4HPMB 1WR6E 3ENEA 2PPHA 1WXVA 2XK5B 1RAXA 1ZGUB 5D6JB 2L8JA 4BOSC 3PZDA 3CF6E 4GDLA 4M8MA 1WXSA 3TL5A 3WALA 3S2AA 3DBRI 2ZPNA 2FCSA 1UH6A 3PT2B 3VXWA 5TR5A 4AP4C 2KHWB 2NPTA 2GBJA 2LVPA 4GDKA 4I6LB 5KHQA 2BWES 1WE7A 3A1QA 2FUHB 4HXDA 1WXAA 4K81A 4ANWA 3JSVB 2KMAA 2WDTB 1TBEA 4W9LA 3QAQA 3B08A 1E8XA 3HIZA 3RUIB 4ANVA 2KFKB 3HK0A 4EUTA 4FHKA 2G4SA 3ZLZA 4MELA 2KX3A 3H7PB 3CSFA 3IFWB 5JHBA 2D07B 4HJKA 4ANXA 2CKHB 5C1ZA 4TV3A 2LXAA 2KZRA 5CTRC 3VTWA 3I3TB 4KIKA 2XBBC 3PTFC 1J8CA 2AWTA 5D2MB 5AZGA 4MJSB 1WXMA 4FJZA 3OAWA 1CMXB 4RMAA 4BKSA 4FADA 1LQBA 2KD0A 3L13A 4KV2A 4A20A 3QCAA 3QHTA 3O65B 3RCZA 2WX1A 2B3AA 1ZW7A 3KUZA 3H9DA 3ZUNA 1P3QU 3D32A 5DPRA 1EF5A 4HLEA 1YD8U 2PJHA 3A4RA 2CHZA 4WJQA 3APCA 2JPHA 4MSQB 3VDZA 3ZDMC 2L3ZA 2ZEQA 4HPLB 3U8ZA 1RFAA 4NAWA 1RLFA 4PYZA 1OTRB 4E3CA 2K6QA 3VHTC 4HDQA 3U30A 1UBIA 2Z0EB 3WAMA 2KWCA 4MGZE 4E74A 2YVCA 3DOWA 3UIPB 2DHZA 3IVFA 3PRZA 2M8SA 3ECIA 2NBWB 1JRUA 1Z2MA 2V3SA 2DZMA 3DBLI 2BKFA 2NBVB 2MBOA 4GOCA 2OOBB 1NI2A 2MBQA 2L7RA 2XK5A 3H7SA 1EUVB 4DHJD 1ZKHA 3HM6X 5JHAA 2IO2B 2GBKA 2L05A 2CHWA 3N32A 3WANA 3PS6A 4GDLB 3APFA 3ZTDA 1J19A 4HCPB 5DCNA 3NHEB 2I1JA 2KANA 4I6PA 2NPTB 1A5RA 4GDKB 4ZYNA 1PQSA 3PREA 3DQVA 3LJ3A 4P7IA 3VUXA 3A1QB 2NR2A 1IPGA 1C1YB 3B0AA 3H1UA 1TTNA 3ZKJC 1QZEA 2KFKA 2LVOA 4HVBA 3L54A 4F7ZA 2FCNA 2IO1B 1WJNA 2AL3A 2DENB 1KJTA 1RRBA 2LVQA 2MW5A 3NS8A 1R4MI 3M95A 4W9HA 2KQ7A 3DBHI 4GGQA 4B6WA 2KLGA 1NBFC 3PLVA 2I1KA 4AWJA 5LXIB 2MSED 1WF9A 4KIKB 2K1FA 2FIDA 3KW5B 2DZIA 2JY6A 4HWIB 5DPSA 4G3XB 3AULA 3MJWA 4NQLB 4DBGA 2KJRA 4DXAB 4W9CA 3JW0X 2LGYA 2GBNA 2BYVE 1KLVA 5CHVC 4BFRA 4HDOA 3WIMA 3EC8A 4WJPA 1GJZA 4JIOU 4TKNA 2HTHA 1IYFA 4EOYA 5DPWA 3ZRCA 4F1SA 1V80A 4MGKE 4W9GA 4W9JA 2ZPYA 2MBBB 3R3MA 4FULA 2ZCCA 4NAWB 2LGDA 2NCNA 4B9KA 3B1LX 3NOBA 3A4SC 1L7YA 3PRMB 2KC2A 3VQIA 2AL6A 4W9DA 3RZWC 2KX0A 2KTRA 3IG3A 4WWPA 1YQBA 1J0GA 2JZZA 1OGWA 4DHZE 3RD2A 4NQKE 4KDIC 5AZFA 3WA0A 2JZ3B 4G11A 4IWPA 2LRUA 3MHSD 3OJ3A 5EDSA 2N9PC 4XX5A 3R7QA 4ZDVA 4AUQC 5AZHA 1P98A 4XC2A 4K1RB 1P9DU 3K9PB 2EKEC 1YJ1A 2RR9A 3L16A 3PLUA 2GOWA 2MX2A 2A4ZA 2LJ5A 4KZCA 4W9KA 2G4DB 4ICUA 1GC6A 4KZ0A 1UD7A 4MH0E 2IZVB 3KUDB 4URKA 4WAAA 4WQOB 1WGHA 1E90A 1YX6B 2J0JA 3TBLD 4M0WB 1V86A 2V1YA 5GMVA 5G55A 3EECA 2KLCA 3A9KA 3AXCA 1V6EA 2N1VA 1Z5SB 3V60A 3W1SC 1LFDA 3W1SA 3L0WB 1WZ0A 2KTFA 4NNJB 4DHJB 2K6DB 2FAZA 2WX0A 3L10B 4K7UA 1C3TA 4WJNA 4IUMB 4FLHA 3LDZE 3X0WA 1E7VA 4IWOA 3N3KB 4N9F4 1H4RA 4A3PA 4ASWC 2EMSA 4NPNA 1R4NI 2N4FA 4JL9A 1V5TA 4W9EA 5D94A 3UINB 2KDBA 4PS7A 1YX5B 2LI5A 2KN5A 2KDIA 2GMIC 3X23A 4G0NB 3WAPA 1MG8A 4WJOA 2Z59B 2LRWA 3ZNHB 4FN2A 4FJYA 1E5WA 1GG3A 2LZ6A 4II3B 4K7SA 4WWOA 1WYWB 3DDCB 4M8NA 2KO3A 1VCBA 2D2QA 2LD9A 2VRRB 2N9EB 4BBNF 3DVNV 2KTRB 2L76A 5IAAC 2BPSA 1TGZB 4GIVA 3TJPA 1L2NA 2L0FA 1V9JA 5CHFA 2LGXA 4GN1A 5G2NA 2KFJA 3M62B 4YL8A 4GMVA 3HM3A 4KSLC 3APDA 2K8HA 3R66C 1WX9A 5JZEB 2M4NA 5D7GA 1BT0A 1SE9A 4NJ7A 1V49A 3KUCB 3W1YA 4IG7B 3ZNZB 2K39A 1WGRA 2D10A 2N1WA 3V62A 3ZW3A 2ZCBA 4IWQA 5J17A 4JLCA 2BF8B 2LWPA 3DPDA 2IY0B 1WJ4A 3RT3B 3A9JA 3NY5A 4PS3A 4EKUA 1YIWA 3VH4B 2JRIB 3V61A 3M3JA 3VVWB 2KDFB 3VFKA 2KQSA 2PE6B 3A9KB 4RM8A 4FBJB 2KOXA 3MTNB 3KYCD 1WGYA 4J6IA 2ASQA 2HE7A 1Q1OA 3PV1A 4AJWA 3QWZB 2IO0B 4IM2A 4G50A 1I35A 2M17A 2JVCA 2WWZA 3H6NA 1OEYA 3ML9A 1XT9B 2KC1A 1SIFA 3PGEA 1T0YA 1Q0WB 1F9JA 2IO3B 3PHWB 2ZNVC 2KK8A 3CMMB 4X57B 1V2YA 2J0KA 2MBHA 2UWQA 4DWFA 2J7QB 2K8BA 2KJ6A 3UF8A 3QJZA 3VH3B 3PRPB 1E8YA 3IHPC 3UQBA 2L00B 4OVUA 5BO4B 2BKRB 2MP2A 4MGIE 5C23A 4MSMB 4PS8A 3Q3JA 4MEMA 2JT4B 3IBEA 1WFYA 4A3OA 2W9NA 1SGHA 2FIFA 2MWSB 2KNBA 4EZJA 1WGGA 2C7NB 4ZRJA 4CYEA 2V4LA 4II2B 4W9FA 3ZNGC 2JRHA 4WWNA 4DHZB 3V6EB 2DZKA 2R2QA 2IYDB 3ML8A 4BOZB 4ICVA 3AU5A 2BWFA 2KJHB 2NS5A 2DYOA 1NDDA 4I6NB 2ZZPB 2REXA 4CO7A 2ZVOA 1GNUA 2YLMA 2MCNB 3DVGX 2CR5A 3DCGA 1D3ZA 4EEWA 4OVVA 5CX3A 2BGFA 4ZRIA 2L0TA 4IW0A 5J18A 3L17A 3ZIMA 4CHKA 4KDLB 1LXDA 3QC8B 3RYTA 3UGBB 3T8MA 4TUUA 3SHQA 2RGFA 4IM0A 4MDKE 1WY8A 4PYUA 3A9JB 5E6PA 3RULA 5L83A 1WMHA 3ZNID 2O2VA 4NY0A 5LXHA 2A5UA 4BKSD 2J0MA 4XZ4A 1OQYA 1G6JA 2DAJA 2MRPA 4LDTD 2D3GA 2M1MA 1E7UA 2OJRA 2UYZB 1P1AA 2CS4A 1E8WA 2KWVB 5AEKB 2MA9B 1V81A 2RD0A 3KVFB 2CU1A 2NBUA 3QIJA 4W9IA 3ZO5B 2M0XA 2O6VD 3HHMA 2KKCA 3DVGY 2ZVNA 5CHWA 4EZLA 2AYOB 2N7DA 2ZNVB 3AI5A 2DYMA 5LLIA 1WM2A 2GBRA 4ZRKA 2C9WB 4GU2A 4GB9A 3BY4B 3DVNU 1GUAB 2DYBA 1UGMA 1HE8A 2MP2B 4LCDE 3OLMD 4BKTA 4DDGD 2C60A 3QQ8B 2LASA 4IC7B 3EFUA 3KYDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WZ3 A;  4BKG A;  2Y5B B;  2Z0D B;  1UZX B;  4F8C B;  3SDL C;  2N9X A;  2K25 A;  4RM9 A;  3TCA A;  2FCM A;  3VAW A;  4BVU C;  4TQ0 A;  3UIO B;  1WX8 A;  3VUY A;  5DPT A;  1WE6 A;  1X1M A;  5J2R A;  2HJ8 A;  4KVG B;  1KOT A;  1LM8 B;  2C7H A;  3CST A;  3U7D A;  4GSW A;  3VUW A;  4DDI D;  4FA6 A;  2O6V A;  2JXX A;  3PHX B;  3ALB A;  2FNJ B;  5HKH A;  2RSU A;  3PPA A;  1M94 A;  3OJ4 B;  3SD5 A;  2GBM A;  1Y8R C;  4EFO A;  4JQW C;  4NJ6 A;  2FCQ A;  1FXT B;  3QA8 A;  3ZVV A;  3ZRF A;  2EMT A;  4BBN C;  3ONS A;  1U4A A;  4K7W A;  3R7R A;  2N7E A;  2JWZ A;  3N30 A;  1ISN A;  1S3S G;  5L95 C;  4LJO B;  1WJ6 A;  2DAF A;  2BYF A;  2IBI B;  2KDE B;  3TIX A;  1WMH B;  2O2V B;  2BYE A;  1VD2 A;  2KWU B;  4MGY E;  2MLB A;  3VTU A;  4B95 A;  4E71 A;  3RZF A;  3GOE A;  4ANU A;  2PEA A;  3NZU A;  4IM3 A;  3M63 B;  5E6N A;  3QAR A;  1I42 A;  4LJP B;  1WM3 A;  2MQJ A;  2NVU I;  3K9O B;  1V5O A;  2KMC A;  2RPQ A;  2WYQ A;  3JSV A;  4FJV B;  3NZS A;  5E6O A;  3EHV A;  2K8C A;  3PSE B;  3UQA A;  1GC7 A;  2C7M B;  3VTV A;  3H7P A;  4HK2 A;  1WRD B;  3QK0 A;  2XEW A;  2JUO A;  2G45 B;  5JH5 C;  1H8C A;  2DZJ A;  3JYU A;  2AEH A;  2HD5 B;  3BIN A;  1WI0 A;  5FR6 A;  5KHO A;  1UBQ A;  1OEY J;  3L08 A;  3SU8 X;  4AJY B;  2QHO A;  1E8Z A;  1WH3 A;  3PVL A;  4JGH B;  4MJS A;  3V6C B;  3Q3F A;  1WGD A;  1IP9 A;  2LXC A;  1P0R A;  1Q5W B;  4KSK C;  1XQQ A;  3TMP B;  3WAO A;  1TZ1 A;  4LDT B;  2R2O A;  2C5L C;  3T9L A;  3ZTC A;  4DK5 A;  5IA7 A;  1K8R B;  2IY1 B;  1S1Q B;  2ZJD A;  3C0R B;  1XD3 B;  2CHX A;  4AOF A;  3GZN I;  2O6V B;  2PE9 A;  1WR1 A;  2KXJ A;  3KH0 A;  4MM3 A;  1WJU A;  2D11 A;  3P2B A;  1WIA A;  3QX1 A;  4FHJ A;  4GXB A;  2DX5 B;  2G3Q B;  3AU4 A;  3JVZ X;  2LUE A;  1AAR A;  2MBE A;  2JF5 A;  3A33 B;  4TQ1 A;  1EO6 A;  1WX7 A;  3ZDT A;  1UEL A;  1EF1 A;  4EZK A;  1KM7 A;  2KVR A;  3DBS A;  4HCN B;  4HPM B;  1WR6 E;  3ENE A;  2PPH A;  1WXV A;  2XK5 B;  1RAX A;  1ZGU B;  5D6J B;  2L8J A;  4BOS C;  3PZD A;  3CF6 E;  4GDL A;  4M8M A;  1WXS A;  3TL5 A;  3WAL A;  3S2A A;  3DBR I;  2ZPN A;  2FCS A;  1UH6 A;  3PT2 B;  3VXW A;  5TR5 A;  4AP4 C;  2KHW B;  2NPT A;  2GBJ A;  2LVP A;  4GDK A;  4I6L B;  5KHQ A;  2BWE S;  1WE7 A;  3A1Q A;  2FUH B;  4HXD A;  1WXA A;  4K81 A;  4ANW A;  3JSV B;  2KMA A;  2WDT B;  1TBE A;  4W9L A;  3QAQ A;  3B08 A;  1E8X A;  3HIZ A;  3RUI B;  4ANV A;  2KFK B;  3HK0 A;  4EUT A;  4FHK A;  2G4S A;  3ZLZ A;  4MEL A;  2KX3 A;  3H7P B;  3CSF A;  3IFW B;  5JHB A;  2D07 B;  4HJK A;  4ANX A;  2CKH B;  5C1Z A;  4TV3 A;  2LXA A;  2KZR A;  5CTR C;  3VTW A;  3I3T B;  4KIK A;  2XBB C;  3PTF C;  1J8C A;  2AWT A;  5D2M B;  5AZG A;  4MJS B;  1WXM A;  4FJZ A;  3OAW A;  1CMX B;  4RMA A;  4BKS A;  4FAD A;  1LQB A;  2KD0 A;  3L13 A;  4KV2 A;  4A20 A;  3QCA A;  3QHT A;  3O65 B;  3RCZ A;  2WX1 A;  2B3A A;  1ZW7 A;  3KUZ A;  3H9D A;  3ZUN A;  1P3Q U;  3D32 A;  5DPR A;  1EF5 A;  4HLE A;  1YD8 U;  2PJH A;  3A4R A;  2CHZ A;  4WJQ A;  3APC A;  2JPH A;  4MSQ B;  3VDZ A;  3ZDM C;  2L3Z A;  2ZEQ A;  4HPL B;  3U8Z A;  1RFA A;  4NAW A;  1RLF A;  4PYZ A;  1OTR B;  4E3C A;  2K6Q A;  3VHT C;  4HDQ A;  3U30 A;  1UBI A;  2Z0E B;  3WAM A;  2KWC A;  4MGZ E;  4E74 A;  2YVC A;  3DOW A;  3UIP B;  2DHZ A;  3IVF A;  3PRZ A;  2M8S A;  3ECI A;  2NBW B;  1JRU A;  1Z2M A;  2V3S A;  2DZM A;  3DBL I;  2BKF A;  2NBV B;  2MBO A;  4GOC A;  2OOB B;  1NI2 A;  2MBQ A;  2L7R A;  2XK5 A;  3H7S A;  1EUV B;  4DHJ D;  1ZKH A;  3HM6 X;  5JHA A;  2IO2 B;  2GBK A;  2L05 A;  2CHW A;  3N32 A;  3WAN A;  3PS6 A;  4GDL B;  3APF A;  3ZTD A;  1J19 A;  4HCP B;  5DCN A;  3NHE B;  2I1J A;  2KAN A;  4I6P A;  2NPT B;  1A5R A;  4GDK B;  4ZYN A;  1PQS A;  3PRE A;  3DQV A;  3LJ3 A;  4P7I A;  3VUX A;  3A1Q B;  2NR2 A;  1IPG A;  1C1Y B;  3B0A A;  3H1U A;  1TTN A;  3ZKJ C;  1QZE A;  2KFK A;  2LVO A;  4HVB A;  3L54 A;  4F7Z A;  2FCN A;  2IO1 B;  1WJN A;  2AL3 A;  2DEN B;  1KJT A;  1RRB A;  2LVQ A;  2MW5 A;  3NS8 A;  1R4M I;  3M95 A;  4W9H A;  2KQ7 A;  3DBH I;  4GGQ A;  4B6W A;  2KLG A;  1NBF C;  3PLV A;  2I1K A;  4AWJ A;  5LXI B;  2MSE D;  1WF9 A;  4KIK B;  2K1F A;  2FID A;  3KW5 B;  2DZI A;  2JY6 A;  4HWI B;  5DPS A;  4G3X B;  3AUL A;  3MJW A;  4NQL B;  4DBG A;  2KJR A;  4DXA B;  4W9C A;  3JW0 X;  2LGY A;  2GBN A;  2BYV E;  1KLV A;  5CHV C;  4BFR A;  4HDO A;  3WIM A;  3EC8 A;  4WJP A;  1GJZ A;  4JIO U;  4TKN A;  2HTH A;  1IYF A;  4EOY A;  5DPW A;  3ZRC A;  4F1S A;  1V80 A;  4MGK E;  4W9G A;  4W9J A;  2ZPY A;  2MBB B;  3R3M A;  4FUL A;  2ZCC A;  4NAW B;  2LGD A;  2NCN A;  4B9K A;  3B1L X;  3NOB A;  3A4S C;  1L7Y A;  3PRM B;  2KC2 A;  3VQI A;  2AL6 A;  4W9D A;  3RZW C;  2KX0 A;  2KTR A;  3IG3 A;  4WWP A;  1YQB A;  1J0G A;  2JZZ A;  1OGW A;  4DHZ E;  3RD2 A;  4NQK E;  4KDI C;  5AZF A;  3WA0 A;  2JZ3 B;  4G11 A;  4IWP A;  2LRU A;  3MHS D;  3OJ3 A;  5EDS A;  2N9P C;  4XX5 A;  3R7Q A;  4ZDV A;  4AUQ C;  5AZH A;  1P98 A;  4XC2 A;  4K1R B;  1P9D U;  3K9P B;  2EKE C;  1YJ1 A;  2RR9 A;  3L16 A;  3PLU A;  2GOW A;  2MX2 A;  2A4Z A;  2LJ5 A;  4KZC A;  4W9K A;  2G4D B;  4ICU A;  1GC6 A;  4KZ0 A;  1UD7 A;  4MH0 E;  2IZV B;  3KUD B;  4URK A;  4WAA A;  4WQO B;  1WGH A;  1E90 A;  1YX6 B;  2J0J A;  3TBL D;  4M0W B;  1V86 A;  2V1Y A;  5GMV A;  5G55 A;  3EEC A;  2KLC A;  3A9K A;  3AXC A;  1V6E A;  2N1V A;  1Z5S B;  3V60 A;  3W1S C;  1LFD A;  3W1S A;  3L0W B;  1WZ0 A;  2KTF A;  4NNJ B;  4DHJ B;  2K6D B;  2FAZ A;  2WX0 A;  3L10 B;  4K7U A;  1C3T A;  4WJN A;  4IUM B;  4FLH A;  3LDZ E;  3X0W A;  1E7V A;  4IWO A;  3N3K B;  4N9F 4;  1H4R A;  4A3P A;  4ASW C;  2EMS A;  4NPN A;  1R4N I;  2N4F A;  4JL9 A;  1V5T A;  4W9E A;  5D94 A;  3UIN B;  2KDB A;  4PS7 A;  1YX5 B;  2LI5 A;  2KN5 A;  2KDI A;  2GMI C;  3X23 A;  4G0N B;  3WAP A;  1MG8 A;  4WJO A;  2Z59 B;  2LRW A;  3ZNH B;  4FN2 A;  4FJY A;  1E5W A;  1GG3 A;  2LZ6 A;  4II3 B;  4K7S A;  4WWO A;  1WYW B;  3DDC B;  4M8N A;  2KO3 A;  1VCB A;  2D2Q A;  2LD9 A;  2VRR B;  2N9E B;  4BBN F;  3DVN V;  2KTR B;  2L76 A;  5IAA C;  2BPS A;  1TGZ B;  4GIV A;  3TJP A;  1L2N A;  2L0F A;  1V9J A;  5CHF A;  2LGX A;  4GN1 A;  5G2N A;  2KFJ A;  3M62 B;  4YL8 A;  4GMV A;  3HM3 A;  4KSL C;  3APD A;  2K8H A;  3R66 C;  1WX9 A;  5JZE B;  2M4N A;  5D7G A;  1BT0 A;  1SE9 A;  4NJ7 A;  1V49 A;  3KUC B;  3W1Y A;  4IG7 B;  3ZNZ B;  2K39 A;  1WGR A;  2D10 A;  2N1W A;  3V62 A;  3ZW3 A;  2ZCB A;  4IWQ A;  5J17 A;  4JLC A;  2BF8 B;  2LWP A;  3DPD A;  2IY0 B;  1WJ4 A;  3RT3 B;  3A9J A;  3NY5 A;  4PS3 A;  4EKU A;  1YIW A;  3VH4 B;  2JRI B;  3V61 A;  3M3J A;  3VVW B;  2KDF B;  3VFK A;  2KQS A;  2PE6 B;  3A9K B;  4RM8 A;  4FBJ B;  2KOX A;  3MTN B;  3KYC D;  1WGY A;  4J6I A;  2ASQ A;  2HE7 A;  1Q1O A;  3PV1 A;  4AJW A;  3QWZ B;  2IO0 B;  4IM2 A;  4G50 A;  1I35 A;  2M17 A;  2JVC A;  2WWZ A;  3H6N A;  1OEY A;  3ML9 A;  1XT9 B;  2KC1 A;  1SIF A;  3PGE A;  1T0Y A;  1Q0W B;  1F9J A;  2IO3 B;  3PHW B;  2ZNV C;  2KK8 A;  3CMM B;  4X57 B;  1V2Y A;  2J0K A;  2MBH A;  2UWQ A;  4DWF A;  2J7Q B;  2K8B A;  2KJ6 A;  3UF8 A;  3QJZ A;  3VH3 B;  3PRP B;  1E8Y A;  3IHP C;  3UQB A;  2L00 B;  4OVU A;  5BO4 B;  2BKR B;  2MP2 A;  4MGI E;  5C23 A;  4MSM B;  4PS8 A;  3Q3J A;  4MEM A;  2JT4 B;  3IBE A;  1WFY A;  4A3O A;  2W9N A;  1SGH A;  2FIF A;  2MWS B;  2KNB A;  4EZJ A;  1WGG A;  2C7N B;  4ZRJ A;  4CYE A;  2V4L A;  4II2 B;  4W9F A;  3ZNG C;  2JRH A;  4WWN A;  4DHZ B;  3V6E B;  2DZK A;  2R2Q A;  2IYD B;  3ML8 A;  4BOZ B;  4ICV A;  3AU5 A;  2BWF A;  2KJH B;  2NS5 A;  2DYO A;  1NDD A;  4I6N B;  2ZZP B;  2REX A;  4CO7 A;  2ZVO A;  1GNU A;  2YLM A;  2MCN B;  3DVG X;  2CR5 A;  3DCG A;  1D3Z A;  4EEW A;  4OVV A;  5CX3 A;  2BGF A;  4ZRI A;  2L0T A;  4IW0 A;  5J18 A;  3L17 A;  3ZIM A;  4CHK A;  4KDL B;  1LXD A;  3QC8 B;  3RYT A;  3UGB B;  3T8M A;  4TUU A;  3SHQ A;  2RGF A;  4IM0 A;  4MDK E;  1WY8 A;  4PYU A;  3A9J B;  5E6P A;  3RUL A;  5L83 A;  1WMH A;  3ZNI D;  2O2V A;  4NY0 A;  5LXH A;  2A5U A;  4BKS D;  2J0M A;  4XZ4 A;  1OQY A;  1G6J A;  2DAJ A;  2MRP A;  4LDT D;  2D3G A;  2M1M A;  1E7U A;  2OJR A;  2UYZ B;  1P1A A;  2CS4 A;  1E8W A;  2KWV B;  5AEK B;  2MA9 B;  1V81 A;  2RD0 A;  3KVF B;  2CU1 A;  2NBU A;  3QIJ A;  4W9I A;  3ZO5 B;  2M0X A;  2O6V D;  3HHM A;  2KKC A;  3DVG Y;  2ZVN A;  5CHW A;  4EZL A;  2AYO B;  2N7D A;  2ZNV B;  3AI5 A;  2DYM A;  5LLI A;  1WM2 A;  2GBR A;  4ZRK A;  2C9W B;  4GU2 A;  4GB9 A;  3BY4 B;  3DVN U;  1GUA B;  2DYB A;  1UGM A;  1HE8 A;  2MP2 B;  4LCD E;  3OLM D;  4BKT A;  4DDG D;  2C60 A;  3QQ8 B;  2LAS A;  4IC7 B;  3EFU A;  3KYD D; 
#chains in the Genus database with same CATH topology
 1NEK B;  4BKG A;  2Y5B B;  2WXQ A;  4R3D A;  2N9X A;  2SEB D;  4RM9 A;  4BVU C;  3UIO B;  1X1M A;  1YJI A;  1KOT A;  4ZYS A;  4C4V B;  4P1B C;  3VUW A;  4FA6 A;  1TZO A;  5HKH A;  3TEY A;  2VZK D;  2GBM A;  4JQW C;  1K53 A;  2IDY A;  2FCQ A;  3R7R A;  1L4Z B;  2BVC A;  3ZJV A;  1S3S G;  2INN E;  2IBI B;  2PTL A;  1XCT L;  2KWU B;  4B95 A;  2MLB A;  3DHI C;  3RZF A;  3GOE A;  4KKJ A;  1YN5 A;  3QAR A;  1WM3 A;  4JWU C;  3K9O B;  4MT5 A;  1V5O A;  1AWD A;  4YSY B;  4N59 A;  3PSE B;  4B0E A;  4WAF A;  1GC7 A;  2C7M B;  3H7P A;  2DZJ A;  4LLG M;  5KHO A;  1OEY J;  5BYQ A;  3L08 A;  4AJY B;  2QHO A;  1E8Z A;  1PYW D;  1HTQ A;  3PVL A;  4MJS A;  3MC8 A;  1P7E A;  1TS5 A;  2XN9 C;  3TMP B;  4MAC A;  2BW2 A;  3WAO A;  3AE6 B;  2R2O A;  3ZTC A;  3T9L A;  2E3T A;  1K8R B;  1YMH E;  2DNF A;  2KXJ A;  1VR9 A;  4WUR A;  1WJU A;  1WIA A;  4GXB A;  2AQ1 B;  3AN1 A;  3JVZ X;  2LUE A;  1WYG A;  1AAR A;  1WX7 A;  3ZDT A;  2JZP A;  2WXR A;  1UEL A;  1QIL A;  1SE2 A;  1EF1 A;  4EZK A;  1KM7 A;  4HPM B;  1WR6 E;  3ENE A;  2PPH A;  1RAX A;  3PZD A;  1MPE A;  2PIA A;  2X38 A;  3W5U B;  3VXW A;  4AP4 C;  2LVP A;  3A1Q A;  2FUH B;  4RNA A;  1I4H A;  1GPX A;  1TBE A;  1EM7 A;  4C56 C;  5C2T B;  4HJK A;  4ANX A;  2D3A A;  4D2K A;  5C1Z A;  2XBB C;  2AWT A;  1M4V A;  4KX6 B;  4RMA A;  4FAD A;  3ABV B;  3O65 B;  1ZW7 A;  3C19 A;  4US8 A;  2N0S B;  1TJE A;  1EF5 A;  4HLE A;  1YD8 U;  2RMM A;  4RGT A;  2CHZ A;  1NYR A;  4MSQ B;  4US9 A;  2AQ2 B;  4IOI E;  3ETR A;  2MJ3 A;  3DOW A;  2DHZ A;  2WXF A;  2AX5 A;  3DBL I;  4GOC A;  2IO2 B;  2GBK A;  2CHW A;  3N32 A;  3WAN A;  1L0X B;  3PS6 A;  4GDL B;  1JWA D;  3ZTD A;  1J19 A;  2J53 A;  4HCP B;  5G5G A;  1F2R I;  1I4Q A;  2I1J A;  3DHG C;  3Q2A C;  1A5R A;  4ZYN A;  3LJ3 A;  1NEN B;  3FC4 A;  3P42 A;  1TS4 A;  3H1U A;  3IT4 B;  1QOA A;  1ZDX A;  2W55 A;  3R2I A;  3PHX B;  1DOY A;  2LVQ A;  3NS8 A;  3M95 A;  2KQ7 A;  3DBH I;  1VJK A;  5IP4 D;  1NBF C;  3PLV A;  5LXI B;  1LGR A;  2KAC A;  1T0Q C;  2FID A;  4HWI B;  4G3X B;  3MJW A;  2H88 B;  4DBG A;  3OG5 A;  1GJZ A;  1P7F A;  4JIO U;  2HTH A;  1IYF A;  4EOY A;  2KN4 A;  2RDH A;  4MGK E;  3RNA C;  1YN4 A;  1TKG A;  2ZPY A;  4NAW B;  4B9K A;  3NOB A;  3A4S C;  2AL6 A;  2BS2 B;  4W9D A;  2KTR A;  3L4P A;  1YQB A;  2FUG 1;  2JZZ A;  3NVZ A;  3Q8A A;  3N1Z C;  4KDI C;  1I4X A;  2JZ3 B;  4IWP A;  3MHS D;  2GLS A;  4XX5 A;  5AZH A;  1P98 A;  4LNO A;  4XC2 A;  3GP7 A;  2LJ5 A;  4W9K A;  2G4D B;  4KZ0 A;  5IO9 A;  3Q8E A;  4XWT A;  2V1Y A;  1QLB B;  3NJT A;  1SIJ A;  3PZ7 A;  3EA6 A;  4DHJ B;  1JWS D;  2FAZ A;  4IUM B;  3LDZ E;  4IWO A;  4XDC A;  1C77 A;  1H4R A;  3NS1 A;  4A3P A;  1V5T A;  5D94 A;  3GE8 C;  2LRW A;  5D3I B;  3N1Y C;  4K7S A;  4M8N A;  2KO3 A;  2D2Q A;  4TSS A;  4N58 A;  2N9E B;  3DVN V;  2AQ3 B;  3RPF C;  3TJP A;  4YTP B;  5CHF A;  1XLN A;  2WXM A;  1R4N B;  3HVD A;  3APD A;  1WX9 A;  1UWX A;  1ZOY B;  2M4N A;  2W3S A;  3KUC B;  2K39 A;  1HA5 A;  2N1W A;  2LUM A;  1CJE A;  1C79 A;  2BF8 B;  3DPD A;  1VDV A;  1ESF A;  3VH4 B;  3CWI A;  4RF0 A;  2MHJ A;  3A9K B;  2WDR B;  2KOX A;  3MTN B;  1WGY A;  4LNK A;  2IO0 B;  4G50 A;  2DWQ A;  4HEA 1;  2IO3 B;  4EE2 A;  3CMM B;  1V2Y A;  2UWQ A;  3IHP C;  3UQB A;  4OVU A;  4A3O A;  4AQ7 A;  1C4C A;  2DBY A;  4O1N A;  1WGG A;  3HRD D;  4CYE A;  3W2D A;  4II2 B;  2MJD A;  4WWN A;  2YEP F;  2ACZ B;  3TEZ A;  3MHZ A;  3ML8 A;  4OHJ A;  4HRO A;  5C3J B;  2NS5 A;  1EU3 A;  2ZVO A;  1PGX A;  2MCN B;  2CR5 A;  4EEW A;  2BGF A;  3NRZ A;  4ITK A;  3L17 A;  1E9M A;  1IGD A;  2RGF A;  3RNB C;  4MH8 A;  2Z8L A;  3A9J B;  2O2V A;  4NY0 A;  5LXH A;  4B0M A;  3P4S B;  4XZ4 A;  1OQY A;  1G6J A;  2Q5W D;  1E8W A;  2KWV B;  5AEK B;  5E6J A;  1SE4 A;  4W9I A;  4ZHO A;  4XDD A;  2M0X A;  2M56 B;  1TKY A;  1Y56 A;  3IAM 1;  2RPV A;  1WM2 A;  1FXA A;  3KQ4 A;  4CQN A;  2GBR A;  4ZRK A;  2C9W B;  3R2T A;  4ZOH C;  4DDG D;  2C60 A;  1EWY C;  2GBJ A;  1B1Z A;  4JX1 C;  2Z0D B;  3AE4 B;  2B76 B;  3DBR B;  3SDL C;  3TCA A;  4TQ0 A;  5DPT A;  1WE6 A;  3N9Y C;  5J2R A;  4S17 A;  1LM8 B;  1D5Z C;  2JXX A;  3AED B;  3PPA A;  3OJ4 B;  1Y8R C;  3KLS X;  1FXI A;  4A8X C;  3DWG C;  3ZRF A;  4BBN C;  1U4A A;  2JWZ A;  4LJO B;  2BYF A;  1WMH B;  1J7B A;  4MGY E;  2KYW A;  4ANU A;  2PEA A;  1UGJ A;  2PKO A;  3M63 B;  4GLS C;  4YTM B;  2RPQ A;  2TSS A;  1NVI D;  3QK0 A;  1E10 A;  1MHX A;  3AEC B;  2AEH A;  1WI0 A;  1WGD A;  1IP9 A;  4OZA A;  3FIL B;  2L52 A;  4DK5 A;  1TYG B;  1V1P A;  2IY1 B;  3C0R B;  5MPO A;  2O6V B;  1QOB A;  4MM3 A;  1BUI C;  2D11 A;  3AU4 A;  3E9S A;  1XLP A;  1EO6 A;  4ARI A;  2V3N A;  2KVR A;  3DBS A;  2WS3 B;  1T0R C;  1WXV A;  5D6J B;  2L8J A;  4BOS C;  2VH2 A;  1F77 A;  1WGK A;  3TL5 A;  3WAL A;  3S2A A;  2N9K A;  3TEW A;  2ZPN A;  2QJL A;  2KHW B;  2CJO A;  2NPT A;  4I6L B;  3CIR B;  1WE7 A;  3GZN B;  2RDB C;  4HKQ A;  3IT6 B;  1DOX A;  4IKG A;  3JSV B;  2KMA A;  4ANV A;  3B08 A;  3AE9 B;  3HK0 A;  4DXG A;  4FHK A;  2JXT A;  2G4S A;  4MEL A;  3P4R B;  2CKH B;  3VTW A;  3I3T B;  3PTF C;  1J8C A;  3FAH A;  1LO5 D;  4FJZ A;  1PFD A;  2OED A;  1FRD A;  1E6E B;  1EU4 A;  1LQB A;  1F2R C;  3RCZ A;  3KUZ A;  3H9D A;  4PK1 A;  2PJH A;  1ZP0 B;  4HPL B;  1GB1 A;  1RFA A;  1HTO A;  4PYZ A;  1JWU D;  4K3B A;  4MGZ E;  2YVC A;  3UIP B;  3IVF A;  3PRZ A;  2M8S A;  3ECI A;  2NBW B;  1PGB A;  5HHD G;  2NBV B;  5FR3 A;  1NI2 A;  2L7R A;  3H7S A;  2K22 A;  1ZKH A;  3HM6 X;  5JHA A;  4HJG E;  2NMQ A;  1ZUD 2;  2WP9 B;  5DCN A;  1YQ3 B;  2K0P A;  1OQR A;  4I6P A;  4M02 A;  3RMK C;  1D6E C;  4GDK B;  1PQS A;  4P7I A;  4ZHP A;  2WXL A;  1C1Y B;  3B0A A;  4RFB A;  3ZKJ C;  2LVO A;  4HVB A;  4M0W A;  3QJZ A;  2AL3 A;  1RRB A;  3KWL A;  1TIF A;  2Y5P A;  4J3O D;  2KWD A;  2MSE D;  4KIK B;  5DPS A;  3AUL A;  3URY A;  3Q3N C;  2JU6 X;  2KJR A;  4W9C A;  3JW0 X;  2GBN A;  2BYV E;  1KLV A;  1YOV B;  4WJP A;  5DPW A;  3ZRC A;  4F1S A;  4W9G A;  3BII D;  2MBB B;  3Q3M C;  2ZCC A;  3B1L X;  3PRM B;  2KC2 A;  3VQI A;  4LK0 M;  4A90 A;  3RZW C;  3IG3 A;  1R7S A;  4JWS C;  1J0G A;  4HRS A;  4DHZ E;  3RD2 A;  4NQK E;  5AZF A;  2ON8 A;  3WA0 A;  1FO4 A;  1ET6 A;  1IBX B;  5EDS A;  2N9P C;  1FD6 A;  4AUQ C;  2K9X A;  5TSS A;  4K1R B;  1TS3 A;  1ENF A;  1YJ1 A;  3L16 A;  3NZ3 A;  2R61 A;  5IKC M;  4KZC A;  3VRA B;  3KUD B;  1JRO A;  1WGH A;  1E90 A;  2J0J A;  1VZ6 A;  3SEB A;  1FEH A;  5G55 A;  3DWM A;  2GI9 A;  4Q2J A;  4OW0 A;  1V6E A;  1SSN A;  3V60 A;  4NNJ B;  2K6D B;  2WX0 A;  3L10 B;  4DXF A;  1C3T A;  2K5P A;  3MJ5 A;  3X0W A;  1AN8 A;  4N9F 4;  2M19 A;  2ZW1 A;  1R4N I;  3IXS A;  3UIN B;  4PS7 A;  1YX5 B;  3RFZ B;  2KDI A;  3WAP A;  2Z59 B;  3ZNH B;  2LZ6 A;  3RN9 C;  3E56 A;  4WWO A;  1ACC A;  1K50 A;  1JML A;  1SF0 A;  2GB1 A;  3OWE B;  3V3X A;  3BVG A;  4BBN F;  1DYQ A;  1FM0 D;  1VRA B;  2L76 A;  1C76 A;  4GIV A;  1L2N A;  1V9J A;  5BMH A;  3HM3 A;  4NJC A;  3W9C B;  4KSL C;  3ZJU A;  5JZE B;  1V49 A;  3ZNZ B;  4IG7 B;  1WGR A;  2INC C;  1FIQ A;  2ZCB A;  4IWQ A;  2LWP A;  2IY0 B;  1WJ4 A;  1J7C A;  3V61 A;  3HUI A;  3M3J A;  2KDF B;  3EUB 2;  3VFK A;  2KQS A;  4FBJ B;  3KYC D;  3Q69 A;  4J6I A;  3LB8 C;  3P63 A;  3QWZ B;  4IM2 A;  5FKA C;  1OEY A;  4LNI A;  1QF6 A;  1XT9 B;  2N7J A;  1T6B X;  2BB5 A;  3PHW B;  2ZNV C;  3ZXV A;  4LNF A;  4X57 B;  2J0K A;  4S0R A;  1CZP A;  3UF8 A;  1V97 A;  3PRP B;  1L4D B;  2M0A A;  2BKR B;  4MGI E;  3PO0 A;  5C23 A;  4PS8 A;  4MEM A;  1KLG D;  2JT4 B;  3IBE A;  2W3R A;  4EZJ A;  2MH7 A;  1V1O A;  3HVZ A;  5I4D A;  1RM6 C;  2V4L A;  3ZNG C;  2QIL A;  3AE8 B;  4DHZ B;  3SR6 A;  3MFG A;  2R2Q A;  2WXP A;  2HTM E;  4C4V A;  2KJH B;  2BBC A;  3LXF A;  1GNU A;  2YLM A;  1D3Z A;  4IW0 A;  3ZIM A;  5BMG A;  3RYT A;  2ZW0 A;  3SFD B;  3SHQ A;  4MDK E;  2LJI A;  3DHH C;  2IND C;  5BYS A;  5E6P A;  2L1A A;  3P4Q B;  5L83 A;  4BKS D;  4KGT A;  3AV8 A;  4JE3 B;  2MRP A;  4LDT D;  2INP E;  2M1M A;  1E7U A;  2OJR A;  3KVF B;  1PGA A;  2NBU A;  5H8Y E;  1FCC C;  2ZVN A;  2AYO B;  5EE1 A;  2DYM A;  2MP2 B;  4BKT A;  2LAS A;  1HXY D;  3KYD D;  1UZX B;  2DLB A;  2K25 A;  3VAW A;  1F1H A;  2HJ8 A;  1YNT E;  1KFY B;  2C7H A;  3CST A;  3U7D A;  3AE5 B;  4A55 A;  1QQR A;  4DDI D;  3ALB A;  2RSU A;  1M94 A;  3SD5 A;  4BAX A;  1C9F A;  1FXT B;  3QA8 A;  1MFW A;  2QCZ A;  3ONS A;  2N7E A;  2K3U A;  3N30 A;  1ISN A;  1N61 A;  1WJ6 A;  2DAF A;  4YXD B;  2KDE B;  5HG2 A;  3BVM A;  4E71 A;  2LFI A;  2WLB A;  2WQY B;  4OZB A;  3SFE B;  5E6N A;  2MQJ A;  2BT6 A;  4P16 A;  4FJV B;  3EHV A;  3BZD B;  3VTV A;  1F0Z A;  4HK2 A;  1WRD B;  3DBL B;  2XEW A;  5JH5 C;  1H8C A;  1L6U A;  2HD5 B;  5FR6 A;  3SU8 X;  1CK1 A;  1C4P A;  1WH3 A;  3V6C B;  2KAJ A;  3Q3F A;  4KSK C;  1XQQ A;  3BWU D;  1TS2 A;  1FNU A;  1JWB D;  1TZ1 A;  2N9L A;  5IA7 A;  1SBB B;  3TUO A;  4YT0 B;  3BYY B;  2CHX A;  4AOF A;  3GZN I;  2PE9 A;  1WR1 A;  1IUE A;  4QAY A;  3QX1 A;  2G3Q B;  1ROE A;  2V4I B;  2MBE A;  1IGC A;  1MJD A;  2WXN A;  4TQ1 A;  1BML C;  1N60 A;  5G5H A;  4OZC A;  2VH1 A;  1KRH A;  1ZGU B;  2PLP A;  2OJW A;  1GOZ A;  3CF6 E;  5EE3 A;  4GDL A;  1WXS A;  2FCS A;  4C7Z A;  3VR8 B;  5KHQ A;  1YN3 A;  3AEA B;  2BWE S;  5HI1 A;  1E7P B;  1QT9 A;  5FK9 C;  1WXA A;  4M01 A;  2BTE A;  2I38 A;  4K81 A;  4ANW A;  3RUI B;  4W9L A;  3QAQ A;  1E8X A;  3HIZ A;  3U52 E;  3ZLZ A;  1ZPS A;  2KX3 A;  3H7P B;  3CSF A;  1HEZ E;  3B2F A;  2LXA A;  3NVV A;  3RNE C;  2JWU A;  1D5X C;  4MJS B;  1WXM A;  2CJN A;  4BKS A;  4KGR A;  3ZGZ A;  2WX1 A;  1T3Q A;  3GB1 A;  1P3Q U;  3D32 A;  2WHI A;  1QKZ A;  4WJQ A;  2JPH A;  2D3C A;  2L3Z A;  3U8Z A;  4NAW A;  1RLF A;  5IOI A;  3U30 A;  2Z0E B;  4E74 A;  2RDG A;  5D3D A;  2QDF A;  4P1C C;  2DZM A;  2XK5 A;  4XE0 A;  2L05 A;  2YEP B;  1HZ6 A;  3APF A;  3P1M A;  2IGD A;  2V3P A;  3A1Q B;  1FNV A;  2FBW B;  3P4P B;  1QZE A;  2KFK A;  4KGS A;  3L54 A;  1WJN A;  4W9H A;  1L0Y B;  1KJT A;  2MW5 A;  4ZRP A;  4GGQ A;  4B6W A;  2KLG A;  4AWJ A;  2I1K A;  2QC8 A;  3KW5 B;  2DZI A;  2JY6 A;  4NQL B;  3J9C A;  5CHV C;  3WIM A;  3EC8 A;  1MI0 A;  2KDM A;  3NG0 A;  3T3N A;  1V80 A;  1YQ4 B;  1KH0 A;  3R3M A;  1L5P A;  2LEK A;  2G9H D;  2LGD A;  2NCN A;  2W82 A;  1VZ7 A;  2J52 A;  5EE0 A;  1R4M B;  2KX0 A;  4WWP A;  1UWM A;  4HKZ E;  4G11 A;  2LRU A;  3ZXR A;  4ZDV A;  1ZDV A;  1P9D U;  3K9P B;  2RR9 A;  3PLU A;  2GOW A;  2MX2 A;  2PW9 A;  2A4Z A;  3O13 A;  2WDQ B;  4MH0 E;  1WSP A;  4URK A;  1FCL A;  1UUP A;  2VZK B;  4JPS A;  3TBL D;  3A9K A;  3W1S C;  3W1S A;  1WZ0 A;  2KTF A;  3BYT B;  4WJN A;  1FRR A;  4FLH A;  3EGR A;  2EMS A;  4NPN A;  4JL9 A;  2N4F A;  4W9E A;  4A6Q A;  2KDB A;  2GMI C;  2LHE A;  3X23 A;  4G0N B;  1MG8 A;  4WJO A;  1FPY A;  4FJY A;  3AE1 B;  4II3 B;  3AE7 B;  1PDX A;  2CU3 A;  1EWC A;  1K51 A;  4N6E B;  3Q8F A;  2KTR B;  5IAA C;  2BPS A;  1TGZ B;  2L0F A;  1VLB A;  3M62 B;  4YL8 A;  4GMV A;  3ZQ4 A;  3R66 C;  5D7G A;  1TT5 B;  5H92 C;  1OFF A;  3I63 C;  2WDV B;  3AEE B;  4KKI A;  4RGO S;  3V62 A;  2HJ1 A;  2PVG C;  4JLC A;  1L0V B;  2LGI A;  1JCK B;  2JYT A;  2WXG A;  3A9J A;  4PS3 A;  4EKU A;  1YIW A;  2JRI B;  3VVW B;  3AE2 B;  4YWG G;  2PE6 B;  1MVK A;  2ASQ A;  2L32 A;  2V0G A;  1I35 A;  5LNK 1;  2M17 A;  2JVC A;  2WWZ A;  3ML9 A;  2IGG A;  1SIF A;  3PGE A;  4ACF A;  1XF5 L;  2KK8 A;  2J7Q B;  2K8B A;  3VH3 B;  5BO4 B;  2BS3 B;  1CQV A;  4MSM B;  3T3O A;  1SGH A;  2NTT A;  2WXJ A;  1B9R A;  1ZXI A;  1KF6 B;  2WU5 B;  1N5X A;  3WCQ A;  4BOZ B;  4ICV A;  3AU5 A;  2X8X X;  4DQO C;  1UF0 A;  2DYO A;  3BK1 A;  4I6N B;  2ZZP B;  4M00 A;  2REX A;  2V9H A;  4CO7 A;  1A70 A;  3DVG X;  1UNS A;  1T0S C;  4OVV A;  5CX3 A;  2LHD A;  2HDE A;  4CHK A;  1XEE A;  1LXD A;  3Q3O C;  3QC8 B;  1JRP A;  3UGB B;  3T8M A;  3NVY A;  2OHF A;  4IM0 A;  4PYU A;  3RUL A;  1WMH A;  3ZNI D;  2A5U A;  2J42 A;  2J0M A;  1C4A A;  3BVZ A;  2DAJ A;  2D3G A;  1JAL A;  1SXT A;  5JXV A;  1T5X D;  5T8I A;  4RH6 A;  1D4B A;  2MA9 B;  2RD0 A;  3Q14 C;  3QIJ A;  4ARC A;  2KKC A;  3DVG Y;  4EZL A;  2FE8 A;  3U7Z A;  2N7D A;  5LLI A;  3AEG B;  3MC9 A;  4GU2 A;  3BY4 B;  3DVN U;  1UGM A;  1HE8 A;  3N1X C;  4WIP A;  3QQ8 B;  4IC7 B;  2KMM A;  3EFU A;  3U4E G;  4IDI A;  1WZ3 A;  2WXK A;  3RNC C;  1N62 A;  4K3C A;  1NYQ A;  4F8C B;  1RFK A;  2IJ0 A;  2FCM A;  3FIL A;  5HFY A;  1WX8 A;  2J4X A;  3VUY A;  4KVG B;  4GSW A;  2O6V A;  3ZJT A;  2FNJ B;  1SJE D;  4NZL B;  1PUT A;  4EFO A;  4NJ6 A;  1K52 A;  1I4R A;  2QSD A;  3VR9 B;  3ZVV A;  2EMT A;  1WRI A;  4K7W A;  2E6X A;  2W54 A;  4YTN B;  5L95 C;  1KLU D;  3TIX A;  1YJJ A;  2MJE A;  3R8B A;  2O2V B;  2BYE A;  4HPP A;  1NI3 A;  1VD2 A;  3VTU A;  3W5V B;  3ZYY X;  1FFU A;  3NZU A;  4IM3 A;  2KT7 A;  1I42 A;  4LJP B;  2NVU I;  3AE3 B;  2KMC A;  5E6O A;  2WYQ A;  3JSV A;  3NZS A;  2K8C A;  2ICI A;  1XO3 A;  1SJH D;  3B2G A;  3UQA A;  2Y3A A;  1JWM D;  2UU7 A;  2WGS A;  2JUO A;  2G45 B;  2WXI A;  3JYU A;  3BIN A;  1UBQ A;  3TSS A;  4JGH B;  2LXC A;  1P0R A;  1Q5W B;  2EEL A;  4ZRQ A;  4LDT B;  2C5L C;  5AUK A;  4USA A;  1FFV A;  1S1Q B;  2ZJD A;  1XD3 B;  3KH0 A;  3P2B A;  4FHJ A;  1I7H A;  2DX5 B;  2LMC A;  3A33 B;  2JF5 A;  1RWS A;  4HCN B;  2XK5 B;  4RF1 A;  2WU2 B;  1XCQ L;  3BK2 A;  4M8M A;  3DBR I;  1KTK A;  1UH6 A;  3PT2 B;  5TR5 A;  3RNF C;  4RCO A;  4GDK A;  4YSZ B;  1I4P A;  4HXD A;  3LYY A;  2WDT B;  4EUT A;  2KFK B;  1L6V A;  4NAM A;  3IFW B;  5JHB A;  4UDU C;  2D07 B;  1FMA D;  4TV3 A;  5CTR C;  2KZR A;  2KQ4 X;  4KIK A;  2JSV X;  5D2M B;  5AZG A;  3OAW A;  1CMX B;  1TY2 A;  3H8H A;  2KD0 A;  3L13 A;  4KV2 A;  3TEX A;  4A20 A;  3QCA A;  3QHT A;  2B3A A;  1HZ5 A;  3ZUN A;  1V1P B;  5DPR A;  3AEB B;  3A4R A;  1AW7 A;  3APC A;  1DGJ A;  2BB6 A;  3VDZ A;  3ZDM C;  2ZEQ A;  4REZ A;  1OTR B;  2IPK D;  2K6Q A;  3VHT C;  4HDQ A;  4E3C A;  1UBI A;  4MM3 B;  4XWW A;  3WAM A;  2KWC A;  2I2Y A;  1HQR D;  1JRU A;  1OQQ A;  1Z2M A;  2V3S A;  2BKF A;  2MBO A;  1DOI A;  2OOB B;  4P6V F;  2MBQ A;  4DHJ D;  1EUV B;  3EFC A;  1IBX A;  1MHH E;  4TMA B;  2QMT A;  3NHE B;  2JYE A;  2KAN A;  3VRB B;  2NPT B;  3MP9 A;  3PRE A;  3DQV A;  3VUX A;  1TY0 A;  4RGM A;  3I57 A;  2NR2 A;  1IPG A;  2QEJ C;  3Q8B A;  2WNM A;  1TTN A;  2IGH A;  4F7Z A;  5BMI A;  2FCN A;  3NUH B;  2IO1 B;  2DEN B;  1STE A;  1R4M I;  1J7A A;  4WQM A;  1F52 A;  2WXO A;  4BZA A;  1WF9 A;  2K1F A;  3AMZ A;  3AEF B;  1AYF A;  3I5J C;  4DXA B;  2D3B A;  2LGY A;  4LTU A;  4BFR A;  1I4G A;  4HDO A;  4L2Y A;  3Q6B A;  1RYJ A;  4TKN A;  1C78 A;  4RGN A;  3AB5 A;  3N20 C;  4W9J A;  1MG4 A;  4FUL A;  1L7Y A;  4OVZ A;  2LGS A;  2JX5 A;  3DBH B;  4C7Y A;  5IN7 A;  1OGW A;  3RNG C;  5BYR A;  3OJ3 A;  4FXC A;  3R7Q A;  2EKE C;  2Y5C A;  1JW9 D;  2PVO D;  4ICU A;  1GC6 A;  3Q8C A;  1UD7 A;  2IZV B;  3PZ8 A;  4C80 A;  3NVW A;  4WAA A;  4WQO B;  1FNW A;  1YX6 B;  4M0W B;  1V86 A;  5GMV A;  3EEC A;  2KLC A;  3AXC A;  2N1V A;  1Z5S B;  1LFD A;  3B9J A;  3L0W B;  4K7U A;  1SEB D;  1XXG A;  1E7V A;  1WWT A;  3N3K B;  4ASW C;  1ZE3 D;  2LI5 A;  3U2S C;  1JQ4 A;  1BXT A;  2KN5 A;  3GS2 A;  1SB3 C;  1QOF A;  4FN2 A;  1E5W A;  1GG3 A;  4A9A A;  4L23 A;  1WYW B;  3DDC B;  1VCB A;  1N5W A;  2LD9 A;  2VRR B;  2G1E A;  3KWV A;  2MEK A;  3RI7 C;  2LGX A;  4GN1 A;  4PT5 A;  5G2N A;  2KFJ A;  4XGA B;  3FKY A;  2K8H A;  4C00 A;  1BT0 A;  1SE9 A;  4NJ7 A;  3W1Y A;  3UI3 A;  2D5G A;  3MC0 B;  5GXG B;  2D10 A;  2GRI A;  2NTS A;  3ZW3 A;  4H2A A;  5J17 A;  1WXQ A;  1ZXH A;  3RT3 B;  3NY5 A;  1SE3 A;  4RM8 A;  1N63 A;  2HE7 A;  1Q1O A;  3PV1 A;  4AJW A;  4LNN A;  3AH7 A;  3I9V 1;  3H6N A;  2PMV A;  1ET9 A;  1V8C A;  2KC1 A;  1T0Y A;  1Q0W B;  1F9J A;  3C8Y A;  2MBH A;  2WXH A;  4XYC A;  4DWF A;  2KJ6 A;  2ONQ A;  2JQR B;  1E8Y A;  2L00 B;  2MP2 A;  3V05 A;  1D5M C;  3Q3J A;  1WFY A;  2W9N A;  2FIF A;  2MWS B;  2BQQ A;  2QIE B;  2KNB A;  2XNA C;  5AUI A;  4ZRJ A;  2C7N B;  4W9F A;  1QOG A;  2JRH A;  3V6E B;  2DZK A;  4L1B A;  2IYD B;  1XLQ A;  2BWF A;  3IAS 1;  1GB4 A;  1NDD A;  2SAK A;  2L83 A;  1GAQ B;  2KVZ A;  2BS4 B;  1E0Z A;  1VZ8 A;  2H89 B;  3DCG A;  4ZRI A;  2L0T A;  5J18 A;  4KDL B;  4TUU A;  3AM9 A;  1WY8 A;  1Q10 A;  4YSX B;  2BYT A;  2UYZ B;  4WWM A;  1P1A A;  2CS4 A;  1V81 A;  2EKI A;  1N6Z A;  3GE3 C;  2CU1 A;  3ZO5 B;  2O6V D;  3HHM A;  5EE9 A;  5CHW A;  2ZNV B;  4AS1 A;  3AI5 A;  4WH4 A;  1TKE A;  4GB9 A;  1GUA B;  2DYB A;  4LCD E;  3OLM D;  1XLO A; 
#chains in the Genus database with same CATH homology
 1WZ3 A;  4BKG A;  2Y5B B;  2Z0D B;  1UZX B;  4F8C B;  3SDL C;  2N9X A;  2K25 A;  4RM9 A;  3TCA A;  2FCM A;  3VAW A;  4BVU C;  4TQ0 A;  3UIO B;  1WX8 A;  3VUY A;  5DPT A;  1WE6 A;  1X1M A;  5J2R A;  2HJ8 A;  4KVG B;  1KOT A;  1LM8 B;  2C7H A;  3CST A;  3U7D A;  4GSW A;  3VUW A;  4DDI D;  4FA6 A;  2O6V A;  2JXX A;  3PHX B;  3ALB A;  2FNJ B;  5HKH A;  2RSU A;  3PPA A;  1M94 A;  3OJ4 B;  3SD5 A;  2GBM A;  1Y8R C;  4EFO A;  4JQW C;  4NJ6 A;  2FCQ A;  1FXT B;  3QA8 A;  3ZVV A;  3ZRF A;  2EMT A;  4BBN C;  3ONS A;  1U4A A;  4K7W A;  3R7R A;  2N7E A;  2JWZ A;  3N30 A;  1ISN A;  1S3S G;  5L95 C;  4LJO B;  1WJ6 A;  2DAF A;  2BYF A;  2IBI B;  2KDE B;  3TIX A;  1WMH B;  2O2V B;  2BYE A;  1VD2 A;  2KWU B;  4MGY E;  2MLB A;  3VTU A;  4B95 A;  4E71 A;  3RZF A;  3GOE A;  4ANU A;  2PEA A;  3NZU A;  4IM3 A;  3M63 B;  5E6N A;  3QAR A;  1I42 A;  4LJP B;  1WM3 A;  2MQJ A;  2NVU I;  3K9O B;  1V5O A;  2KMC A;  2RPQ A;  2WYQ A;  3JSV A;  4FJV B;  3NZS A;  5E6O A;  3EHV A;  2K8C A;  3PSE B;  3UQA A;  1GC7 A;  2C7M B;  3VTV A;  3H7P A;  4HK2 A;  1WRD B;  3QK0 A;  2XEW A;  2JUO A;  2G45 B;  5JH5 C;  1H8C A;  2DZJ A;  3JYU A;  2AEH A;  2HD5 B;  3BIN A;  1WI0 A;  5FR6 A;  5KHO A;  1UBQ A;  1OEY J;  3L08 A;  3SU8 X;  4AJY B;  2QHO A;  1E8Z A;  1WH3 A;  3PVL A;  4JGH B;  4MJS A;  3V6C B;  3Q3F A;  1WGD A;  1IP9 A;  2LXC A;  1P0R A;  1Q5W B;  4KSK C;  1XQQ A;  3TMP B;  3WAO A;  1TZ1 A;  4LDT B;  2R2O A;  2C5L C;  3T9L A;  3ZTC A;  4DK5 A;  5IA7 A;  1K8R B;  2IY1 B;  1S1Q B;  2ZJD A;  3C0R B;  1XD3 B;  2CHX A;  4AOF A;  3GZN I;  2O6V B;  2PE9 A;  1WR1 A;  2KXJ A;  3KH0 A;  4MM3 A;  1WJU A;  2D11 A;  3P2B A;  1WIA A;  3QX1 A;  4FHJ A;  4GXB A;  2DX5 B;  2G3Q B;  3AU4 A;  3JVZ X;  2LUE A;  1AAR A;  2MBE A;  2JF5 A;  3A33 B;  4TQ1 A;  1EO6 A;  1WX7 A;  3ZDT A;  1UEL A;  1EF1 A;  4EZK A;  1KM7 A;  2KVR A;  3DBS A;  4HCN B;  4HPM B;  1WR6 E;  3ENE A;  2PPH A;  1WXV A;  2XK5 B;  1RAX A;  1ZGU B;  5D6J B;  2L8J A;  4BOS C;  3PZD A;  3CF6 E;  4GDL A;  4M8M A;  1WXS A;  3TL5 A;  3WAL A;  3S2A A;  3DBR I;  2ZPN A;  2FCS A;  1UH6 A;  3PT2 B;  3VXW A;  5TR5 A;  4AP4 C;  2KHW B;  2NPT A;  2GBJ A;  2LVP A;  4GDK A;  4I6L B;  5KHQ A;  2BWE S;  1WE7 A;  3A1Q A;  2FUH B;  4HXD A;  1WXA A;  4K81 A;  4ANW A;  3JSV B;  2KMA A;  2WDT B;  1TBE A;  4W9L A;  3QAQ A;  3B08 A;  1E8X A;  3HIZ A;  3RUI B;  4ANV A;  2KFK B;  3HK0 A;  4EUT A;  4FHK A;  2G4S A;  3ZLZ A;  4MEL A;  2KX3 A;  3H7P B;  3CSF A;  3IFW B;  5JHB A;  2D07 B;  4HJK A;  4ANX A;  2CKH B;  5C1Z A;  4TV3 A;  2LXA A;  2KZR A;  5CTR C;  3VTW A;  3I3T B;  4KIK A;  2XBB C;  3PTF C;  1J8C A;  2AWT A;  5D2M B;  5AZG A;  4MJS B;  1WXM A;  4FJZ A;  3OAW A;  1CMX B;  4RMA A;  4BKS A;  4FAD A;  1LQB A;  2KD0 A;  3L13 A;  4KV2 A;  4A20 A;  3QCA A;  3QHT A;  3O65 B;  3RCZ A;  2WX1 A;  2B3A A;  1ZW7 A;  3KUZ A;  3H9D A;  3ZUN A;  1P3Q U;  3D32 A;  5DPR A;  1EF5 A;  4HLE A;  1YD8 U;  2PJH A;  3A4R A;  2CHZ A;  4WJQ A;  3APC A;  2JPH A;  4MSQ B;  3VDZ A;  3ZDM C;  2L3Z A;  2ZEQ A;  4HPL B;  3U8Z A;  1RFA A;  4NAW A;  1RLF A;  4PYZ A;  1OTR B;  4E3C A;  2K6Q A;  3VHT C;  4HDQ A;  3U30 A;  1UBI A;  2Z0E B;  3WAM A;  2KWC A;  4MGZ E;  4E74 A;  2YVC A;  3DOW A;  3UIP B;  2DHZ A;  3IVF A;  3PRZ A;  2M8S A;  3ECI A;  2NBW B;  1JRU A;  1Z2M A;  2V3S A;  2DZM A;  3DBL I;  2BKF A;  2NBV B;  2MBO A;  4GOC A;  2OOB B;  1NI2 A;  2MBQ A;  2L7R A;  2XK5 A;  3H7S A;  1EUV B;  4DHJ D;  1ZKH A;  3HM6 X;  5JHA A;  2IO2 B;  2GBK A;  2L05 A;  2CHW A;  3N32 A;  3WAN A;  3PS6 A;  4GDL B;  3APF A;  3ZTD A;  1J19 A;  4HCP B;  5DCN A;  3NHE B;  2I1J A;  2KAN A;  4I6P A;  2NPT B;  1A5R A;  4GDK B;  4ZYN A;  1PQS A;  3PRE A;  3DQV A;  3LJ3 A;  4P7I A;  3VUX A;  3A1Q B;  2NR2 A;  1IPG A;  1C1Y B;  3B0A A;  3H1U A;  1TTN A;  3ZKJ C;  1QZE A;  2KFK A;  2LVO A;  4HVB A;  3L54 A;  4F7Z A;  2FCN A;  2IO1 B;  1WJN A;  2AL3 A;  2DEN B;  1KJT A;  1RRB A;  2LVQ A;  2MW5 A;  3NS8 A;  1R4M I;  3M95 A;  4W9H A;  2KQ7 A;  3DBH I;  4GGQ A;  4B6W A;  2KLG A;  1NBF C;  3PLV A;  2I1K A;  4AWJ A;  5LXI B;  2MSE D;  1WF9 A;  4KIK B;  2K1F A;  2FID A;  3KW5 B;  2DZI A;  2JY6 A;  4HWI B;  5DPS A;  4G3X B;  3AUL A;  3MJW A;  4NQL B;  4DBG A;  2KJR A;  4DXA B;  4W9C A;  3JW0 X;  2LGY A;  2GBN A;  2BYV E;  1KLV A;  5CHV C;  4BFR A;  4HDO A;  3WIM A;  3EC8 A;  4WJP A;  1GJZ A;  4JIO U;  4TKN A;  2HTH A;  1IYF A;  4EOY A;  5DPW A;  3ZRC A;  4F1S A;  1V80 A;  4MGK E;  4W9G A;  4W9J A;  2ZPY A;  2MBB B;  3R3M A;  4FUL A;  2ZCC A;  4NAW B;  2LGD A;  2NCN A;  4B9K A;  3B1L X;  3NOB A;  3A4S C;  1L7Y A;  3PRM B;  2KC2 A;  3VQI A;  2AL6 A;  4W9D A;  3RZW C;  2KX0 A;  2KTR A;  3IG3 A;  4WWP A;  1YQB A;  1J0G A;  2JZZ A;  1OGW A;  4DHZ E;  3RD2 A;  4NQK E;  4KDI C;  5AZF A;  3WA0 A;  2JZ3 B;  4G11 A;  4IWP A;  2LRU A;  3MHS D;  3OJ3 A;  5EDS A;  2N9P C;  4XX5 A;  3R7Q A;  4ZDV A;  4AUQ C;  5AZH A;  1P98 A;  4XC2 A;  4K1R B;  1P9D U;  3K9P B;  2EKE C;  1YJ1 A;  2RR9 A;  3L16 A;  3PLU A;  2GOW A;  2MX2 A;  2A4Z A;  2LJ5 A;  4KZC A;  4W9K A;  2G4D B;  4ICU A;  1GC6 A;  4KZ0 A;  1UD7 A;  4MH0 E;  2IZV B;  3KUD B;  4URK A;  4WAA A;  4WQO B;  1WGH A;  1E90 A;  1YX6 B;  2J0J A;  3TBL D;  4M0W B;  1V86 A;  2V1Y A;  5GMV A;  5G55 A;  3EEC A;  2KLC A;  3A9K A;  3AXC A;  1V6E A;  2N1V A;  1Z5S B;  3V60 A;  3W1S C;  1LFD A;  3W1S A;  3L0W B;  1WZ0 A;  2KTF A;  4NNJ B;  4DHJ B;  2K6D B;  2FAZ A;  2WX0 A;  3L10 B;  4K7U A;  1C3T A;  4WJN A;  4IUM B;  4FLH A;  3LDZ E;  3X0W A;  1E7V A;  4IWO A;  3N3K B;  4N9F 4;  1H4R A;  4A3P A;  4ASW C;  2EMS A;  4NPN A;  1R4N I;  2N4F A;  4JL9 A;  1V5T A;  4W9E A;  5D94 A;  3UIN B;  2KDB A;  4PS7 A;  1YX5 B;  2LI5 A;  2KN5 A;  2KDI A;  2GMI C;  3X23 A;  4G0N B;  3WAP A;  1MG8 A;  4WJO A;  2Z59 B;  2LRW A;  3ZNH B;  4FN2 A;  4FJY A;  1E5W A;  1GG3 A;  2LZ6 A;  4II3 B;  4K7S A;  4WWO A;  1WYW B;  3DDC B;  4M8N A;  2KO3 A;  1VCB A;  2D2Q A;  2LD9 A;  2VRR B;  2N9E B;  4BBN F;  3DVN V;  2KTR B;  2L76 A;  5IAA C;  2BPS A;  1TGZ B;  4GIV A;  3TJP A;  1L2N A;  2L0F A;  1V9J A;  5CHF A;  2LGX A;  4GN1 A;  5G2N A;  2KFJ A;  3M62 B;  4YL8 A;  4GMV A;  3HM3 A;  4KSL C;  3APD A;  2K8H A;  3R66 C;  1WX9 A;  5JZE B;  2M4N A;  5D7G A;  1BT0 A;  1SE9 A;  4NJ7 A;  1V49 A;  3KUC B;  3W1Y A;  4IG7 B;  3ZNZ B;  2K39 A;  1WGR A;  2D10 A;  2N1W A;  3V62 A;  3ZW3 A;  2ZCB A;  4IWQ A;  5J17 A;  4JLC A;  2BF8 B;  2LWP A;  3DPD A;  2IY0 B;  1WJ4 A;  3RT3 B;  3A9J A;  3NY5 A;  4PS3 A;  4EKU A;  1YIW A;  3VH4 B;  2JRI B;  3V61 A;  3M3J A;  3VVW B;  2KDF B;  3VFK A;  2KQS A;  2PE6 B;  3A9K B;  4RM8 A;  4FBJ B;  2KOX A;  3MTN B;  3KYC D;  1WGY A;  4J6I A;  2ASQ A;  2HE7 A;  1Q1O A;  3PV1 A;  4AJW A;  3QWZ B;  2IO0 B;  4IM2 A;  4G50 A;  1I35 A;  2M17 A;  2JVC A;  2WWZ A;  3H6N A;  1OEY A;  3ML9 A;  1XT9 B;  2KC1 A;  1SIF A;  3PGE A;  1T0Y A;  1Q0W B;  1F9J A;  2IO3 B;  3PHW B;  2ZNV C;  2KK8 A;  3CMM B;  4X57 B;  1V2Y A;  2J0K A;  2MBH A;  2UWQ A;  4DWF A;  2J7Q B;  2K8B A;  2KJ6 A;  3UF8 A;  3QJZ A;  3VH3 B;  3PRP B;  1E8Y A;  3IHP C;  3UQB A;  2L00 B;  4OVU A;  5BO4 B;  2BKR B;  2MP2 A;  4MGI E;  5C23 A;  4MSM B;  4PS8 A;  3Q3J A;  4MEM A;  2JT4 B;  3IBE A;  1WFY A;  4A3O A;  2W9N A;  1SGH A;  2FIF A;  2MWS B;  2KNB A;  4EZJ A;  1WGG A;  2C7N B;  4ZRJ A;  4CYE A;  2V4L A;  4II2 B;  4W9F A;  3ZNG C;  2JRH A;  4WWN A;  4DHZ B;  3V6E B;  2DZK A;  2R2Q A;  2IYD B;  3ML8 A;  4BOZ B;  4ICV A;  3AU5 A;  2BWF A;  2KJH B;  2NS5 A;  2DYO A;  1NDD A;  4I6N B;  2ZZP B;  2REX A;  4CO7 A;  2ZVO A;  1GNU A;  2YLM A;  2MCN B;  3DVG X;  2CR5 A;  3DCG A;  1D3Z A;  4EEW A;  4OVV A;  5CX3 A;  2BGF A;  4ZRI A;  2L0T A;  4IW0 A;  5J18 A;  3L17 A;  3ZIM A;  4CHK A;  4KDL B;  1LXD A;  3QC8 B;  3RYT A;  3UGB B;  3T8M A;  4TUU A;  3SHQ A;  2RGF A;  4IM0 A;  4MDK E;  1WY8 A;  4PYU A;  3A9J B;  5E6P A;  3RUL A;  5L83 A;  1WMH A;  3ZNI D;  2O2V A;  4NY0 A;  5LXH A;  2A5U A;  4BKS D;  2J0M A;  4XZ4 A;  1OQY A;  1G6J A;  2DAJ A;  2MRP A;  4LDT D;  2D3G A;  2M1M A;  1E7U A;  2OJR A;  2UYZ B;  1P1A A;  2CS4 A;  1E8W A;  2KWV B;  5AEK B;  2MA9 B;  1V81 A;  2RD0 A;  3KVF B;  2CU1 A;  2NBU A;  3QIJ A;  4W9I A;  3ZO5 B;  2M0X A;  2O6V D;  3HHM A;  2KKC A;  3DVG Y;  2ZVN A;  5CHW A;  4EZL A;  2AYO B;  2N7D A;  2ZNV B;  3AI5 A;  2DYM A;  5LLI A;  1WM2 A;  2GBR A;  4ZRK A;  2C9W B;  4GU2 A;  4GB9 A;  3BY4 B;  3DVN U;  1GUA B;  2DYB A;  1UGM A;  1HE8 A;  2MP2 B;  4LCD E;  3OLM D;  4BKT A;  4DDG D;  2C60 A;  3QQ8 B;  2LAS A;  4IC7 B;  3EFU A;  3KYD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...