2C60A

Crystal structure of human mitogen-activated protein kinase kinase kinase 3 isoform 2 phox domain at 1.25 a resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
85
Chain Sequence
b'GTENLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 3 ISOFO
molecule tags Transferase
source organism Homo sapiens
publication title Crystal Structure of Human Mitogen-Activated Protein Kinase Kinase Kinase 3 Isoform 2 Fox Domain at 1.25 A Resolution
rcsb
total genus 20
structure length 85
sequence length 96
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c60A01
3CSFA 3APCA 1WZ3A 4GDKA 3ZRCA 1U4AA 1YJ1A 4TUUA 1BT0A 5IA7A 1EO6A 1UBQA 2D11A 1WJUA 3C0RB 1MG8A 3UGBB 4RM9A 4GDKB 4TV3A 2L76A 2KC2A 5CTRC 2M4NA 2I1KA 2IO2B 2K8CA 4NJ6A 3WANA 3W1SC 2M8SA 1ZW7A 4NAWA 3LDZE 2DAJA 4B6WA 2JRHA 2KNBA 1WX9A 4GOCA 2BKRB 1GNUA 1TGZB 3UIPB 2KJ6A 2KTFA 5C1ZA 4HWIB 2L0FA 2K6QA 1WX8A 1KOTA 2KWUB 5JHAA 2MBBB 4W9CA 3RZFA 2KX3A 2HJ8A 2AWTA 2KDIA 1CMXB 1E5WA 2A5UA 2KLGA 2MW5A 4GGQA 3ZW3A 2UWQA 3A9KA 2IO0B 3PS6A 3PRZA 3VFKA 2M17A 3PVLA 2LWPA 4K81A 1YIWA 3H1UA 4JL9A 3A9KB 2JZZA 1VCBA 1WGRA 3A9JB 1XD3B 2D3GA 1WGHA 2LVQA 2DYBA 3NZUA 2L05A 2OOBB 3DVNV 3UINB 4CHKA 2K1FA 2AYOB 2MSED 2PJHA 3PREA 4WJNA 3S2AA 3T9LA 3ZIMA 1XQQA 2QHOA 3RULA 3VXWA 2L8JA 4HPLB 4W9GA 2BF8B 3L13A 1T0YA 1V6EA 4I6LB 4EZLA 3R7RA 5JH5C 2KANA 4IC7B 1FXTB 4WJQA 1WMHA 2GBNA 2BGFA 4MJSB 3A33B 1WJ4A 4HCNB 1TZ1A 4BVUC 2B3AA 1ISNA 1EF1A 3CF6E 1E7VA 4IM3A 4K7WA 2IY1B 2KJRA 3DVGY 3K9PB 4DHJB 3VUWA 1TTNA 5HKHA 4W9LA 3H7PB 2MBHA 1ZGUB 2KMCA 4FJYA 3VTVA 2OJRA 3DVNU 4A3PA 1WXAA 1WIAA 2K8HA 2BWES 3TIXA 1WE7A 3ZO5B 1YX6B 2EMSA 2KMAA 5LXHA 2JRIB 3KYDD 2DX5B 3DCGA 4HJKA 2N9EB 1WRDB 4KSLC 5CHVC 1LXDA 1RFAA 1IYFA 3DBRI 4GDLA 4KVGB 4BBNF 2EMTA 5CHWA 4BOSC 1ZKHA 3Q3JA 3RYTA 3W1YA 3A4RA 1OEYJ 3VTWA 3M62B 3QJZA 5DPRA 1WE6A 2CHZA 2BYVE 3PTFC 4II3B 2JF5A 2MLBA 1QZEA 2I1JA 3MJWA 3HM6X 5J17A 2MBQA 3CSTA 3A4SC 2HD5B 1UZXB 4AWJA 3VHTC 3JSVB 1WY8A 2YLMA 4E74A 3UF8A 2KTRB 3QQ8B 4IWQA 3DBSA 2K39A 1Z2MA 2WX1A 1WR6E 4LDTD 5FR6A 1F9JA 2LASA 1PQSA 5J2RA 2L00B 3QCAA 2V1YA 4KDLB 4DK5A 3PLVA 3WA0A 1YX5B 4HDOA 1S1QB 2UYZB 1V49A 2Z0EB 2D10A 3EECA 4JIOU 4RMAA 4B9KA 1J19A 4G3XB 1OGWA 3RZWC 1RLFA 4ANWA 4KZCA 2REXA 4ANUA 3WAOA 4DXAB 2CHWA 2KKCA 1EF5A 3EFUA 4WJOA 4FULA 5DPWA 4E71A 2ZJDA 2Z0DB 3PLUA 4FLHA 4BBNC 2KLCA 2BYEA 3V62A 1P1AA 2CS4A 4F7ZA 3ZDMC 3RCZA 1LQBA 3DPDA 4IWPA 1WZ0A 2GOWA 2M1MA 2N9PC 2LI5A 2C7NB 4KDIC 2J0MA 3H6NA 5D2MB 1D3ZA 4IG7B 4HDQA 3NHEB 4ANXA 2KO3A 3SHQA 4MM3A 4DHZB 5KHQA 1E7UA 4ZDVA 5IAAC 2C60A 3BY4B 1V5OA 3ZRFA 1V81A 2M0XA 5DCNA 3V61A 4GB9A 5TR5A 4DBGA 2KWCA 1GG3A 4DHZE 3VQIA 3A1QB 1RAXA 2JVCA 4LDTB 3QARA 3DOWA 2DZMA 2KJHB 3NOBA 4B95A 4NQLB 3KUCB 3L54A 3N30A 2NVUI 2MP2B 1WXSA 2CHXA 3ECIA 3R66C 4J6IA 4BOZB 1UH6A 3QK0A 4W9HA 1OTRB 2XEWA 2J0JA 2L0TA 4WWOA 2N1WA 4MGKE 4NJ7A 3L08A 3JVZX 1Q0WB 2KX0A 2Z59B 3IBEA 1E8ZA 1NBFC 2LUEA 2LGDA 4NY0A 4X57B 4ZRJA 2LVOA 4M8MA 4W9JA 1M94A 4WJPA 3VH4B 2MRPA 5CHFA 4EFOA 2GMIC 4KSKC 1YQBA 2PPHA 4DDID 3X23A 2N9XA 2O2VB 3LJ3A 4AOFA 4LJOB 2KDBA 3K9OB 2KXJA 4AUQC 2CKHB 4NQKE 3VUYA 3T8MA 2K25A 1UELA 3IHPC 3ZLZA 5G55A 1AARA 3HIZA 4K7SA 3ZNHB 2MWSB 4BKTA 2FIFA 3N32A 3AULA 2HTHA 4BKSA 3GZNI 3SDLC 1XT9B 4PS8A 2R2OA 3WALA 2AL3A 1E8WA 4IM2A 4WAAA 4W9FA 3OLMD 4II2B 2ZZPB 2NPTA 4RM8A 4W9IA 3OJ3A 2IBIB 2LGYA 5AZHA 4MSMB 3BINA 1GC6A 3P2BA 5L95C 4I6PA 3KUZA 2C9WB 3WIMA 4HPMB 2G3QB 2RD0A 5AZGA 3TJPA 2NR2A 1RRBA 2YVCA 3ML9A 4GU2A 4JGHB 2AEHA 2A4ZA 4GDLB 3KVFB 5JZEB 1C3TA 4HK2A 4P7IA 2BKFA 4AP4C 3H7SA 1J0GA 2AL6A 2LVPA 1WGYA 2KFKA 5DPSA 2WWZA 3B0AA 3A1QA 4F1SA 3V6CB 1SE9A 1E90A 2KDEB 1WF9A 5DPTA 2JXXA 2KQSA 3Q3FA 2ZNVB 2K6DB 2RSUA 1GJZA 2FCSA 4TQ1A 4M0WB 3TL5A 1WM3A 2NCNA 3CMMB 3JSVA 4TKNA 1VD2A 1WX7A 3EHVA 4HLEA 3APFA 1Q5WB 4EEWA 1WFYA 3ML8A 2GBKA 3HHMA 5EDSA 2N7EA 2MCNB 1WJNA 2ZPYA 1HE8A 3ALBA 1E8XA 1Y8RC 2O6VA 4PS7A 3DVGX 1X1MA 5L83A 2ZPNA 3N3KB 4FBJB 2J0KA 4XX5A 2BWFA 4FJVB 2ZCCA 4PYUA 1TBEA 2IZVB 2C7HA 3V60A 1JRUA 2KVRA 4GSWA 3VVWB 3TCAA 2L3ZA 4FHKA 4MEMA 3PV1A 4EZKA 5BO4B 3KYCD 3ZTDA 4NPNA 3SU8X 2FCNA 4PS3A 2LD9A 4XZ4A 2WDTB 5D94A 3TMPB 4K1RB 4K7UA 4ZRIA 2XK5B 3AU5A 2LXAA 4FHJA 2DAFA 4MGZE 1OEYA 2C5LC 2LRWA 3D32A 4AJYB 2KFKB 4HXDA 3RT3B 4CYEA 3ZNGC 1KJTA 3R3MA 4YL8A 4XC2A 2ZVOA 1P3QU 2PEAA 4GN1A 4DHJD 1C1YB 3QWZB 1I35A 1OQYA 4FN2A 3B1LX 2ASQA 2LZ6A 1P0RA 2DZJA 4KIKB 4A20A 3NY5A 4BKSD 1L7YA 2CU1A 2WYQA 4G50A 3VTUA 3ZDTA 3SD5A 1YD8U 4A3OA 2DHZA 3WAMA 4MSQB 3U30A 2KZRA 2LRUA 2KDFB 3IG3A 1UD7A 4GIVA 4W9KA 2KC1A 2ZCBA 3PHWB 4JQWC 1A5RA 4G0NB 2ZNVC 2K8BA 3PHXB 3IVFA 3PGEA 4KV2A 3VUXA 2LGXA 2LJ5A 4ASWC 4NNJB 1UBIA 4ANVA 1KLVA 4EOYA 2DENB 2NBVB 2LXCA 2ZVNA 4OVVA 3QA8A 3W1SA 3M63B 4KZ0A 1WH3A 4MELA 4E3CA 1SIFA 1GC7A 1LFDA 3PRPB 1E8YA 2PE6B 2WX0A 2G4SA 3JW0X 3VAWA 4EUTA 1WMHB 2N4FA 4MJSA 1IP9A 2O2VA 2FCMA 2W9NA 1WM2A 2IO1B 2V4LA 3QHTA 1LM8B 4HCPB 2KK8A 3UQAA 4AJWA 4LJPB 4IWOA 4JLCA 2MQJA 4OVUA 1R4NI 2PE9A 2KQ7A 2CR5A 3L10B 2GBRA 3IFWB 4EKUA 3UQBA 3A9JA 4F8CB 2DYOA 1V9JA 1Z5SB 3KUDB 5C23A 2G45B 2O6VD 3QX1A 3NS8A 4FA6A 1WJ6A 2JPHA 3PPAA 4IM0A 2IY0B 4M8NA 2N7DA 2NPTB 3ZVVA 3WAPA 4BFRA 3ENEA 4DDGD 3U8ZA 4MDKE 3DBLI 2JUOA 4ICUA 5LXIB 3RD2A 3HK0A 2FNJB 3ZKJC 2KFJA 3L16A 3R7QA 2C7MB 2D2QA 2XK5A 3GOEA 2FCQA 2MBEA 2G4DB 2NS5A 3PZDA 5AZFA 4URKA 2KTRA 5LLIA 1J8CA 1WI0A 1V5TA 5KHOA 4HVBA 3MHSD 4FJZA 4ZYNA 2D07B 2KWVB 3ZUNA 3QAQA 3AXCA 3H9DA 3ZTCA 1KM7A 1WGDA 2JZ3B 2RR9A 2EKEC 2MP2A 1P9DU 1K8RB 2DZIA 4FADA 3H7PA 4KIKA 2RGFA 3ZNID 1NDDA 2NBWB 3V6EB 2DYMA 1V86A 4W9DA 1WYWB 4EZJA 3KH0A 2BPSA 3AI5A 2BYFA 3VH3B 3APDA 2DZKA 5E6NA 4LCDE 3UIOB 4TQ0A 1L2NA 2KN5A 2KD0A 3AU4A 3I3TB 4GMVA 1EUVB 1S3SG 2L7RA 3O65B 3L17A 2R2QA 4I6NB 2O6VB 2VRRB 3QC8B 4IW0A 4MH0E 3KW5B 2KOXA 4IUMB 1WXMA 2GBJA 3U7DA 4BKGA 1R4MI 1P98A 2Y5BB 3QIJA 1Q1OA 4N9F4 1V2YA 4PYZA 2FUHB 5J18A 2N1VA 3PT2B 5D6JB 3L0WB 4WQOB 2MBOA 5CX3A 2KHWB 2V3SA 3ZNZB 4WWPA 1UGMA 3B08A 3PSEB 1G6JA 2J7QB 5E6OA 2JY6A 3JYUA 1WXVA 2FIDA 3EC8A 4NAWB 4DWFA 3M95A 1V80A 3NZSA 5E6PA 3DDCB 2IO3B 2GBMA 2FAZA 3DQVA 3TBLD 4ZRKA 2XBBC 5GMVA 2MA9B 2JT4B 4G11A 4ICVA 3X0WA 3OJ4B 5D7GA 2ZEQA 4WWNA 2RPQA 5AEKB 3PRMB 3VDZA 4GXBA 1NI2A 2MX2A 2IYDB 1I42A 3MTNB 5JHBA 3M3JA 2JWZA 1IPGA 3HM3A 4W9EA 3ONSA 1WR1A 1H8CA 4MGYE 4CO7A 4MGIE 1SGHA 1WGGA 3RUIB 5G2NA 2HE7A 3OAWA 1GUAB 2NBUA 1H4RA 3DBHI
chains in the Genus database with same CATH superfamily
3CSFA 2BW2A 1WZ3A 4GDKA 1EO6A 1SBBB 2D11A 1WJUA 3WCQA 2Y3AA 3UGBB 4M0WA 4RM9A 4GDKB 4DXFA 5EE3A 2EELA 1ZDVA 5CTRC 2SEBD 1STEA 2K8CA 4DHJD 1T3QA 2JRHA 2KNBA 1EM7A 3UIPB 2KJ6A 2KTFA 5C1ZA 1KOTA 4W9CA 1QOBA 1NYQA 2X8XX 2KLGA 1I7HA 1FNVA 2IO0B 4N6EB 3T3NA 5FK9C 2M17A 2E3TA 2LWPA 2JZZA 3FAHA 1YJJA 4LTUA 4K3CA 2K22A 3FILB 3T9LA 1XQQA 4YT0B 1N5WA 4HPLB 2WU2B 1T0YA 3FKYA 2KANA 4KGTA 2QCZA 1FXTB 1YOVB 1TZ1A 4BVUC 4Q2JA 4IM3A 4W9LA 2OJRA 1WXAA 2BWES 1YX6B 3J9CA 2V9HA 3T3OA 2IDYA 3AE7B 2DX5B 2N9EB 3PZ8A 1ZKHA 3W1YA 3A4RA 1OEYJ 3M62B 3RMKC 1FFVA 4II3B 3MJWA 2MLBA 2I1JA 4YXDB 3HM6X 3P4SB 1WXQA 2LHEA 2KYWA 2WXOA 2OJWA 5E6JA 3P42A 3JSVB 4LNFA 3VHTC 1WY8A 2YLMA 3DBSA 1DOXA 3ZXRA 4LDTD 1KRHA 2LASA 3DHGC 3AEEB 4DK5A 4L23A 1JMLA 3EECA 2TSSA 1YMHE 1RLFA 1SF0A 4KZCA 2REXA 5G5GA 2CHWA 2KKCA 2KT7A 4E71A 2Z0DB 3I9V1 4BBNC 2Z8LA 1NVID 1SJHD 2KLCA 3Q3OC 3V62A 1P1AA 3DBRB 2N9KA 1KF6B 4F7ZA 1N62A 3RCZA 4IWPA 1WZ0A 2M1MA 4KDIC 2C7NB 2LI5A 2PIAA 4HDQA 2KO3A 1QF6A 4HKZE 1ESFA 1E7UA 4ZDVA 5KHQA 1V81A 2M0XA 2VZKD 3V61A 4GB9A 3OG5A 3O13A 5TR5A 2FE8A 3VRBB 4DBGA 1ET9A 3VQIA 1E6EB 1MFWA 2JVCA 1ZDXA 3Q8AA 4B95A 4DXGA 4NQLB 3KWLA 2EKIA 2MP2B 3R66C 1D5ZC 1OTRB 4NJ7A 2KX0A 2Z59B 3LB8C 4X57B 3VH4B 1Q10A 2MRPA 5JXVA 1YQBA 4OZBA 4DDID 1B1ZA 1I4PA 2WGSA 3LJ3A 2KDBA 2XNAC 1E9MA 4AUQC 2DNFA 2K25A 5BMHA 3FILA 3IHPC 3ZJTA 3Q14C 3U52E 4TSSA 4JE3B 4US9A 4BKTA 4ARCA 2FIFA 4C00A 3GZNI 1E7PB 4ZRQA 1A70A 4PT5A 4YSZB 4P1CC 4W9IA 1ACCA 4C7YA 3RPFC 3DBLB 2LGYA 2YEPB 1LGRA 2C9WB 3WIMA 1TS4A 2G3QB 2I38A 1JWUD 3TJPA 2KACA 2AEHA 2DLBA 1C3TA 4P7IA 1J0GA 1PUTA 1V8CA 4KX6B 4YTNB 2NMQA 1WGYA 1E10A 5DPTA 2JXXA 3Q3FA 2ZNVB 4XE0A 1L4ZB 4M0WB 2M19A 2ZW1A 1P7FA 2MCNB 2ZPYA 1E8XA 1X1MA 4FBJB 2V3NA 4XX5A 2BWFA 2JQRB 3IAS1 2ZCCA 2IZVB 2C7HA 3V60A 1C4PA 1TJEA 1HTQA 3TCAA 1PDXA 2L3ZA 4MEMA 4LNNA 3ZTDA 3SU8X 3TMPB 3MJ5A 3ZJVA 3AU5A 3B2GA 2KQ4X 2DAFA 1OEYA 2C5LC 3C19A 4HXDA 3RT3B 2WXFA 1JW9D 3ZNGC 1KJTA 1QILA 3RN9C 2ZVOA 1P3QU 2PEAA 2BT6A 1I35A 1OQYA 3N1YC 2LZ6A 2DZJA 5GXGB 4G50A 1IBXB 1PGXA 3SD5A 2BS3B 4MSQB 5FR3A 2LRUA 2KDFB 1A5RA 4G0NB 2INPE 2K8BA 3PHXB 4RGOS 3IVFA 1I4HA 2LGXA 2LJ5A 3GP7A 1MPEA 3QA8A 2WXNA 2JWUA 1QLBB 1E8YA 2WX0A 3CIRB 1WMHB 4RNAA 4WURA 2W9NA 2V4LA 2KK8A 1F2RC 1FRRA 4RGTA 1TT5B 1JWSD 3BYTB 1UWXA 2CR5A 4A55A 2WHIA 2WXJA 3KUDB 3QX1A 2IGHA 3AE6B 3NS8A 4NZLB 1FNUA 2PVGC 3PPAA 4BFRA 2BB6A 2PW9A 4ICUA 2BS2B 2W55A 3ZKJC 1QQRA 2C7MB 4HJGE 5AZFA 2G4DB 4URKA 2KTRA 3MHSD 4FJZA 3SR6A 2INNE 3GZNB 1TKEA 3Q2AC 3N1XC 1EWCA 5MPOA 2YEPF 2MP2A 3EUB2 2D3BA 1V1PA 4FADA 3CWIA 4KIKA 1NDDA 2ZW0A 4RGMA 2MJ3A 4W9DA 2BYFA 1HXYD 3MHZA 5E6NA 4TQ0A 1L2NA 3IT4B 4HRSA 2KD0A 1SSNA 1VZ8A 1S3SG 3MC0B 3QC8B 3PZ7A 4MH0E 4ZHOA 2GBJA 4BKGA 1R4MI 1TS5A 5D6JB 2LFIA 3ZNZB 2WLBA 4AS1A 4H2AA 1MJDA 3P4PB 3M95A 1T5XD 4OZCA 5E6PA 4ZRKA 2JT4B 4G11A 4ICVA 2RPQA 5AEKB 1NI2A 3AE1B 2IYDB 4EE2A 3HM3A 2PVOD 1WR1A 2CJOA 1FO4A 2K9XA 4OHJA 5BMIA 2NBUA 2BYTA 3APCA 1U4AA 4XDDA 1YJ1A 4WWMA 4YTPB 5IA7A 1EU4A 1UBQA 4PK1A 2KMMA 5H8YE 3AE4B 4JWUC 4LNKA 4NJ6A 3W1SC 2M8SA 2DAJA 3GS2A 4GOCA 2BKRB 4JX1C 1GNUA 2L0FA 2MH7A 5JHAA 3RZFA 2HJ8A 2AWTA 2KDIA 2J52A 2WU5B 4KGSA 3Q8BA 3AEGB 2MW5A 4MT5A 3ZW3A 2UWQA 3BVGA 3H1UA 4A9AA 3A9KB 4IOIE 1VCBA 1RM6C 1WGRA 2D3GA 2MEKA 2D5GA 2L05A 1WSPA 3DVNV 3PREA 2AYOB 3ZIMA 2PJHA 4WJNA 1FD6A 4XGAB 2WXPA 3W2DA 4I6LB 4EZLA 4HCNB 1WWTA 2B3AA 2N0SB 1ISNA 1EU3A 1EF1A 3CF6E 1E7VA 4NJCA 1UF0A 2KJRA 3DVGY 3H7PB 2KMCA 3VTVA 3DVNU 3DCGA 1BXTA 2LJIA 1WRDB 1IYFA 3DBRI 4GDLA 1QT9A 3Q3JA 3ZQ4A 1UGJA 3PTFC 2BYVE 4YTMB 2JYTA 2MBQA 2HDEA 3A4SC 5EE9A 1UZXB 4AWJA 4USAA 4L2YA 2WX1A 1PQSA 1MHHE 3BVZA 3PLVA 3WA0A 1NEKB 4HDOA 3W5UB 4B9KA 3R2IA 2NTSA 1FMAD 3PLUA 2WXRA 4P6VF 3MP9A 2GOWA 2N9PC 3EA6A 1D3ZA 2J0MA 3NHEB 1TS3A 3SHQA 3E9SA 2KVZA 2C60A 3BY4B 2X38A 2KWCA 1GG3A 2L1AA 3A1QB 1RAXA 1GAQB 1ET6A 2L83A 3NOBA 2KJHB 1JWAD 1D6EC 3L54A 1WXSA 4BOZB 1Q0WB 1E8ZA 4KKIA 1ROEA 4US8A 1M94A 4DQOC 3H8HA 4EFOA 4KSKC 2N9XA 2O2VB 3K9OB 2KXJA 2M56B 3ETRA 4NQKE 2W3RA 1UELA 4HEA1 2QILA 3HIZA 2MWSB 2HTHA 4ZOHC 4PS8A 1XCQL 2VH2A 4WAAA 3RFZB 4MH8A 4A90A 3OWEB 2UU7A 5IKCM 1YQ4B 5AZHA 1SE4A 2JYEA 4MSMB 3NRZA 4I6PA 3KUZA 3Q8EA 2RD0A 4D2KA 2NR2A 2YVCA 3KVFB 5IP4D 4HK2A 2LVPA 3B2FA 2KFKA 5DPSA 3B0AA 3A1QA 4F1SA 1YN3A 3V6CB 1E90A 1WF9A 2KQSA 1TY2A 1FIQA 2E6XA 2RSUA 4TQ1A 1WM3A 1ZE3D 2NCNA 1WX7A 2RDBC 3SFDB 3APFA 1Q5WB 3V05A 2JSVX 3NJTA 1HZ6A 2GBKA 1QKZA 1GB1A 3HHMA 5EDSA 5IN7A 2N7EA 1SEBD 3SEBA 2NTTA 2J0KA 4PYUA 1JCKB 4GSWA 2Y5PA 1XLPA 1SE2A 4NAMA 2FCNA 4XZ4A 5D94A 1FXAA 2WXKA 4K1RB 4K7UA 2XK5B 4C4VA 4FHJA 4MGZE 2LRWA 3BYYB 4AJYB 2KFKB 1FXIA 3RNFC 4XC2A 3Q3MC 3LXFA 4YSXB 3P1MA 3QWZB 5T8IA 1P0RA 2QJLA 4A20A 3BVMA 2CU1A 2WYQA 1K50A 1YD8U 4A3OA 4RCOA 3U30A 2KZRA 4GIVA 4W9KA 3GB1A 2KC1A 4JQWC 1UNSA 3PGEA 2CJNA 3BIID 4P1BC 4KV2A 3ABVB 3VUXA 4ASWC 4NNJB 1K51A 2NBVB 3P63A 1AN8A 3N1ZC 2L32A 4MELA 1GC7A 3PRPB 3JW0X 2N4FA 3AEDB 2O2VA 1WM2A 2IO1B 3QHTA 1LM8B 3DWMA 4N59A 3UQAA 4LJPB 2GI9A 2PE9A 3TUOA 4EKUA 3UQBA 4F8CB 5C23A 4RF0A 1R4NB 4FA6A 3AB5A 4M8NA 3WAPA 3ENEA 3FC4A 4MDKE 2BQQA 2WXGA 5LXIB 1I4XA 2H89B 3HK0A 2FNJB 3RI7C 3R7QA 4JWSC 4BZAA 2NS5A 4LLGM 1J8CA 4HVBA 4ZYNA 2D07B 2KWVB 3ZUNA 4MM3B 1L0XB 2WDQB 2KDMA 2EKEC 1SE3A 2WXMA 3H7PA 3ZNID 2NBWB 2DYMA 1VZ7A 1WYWB 1VDVA 3APDA 1AYFA 2DZKA 4LCDE 2KN5A 3AU4A 3I3TB 2CU3A 3L17A 2R2QA 2O6VB 2VRRB 1OFFA 2QIEB 3KW5B 1WGKA 3QIJA 2QMTA 3PT2B 4WQOB 1I4RA 2V3SA 1HTOA 2J7QB 1F52A 5E6OA 3JYUA 3MC8A 2FIDA 1NI3A 3TSSA 1V80A 3NZSA 3DDCB 3TBLD 2GBMA 2QDFA 5GMVA 2MA9B 3OJ4B 4WWNA 2PKOA 2IGGA 2MX2A 2JWZA 4R3DA 1IPGA 3RNBC 4WQMA 4C7ZA 4HKQA 1H4RA 3BK1A 3RNAC 3ZRCA 1BT0A 1MG8A 4TV3A 2L76A 1HA5A 3WANA 2WXQA 4B6WA 2LHDA 1N5XA 4HWIB 4AQ7A 1K52A 2K6QA 4B0MA 1WX8A 3P4RB 2KX3A 1CMXB 1FRDA 4GGQA 1RYJA 3DHHC 3Q6BA 3PRZA 3PVLA 3Q8FA 4K81A 4ZHPA 4JL9A 2WDRB 3A9JB 2LVQA 1WGHA 3B9JA 2OOBB 3UINB 4CHKA 2WXHA 2VH1A 2MSED 2B76B 3RULA 3U2SC 3VXWA 1MVKA 1VLBA 1UUPA 1WYGA 4W9GA 1R7SA 4J3OD 4OVZA 2BF8B 3R7RA 4IC7B 3MC9A 2IPKD 1WMHA 2GBNA 4RH6A 3U4EG 3IXSA 4K7WA 4DHJB 2JXTA 3K9PB 2MBHA 4S0RA 4FJYA 2QSDA 2W82A 4A3PA 1WIAA 3LYYA 3TIXA 2EMSA 3KYDD 2V0GA 4HJKA 3W9CB 3TEXA 1LXDA 1RFAA 2WS3B 4KVGB 5FKAC 4BOSC 3RYTA 3PO0A 4RFBA 3VTWA 3AECB 3QJZA 5DPRA 1WE6A 2JF5A 1QZEA 5J17A 4C80A 3CSTA 4L1BA 2HD5B 3AE3B 1QOAA 3UF8A 3QQ8B 5G5HA 4IWQA 2K39A 1ZPSA 1Z2MA 1JROA 1NYRA 2L00B 4KDLB 2KN4A 1SXTA 1YX5B 5I4DA 2UYZB 1V49A 4RMAA 1J19A 4G3XB 1OGWA 1EWYC 5BYSA 3WAOA 3EFUA 4WJOA 4FULA 2WXLA 2ZJDA 3UI3A 2GRIA 3ZDMC 1LQBA 3DPDA 1ZXIA 5D2MB 4ANXA 4MM3A 4DHZB 1C4AA 2RPVA 1V5OA 1L5PA 5DCNA 1IGDA 4GLSC 1GOZA 4LDTB 3QARA 4FXCA 3KUCB 3N30A 1OQQA 2NVUI 2CHXA 3ECIA 1IGCA 4J6IA 1KFYB 1UH6A 3QK0A 4W9HA 1L0YB 2XEWA 1TZOA 2N1WA 4MGKE 3AE2B 3L08A 2LVOA 4S17A 3VRAB 3V3XA 4W9JA 4WJPA 2OEDA 1JWBD 2L52A 3DHIC 1QOGA 5CHFA 3AH7A 3NVZA 4AOFA 4LJOB 1R4MB 1IUEA 3SFEB 4ITKA 3T8MA 1FEHA 3ZLZA 1AARA 4K7SA 4WAFA 3AULA 1KLUD 4BKSA 2H88B 2R2OA 3WALA 2AL3A 2BTEA 1E8WA 4IM2A 4W9FA 3OLMD 4II2B 2ZZPB 5AUKA 4RM8A 2IBIB 3EGRA 3P2BA 5L95C 5AZGA 2W54A 3ML9A 3AM9A 4GU2A 4JGHB 2A4ZA 3URYA 5JZEB 1XLOA 1KTKA 3BWUD 1TS2A 2BKFA 3DBHB 3H7SA 2AL6A 1XF5L 3HVZA 2WWZA 1SE9A 2KDEB 4ACFA 2K6DB 2AQ3B 2K3UA 3TL5A 3CMMB 3JSVA 3Q8CA 1AW7A 4TKNA 1VD2A 4EEWA 3ML8A 2K5PA 1HE8A 5D3DA 1Y8RC 4PS7A 2ZPNA 2MHJA 4FJVB 1TBEA 2D3AA 2JZPA 5HFYA 1N6ZA 1C4CA 5BO4B 4EZKA 3KYCD 4NPNA 2LD9A 2ACZB 3RNCC 4XDCA 2INCC 1BMLC 4CYEA 2MJEA 1FPYA 3R3MA 4YL8A 1BUIC 1C1YB 1JALA 3B1LX 4KIKB 3NY5A 4BKSD 2WNMA 4LNIA 1I4QA 3VTUA 3WAMA 1YN5A 3P4QB 3IG3A 1GB4A 1UD7A 3PHWB 4B0EA 2ZNVC 1CQVA 1C79A 4ANVA 4EOYA 2DENB 2LXCA 2DWQA 2ZVNA 4C4VB 3NVWA 3W1SA 4E3CA 2PE6B 1CJEA 2G4SA 3VAWA 4EUTA 4MJSA 1IP9A 5IOIA 3NVYA 4LNOA 1RFKA 4AJWA 1FM0D 1FCLA 4IWOA 4OVUA 3I57A 1R4NI 2KQ7A 1DYQA 3IAM1 3L10B 3IFWB 5D3IB 1N60A 3ZJUA 2DYOA 4TMAB 1TKYA 4M01A 3N20C 2I2YA 1PGBA 2JPHA 4IM0A 4M00A 1T0QC 3U8ZA 3DBLI 2JUOA 2W3SA 1L6UA 3KLSX 3RD2A 2DBYA 3HRDD 1ZOYB 1HQRD 2KFJA 3L16A 2XK5A 3GOEA 3PZDA 1YJIA 5LLIA 1F77A 3QAQA 3AXCA 1KM7A 2JX5A 4C56C 2RR9A 2KWDA 1P9DU 1T0SC 2DZIA 1B9RA 4OW0A 3V6EB 4K3BA 1V86A 4EZJA 2BPSA 1L4DB 1YQ3B 4GMVA 1TYGB 1EUVB 2L7RA 1ENFA 4I6NB 3DWGC 3EFCA 2KOXA 4IUMB 1P98A 2RDGA 2Y5BB 1Q1OA 1V2YA 2GLSA 4PYZA 5J18A 2N1VA 3L0WB 5CX3A 3E56A 1KLGD 4WWPA 1SIJA 1UGMA 4OZAA 2JY6A 2OHFA 4NAWB 2FAZA 2BB5A 3AV8A 5D7GA 4ZYSA 1VJKA 3PRMB 1MHXA 4GXBA 1GPXA 1C78A 1I42A 2FBWB 2N7JA 4W9EA 1JWMD 4CO7A 3HVDA 1SB3C 3RUIB 1PFDA 5G2NA 3Q69A 1GUAB 2VZKB 1HZ5A 1VR9A 5EE0A 5HI1A 4TUUA 4ARIA 2SAKA 3RNEC 3C0RB 1L6VA 2WDVB 2J4XA 2Q5WD 2KC2A 2M4NA 2KAJA 2I1KA 2IO2B 3VR9B 4NAWA 1ZW7A 3LDZE 1MI0A 1WX9A 1J7AA 1TGZB 3AE9B 5HG2A 1TIFA 2KWUB 2MBBB 3TEWA 2A5UA 1E5WA 3RNGC 1FNWA 3A9KA 3PS6A 2IGDA 3VFKA 1YIWA 3ZGZA 1XD3B 2DYBA 2QC8A 3NZUA 4QAYA 2K1FA 4REZA 3S2AA 2QHOA 2L8JA 3L13A 1V6EA 4O1NA 5JH5C 3C8YA 4WJQA 2BGFA 3BZDB 4MJSB 3A33B 1WJ4A 1CK1A 3ZXVA 3R8BA 5C3JB 4UDUC 2IY1B 3KQ4A 3VUWA 1TTNA 5HKHA 1ZGUB 4HROA 4KKJA 5EE1A 5C2TB 2K8HA 1WE7A 3ZO5B 2KMAA 5LXHA 2JRIB 5AUIA 2AX5A 1DOIA 4KSLC 5CHVC 2BVCA 4A8XC 4BBNF 2EMTA 5CHWA 1JQ4A 1FFUA 3U7ZA 2CHZA 4RGNA 3HUIA 2PMVA 4MACA 1K53A 1F0ZA 3NS1A 4E74A 2KTRB 3Q3NC 4IKGA 2LEKA 3NG0A 3NZ3A 1WR6E 5FR6A 1F9JA 5J2RA 1J7BA 3QCAA 2V1YA 2V3PA 2GB1A 2FUG1 3AEBB 1S1QB 3AEAB 2Z0EB 2D10A 4JIOU 2HJ1A 3RZWC 4ANWA 4ANUA 4DXAB 1FCCC 1EF5A 4JPSA 5TSSA 2AQ1B 5DPWA 1PYWD 4FLHA 2PTLA 2BYEA 2CS4A 1F1HA 3L4PA 1SJED 2INDC 3H6NA 5H92C 4IG7B 2G1EA 2ON8A 5IAAC 3ZRFA 1YN4A 1C77A 2QEJC 4RF1A 4DHZE 3AN1A 3DOWA 2DZMA 4YWGG 1UWMA 1N61A 2LGIA 2J0JA 2L0TA 4WWOA 3JVZX 4A6QA 3IBEA 1DOYA 1KH0A 1NBFC 2LUEA 2LGDA 4NY0A 4ZRJA 4M8MA 4BAXA 2JU6X 2BS4B 3VR8B 2BBCA 2GMIC 2PPHA 3N9YC 3X23A 2ICIA 2CKHB 3VUYA 2J42A 1F2RI 1P7EA 5G55A 3ZNHB 3N32A 1XCTL 3SDLC 1XT9B 2WP9B 1V1PB 2NPTA 1D4BA 1D5XC 3OJ3A 1XO3A 3BINA 1GC6A 2XN9C 4HPMB 3AMZA 3AE5B 2V4IB 1RRBA 4GDLB 4AP4C 5BYRA 3MFGA 1V97A 1ZUD2 1GJZA 2FCSA 2G9HD 3GE3C 1N63A 2LUMA 3EHVA 4HLEA 1WFYA 1HEZE 1M4VA 1WJNA 1OQRA 3ALBA 2O6VA 1XLNA 3DVGX 5L83A 3N3KB 1JRUA 2KVRA 3VVWB 3ZYYX 4FHKA 3PV1A 3GE8C 4PS3A 2WDTB 4ZRIA 3AE8B 2AQ2B 2LXAA 2HTME 3I63C 3D32A 3I5JC 4XYCA 1V1OA 3NVVA 2K0PA 4GN1A 4WIPA 1XEEA 4FN2A 1IBXA 1C76A 1NENB 2ASQA 3IT6B 4ZRPA 1L7YA 5BYQA 3TEZA 3ZDTA 2WQYB 2DHZA 2ZCBA 4XWWA 2WXIA 3NUHB 4P16A 1L0VB 1RWSA 1UBIA 1KLVA 3R2TA 4OVVA 3M63B 4KZ0A 1WH3A 1PGAA 1SIFA 1LFDA 2M0AA 2FCMA 4HCPB 4WH4A 4JLCA 5HHDG 1MG4A 2MQJA 2GBRA 1YNTE 3A9JA 1V9JA 1Z5SB 1VRAB 2G45B 2O6VD 2RDHA 1WJ6A 1Y56A 2IY0B 1QOFA 2N7DA 2NPTB 1TY0A 3ZVVA 1E0ZA 2R61A 4DDGD 4XWTA 2D2QA 2FCQA 2MBEA 4N58A 1JRPA 1WI0A 1V5TA 5KHOA 1WRIA 2D3CA 2J53A 3TEYA 3H9DA 3ZTCA 2ONQA 2PLPA 4M02A 1WGDA 2JZ3B 1AWDA 1CZPA 1D5MC 1K8RB 4CQNA 1TKGA 2RGFA 2Y5CA 1DGJA 1J7CA 2RMMA 3KH0A 3AI5A 3VH3B 3UIOB 2IJ0A 3O65B 5BMGA 4IW0A 1T0RC 1WXMA 3U7DA 4IDIA 4N9F4 1ZXHA 2N9LA 2FUHB 1ZP0B 2MBOA 2KHWB 3B08A 3PSEB 3AEFB 1G6JA 2LMCA 1WXVA 3EC8A 1T6BX 1I4GA 5IO9A 4DWFA 2IO3B 1VZ6A 3DQVA 2LGSA 2XBBC 3BK2A 4HPPA 3X0WA 1C9FA 2ZEQA 1LO5D 3VDZA 3MTNB 5JHBA 3M3JA 2MJDA 4KGRA 1XLQA 3W5VB 5LNK1 3ONSA 1H8CA 3KWVA 4MGYE 4MGIE 1SGHA 1WGGA 4YSYB 1XXGA 2HE7A 3OAWA 4LK0M 3DBHI
chains in the Genus database with same CATH topology
3CSFA 3APCA 1WZ3A 4GDKA 3ZRCA 1U4AA 1YJ1A 4TUUA 1BT0A 5IA7A 1EO6A 1UBQA 2D11A 1WJUA 3C0RB 1MG8A 3UGBB 4RM9A 4GDKB 4TV3A 2L76A 2KC2A 5CTRC 2M4NA 2I1KA 2IO2B 2K8CA 4NJ6A 3WANA 3W1SC 2M8SA 1ZW7A 4NAWA 3LDZE 2DAJA 4B6WA 2JRHA 2KNBA 1WX9A 4GOCA 2BKRB 1GNUA 1TGZB 3UIPB 2KJ6A 2KTFA 5C1ZA 4HWIB 2L0FA 2K6QA 1WX8A 1KOTA 2KWUB 5JHAA 2MBBB 4W9CA 3RZFA 2KX3A 2HJ8A 2AWTA 2KDIA 1CMXB 1E5WA 2A5UA 2KLGA 2MW5A 4GGQA 3ZW3A 2UWQA 3A9KA 2IO0B 3PS6A 3PRZA 3VFKA 2M17A 3PVLA 2LWPA 4K81A 1YIWA 3H1UA 4JL9A 3A9KB 2JZZA 1VCBA 1WGRA 3A9JB 1XD3B 2D3GA 1WGHA 2LVQA 2DYBA 3NZUA 2L05A 2OOBB 3DVNV 3UINB 4CHKA 2K1FA 2AYOB 2MSED 2PJHA 3PREA 4WJNA 3S2AA 3T9LA 3ZIMA 1XQQA 2QHOA 3RULA 3VXWA 2L8JA 4HPLB 4W9GA 2BF8B 3L13A 1T0YA 1V6EA 4I6LB 4EZLA 3R7RA 5JH5C 2KANA 4IC7B 1FXTB 4WJQA 1WMHA 2GBNA 2BGFA 4MJSB 3A33B 1WJ4A 4HCNB 1TZ1A 4BVUC 2B3AA 1ISNA 1EF1A 3CF6E 1E7VA 4IM3A 4K7WA 2IY1B 2KJRA 3DVGY 3K9PB 4DHJB 3VUWA 1TTNA 5HKHA 4W9LA 3H7PB 2MBHA 1ZGUB 2KMCA 4FJYA 3VTVA 2OJRA 3DVNU 4A3PA 1WXAA 1WIAA 2K8HA 2BWES 3TIXA 1WE7A 3ZO5B 1YX6B 2EMSA 2KMAA 5LXHA 2JRIB 3KYDD 2DX5B 3DCGA 4HJKA 2N9EB 1WRDB 4KSLC 5CHVC 1LXDA 1RFAA 1IYFA 3DBRI 4GDLA 4KVGB 4BBNF 2EMTA 5CHWA 4BOSC 1ZKHA 3Q3JA 3RYTA 3W1YA 3A4RA 1OEYJ 3VTWA 3M62B 3QJZA 5DPRA 1WE6A 2CHZA 2BYVE 3PTFC 4II3B 2JF5A 2MLBA 1QZEA 2I1JA 3MJWA 3HM6X 5J17A 2MBQA 3CSTA 3A4SC 2HD5B 1UZXB 4AWJA 3VHTC 3JSVB 1WY8A 2YLMA 4E74A 3UF8A 2KTRB 3QQ8B 4IWQA 3DBSA 2K39A 1Z2MA 2WX1A 1WR6E 4LDTD 5FR6A 1F9JA 2LASA 1PQSA 5J2RA 2L00B 3QCAA 2V1YA 4KDLB 4DK5A 3PLVA 3WA0A 1YX5B 4HDOA 1S1QB 2UYZB 1V49A 2Z0EB 2D10A 3EECA 4JIOU 4RMAA 4B9KA 1J19A 4G3XB 1OGWA 3RZWC 1RLFA 4ANWA 4KZCA 2REXA 4ANUA 3WAOA 4DXAB 2CHWA 2KKCA 1EF5A 3EFUA 4WJOA 4FULA 5DPWA 4E71A 2ZJDA 2Z0DB 3PLUA 4FLHA 4BBNC 2KLCA 2BYEA 3V62A 1P1AA 2CS4A 4F7ZA 3ZDMC 3RCZA 1LQBA 3DPDA 4IWPA 1WZ0A 2GOWA 2M1MA 2N9PC 2LI5A 2C7NB 4KDIC 2J0MA 3H6NA 5D2MB 1D3ZA 4IG7B 4HDQA 3NHEB 4ANXA 2KO3A 3SHQA 4MM3A 4DHZB 5KHQA 1E7UA 4ZDVA 5IAAC 2C60A 3BY4B 1V5OA 3ZRFA 1V81A 2M0XA 5DCNA 3V61A 4GB9A 5TR5A 4DBGA 2KWCA 1GG3A 4DHZE 3VQIA 3A1QB 1RAXA 2JVCA 4LDTB 3QARA 3DOWA 2DZMA 2KJHB 3NOBA 4B95A 4NQLB 3KUCB 3L54A 3N30A 2NVUI 2MP2B 1WXSA 2CHXA 3ECIA 3R66C 4J6IA 4BOZB 1UH6A 3QK0A 4W9HA 1OTRB 2XEWA 2J0JA 2L0TA 4WWOA 2N1WA 4MGKE 4NJ7A 3L08A 3JVZX 1Q0WB 2KX0A 2Z59B 3IBEA 1E8ZA 1NBFC 2LUEA 2LGDA 4NY0A 4X57B 4ZRJA 2LVOA 4M8MA 4W9JA 1M94A 4WJPA 3VH4B 2MRPA 5CHFA 4EFOA 2GMIC 4KSKC 1YQBA 2PPHA 4DDID 3X23A 2N9XA 2O2VB 3LJ3A 4AOFA 4LJOB 2KDBA 3K9OB 2KXJA 4AUQC 2CKHB 4NQKE 3VUYA 3T8MA 2K25A 1UELA 3IHPC 3ZLZA 5G55A 1AARA 3HIZA 4K7SA 3ZNHB 2MWSB 4BKTA 2FIFA 3N32A 3AULA 2HTHA 4BKSA 3GZNI 3SDLC 1XT9B 4PS8A 2R2OA 3WALA 2AL3A 1E8WA 4IM2A 4WAAA 4W9FA 3OLMD 4II2B 2ZZPB 2NPTA 4RM8A 4W9IA 3OJ3A 2IBIB 2LGYA 5AZHA 4MSMB 3BINA 1GC6A 3P2BA 5L95C 4I6PA 3KUZA 2C9WB 3WIMA 4HPMB 2G3QB 2RD0A 5AZGA 3TJPA 2NR2A 1RRBA 2YVCA 3ML9A 4GU2A 4JGHB 2AEHA 2A4ZA 4GDLB 3KVFB 5JZEB 1C3TA 4HK2A 4P7IA 2BKFA 4AP4C 3H7SA 1J0GA 2AL6A 2LVPA 1WGYA 2KFKA 5DPSA 2WWZA 3B0AA 3A1QA 4F1SA 3V6CB 1SE9A 1E90A 2KDEB 1WF9A 5DPTA 2JXXA 2KQSA 3Q3FA 2ZNVB 2K6DB 2RSUA 1GJZA 2FCSA 4TQ1A 4M0WB 3TL5A 1WM3A 2NCNA 3CMMB 3JSVA 4TKNA 1VD2A 1WX7A 3EHVA 4HLEA 3APFA 1Q5WB 4EEWA 1WFYA 3ML8A 2GBKA 3HHMA 5EDSA 2N7EA 2MCNB 1WJNA 2ZPYA 1HE8A 3ALBA 1E8XA 1Y8RC 2O6VA 4PS7A 3DVGX 1X1MA 5L83A 2ZPNA 3N3KB 4FBJB 2J0KA 4XX5A 2BWFA 4FJVB 2ZCCA 4PYUA 1TBEA 2IZVB 2C7HA 3V60A 1JRUA 2KVRA 4GSWA 3VVWB 3TCAA 2L3ZA 4FHKA 4MEMA 3PV1A 4EZKA 5BO4B 3KYCD 3ZTDA 4NPNA 3SU8X 2FCNA 4PS3A 2LD9A 4XZ4A 2WDTB 5D94A 3TMPB 4K1RB 4K7UA 4ZRIA 2XK5B 3AU5A 2LXAA 4FHJA 2DAFA 4MGZE 1OEYA 2C5LC 2LRWA 3D32A 4AJYB 2KFKB 4HXDA 3RT3B 4CYEA 3ZNGC 1KJTA 3R3MA 4YL8A 4XC2A 2ZVOA 1P3QU 2PEAA 4GN1A 4DHJD 1C1YB 3QWZB 1I35A 1OQYA 4FN2A 3B1LX 2ASQA 2LZ6A 1P0RA 2DZJA 4KIKB 4A20A 3NY5A 4BKSD 1L7YA 2CU1A 2WYQA 4G50A 3VTUA 3ZDTA 3SD5A 1YD8U 4A3OA 2DHZA 3WAMA 4MSQB 3U30A 2KZRA 2LRUA 2KDFB 3IG3A 1UD7A 4GIVA 4W9KA 2KC1A 2ZCBA 3PHWB 4JQWC 1A5RA 4G0NB 2ZNVC 2K8BA 3PHXB 3IVFA 3PGEA 4KV2A 3VUXA 2LGXA 2LJ5A 4ASWC 4NNJB 1UBIA 4ANVA 1KLVA 4EOYA 2DENB 2NBVB 2LXCA 2ZVNA 4OVVA 3QA8A 3W1SA 3M63B 4KZ0A 1WH3A 4MELA 4E3CA 1SIFA 1GC7A 1LFDA 3PRPB 1E8YA 2PE6B 2WX0A 2G4SA 3JW0X 3VAWA 4EUTA 1WMHB 2N4FA 4MJSA 1IP9A 2O2VA 2FCMA 2W9NA 1WM2A 2IO1B 2V4LA 3QHTA 1LM8B 4HCPB 2KK8A 3UQAA 4AJWA 4LJPB 4IWOA 4JLCA 2MQJA 4OVUA 1R4NI 2PE9A 2KQ7A 2CR5A 3L10B 2GBRA 3IFWB 4EKUA 3UQBA 3A9JA 4F8CB 2DYOA 1V9JA 1Z5SB 3KUDB 5C23A 2G45B 2O6VD 3QX1A 3NS8A 4FA6A 1WJ6A 2JPHA 3PPAA 4IM0A 2IY0B 4M8NA 2N7DA 2NPTB 3ZVVA 3WAPA 4BFRA 3ENEA 4DDGD 3U8ZA 4MDKE 3DBLI 2JUOA 4ICUA 5LXIB 3RD2A 3HK0A 2FNJB 3ZKJC 2KFJA 3L16A 3R7QA 2C7MB 2D2QA 2XK5A 3GOEA 2FCQA 2MBEA 2G4DB 2NS5A 3PZDA 5AZFA 4URKA 2KTRA 5LLIA 1J8CA 1WI0A 1V5TA 5KHOA 4HVBA 3MHSD 4FJZA 4ZYNA 2D07B 2KWVB 3ZUNA 3QAQA 3AXCA 3H9DA 3ZTCA 1KM7A 1WGDA 2JZ3B 2RR9A 2EKEC 2MP2A 1P9DU 1K8RB 2DZIA 4FADA 3H7PA 4KIKA 2RGFA 3ZNID 1NDDA 2NBWB 3V6EB 2DYMA 1V86A 4W9DA 1WYWB 4EZJA 3KH0A 2BPSA 3AI5A 2BYFA 3VH3B 3APDA 2DZKA 5E6NA 4LCDE 3UIOB 4TQ0A 1L2NA 2KN5A 2KD0A 3AU4A 3I3TB 4GMVA 1EUVB 1S3SG 2L7RA 3O65B 3L17A 2R2QA 4I6NB 2O6VB 2VRRB 3QC8B 4IW0A 4MH0E 3KW5B 2KOXA 4IUMB 1WXMA 2GBJA 3U7DA 4BKGA 1R4MI 1P98A 2Y5BB 3QIJA 1Q1OA 4N9F4 1V2YA 4PYZA 2FUHB 5J18A 2N1VA 3PT2B 5D6JB 3L0WB 4WQOB 2MBOA 5CX3A 2KHWB 2V3SA 3ZNZB 4WWPA 1UGMA 3B08A 3PSEB 1G6JA 2J7QB 5E6OA 2JY6A 3JYUA 1WXVA 2FIDA 3EC8A 4NAWB 4DWFA 3M95A 1V80A 3NZSA 5E6PA 3DDCB 2IO3B 2GBMA 2FAZA 3DQVA 3TBLD 4ZRKA 2XBBC 5GMVA 2MA9B 2JT4B 4G11A 4ICVA 3X0WA 3OJ4B 5D7GA 2ZEQA 4WWNA 2RPQA 5AEKB 3PRMB 3VDZA 4GXBA 1NI2A 2MX2A 2IYDB 1I42A 3MTNB 5JHBA 3M3JA 2JWZA 1IPGA 3HM3A 4W9EA 3ONSA 1WR1A 1H8CA 4MGYE 4CO7A 4MGIE 1SGHA 1WGGA 3RUIB 5G2NA 2HE7A 3OAWA 1GUAB 2NBUA 1H4RA 3DBHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSF A;  3APC A;  1WZ3 A;  4GDK A;  3ZRC A;  1U4A A;  1YJ1 A;  4TUU A;  1BT0 A;  5IA7 A;  1EO6 A;  1UBQ A;  2D11 A;  1WJU A;  3C0R B;  1MG8 A;  3UGB B;  4RM9 A;  4GDK B;  4TV3 A;  2L76 A;  2KC2 A;  5CTR C;  2M4N A;  2I1K A;  2IO2 B;  2K8C A;  4NJ6 A;  3WAN A;  3W1S C;  2M8S A;  1ZW7 A;  4NAW A;  3LDZ E;  2DAJ A;  4B6W A;  2JRH A;  2KNB A;  1WX9 A;  4GOC A;  2BKR B;  1GNU A;  1TGZ B;  3UIP B;  2KJ6 A;  2KTF A;  5C1Z A;  4HWI B;  2L0F A;  2K6Q A;  1WX8 A;  1KOT A;  2KWU B;  5JHA A;  2MBB B;  4W9C A;  3RZF A;  2KX3 A;  2HJ8 A;  2AWT A;  2KDI A;  1CMX B;  1E5W A;  2A5U A;  2KLG A;  2MW5 A;  4GGQ A;  3ZW3 A;  2UWQ A;  3A9K A;  2IO0 B;  3PS6 A;  3PRZ A;  3VFK A;  2M17 A;  3PVL A;  2LWP A;  4K81 A;  1YIW A;  3H1U A;  4JL9 A;  3A9K B;  2JZZ A;  1VCB A;  1WGR A;  3A9J B;  1XD3 B;  2D3G A;  1WGH A;  2LVQ A;  2DYB A;  3NZU A;  2L05 A;  2OOB B;  3DVN V;  3UIN B;  4CHK A;  2K1F A;  2AYO B;  2MSE D;  2PJH A;  3PRE A;  4WJN A;  3S2A A;  3T9L A;  3ZIM A;  1XQQ A;  2QHO A;  3RUL A;  3VXW A;  2L8J A;  4HPL B;  4W9G A;  2BF8 B;  3L13 A;  1T0Y A;  1V6E A;  4I6L B;  4EZL A;  3R7R A;  5JH5 C;  2KAN A;  4IC7 B;  1FXT B;  4WJQ A;  1WMH A;  2GBN A;  2BGF A;  4MJS B;  3A33 B;  1WJ4 A;  4HCN B;  1TZ1 A;  4BVU C;  2B3A A;  1ISN A;  1EF1 A;  3CF6 E;  1E7V A;  4IM3 A;  4K7W A;  2IY1 B;  2KJR A;  3DVG Y;  3K9P B;  4DHJ B;  3VUW A;  1TTN A;  5HKH A;  4W9L A;  3H7P B;  2MBH A;  1ZGU B;  2KMC A;  4FJY A;  3VTV A;  2OJR A;  3DVN U;  4A3P A;  1WXA A;  1WIA A;  2K8H A;  2BWE S;  3TIX A;  1WE7 A;  3ZO5 B;  1YX6 B;  2EMS A;  2KMA A;  5LXH A;  2JRI B;  3KYD D;  2DX5 B;  3DCG A;  4HJK A;  2N9E B;  1WRD B;  4KSL C;  5CHV C;  1LXD A;  1RFA A;  1IYF A;  3DBR I;  4GDL A;  4KVG B;  4BBN F;  2EMT A;  5CHW A;  4BOS C;  1ZKH A;  3Q3J A;  3RYT A;  3W1Y A;  3A4R A;  1OEY J;  3VTW A;  3M62 B;  3QJZ A;  5DPR A;  1WE6 A;  2CHZ A;  2BYV E;  3PTF C;  4II3 B;  2JF5 A;  2MLB A;  1QZE A;  2I1J A;  3MJW A;  3HM6 X;  5J17 A;  2MBQ A;  3CST A;  3A4S C;  2HD5 B;  1UZX B;  4AWJ A;  3VHT C;  3JSV B;  1WY8 A;  2YLM A;  4E74 A;  3UF8 A;  2KTR B;  3QQ8 B;  4IWQ A;  3DBS A;  2K39 A;  1Z2M A;  2WX1 A;  1WR6 E;  4LDT D;  5FR6 A;  1F9J A;  2LAS A;  1PQS A;  5J2R A;  2L00 B;  3QCA A;  2V1Y A;  4KDL B;  4DK5 A;  3PLV A;  3WA0 A;  1YX5 B;  4HDO A;  1S1Q B;  2UYZ B;  1V49 A;  2Z0E B;  2D10 A;  3EEC A;  4JIO U;  4RMA A;  4B9K A;  1J19 A;  4G3X B;  1OGW A;  3RZW C;  1RLF A;  4ANW A;  4KZC A;  2REX A;  4ANU A;  3WAO A;  4DXA B;  2CHW A;  2KKC A;  1EF5 A;  3EFU A;  4WJO A;  4FUL A;  5DPW A;  4E71 A;  2ZJD A;  2Z0D B;  3PLU A;  4FLH A;  4BBN C;  2KLC A;  2BYE A;  3V62 A;  1P1A A;  2CS4 A;  4F7Z A;  3ZDM C;  3RCZ A;  1LQB A;  3DPD A;  4IWP A;  1WZ0 A;  2GOW A;  2M1M A;  2N9P C;  2LI5 A;  2C7N B;  4KDI C;  2J0M A;  3H6N A;  5D2M B;  1D3Z A;  4IG7 B;  4HDQ A;  3NHE B;  4ANX A;  2KO3 A;  3SHQ A;  4MM3 A;  4DHZ B;  5KHQ A;  1E7U A;  4ZDV A;  5IAA C;  2C60 A;  3BY4 B;  1V5O A;  3ZRF A;  1V81 A;  2M0X A;  5DCN A;  3V61 A;  4GB9 A;  5TR5 A;  4DBG A;  2KWC A;  1GG3 A;  4DHZ E;  3VQI A;  3A1Q B;  1RAX A;  2JVC A;  4LDT B;  3QAR A;  3DOW A;  2DZM A;  2KJH B;  3NOB A;  4B95 A;  4NQL B;  3KUC B;  3L54 A;  3N30 A;  2NVU I;  2MP2 B;  1WXS A;  2CHX A;  3ECI A;  3R66 C;  4J6I A;  4BOZ B;  1UH6 A;  3QK0 A;  4W9H A;  1OTR B;  2XEW A;  2J0J A;  2L0T A;  4WWO A;  2N1W A;  4MGK E;  4NJ7 A;  3L08 A;  3JVZ X;  1Q0W B;  2KX0 A;  2Z59 B;  3IBE A;  1E8Z A;  1NBF C;  2LUE A;  2LGD A;  4NY0 A;  4X57 B;  4ZRJ A;  2LVO A;  4M8M A;  4W9J A;  1M94 A;  4WJP A;  3VH4 B;  2MRP A;  5CHF A;  4EFO A;  2GMI C;  4KSK C;  1YQB A;  2PPH A;  4DDI D;  3X23 A;  2N9X A;  2O2V B;  3LJ3 A;  4AOF A;  4LJO B;  2KDB A;  3K9O B;  2KXJ A;  4AUQ C;  2CKH B;  4NQK E;  3VUY A;  3T8M A;  2K25 A;  1UEL A;  3IHP C;  3ZLZ A;  5G55 A;  1AAR A;  3HIZ A;  4K7S A;  3ZNH B;  2MWS B;  4BKT A;  2FIF A;  3N32 A;  3AUL A;  2HTH A;  4BKS A;  3GZN I;  3SDL C;  1XT9 B;  4PS8 A;  2R2O A;  3WAL A;  2AL3 A;  1E8W A;  4IM2 A;  4WAA A;  4W9F A;  3OLM D;  4II2 B;  2ZZP B;  2NPT A;  4RM8 A;  4W9I A;  3OJ3 A;  2IBI B;  2LGY A;  5AZH A;  4MSM B;  3BIN A;  1GC6 A;  3P2B A;  5L95 C;  4I6P A;  3KUZ A;  2C9W B;  3WIM A;  4HPM B;  2G3Q B;  2RD0 A;  5AZG A;  3TJP A;  2NR2 A;  1RRB A;  2YVC A;  3ML9 A;  4GU2 A;  4JGH B;  2AEH A;  2A4Z A;  4GDL B;  3KVF B;  5JZE B;  1C3T A;  4HK2 A;  4P7I A;  2BKF A;  4AP4 C;  3H7S A;  1J0G A;  2AL6 A;  2LVP A;  1WGY A;  2KFK A;  5DPS A;  2WWZ A;  3B0A A;  3A1Q A;  4F1S A;  3V6C B;  1SE9 A;  1E90 A;  2KDE B;  1WF9 A;  5DPT A;  2JXX A;  2KQS A;  3Q3F A;  2ZNV B;  2K6D B;  2RSU A;  1GJZ A;  2FCS A;  4TQ1 A;  4M0W B;  3TL5 A;  1WM3 A;  2NCN A;  3CMM B;  3JSV A;  4TKN A;  1VD2 A;  1WX7 A;  3EHV A;  4HLE A;  3APF A;  1Q5W B;  4EEW A;  1WFY A;  3ML8 A;  2GBK A;  3HHM A;  5EDS A;  2N7E A;  2MCN B;  1WJN A;  2ZPY A;  1HE8 A;  3ALB A;  1E8X A;  1Y8R C;  2O6V A;  4PS7 A;  3DVG X;  1X1M A;  5L83 A;  2ZPN A;  3N3K B;  4FBJ B;  2J0K A;  4XX5 A;  2BWF A;  4FJV B;  2ZCC A;  4PYU A;  1TBE A;  2IZV B;  2C7H A;  3V60 A;  1JRU A;  2KVR A;  4GSW A;  3VVW B;  3TCA A;  2L3Z A;  4FHK A;  4MEM A;  3PV1 A;  4EZK A;  5BO4 B;  3KYC D;  3ZTD A;  4NPN A;  3SU8 X;  2FCN A;  4PS3 A;  2LD9 A;  4XZ4 A;  2WDT B;  5D94 A;  3TMP B;  4K1R B;  4K7U A;  4ZRI A;  2XK5 B;  3AU5 A;  2LXA A;  4FHJ A;  2DAF A;  4MGZ E;  1OEY A;  2C5L C;  2LRW A;  3D32 A;  4AJY B;  2KFK B;  4HXD A;  3RT3 B;  4CYE A;  3ZNG C;  1KJT A;  3R3M A;  4YL8 A;  4XC2 A;  2ZVO A;  1P3Q U;  2PEA A;  4GN1 A;  4DHJ D;  1C1Y B;  3QWZ B;  1I35 A;  1OQY A;  4FN2 A;  3B1L X;  2ASQ A;  2LZ6 A;  1P0R A;  2DZJ A;  4KIK B;  4A20 A;  3NY5 A;  4BKS D;  1L7Y A;  2CU1 A;  2WYQ A;  4G50 A;  3VTU A;  3ZDT A;  3SD5 A;  1YD8 U;  4A3O A;  2DHZ A;  3WAM A;  4MSQ B;  3U30 A;  2KZR A;  2LRU A;  2KDF B;  3IG3 A;  1UD7 A;  4GIV A;  4W9K A;  2KC1 A;  2ZCB A;  3PHW B;  4JQW C;  1A5R A;  4G0N B;  2ZNV C;  2K8B A;  3PHX B;  3IVF A;  3PGE A;  4KV2 A;  3VUX A;  2LGX A;  2LJ5 A;  4ASW C;  4NNJ B;  1UBI A;  4ANV A;  1KLV A;  4EOY A;  2DEN B;  2NBV B;  2LXC A;  2ZVN A;  4OVV A;  3QA8 A;  3W1S A;  3M63 B;  4KZ0 A;  1WH3 A;  4MEL A;  4E3C A;  1SIF A;  1GC7 A;  1LFD A;  3PRP B;  1E8Y A;  2PE6 B;  2WX0 A;  2G4S A;  3JW0 X;  3VAW A;  4EUT A;  1WMH B;  2N4F A;  4MJS A;  1IP9 A;  2O2V A;  2FCM A;  2W9N A;  1WM2 A;  2IO1 B;  2V4L A;  3QHT A;  1LM8 B;  4HCP B;  2KK8 A;  3UQA A;  4AJW A;  4LJP B;  4IWO A;  4JLC A;  2MQJ A;  4OVU A;  1R4N I;  2PE9 A;  2KQ7 A;  2CR5 A;  3L10 B;  2GBR A;  3IFW B;  4EKU A;  3UQB A;  3A9J A;  4F8C B;  2DYO A;  1V9J A;  1Z5S B;  3KUD B;  5C23 A;  2G45 B;  2O6V D;  3QX1 A;  3NS8 A;  4FA6 A;  1WJ6 A;  2JPH A;  3PPA A;  4IM0 A;  2IY0 B;  4M8N A;  2N7D A;  2NPT B;  3ZVV A;  3WAP A;  4BFR A;  3ENE A;  4DDG D;  3U8Z A;  4MDK E;  3DBL I;  2JUO A;  4ICU A;  5LXI B;  3RD2 A;  3HK0 A;  2FNJ B;  3ZKJ C;  2KFJ A;  3L16 A;  3R7Q A;  2C7M B;  2D2Q A;  2XK5 A;  3GOE A;  2FCQ A;  2MBE A;  2G4D B;  2NS5 A;  3PZD A;  5AZF A;  4URK A;  2KTR A;  5LLI A;  1J8C A;  1WI0 A;  1V5T A;  5KHO A;  4HVB A;  3MHS D;  4FJZ A;  4ZYN A;  2D07 B;  2KWV B;  3ZUN A;  3QAQ A;  3AXC A;  3H9D A;  3ZTC A;  1KM7 A;  1WGD A;  2JZ3 B;  2RR9 A;  2EKE C;  2MP2 A;  1P9D U;  1K8R B;  2DZI A;  4FAD A;  3H7P A;  4KIK A;  2RGF A;  3ZNI D;  1NDD A;  2NBW B;  3V6E B;  2DYM A;  1V86 A;  4W9D A;  1WYW B;  4EZJ A;  3KH0 A;  2BPS A;  3AI5 A;  2BYF A;  3VH3 B;  3APD A;  2DZK A;  5E6N A;  4LCD E;  3UIO B;  4TQ0 A;  1L2N A;  2KN5 A;  2KD0 A;  3AU4 A;  3I3T B;  4GMV A;  1EUV B;  1S3S G;  2L7R A;  3O65 B;  3L17 A;  2R2Q A;  4I6N B;  2O6V B;  2VRR B;  3QC8 B;  4IW0 A;  4MH0 E;  3KW5 B;  2KOX A;  4IUM B;  1WXM A;  2GBJ A;  3U7D A;  4BKG A;  1R4M I;  1P98 A;  2Y5B B;  3QIJ A;  1Q1O A;  4N9F 4;  1V2Y A;  4PYZ A;  2FUH B;  5J18 A;  2N1V A;  3PT2 B;  5D6J B;  3L0W B;  4WQO B;  2MBO A;  5CX3 A;  2KHW B;  2V3S A;  3ZNZ B;  4WWP A;  1UGM A;  3B08 A;  3PSE B;  1G6J A;  2J7Q B;  5E6O A;  2JY6 A;  3JYU A;  1WXV A;  2FID A;  3EC8 A;  4NAW B;  4DWF A;  3M95 A;  1V80 A;  3NZS A;  5E6P A;  3DDC B;  2IO3 B;  2GBM A;  2FAZ A;  3DQV A;  3TBL D;  4ZRK A;  2XBB C;  5GMV A;  2MA9 B;  2JT4 B;  4G11 A;  4ICV A;  3X0W A;  3OJ4 B;  5D7G A;  2ZEQ A;  4WWN A;  2RPQ A;  5AEK B;  3PRM B;  3VDZ A;  4GXB A;  1NI2 A;  2MX2 A;  2IYD B;  1I42 A;  3MTN B;  5JHB A;  3M3J A;  2JWZ A;  1IPG A;  3HM3 A;  4W9E A;  3ONS A;  1WR1 A;  1H8C A;  4MGY E;  4CO7 A;  4MGI E;  1SGH A;  1WGG A;  3RUI B;  5G2N A;  2HE7 A;  3OAW A;  1GUA B;  2NBU A;  1H4R A;  3DBH I; 
#chains in the Genus database with same CATH topology
 3CSF A;  2BW2 A;  1WZ3 A;  4GDK A;  1EO6 A;  1SBB B;  2D11 A;  1WJU A;  3WCQ A;  2Y3A A;  3UGB B;  4M0W A;  4RM9 A;  4GDK B;  4DXF A;  5EE3 A;  2EEL A;  1ZDV A;  5CTR C;  2SEB D;  1STE A;  2K8C A;  4DHJ D;  1T3Q A;  2JRH A;  2KNB A;  1EM7 A;  3UIP B;  2KJ6 A;  2KTF A;  5C1Z A;  1KOT A;  4W9C A;  1QOB A;  1NYQ A;  2X8X X;  2KLG A;  1I7H A;  1FNV A;  2IO0 B;  4N6E B;  3T3N A;  5FK9 C;  2M17 A;  2E3T A;  2LWP A;  2JZZ A;  3FAH A;  1YJJ A;  4LTU A;  4K3C A;  2K22 A;  3FIL B;  3T9L A;  1XQQ A;  4YT0 B;  1N5W A;  4HPL B;  2WU2 B;  1T0Y A;  3FKY A;  2KAN A;  4KGT A;  2QCZ A;  1FXT B;  1YOV B;  1TZ1 A;  4BVU C;  4Q2J A;  4IM3 A;  4W9L A;  2OJR A;  1WXA A;  2BWE S;  1YX6 B;  3J9C A;  2V9H A;  3T3O A;  2IDY A;  3AE7 B;  2DX5 B;  2N9E B;  3PZ8 A;  1ZKH A;  3W1Y A;  3A4R A;  1OEY J;  3M62 B;  3RMK C;  1FFV A;  4II3 B;  3MJW A;  2MLB A;  2I1J A;  4YXD B;  3HM6 X;  3P4S B;  1WXQ A;  2LHE A;  2KYW A;  2WXO A;  2OJW A;  5E6J A;  3P42 A;  3JSV B;  4LNF A;  3VHT C;  1WY8 A;  2YLM A;  3DBS A;  1DOX A;  3ZXR A;  4LDT D;  1KRH A;  2LAS A;  3DHG C;  3AEE B;  4DK5 A;  4L23 A;  1JML A;  3EEC A;  2TSS A;  1YMH E;  1RLF A;  1SF0 A;  4KZC A;  2REX A;  5G5G A;  2CHW A;  2KKC A;  2KT7 A;  4E71 A;  2Z0D B;  3I9V 1;  4BBN C;  2Z8L A;  1NVI D;  1SJH D;  2KLC A;  3Q3O C;  3V62 A;  1P1A A;  3DBR B;  2N9K A;  1KF6 B;  4F7Z A;  1N62 A;  3RCZ A;  4IWP A;  1WZ0 A;  2M1M A;  4KDI C;  2C7N B;  2LI5 A;  2PIA A;  4HDQ A;  2KO3 A;  1QF6 A;  4HKZ E;  1ESF A;  1E7U A;  4ZDV A;  5KHQ A;  1V81 A;  2M0X A;  2VZK D;  3V61 A;  4GB9 A;  3OG5 A;  3O13 A;  5TR5 A;  2FE8 A;  3VRB B;  4DBG A;  1ET9 A;  3VQI A;  1E6E B;  1MFW A;  2JVC A;  1ZDX A;  3Q8A A;  4B95 A;  4DXG A;  4NQL B;  3KWL A;  2EKI A;  2MP2 B;  3R66 C;  1D5Z C;  1OTR B;  4NJ7 A;  2KX0 A;  2Z59 B;  3LB8 C;  4X57 B;  3VH4 B;  1Q10 A;  2MRP A;  5JXV A;  1YQB A;  4OZB A;  4DDI D;  1B1Z A;  1I4P A;  2WGS A;  3LJ3 A;  2KDB A;  2XNA C;  1E9M A;  4AUQ C;  2DNF A;  2K25 A;  5BMH A;  3FIL A;  3IHP C;  3ZJT A;  3Q14 C;  3U52 E;  4TSS A;  4JE3 B;  4US9 A;  4BKT A;  4ARC A;  2FIF A;  4C00 A;  3GZN I;  1E7P B;  4ZRQ A;  1A70 A;  4PT5 A;  4YSZ B;  4P1C C;  4W9I A;  1ACC A;  4C7Y A;  3RPF C;  3DBL B;  2LGY A;  2YEP B;  1LGR A;  2C9W B;  3WIM A;  1TS4 A;  2G3Q B;  2I38 A;  1JWU D;  3TJP A;  2KAC A;  2AEH A;  2DLB A;  1C3T A;  4P7I A;  1J0G A;  1PUT A;  1V8C A;  4KX6 B;  4YTN B;  2NMQ A;  1WGY A;  1E10 A;  5DPT A;  2JXX A;  3Q3F A;  2ZNV B;  4XE0 A;  1L4Z B;  4M0W B;  2M19 A;  2ZW1 A;  1P7F A;  2MCN B;  2ZPY A;  1E8X A;  1X1M A;  4FBJ B;  2V3N A;  4XX5 A;  2BWF A;  2JQR B;  3IAS 1;  2ZCC A;  2IZV B;  2C7H A;  3V60 A;  1C4P A;  1TJE A;  1HTQ A;  3TCA A;  1PDX A;  2L3Z A;  4MEM A;  4LNN A;  3ZTD A;  3SU8 X;  3TMP B;  3MJ5 A;  3ZJV A;  3AU5 A;  3B2G A;  2KQ4 X;  2DAF A;  1OEY A;  2C5L C;  3C19 A;  4HXD A;  3RT3 B;  2WXF A;  1JW9 D;  3ZNG C;  1KJT A;  1QIL A;  3RN9 C;  2ZVO A;  1P3Q U;  2PEA A;  2BT6 A;  1I35 A;  1OQY A;  3N1Y C;  2LZ6 A;  2DZJ A;  5GXG B;  4G50 A;  1IBX B;  1PGX A;  3SD5 A;  2BS3 B;  4MSQ B;  5FR3 A;  2LRU A;  2KDF B;  1A5R A;  4G0N B;  2INP E;  2K8B A;  3PHX B;  4RGO S;  3IVF A;  1I4H A;  2LGX A;  2LJ5 A;  3GP7 A;  1MPE A;  3QA8 A;  2WXN A;  2JWU A;  1QLB B;  1E8Y A;  2WX0 A;  3CIR B;  1WMH B;  4RNA A;  4WUR A;  2W9N A;  2V4L A;  2KK8 A;  1F2R C;  1FRR A;  4RGT A;  1TT5 B;  1JWS D;  3BYT B;  1UWX A;  2CR5 A;  4A55 A;  2WHI A;  2WXJ A;  3KUD B;  3QX1 A;  2IGH A;  3AE6 B;  3NS8 A;  4NZL B;  1FNU A;  2PVG C;  3PPA A;  4BFR A;  2BB6 A;  2PW9 A;  4ICU A;  2BS2 B;  2W55 A;  3ZKJ C;  1QQR A;  2C7M B;  4HJG E;  5AZF A;  2G4D B;  4URK A;  2KTR A;  3MHS D;  4FJZ A;  3SR6 A;  2INN E;  3GZN B;  1TKE A;  3Q2A C;  3N1X C;  1EWC A;  5MPO A;  2YEP F;  2MP2 A;  3EUB 2;  2D3B A;  1V1P A;  4FAD A;  3CWI A;  4KIK A;  1NDD A;  2ZW0 A;  4RGM A;  2MJ3 A;  4W9D A;  2BYF A;  1HXY D;  3MHZ A;  5E6N A;  4TQ0 A;  1L2N A;  3IT4 B;  4HRS A;  2KD0 A;  1SSN A;  1VZ8 A;  1S3S G;  3MC0 B;  3QC8 B;  3PZ7 A;  4MH0 E;  4ZHO A;  2GBJ A;  4BKG A;  1R4M I;  1TS5 A;  5D6J B;  2LFI A;  3ZNZ B;  2WLB A;  4AS1 A;  4H2A A;  1MJD A;  3P4P B;  3M95 A;  1T5X D;  4OZC A;  5E6P A;  4ZRK A;  2JT4 B;  4G11 A;  4ICV A;  2RPQ A;  5AEK B;  1NI2 A;  3AE1 B;  2IYD B;  4EE2 A;  3HM3 A;  2PVO D;  1WR1 A;  2CJO A;  1FO4 A;  2K9X A;  4OHJ A;  5BMI A;  2NBU A;  2BYT A;  3APC A;  1U4A A;  4XDD A;  1YJ1 A;  4WWM A;  4YTP B;  5IA7 A;  1EU4 A;  1UBQ A;  4PK1 A;  2KMM A;  5H8Y E;  3AE4 B;  4JWU C;  4LNK A;  4NJ6 A;  3W1S C;  2M8S A;  2DAJ A;  3GS2 A;  4GOC A;  2BKR B;  4JX1 C;  1GNU A;  2L0F A;  2MH7 A;  5JHA A;  3RZF A;  2HJ8 A;  2AWT A;  2KDI A;  2J52 A;  2WU5 B;  4KGS A;  3Q8B A;  3AEG B;  2MW5 A;  4MT5 A;  3ZW3 A;  2UWQ A;  3BVG A;  3H1U A;  4A9A A;  3A9K B;  4IOI E;  1VCB A;  1RM6 C;  1WGR A;  2D3G A;  2MEK A;  2D5G A;  2L05 A;  1WSP A;  3DVN V;  3PRE A;  2AYO B;  3ZIM A;  2PJH A;  4WJN A;  1FD6 A;  4XGA B;  2WXP A;  3W2D A;  4I6L B;  4EZL A;  4HCN B;  1WWT A;  2B3A A;  2N0S B;  1ISN A;  1EU3 A;  1EF1 A;  3CF6 E;  1E7V A;  4NJC A;  1UF0 A;  2KJR A;  3DVG Y;  3H7P B;  2KMC A;  3VTV A;  3DVN U;  3DCG A;  1BXT A;  2LJI A;  1WRD B;  1IYF A;  3DBR I;  4GDL A;  1QT9 A;  3Q3J A;  3ZQ4 A;  1UGJ A;  3PTF C;  2BYV E;  4YTM B;  2JYT A;  2MBQ A;  2HDE A;  3A4S C;  5EE9 A;  1UZX B;  4AWJ A;  4USA A;  4L2Y A;  2WX1 A;  1PQS A;  1MHH E;  3BVZ A;  3PLV A;  3WA0 A;  1NEK B;  4HDO A;  3W5U B;  4B9K A;  3R2I A;  2NTS A;  1FMA D;  3PLU A;  2WXR A;  4P6V F;  3MP9 A;  2GOW A;  2N9P C;  3EA6 A;  1D3Z A;  2J0M A;  3NHE B;  1TS3 A;  3SHQ A;  3E9S A;  2KVZ A;  2C60 A;  3BY4 B;  2X38 A;  2KWC A;  1GG3 A;  2L1A A;  3A1Q B;  1RAX A;  1GAQ B;  1ET6 A;  2L83 A;  3NOB A;  2KJH B;  1JWA D;  1D6E C;  3L54 A;  1WXS A;  4BOZ B;  1Q0W B;  1E8Z A;  4KKI A;  1ROE A;  4US8 A;  1M94 A;  4DQO C;  3H8H A;  4EFO A;  4KSK C;  2N9X A;  2O2V B;  3K9O B;  2KXJ A;  2M56 B;  3ETR A;  4NQK E;  2W3R A;  1UEL A;  4HEA 1;  2QIL A;  3HIZ A;  2MWS B;  2HTH A;  4ZOH C;  4PS8 A;  1XCQ L;  2VH2 A;  4WAA A;  3RFZ B;  4MH8 A;  4A90 A;  3OWE B;  2UU7 A;  5IKC M;  1YQ4 B;  5AZH A;  1SE4 A;  2JYE A;  4MSM B;  3NRZ A;  4I6P A;  3KUZ A;  3Q8E A;  2RD0 A;  4D2K A;  2NR2 A;  2YVC A;  3KVF B;  5IP4 D;  4HK2 A;  2LVP A;  3B2F A;  2KFK A;  5DPS A;  3B0A A;  3A1Q A;  4F1S A;  1YN3 A;  3V6C B;  1E90 A;  1WF9 A;  2KQS A;  1TY2 A;  1FIQ A;  2E6X A;  2RSU A;  4TQ1 A;  1WM3 A;  1ZE3 D;  2NCN A;  1WX7 A;  2RDB C;  3SFD B;  3APF A;  1Q5W B;  3V05 A;  2JSV X;  3NJT A;  1HZ6 A;  2GBK A;  1QKZ A;  1GB1 A;  3HHM A;  5EDS A;  5IN7 A;  2N7E A;  1SEB D;  3SEB A;  2NTT A;  2J0K A;  4PYU A;  1JCK B;  4GSW A;  2Y5P A;  1XLP A;  1SE2 A;  4NAM A;  2FCN A;  4XZ4 A;  5D94 A;  1FXA A;  2WXK A;  4K1R B;  4K7U A;  2XK5 B;  4C4V A;  4FHJ A;  4MGZ E;  2LRW A;  3BYY B;  4AJY B;  2KFK B;  1FXI A;  3RNF C;  4XC2 A;  3Q3M C;  3LXF A;  4YSX B;  3P1M A;  3QWZ B;  5T8I A;  1P0R A;  2QJL A;  4A20 A;  3BVM A;  2CU1 A;  2WYQ A;  1K50 A;  1YD8 U;  4A3O A;  4RCO A;  3U30 A;  2KZR A;  4GIV A;  4W9K A;  3GB1 A;  2KC1 A;  4JQW C;  1UNS A;  3PGE A;  2CJN A;  3BII D;  4P1B C;  4KV2 A;  3ABV B;  3VUX A;  4ASW C;  4NNJ B;  1K51 A;  2NBV B;  3P63 A;  1AN8 A;  3N1Z C;  2L32 A;  4MEL A;  1GC7 A;  3PRP B;  3JW0 X;  2N4F A;  3AED B;  2O2V A;  1WM2 A;  2IO1 B;  3QHT A;  1LM8 B;  3DWM A;  4N59 A;  3UQA A;  4LJP B;  2GI9 A;  2PE9 A;  3TUO A;  4EKU A;  3UQB A;  4F8C B;  5C23 A;  4RF0 A;  1R4N B;  4FA6 A;  3AB5 A;  4M8N A;  3WAP A;  3ENE A;  3FC4 A;  4MDK E;  2BQQ A;  2WXG A;  5LXI B;  1I4X A;  2H89 B;  3HK0 A;  2FNJ B;  3RI7 C;  3R7Q A;  4JWS C;  4BZA A;  2NS5 A;  4LLG M;  1J8C A;  4HVB A;  4ZYN A;  2D07 B;  2KWV B;  3ZUN A;  4MM3 B;  1L0X B;  2WDQ B;  2KDM A;  2EKE C;  1SE3 A;  2WXM A;  3H7P A;  3ZNI D;  2NBW B;  2DYM A;  1VZ7 A;  1WYW B;  1VDV A;  3APD A;  1AYF A;  2DZK A;  4LCD E;  2KN5 A;  3AU4 A;  3I3T B;  2CU3 A;  3L17 A;  2R2Q A;  2O6V B;  2VRR B;  1OFF A;  2QIE B;  3KW5 B;  1WGK A;  3QIJ A;  2QMT A;  3PT2 B;  4WQO B;  1I4R A;  2V3S A;  1HTO A;  2J7Q B;  1F52 A;  5E6O A;  3JYU A;  3MC8 A;  2FID A;  1NI3 A;  3TSS A;  1V80 A;  3NZS A;  3DDC B;  3TBL D;  2GBM A;  2QDF A;  5GMV A;  2MA9 B;  3OJ4 B;  4WWN A;  2PKO A;  2IGG A;  2MX2 A;  2JWZ A;  4R3D A;  1IPG A;  3RNB C;  4WQM A;  4C7Z A;  4HKQ A;  1H4R A;  3BK1 A;  3RNA C;  3ZRC A;  1BT0 A;  1MG8 A;  4TV3 A;  2L76 A;  1HA5 A;  3WAN A;  2WXQ A;  4B6W A;  2LHD A;  1N5X A;  4HWI B;  4AQ7 A;  1K52 A;  2K6Q A;  4B0M A;  1WX8 A;  3P4R B;  2KX3 A;  1CMX B;  1FRD A;  4GGQ A;  1RYJ A;  3DHH C;  3Q6B A;  3PRZ A;  3PVL A;  3Q8F A;  4K81 A;  4ZHP A;  4JL9 A;  2WDR B;  3A9J B;  2LVQ A;  1WGH A;  3B9J A;  2OOB B;  3UIN B;  4CHK A;  2WXH A;  2VH1 A;  2MSE D;  2B76 B;  3RUL A;  3U2S C;  3VXW A;  1MVK A;  1VLB A;  1UUP A;  1WYG A;  4W9G A;  1R7S A;  4J3O D;  4OVZ A;  2BF8 B;  3R7R A;  4IC7 B;  3MC9 A;  2IPK D;  1WMH A;  2GBN A;  4RH6 A;  3U4E G;  3IXS A;  4K7W A;  4DHJ B;  2JXT A;  3K9P B;  2MBH A;  4S0R A;  4FJY A;  2QSD A;  2W82 A;  4A3P A;  1WIA A;  3LYY A;  3TIX A;  2EMS A;  3KYD D;  2V0G A;  4HJK A;  3W9C B;  3TEX A;  1LXD A;  1RFA A;  2WS3 B;  4KVG B;  5FKA C;  4BOS C;  3RYT A;  3PO0 A;  4RFB A;  3VTW A;  3AEC B;  3QJZ A;  5DPR A;  1WE6 A;  2JF5 A;  1QZE A;  5J17 A;  4C80 A;  3CST A;  4L1B A;  2HD5 B;  3AE3 B;  1QOA A;  3UF8 A;  3QQ8 B;  5G5H A;  4IWQ A;  2K39 A;  1ZPS A;  1Z2M A;  1JRO A;  1NYR A;  2L00 B;  4KDL B;  2KN4 A;  1SXT A;  1YX5 B;  5I4D A;  2UYZ B;  1V49 A;  4RMA A;  1J19 A;  4G3X B;  1OGW A;  1EWY C;  5BYS A;  3WAO A;  3EFU A;  4WJO A;  4FUL A;  2WXL A;  2ZJD A;  3UI3 A;  2GRI A;  3ZDM C;  1LQB A;  3DPD A;  1ZXI A;  5D2M B;  4ANX A;  4MM3 A;  4DHZ B;  1C4A A;  2RPV A;  1V5O A;  1L5P A;  5DCN A;  1IGD A;  4GLS C;  1GOZ A;  4LDT B;  3QAR A;  4FXC A;  3KUC B;  3N30 A;  1OQQ A;  2NVU I;  2CHX A;  3ECI A;  1IGC A;  4J6I A;  1KFY B;  1UH6 A;  3QK0 A;  4W9H A;  1L0Y B;  2XEW A;  1TZO A;  2N1W A;  4MGK E;  3AE2 B;  3L08 A;  2LVO A;  4S17 A;  3VRA B;  3V3X A;  4W9J A;  4WJP A;  2OED A;  1JWB D;  2L52 A;  3DHI C;  1QOG A;  5CHF A;  3AH7 A;  3NVZ A;  4AOF A;  4LJO B;  1R4M B;  1IUE A;  3SFE B;  4ITK A;  3T8M A;  1FEH A;  3ZLZ A;  1AAR A;  4K7S A;  4WAF A;  3AUL A;  1KLU D;  4BKS A;  2H88 B;  2R2O A;  3WAL A;  2AL3 A;  2BTE A;  1E8W A;  4IM2 A;  4W9F A;  3OLM D;  4II2 B;  2ZZP B;  5AUK A;  4RM8 A;  2IBI B;  3EGR A;  3P2B A;  5L95 C;  5AZG A;  2W54 A;  3ML9 A;  3AM9 A;  4GU2 A;  4JGH B;  2A4Z A;  3URY A;  5JZE B;  1XLO A;  1KTK A;  3BWU D;  1TS2 A;  2BKF A;  3DBH B;  3H7S A;  2AL6 A;  1XF5 L;  3HVZ A;  2WWZ A;  1SE9 A;  2KDE B;  4ACF A;  2K6D B;  2AQ3 B;  2K3U A;  3TL5 A;  3CMM B;  3JSV A;  3Q8C A;  1AW7 A;  4TKN A;  1VD2 A;  4EEW A;  3ML8 A;  2K5P A;  1HE8 A;  5D3D A;  1Y8R C;  4PS7 A;  2ZPN A;  2MHJ A;  4FJV B;  1TBE A;  2D3A A;  2JZP A;  5HFY A;  1N6Z A;  1C4C A;  5BO4 B;  4EZK A;  3KYC D;  4NPN A;  2LD9 A;  2ACZ B;  3RNC C;  4XDC A;  2INC C;  1BML C;  4CYE A;  2MJE A;  1FPY A;  3R3M A;  4YL8 A;  1BUI C;  1C1Y B;  1JAL A;  3B1L X;  4KIK B;  3NY5 A;  4BKS D;  2WNM A;  4LNI A;  1I4Q A;  3VTU A;  3WAM A;  1YN5 A;  3P4Q B;  3IG3 A;  1GB4 A;  1UD7 A;  3PHW B;  4B0E A;  2ZNV C;  1CQV A;  1C79 A;  4ANV A;  4EOY A;  2DEN B;  2LXC A;  2DWQ A;  2ZVN A;  4C4V B;  3NVW A;  3W1S A;  4E3C A;  2PE6 B;  1CJE A;  2G4S A;  3VAW A;  4EUT A;  4MJS A;  1IP9 A;  5IOI A;  3NVY A;  4LNO A;  1RFK A;  4AJW A;  1FM0 D;  1FCL A;  4IWO A;  4OVU A;  3I57 A;  1R4N I;  2KQ7 A;  1DYQ A;  3IAM 1;  3L10 B;  3IFW B;  5D3I B;  1N60 A;  3ZJU A;  2DYO A;  4TMA B;  1TKY A;  4M01 A;  3N20 C;  2I2Y A;  1PGB A;  2JPH A;  4IM0 A;  4M00 A;  1T0Q C;  3U8Z A;  3DBL I;  2JUO A;  2W3S A;  1L6U A;  3KLS X;  3RD2 A;  2DBY A;  3HRD D;  1ZOY B;  1HQR D;  2KFJ A;  3L16 A;  2XK5 A;  3GOE A;  3PZD A;  1YJI A;  5LLI A;  1F77 A;  3QAQ A;  3AXC A;  1KM7 A;  2JX5 A;  4C56 C;  2RR9 A;  2KWD A;  1P9D U;  1T0S C;  2DZI A;  1B9R A;  4OW0 A;  3V6E B;  4K3B A;  1V86 A;  4EZJ A;  2BPS A;  1L4D B;  1YQ3 B;  4GMV A;  1TYG B;  1EUV B;  2L7R A;  1ENF A;  4I6N B;  3DWG C;  3EFC A;  2KOX A;  4IUM B;  1P98 A;  2RDG A;  2Y5B B;  1Q1O A;  1V2Y A;  2GLS A;  4PYZ A;  5J18 A;  2N1V A;  3L0W B;  5CX3 A;  3E56 A;  1KLG D;  4WWP A;  1SIJ A;  1UGM A;  4OZA A;  2JY6 A;  2OHF A;  4NAW B;  2FAZ A;  2BB5 A;  3AV8 A;  5D7G A;  4ZYS A;  1VJK A;  3PRM B;  1MHX A;  4GXB A;  1GPX A;  1C78 A;  1I42 A;  2FBW B;  2N7J A;  4W9E A;  1JWM D;  4CO7 A;  3HVD A;  1SB3 C;  3RUI B;  1PFD A;  5G2N A;  3Q69 A;  1GUA B;  2VZK B;  1HZ5 A;  1VR9 A;  5EE0 A;  5HI1 A;  4TUU A;  4ARI A;  2SAK A;  3RNE C;  3C0R B;  1L6V A;  2WDV B;  2J4X A;  2Q5W D;  2KC2 A;  2M4N A;  2KAJ A;  2I1K A;  2IO2 B;  3VR9 B;  4NAW A;  1ZW7 A;  3LDZ E;  1MI0 A;  1WX9 A;  1J7A A;  1TGZ B;  3AE9 B;  5HG2 A;  1TIF A;  2KWU B;  2MBB B;  3TEW A;  2A5U A;  1E5W A;  3RNG C;  1FNW A;  3A9K A;  3PS6 A;  2IGD A;  3VFK A;  1YIW A;  3ZGZ A;  1XD3 B;  2DYB A;  2QC8 A;  3NZU A;  4QAY A;  2K1F A;  4REZ A;  3S2A A;  2QHO A;  2L8J A;  3L13 A;  1V6E A;  4O1N A;  5JH5 C;  3C8Y A;  4WJQ A;  2BGF A;  3BZD B;  4MJS B;  3A33 B;  1WJ4 A;  1CK1 A;  3ZXV A;  3R8B A;  5C3J B;  4UDU C;  2IY1 B;  3KQ4 A;  3VUW A;  1TTN A;  5HKH A;  1ZGU B;  4HRO A;  4KKJ A;  5EE1 A;  5C2T B;  2K8H A;  1WE7 A;  3ZO5 B;  2KMA A;  5LXH A;  2JRI B;  5AUI A;  2AX5 A;  1DOI A;  4KSL C;  5CHV C;  2BVC A;  4A8X C;  4BBN F;  2EMT A;  5CHW A;  1JQ4 A;  1FFU A;  3U7Z A;  2CHZ A;  4RGN A;  3HUI A;  2PMV A;  4MAC A;  1K53 A;  1F0Z A;  3NS1 A;  4E74 A;  2KTR B;  3Q3N C;  4IKG A;  2LEK A;  3NG0 A;  3NZ3 A;  1WR6 E;  5FR6 A;  1F9J A;  5J2R A;  1J7B A;  3QCA A;  2V1Y A;  2V3P A;  2GB1 A;  2FUG 1;  3AEB B;  1S1Q B;  3AEA B;  2Z0E B;  2D10 A;  4JIO U;  2HJ1 A;  3RZW C;  4ANW A;  4ANU A;  4DXA B;  1FCC C;  1EF5 A;  4JPS A;  5TSS A;  2AQ1 B;  5DPW A;  1PYW D;  4FLH A;  2PTL A;  2BYE A;  2CS4 A;  1F1H A;  3L4P A;  1SJE D;  2IND C;  3H6N A;  5H92 C;  4IG7 B;  2G1E A;  2ON8 A;  5IAA C;  3ZRF A;  1YN4 A;  1C77 A;  2QEJ C;  4RF1 A;  4DHZ E;  3AN1 A;  3DOW A;  2DZM A;  4YWG G;  1UWM A;  1N61 A;  2LGI A;  2J0J A;  2L0T A;  4WWO A;  3JVZ X;  4A6Q A;  3IBE A;  1DOY A;  1KH0 A;  1NBF C;  2LUE A;  2LGD A;  4NY0 A;  4ZRJ A;  4M8M A;  4BAX A;  2JU6 X;  2BS4 B;  3VR8 B;  2BBC A;  2GMI C;  2PPH A;  3N9Y C;  3X23 A;  2ICI A;  2CKH B;  3VUY A;  2J42 A;  1F2R I;  1P7E A;  5G55 A;  3ZNH B;  3N32 A;  1XCT L;  3SDL C;  1XT9 B;  2WP9 B;  1V1P B;  2NPT A;  1D4B A;  1D5X C;  3OJ3 A;  1XO3 A;  3BIN A;  1GC6 A;  2XN9 C;  4HPM B;  3AMZ A;  3AE5 B;  2V4I B;  1RRB A;  4GDL B;  4AP4 C;  5BYR A;  3MFG A;  1V97 A;  1ZUD 2;  1GJZ A;  2FCS A;  2G9H D;  3GE3 C;  1N63 A;  2LUM A;  3EHV A;  4HLE A;  1WFY A;  1HEZ E;  1M4V A;  1WJN A;  1OQR A;  3ALB A;  2O6V A;  1XLN A;  3DVG X;  5L83 A;  3N3K B;  1JRU A;  2KVR A;  3VVW B;  3ZYY X;  4FHK A;  3PV1 A;  3GE8 C;  4PS3 A;  2WDT B;  4ZRI A;  3AE8 B;  2AQ2 B;  2LXA A;  2HTM E;  3I63 C;  3D32 A;  3I5J C;  4XYC A;  1V1O A;  3NVV A;  2K0P A;  4GN1 A;  4WIP A;  1XEE A;  4FN2 A;  1IBX A;  1C76 A;  1NEN B;  2ASQ A;  3IT6 B;  4ZRP A;  1L7Y A;  5BYQ A;  3TEZ A;  3ZDT A;  2WQY B;  2DHZ A;  2ZCB A;  4XWW A;  2WXI A;  3NUH B;  4P16 A;  1L0V B;  1RWS A;  1UBI A;  1KLV A;  3R2T A;  4OVV A;  3M63 B;  4KZ0 A;  1WH3 A;  1PGA A;  1SIF A;  1LFD A;  2M0A A;  2FCM A;  4HCP B;  4WH4 A;  4JLC A;  5HHD G;  1MG4 A;  2MQJ A;  2GBR A;  1YNT E;  3A9J A;  1V9J A;  1Z5S B;  1VRA B;  2G45 B;  2O6V D;  2RDH A;  1WJ6 A;  1Y56 A;  2IY0 B;  1QOF A;  2N7D A;  2NPT B;  1TY0 A;  3ZVV A;  1E0Z A;  2R61 A;  4DDG D;  4XWT A;  2D2Q A;  2FCQ A;  2MBE A;  4N58 A;  1JRP A;  1WI0 A;  1V5T A;  5KHO A;  1WRI A;  2D3C A;  2J53 A;  3TEY A;  3H9D A;  3ZTC A;  2ONQ A;  2PLP A;  4M02 A;  1WGD A;  2JZ3 B;  1AWD A;  1CZP A;  1D5M C;  1K8R B;  4CQN A;  1TKG A;  2RGF A;  2Y5C A;  1DGJ A;  1J7C A;  2RMM A;  3KH0 A;  3AI5 A;  3VH3 B;  3UIO B;  2IJ0 A;  3O65 B;  5BMG A;  4IW0 A;  1T0R C;  1WXM A;  3U7D A;  4IDI A;  4N9F 4;  1ZXH A;  2N9L A;  2FUH B;  1ZP0 B;  2MBO A;  2KHW B;  3B08 A;  3PSE B;  3AEF B;  1G6J A;  2LMC A;  1WXV A;  3EC8 A;  1T6B X;  1I4G A;  5IO9 A;  4DWF A;  2IO3 B;  1VZ6 A;  3DQV A;  2LGS A;  2XBB C;  3BK2 A;  4HPP A;  3X0W A;  1C9F A;  2ZEQ A;  1LO5 D;  3VDZ A;  3MTN B;  5JHB A;  3M3J A;  2MJD A;  4KGR A;  1XLQ A;  3W5V B;  5LNK 1;  3ONS A;  1H8C A;  3KWV A;  4MGY E;  4MGI E;  1SGH A;  1WGG A;  4YSY B;  1XXG A;  2HE7 A;  3OAW A;  4LK0 M;  3DBH I; 
#chains in the Genus database with same CATH homology
 3CSF A;  3APC A;  1WZ3 A;  4GDK A;  3ZRC A;  1U4A A;  1YJ1 A;  4TUU A;  1BT0 A;  5IA7 A;  1EO6 A;  1UBQ A;  2D11 A;  1WJU A;  3C0R B;  1MG8 A;  3UGB B;  4RM9 A;  4GDK B;  4TV3 A;  2L76 A;  2KC2 A;  5CTR C;  2M4N A;  2I1K A;  2IO2 B;  2K8C A;  4NJ6 A;  3WAN A;  3W1S C;  2M8S A;  1ZW7 A;  4NAW A;  3LDZ E;  2DAJ A;  4B6W A;  2JRH A;  2KNB A;  1WX9 A;  4GOC A;  2BKR B;  1GNU A;  1TGZ B;  3UIP B;  2KJ6 A;  2KTF A;  5C1Z A;  4HWI B;  2L0F A;  2K6Q A;  1WX8 A;  1KOT A;  2KWU B;  5JHA A;  2MBB B;  4W9C A;  3RZF A;  2KX3 A;  2HJ8 A;  2AWT A;  2KDI A;  1CMX B;  1E5W A;  2A5U A;  2KLG A;  2MW5 A;  4GGQ A;  3ZW3 A;  2UWQ A;  3A9K A;  2IO0 B;  3PS6 A;  3PRZ A;  3VFK A;  2M17 A;  3PVL A;  2LWP A;  4K81 A;  1YIW A;  3H1U A;  4JL9 A;  3A9K B;  2JZZ A;  1VCB A;  1WGR A;  3A9J B;  1XD3 B;  2D3G A;  1WGH A;  2LVQ A;  2DYB A;  3NZU A;  2L05 A;  2OOB B;  3DVN V;  3UIN B;  4CHK A;  2K1F A;  2AYO B;  2MSE D;  2PJH A;  3PRE A;  4WJN A;  3S2A A;  3T9L A;  3ZIM A;  1XQQ A;  2QHO A;  3RUL A;  3VXW A;  2L8J A;  4HPL B;  4W9G A;  2BF8 B;  3L13 A;  1T0Y A;  1V6E A;  4I6L B;  4EZL A;  3R7R A;  5JH5 C;  2KAN A;  4IC7 B;  1FXT B;  4WJQ A;  1WMH A;  2GBN A;  2BGF A;  4MJS B;  3A33 B;  1WJ4 A;  4HCN B;  1TZ1 A;  4BVU C;  2B3A A;  1ISN A;  1EF1 A;  3CF6 E;  1E7V A;  4IM3 A;  4K7W A;  2IY1 B;  2KJR A;  3DVG Y;  3K9P B;  4DHJ B;  3VUW A;  1TTN A;  5HKH A;  4W9L A;  3H7P B;  2MBH A;  1ZGU B;  2KMC A;  4FJY A;  3VTV A;  2OJR A;  3DVN U;  4A3P A;  1WXA A;  1WIA A;  2K8H A;  2BWE S;  3TIX A;  1WE7 A;  3ZO5 B;  1YX6 B;  2EMS A;  2KMA A;  5LXH A;  2JRI B;  3KYD D;  2DX5 B;  3DCG A;  4HJK A;  2N9E B;  1WRD B;  4KSL C;  5CHV C;  1LXD A;  1RFA A;  1IYF A;  3DBR I;  4GDL A;  4KVG B;  4BBN F;  2EMT A;  5CHW A;  4BOS C;  1ZKH A;  3Q3J A;  3RYT A;  3W1Y A;  3A4R A;  1OEY J;  3VTW A;  3M62 B;  3QJZ A;  5DPR A;  1WE6 A;  2CHZ A;  2BYV E;  3PTF C;  4II3 B;  2JF5 A;  2MLB A;  1QZE A;  2I1J A;  3MJW A;  3HM6 X;  5J17 A;  2MBQ A;  3CST A;  3A4S C;  2HD5 B;  1UZX B;  4AWJ A;  3VHT C;  3JSV B;  1WY8 A;  2YLM A;  4E74 A;  3UF8 A;  2KTR B;  3QQ8 B;  4IWQ A;  3DBS A;  2K39 A;  1Z2M A;  2WX1 A;  1WR6 E;  4LDT D;  5FR6 A;  1F9J A;  2LAS A;  1PQS A;  5J2R A;  2L00 B;  3QCA A;  2V1Y A;  4KDL B;  4DK5 A;  3PLV A;  3WA0 A;  1YX5 B;  4HDO A;  1S1Q B;  2UYZ B;  1V49 A;  2Z0E B;  2D10 A;  3EEC A;  4JIO U;  4RMA A;  4B9K A;  1J19 A;  4G3X B;  1OGW A;  3RZW C;  1RLF A;  4ANW A;  4KZC A;  2REX A;  4ANU A;  3WAO A;  4DXA B;  2CHW A;  2KKC A;  1EF5 A;  3EFU A;  4WJO A;  4FUL A;  5DPW A;  4E71 A;  2ZJD A;  2Z0D B;  3PLU A;  4FLH A;  4BBN C;  2KLC A;  2BYE A;  3V62 A;  1P1A A;  2CS4 A;  4F7Z A;  3ZDM C;  3RCZ A;  1LQB A;  3DPD A;  4IWP A;  1WZ0 A;  2GOW A;  2M1M A;  2N9P C;  2LI5 A;  2C7N B;  4KDI C;  2J0M A;  3H6N A;  5D2M B;  1D3Z A;  4IG7 B;  4HDQ A;  3NHE B;  4ANX A;  2KO3 A;  3SHQ A;  4MM3 A;  4DHZ B;  5KHQ A;  1E7U A;  4ZDV A;  5IAA C;  2C60 A;  3BY4 B;  1V5O A;  3ZRF A;  1V81 A;  2M0X A;  5DCN A;  3V61 A;  4GB9 A;  5TR5 A;  4DBG A;  2KWC A;  1GG3 A;  4DHZ E;  3VQI A;  3A1Q B;  1RAX A;  2JVC A;  4LDT B;  3QAR A;  3DOW A;  2DZM A;  2KJH B;  3NOB A;  4B95 A;  4NQL B;  3KUC B;  3L54 A;  3N30 A;  2NVU I;  2MP2 B;  1WXS A;  2CHX A;  3ECI A;  3R66 C;  4J6I A;  4BOZ B;  1UH6 A;  3QK0 A;  4W9H A;  1OTR B;  2XEW A;  2J0J A;  2L0T A;  4WWO A;  2N1W A;  4MGK E;  4NJ7 A;  3L08 A;  3JVZ X;  1Q0W B;  2KX0 A;  2Z59 B;  3IBE A;  1E8Z A;  1NBF C;  2LUE A;  2LGD A;  4NY0 A;  4X57 B;  4ZRJ A;  2LVO A;  4M8M A;  4W9J A;  1M94 A;  4WJP A;  3VH4 B;  2MRP A;  5CHF A;  4EFO A;  2GMI C;  4KSK C;  1YQB A;  2PPH A;  4DDI D;  3X23 A;  2N9X A;  2O2V B;  3LJ3 A;  4AOF A;  4LJO B;  2KDB A;  3K9O B;  2KXJ A;  4AUQ C;  2CKH B;  4NQK E;  3VUY A;  3T8M A;  2K25 A;  1UEL A;  3IHP C;  3ZLZ A;  5G55 A;  1AAR A;  3HIZ A;  4K7S A;  3ZNH B;  2MWS B;  4BKT A;  2FIF A;  3N32 A;  3AUL A;  2HTH A;  4BKS A;  3GZN I;  3SDL C;  1XT9 B;  4PS8 A;  2R2O A;  3WAL A;  2AL3 A;  1E8W A;  4IM2 A;  4WAA A;  4W9F A;  3OLM D;  4II2 B;  2ZZP B;  2NPT A;  4RM8 A;  4W9I A;  3OJ3 A;  2IBI B;  2LGY A;  5AZH A;  4MSM B;  3BIN A;  1GC6 A;  3P2B A;  5L95 C;  4I6P A;  3KUZ A;  2C9W B;  3WIM A;  4HPM B;  2G3Q B;  2RD0 A;  5AZG A;  3TJP A;  2NR2 A;  1RRB A;  2YVC A;  3ML9 A;  4GU2 A;  4JGH B;  2AEH A;  2A4Z A;  4GDL B;  3KVF B;  5JZE B;  1C3T A;  4HK2 A;  4P7I A;  2BKF A;  4AP4 C;  3H7S A;  1J0G A;  2AL6 A;  2LVP A;  1WGY A;  2KFK A;  5DPS A;  2WWZ A;  3B0A A;  3A1Q A;  4F1S A;  3V6C B;  1SE9 A;  1E90 A;  2KDE B;  1WF9 A;  5DPT A;  2JXX A;  2KQS A;  3Q3F A;  2ZNV B;  2K6D B;  2RSU A;  1GJZ A;  2FCS A;  4TQ1 A;  4M0W B;  3TL5 A;  1WM3 A;  2NCN A;  3CMM B;  3JSV A;  4TKN A;  1VD2 A;  1WX7 A;  3EHV A;  4HLE A;  3APF A;  1Q5W B;  4EEW A;  1WFY A;  3ML8 A;  2GBK A;  3HHM A;  5EDS A;  2N7E A;  2MCN B;  1WJN A;  2ZPY A;  1HE8 A;  3ALB A;  1E8X A;  1Y8R C;  2O6V A;  4PS7 A;  3DVG X;  1X1M A;  5L83 A;  2ZPN A;  3N3K B;  4FBJ B;  2J0K A;  4XX5 A;  2BWF A;  4FJV B;  2ZCC A;  4PYU A;  1TBE A;  2IZV B;  2C7H A;  3V60 A;  1JRU A;  2KVR A;  4GSW A;  3VVW B;  3TCA A;  2L3Z A;  4FHK A;  4MEM A;  3PV1 A;  4EZK A;  5BO4 B;  3KYC D;  3ZTD A;  4NPN A;  3SU8 X;  2FCN A;  4PS3 A;  2LD9 A;  4XZ4 A;  2WDT B;  5D94 A;  3TMP B;  4K1R B;  4K7U A;  4ZRI A;  2XK5 B;  3AU5 A;  2LXA A;  4FHJ A;  2DAF A;  4MGZ E;  1OEY A;  2C5L C;  2LRW A;  3D32 A;  4AJY B;  2KFK B;  4HXD A;  3RT3 B;  4CYE A;  3ZNG C;  1KJT A;  3R3M A;  4YL8 A;  4XC2 A;  2ZVO A;  1P3Q U;  2PEA A;  4GN1 A;  4DHJ D;  1C1Y B;  3QWZ B;  1I35 A;  1OQY A;  4FN2 A;  3B1L X;  2ASQ A;  2LZ6 A;  1P0R A;  2DZJ A;  4KIK B;  4A20 A;  3NY5 A;  4BKS D;  1L7Y A;  2CU1 A;  2WYQ A;  4G50 A;  3VTU A;  3ZDT A;  3SD5 A;  1YD8 U;  4A3O A;  2DHZ A;  3WAM A;  4MSQ B;  3U30 A;  2KZR A;  2LRU A;  2KDF B;  3IG3 A;  1UD7 A;  4GIV A;  4W9K A;  2KC1 A;  2ZCB A;  3PHW B;  4JQW C;  1A5R A;  4G0N B;  2ZNV C;  2K8B A;  3PHX B;  3IVF A;  3PGE A;  4KV2 A;  3VUX A;  2LGX A;  2LJ5 A;  4ASW C;  4NNJ B;  1UBI A;  4ANV A;  1KLV A;  4EOY A;  2DEN B;  2NBV B;  2LXC A;  2ZVN A;  4OVV A;  3QA8 A;  3W1S A;  3M63 B;  4KZ0 A;  1WH3 A;  4MEL A;  4E3C A;  1SIF A;  1GC7 A;  1LFD A;  3PRP B;  1E8Y A;  2PE6 B;  2WX0 A;  2G4S A;  3JW0 X;  3VAW A;  4EUT A;  1WMH B;  2N4F A;  4MJS A;  1IP9 A;  2O2V A;  2FCM A;  2W9N A;  1WM2 A;  2IO1 B;  2V4L A;  3QHT A;  1LM8 B;  4HCP B;  2KK8 A;  3UQA A;  4AJW A;  4LJP B;  4IWO A;  4JLC A;  2MQJ A;  4OVU A;  1R4N I;  2PE9 A;  2KQ7 A;  2CR5 A;  3L10 B;  2GBR A;  3IFW B;  4EKU A;  3UQB A;  3A9J A;  4F8C B;  2DYO A;  1V9J A;  1Z5S B;  3KUD B;  5C23 A;  2G45 B;  2O6V D;  3QX1 A;  3NS8 A;  4FA6 A;  1WJ6 A;  2JPH A;  3PPA A;  4IM0 A;  2IY0 B;  4M8N A;  2N7D A;  2NPT B;  3ZVV A;  3WAP A;  4BFR A;  3ENE A;  4DDG D;  3U8Z A;  4MDK E;  3DBL I;  2JUO A;  4ICU A;  5LXI B;  3RD2 A;  3HK0 A;  2FNJ B;  3ZKJ C;  2KFJ A;  3L16 A;  3R7Q A;  2C7M B;  2D2Q A;  2XK5 A;  3GOE A;  2FCQ A;  2MBE A;  2G4D B;  2NS5 A;  3PZD A;  5AZF A;  4URK A;  2KTR A;  5LLI A;  1J8C A;  1WI0 A;  1V5T A;  5KHO A;  4HVB A;  3MHS D;  4FJZ A;  4ZYN A;  2D07 B;  2KWV B;  3ZUN A;  3QAQ A;  3AXC A;  3H9D A;  3ZTC A;  1KM7 A;  1WGD A;  2JZ3 B;  2RR9 A;  2EKE C;  2MP2 A;  1P9D U;  1K8R B;  2DZI A;  4FAD A;  3H7P A;  4KIK A;  2RGF A;  3ZNI D;  1NDD A;  2NBW B;  3V6E B;  2DYM A;  1V86 A;  4W9D A;  1WYW B;  4EZJ A;  3KH0 A;  2BPS A;  3AI5 A;  2BYF A;  3VH3 B;  3APD A;  2DZK A;  5E6N A;  4LCD E;  3UIO B;  4TQ0 A;  1L2N A;  2KN5 A;  2KD0 A;  3AU4 A;  3I3T B;  4GMV A;  1EUV B;  1S3S G;  2L7R A;  3O65 B;  3L17 A;  2R2Q A;  4I6N B;  2O6V B;  2VRR B;  3QC8 B;  4IW0 A;  4MH0 E;  3KW5 B;  2KOX A;  4IUM B;  1WXM A;  2GBJ A;  3U7D A;  4BKG A;  1R4M I;  1P98 A;  2Y5B B;  3QIJ A;  1Q1O A;  4N9F 4;  1V2Y A;  4PYZ A;  2FUH B;  5J18 A;  2N1V A;  3PT2 B;  5D6J B;  3L0W B;  4WQO B;  2MBO A;  5CX3 A;  2KHW B;  2V3S A;  3ZNZ B;  4WWP A;  1UGM A;  3B08 A;  3PSE B;  1G6J A;  2J7Q B;  5E6O A;  2JY6 A;  3JYU A;  1WXV A;  2FID A;  3EC8 A;  4NAW B;  4DWF A;  3M95 A;  1V80 A;  3NZS A;  5E6P A;  3DDC B;  2IO3 B;  2GBM A;  2FAZ A;  3DQV A;  3TBL D;  4ZRK A;  2XBB C;  5GMV A;  2MA9 B;  2JT4 B;  4G11 A;  4ICV A;  3X0W A;  3OJ4 B;  5D7G A;  2ZEQ A;  4WWN A;  2RPQ A;  5AEK B;  3PRM B;  3VDZ A;  4GXB A;  1NI2 A;  2MX2 A;  2IYD B;  1I42 A;  3MTN B;  5JHB A;  3M3J A;  2JWZ A;  1IPG A;  3HM3 A;  4W9E A;  3ONS A;  1WR1 A;  1H8C A;  4MGY E;  4CO7 A;  4MGI E;  1SGH A;  1WGG A;  3RUI B;  5G2N A;  2HE7 A;  3OAW A;  1GUA B;  2NBU A;  1H4R A;  3DBH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...