2C7BA

The crystal structure of este1, a new thermophilic and thermostable carboxylesterase cloned from a metagenomic library
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
294
structure length
294
Chain Sequence
b'LSIAASPQELRRQVEEQSRLLTAAVQEPIAETRDVHIPVSGGSIRARVYFPKKAAGLPAVLYYHGGGFVFGSIETHDHICRRLSRLSDSVVVSVDYRLAPEYKFPTAVEDAYAALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNMTGVPTASLVEFGVAETTSLPIELMVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAEYDPLRDEGELYAYKMKASGSRAVAVRFAGMVHGFVSFYPFVDAGREALDLAAASIRSGLQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE
publication title Crystal Structure of Hyperthermophilic Esterase Este1 and the Relationship between its Dimerization and Thermostability Properties.
pubmed doi rcsb
source organism Uncultured archaeon
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c7bA00
2B4KA 3NGMA 5ALJA 4GI1A 2HA3A 4M0FA 3CN9A 2JGLA 3G7NA 4EY5A 1EVQA 2QR5A 1CUVA 2PSHA 4BE9A 2QKYA 2PKYX 4X93A 4OB6A 2CKMA 5DNWA 3VJMA 1LGYA 4NS4A 4B83A 3O95A 2JGFA 3RKSA 4C4XA 2QMQA 1SCQA 1BU8A 2X76A 3OOSA 4OSEA 5LZ8A 3WL8A 1H2XA 5JZSA 1MO2A 2ECFA 1LPSA 1UK6A 1WB4A 3QBJA 3PDCA 1LPMA 1E89A 1JMKC 3H2HA 4F21A 5J3JA 2XUPA 2WHPA 4Q3OA 4BE4A 2WJ3A 4BRZA 3WK6A 1TKRA 4PF1A 1Y7IA 4KYVA 1R88A 2DQYA 1LZKA 2EDCA 5AKGA 4FLMA 3KWFA 3G9XA 1EK1A 2QUAA 5A7HA 4WY8A 2XUKA 5ALWA 3KXPA 4Q82A 5JIBA 2NW6A 2PVSA 2Z5GA 3V1LA 3WI7A 1XKTA 5CT8A 5E2IA 4B9AA 5C81A 1ZGBA 2DFPA 5C7YA 2WUFA 4BTLA 1GKLA 2ES4A 1HQDA 2I78A 1QOZA 5JYCA 3JW8A 3FAKA 1WPXA 3WKBA 2GYVA 4HZGA 1ACLA 5AOBA 2WLSA 4LXIA 2OQVA 3DLTA 5AI4A 5EIEA 2ONCA 5ALRA 1AURA 3WWOA 3IA2A 1QIJA 4G9EA 4IQ4A 4OU4A 1AC5A 5ALOA 5BOVA 1ZGCA 3KOOA 3SWWA 4HRYA 2ZJ7A 3R3UA 4Y2XA 3NOXA 3EBLA 3N2ZB 3O4JA 2I3ZA 5AKXA 4BCDA 1AX9A 1E8DA 4U2FA 4EZIA 4OB8A 1XZCA 2G63A 4CCYA 3FVTA 1L7RA 4IHAA 4W1RA 4E11A 1UT6A 1UZAA 1LZLA 4FDMA 4OPMA 2XMGA 1MTZA 4Y9SA 3L1IA 5LZ7A 4N8SA 1JFRA 1X2EA 4EY7A 4FLEA 1CEXA 4PNZA 3ZPXA 4FHZA 2O7RA 5ESRA 5AJHA 1CQWA 1XZEA 2FJPA 2ZVDA 2BUBA 1QIIA 5ALEA 3IDAA 1UK7A 2VAXA 3WK8A 5FKJA 5K3FA 3DS8A 3FSGA 2ACEA 2C5FA 2YASA 5AIBA 3AINA 4MJ3A 5HQ3A 4UFOA 1DX6A 2JIDA 1VXOA 3C6YA 2QOEA 3BXPA 2X8BA 4BBZA 4AMZA 1XLUA 4MQMA 1CUFA 3AILA 2G5PA 2DCMA 5CT4A 1QONA 2HRQA 1XZHA 5E4JA 2HM7A 3GELA 2RGUA 2C7BA 3F97A 1CUSA 1TK3A 4IH9A 3ANSA 3W9UA 3IB3A 1UKAA 3CCBA 2G5TA 5AK5A 3FYUA 2V9ZA 5HK9A 2ZSIA 1IZ8A 5EHNA 2JGMA 4WJLA 3BDVA 2VEOA 4UHDA 4X85A 4B85A 1BROA 5T4BA 4KAJA 2XUHA 5AKEA 2O2HA 1X70A 3IUNA 2J3QA 2WFLA 4MEAA 2WUEA 1U4NA 4GLBA 5LZ9A 2QJRA 4X6UA 3H17A 3ED1A 3I2HA 4BVLA 5K3BA 1IVYA 1MJ5A 3K2IA 1U8EA 2WJ4A 3WL7A 5JZBA 1BS9A 3I2FA 1SCIA 5AKJA 3S2ZA 4UBJA 2H7XA 2GYWA 5AM4A 4J0KA 4RE6A 5SYMA 1AKNA 1CUYA 2WIJA 5C8XA 2Y6VA 2HA6A 2ZYIA 2WTMA 1P0MA 1CVLA 3Q8WA 1G4HA 1QIEA 2AJBA 5CMLA 3JYHA 2C4HA 2VJBA 5I8PA 4MYSA 3WYDA 4ETWA 4D9JA 2GBFA 2QJWA 3EQ8A 3D4LA 4UHEA 1CIJA 2CBGA 4JUIA 3D3NA 2XQKA 2VJAA 4CIAA 3FLEA 1K6EA 5LYYA 2HU7A 3IVMA 4FLFA 1YR2A 3O9VA 5A7FA 1AMNA 3C6BA 4H77A 4BYMA 3ZLTA 4C01A 4FOLA 2HDWA 3ZV7A 2VT6A 2WIGA 4N5IX 3PUHA 4U2GA 1HPLA 5ALIA 3E1GA 1S8OA 5JAHA 2B20A 5ISMA 2WHRA 2ZSHA 4KEAA 5JALA 1RP1A 4LXHA 4X92A 2D0DA 1RWQA 1HDEA 3HXKA 3BIXA 4M0MA 5HF8A 5LLSA 1QIGA 4W63A 4GDMA 3OC0A 4BP8A 2UZ0A 5EGNA 2Z3WA 2XMSA 2GYUA 1USWA 4H7IA 1NU8A 1YA8A 1E66A 1GXSA 4F60A 4Q3LA 1U65A 2OGZA 5EHXA 3FNBA 1ZI6A 1MAAA 4J3JA 5FLKA 3IBTA 4DNPA 5C8VA 2VQ6A 1XQVA 2QS9A 3I1YA 2DHDA 3ICWA 5HF6A 3PF9A 3DYVA 5A7GA 2QTBA 2XMDA 1YASA 4J0CA 1CUGA 2OPHA 4LYDA 2ZYRA 1P0QA 5LKAA 1EDEA 4MXDA 1DX4A 1JJFA 3WKDA 4G8CA 4BTVA 3OG9A 5HF9A 5AKKA 3C6ZA 5YASA 3STVA 1BN6A 3V48A 2QRUA 4A5SA 4BVKA 3GBSA 5DYTA 1GPLA 2XQFA 3EIOA 2JEZA 4I3FA 3B3QA 4FBLA 2HHAA 3EQ9A 1KEZA 4FNMA 1RYYA 1G66A 5DNUA 2WSLA 2OAGA 2GZRA 5DWDA 5A71A 1DQYA 4QDXA 4DIUA 2PSEA 5JATA 2HA5A 3WMRA 2JGJA 5CRIA 2DQZA 1YB6A 4X95A 1B41A 4NMWA 4I4CA 4L3WA 5CXXA 3I2JA 3R3YA 4OCZA 4HXEB 4V2IA 4ZGBA 4Y2YA 4IO0A 1AQLA 4GBGA 4P92A 4HRXA 1EB9A 2C58A 3N0TA 4UHFA 5ALXA 5AKYA 1FFEA 3WKCA 2CEKA 2Y2VA 1LBSA 3I2KA 1HL7A 1GZ7A 1Q0ZA 1VOTA 1ODSA 5LP1A 1H2WA 2O2GA 1ETHA 1EHYA 2AJLI 5K3DA 2HADA 3PFCA 4AQDA 2GBGA 4UFNA 5CBKA 2CJPA 2XDWA 4L9AA 3DCNA 5IVKA 3ZLVA 3FYTA 5AK6A 2GBCA 1EX9A 3D2CA 4H7EA 1MU0A 1LLFA 1ZJ5A 2OCKA 5AI5A 3I28A 4AZ3A 2HA4A 5DYYA 3ZI7A 5AM2A 1ACJA 4N8DA 1WM1A 4AMYA 4LHEA 2BGNA 1YB7A 4Q05A 5AIAA 2BFNA 4X91A 2WU3A 4Z49A 2PSJA 5LZ4A 4H7JA 1A88A 2W6CX 4UFPA 3I2IA 5ALKA 1UKBA 4BRSA 2WIFA 2RIPA 5BV7A 2BUAA 2X5XA 1QFSA 1VKHA 4GW3A 4QLAA 3WWCA 5D3ZA 4QDTA 4XJVA 1OCEA 1ZD5A 4ZI5A 1EB8A 1GQSA 4N5HX 3G0GA 5HQ3B 4A23A 1DWPA 1R9MA 3FWHA 3QMMA 3W9BA 3QZUA 2BGRA 1EI9A 4BDTA 2RHWA 1CUAA 2ZJFA 5DNVA 4IH1A 3STUA 5D7BA 3RM3A 4CG2A 4BAUA 4TVKA 1CUEA 3JWEA 3STWA 1XZJA 4QDUA 2IIVA 4RGYA 3R3XA 4G1FA 3FYUB 3DJYA 4W1QA 1XRLA 1MT3A 4EHBA 2WM2A 2PBLA 1Z68A 2XMQA 1HLGA 5AM3A 2WFLB 3O4HA 4KACA 2HL6A 4P93A 5KWJA 3DEAA 1GKKA 4BZZA 4Y7DA 4S0XA 4QDZA 2XUJA 2OXEA 2E3JA 4WFIA 3WA6A 4X6YA 3H04A 1IZ7A 2W22A 1ZICA 1WOMA 1YA4A 3PF8A 3DDUA 3KDAA 1CUDA 1IUOA 3WWPA 4J0HA 1BRTA 4NZZA 2Q0XA 5LIPA 2BJHA 3NUZA 1JMYA 3IUJA 4H7FA 4BB0A 4KE8A 1K63A 3AIMA 1EA5A 4FBMA 4L72A 4QNNA 4HVTA 2VT7A 4M0EA 2QXTA 5F4ZA 3E0XA 4ROTA 1XQWA 3C87A 1LPPA 3G0IA 1TCCA 1XZFA 1AUOA 4EB0A 4WCVA 2WILA 1XROA 1IUNA 2YXPX 5HKBA 2ROQA 3G8YA 3T52A 1PV1A 5FDFA 1WHTA 4BVJA 3YASA 5ALLA 5T4HA 2XQJA 3DOHA 4DMCA 2R8BA 2Z3ZA 2BAGA 4BC1A 1YS1X 4BAGA 1CUJA 1XRNA 2OLEA 1R3DA 3ESDA 2HA2A 4H18A 4Y2PA 1EINA 4PO3X 4CCWA 2XQIA 2QXUA 3AZPA 3LIPA 4B0PA 4C4YA 5JD5A 4B84A 4PSDA 4UBKA 3H1BA 3I6YA 5K3AA 3HI4A 1DINA 1DWOA 5FP0A 1C7IA 1Q0RA 1CLEA 4JH0A 3QMWA 1HKHA 3MUNA 1DTEA 4EBBA 1Y37A 1XLWA 1W76A 1BE0A 4PV7A 4B80A 4YK7A 4ARBA 4BCBA 3DKRA 4AN1A 3W05A 5JAUA 4ZRDA 1A8UA 1CUBA 3S8YA 4N8EA 2O2IA 1CR6A 1EH5A 1Q84A 1F6WA 2LIPA 2ACKA 1DT3A 1XZLA 3QH4A 3R3WA 1L7AA 1UXOA 4CG1A 3UMJA 1O6GA 2AJDA 4CIBA 1TCBA 2QT9A 3RARA 5JAPA 4XX1A 2WKWA 4NVRA 1LPNA 5AI8A 2Z8XA 3IULA 1VE7A 3QPDA 2WJ6A 7YASA 2WFMA 5H3HA 1ORVA 5EHZA 3A6ZA 3UUEA 4X00A 4YX9A 1W6RA 4J03A 1CUXA 4QE3A 3PI6A 2C5GA 1VZ3A 3QPCA 1UOQA 3M3DA 4C89A 2BCEA 1QTRA 2VA9A 4DGQA 1PFQA 1XZDA 3ICVA 5AI6A 3DQZA 2H7YA 2HRRA 2XUOA 3FLBA 2AXEA 4BDSA 3C5VA 2XI4A 3IUQA 5A2GA 2C0PA 4K2AA 1XZAA 5JAOA 4QA9A 2J4CA 2PUJA 2H9YA 3ESBA 3WZMA 4ZREA 1E8NA 2H1IA 4CI9A 4KE7A 3C45A 1GGVA 3UUFA 2OGSA 1A7UA 4TPKA 4DYHA 1LNSA 3R3VA 1WB5A 1XQYA 1R1DA 3B5EA 1IMJA 2VF2A 1FJ2A 2XMBA 1N5RA 3HABA 3HSSA 4UBIA 2XB6A 4J0JA 1NX9A 1H2ZA 1R9NA 1J1IA 4UBLA 2AJCA 5ALQA 2Y1KA 4XIIA 2WHQA 5AKIA 2VTVA 4WFKA 4X3CA 4UPDA 4OYYA 4Q1VA 3EF3A 4QWMA 5CXUA 2WUGA 4Y2UA 5ALVA 5D6OA 1QTIA 2VATA 4OYLA 3VDXA 1DQZA 3V1MA 2HFKA 5ALFA 3O9MA 3VISA 1P0PA 4KAAA 3C6XA 1DT5A 3ANTA 1H22A 4BP9A 2PUHA 1W52X 2WG0A 1LBTA 5DTIA 4LKOA 2B9VA 3AIKA 2FJ0A 5AI0A 3IURA 3G0DA 4K6KA 4ARAA 5ALDA 2J3DA 4QEKA 2D5LA 4HAIA 4DNFA 2B61A 2O7VA 1MX5A 3H2JA 4B0OA 1P0IA 1VE6A 2VJDA 4C6HA 3VVLA 3D2BA 1ZD4A 1R50A 4H0CA 1BCSA 2WU4A 3PICA 2FX5A 4X94A 4RE5A 3STXA 4UUQA 2ZYHA 4ITVA 2WIKA 3C8DA 2XQGA 3F67A 3WWDA 5HK8A 2GZSA 5IH7A 1J2EA 3BWXA 5K5EA 1J06A 3H1AA 2PPLA 1LPAB 4PW0A 1UKCA 4DM7A 4J0DA 1W4LA 2OCGA 3H0CA 5ALUA 3M83A 1A8QA 2WHPB 1XQXA 1JT2A 1XRMA 3A2NA 5JADA 4L0CA 4B82A 4GWLA 4JYMA 3D2AA 3I6MA 1KU6A 1CUCA 3HACA 5AK4A 2VJCA 4Y2RA 5DJ5A 1UWCA 2CZQA 3L1HA 5HCUA 3LCRA 2ZJ6A 1UK9A 3WZLA 2HIHA 3MVEA 4KAFA 4AX4A 3C5WP 1ODTC 3P2MA 3ZWQA 3G02A 4OUKX 4BC0A 1LPOA 1XFDA 1X2BA 4H7KA 3WA7A 1XLVA 3R40A 5ALTA 4B9EA 3VVMA 2PM8A 1ORWA 2WIDA 4G4IA 1CFJA 5HF5A 5JD6A 1FFDA 4O08A 1UOOA 3AJAA 2EDAA 3PFBA 3BL8A 1BCRA 2YYSA 3G9UA 3M82A 4W1PA 3KD2A 4G4JA 3FOBA 1JJBA 1XRRA 4F5ZA 1I6WA 3IIIA 1THGA 4B7ZA 3I2GA 2I3DA 1ZD3A 2V96A 4CCYB 4W9RA 1EXWA 1N5MA 4G8BA 4UHBA 1XZBA 1JU4A 5DLPA 2HFJA 3WLAA 1VLQA 2QM0A 1G42A 4DMHA 1Q83A 4JNCA 4C87A 3ZLUA 4AXBA 1GPNA 4BZWA 1BEZA 5JARA 4QWWA 4HXFB 3W2TA 4AO7A 1CUZA 4HTAA 5FV4A 1EDDA 2YH2A 5EHQA 4F0JA 2V97A 4DMKA 4FFWA 3ESAA 4YPVA 1UOPA 5AOCA 3WK7A 1CUIA 3IUMA 5AM1A 3QPAA 5K3FB 1XRQA 4KRYA 3HYSA 3MGAA 2R11A 1ZI8A 5ALMA 3QITA 5LZ2A 3FBWA 2C0QA 3PUIA 5HZGA 1VXRA 5CT5A 3F96A 5IVDA 5AKHA 3BJRA 1XZIA 2DR0A 3PE6A 1H2YA 4KJXA 4HS9A 4KE9A 4AB1A 1JKMA 3AZOA 2WG2A 5AK3A 3WIBA 4GHWA 5FOQA 4MQLA 1ZJ4A 1ZIXA 4WY5A 2ORYA 1OILA 1XZKA 3G9ZA 5I7UA 2OAEA 3D59A 4PSUA 4K6GA 4FTWA 5CH5A 4YASA 1SFRA 1J07A 4C4ZA 5E4YA 3LP5A 1UK8A 2BKLA 5ALZA 4X71A 4WDQA 5CT9A 5AKZA 4U2CA 3W04A 1L7QA 1U2EA 4ZXFA 1T2NA 3BDIA 3W06A 1K5PA 4ZV9A 3AZQA 1QGED 4U2EA 3U0VA 1EDBA 3CN7A 3H2IA 2CMFA 3C70A 1ZOIA 2IITA 1GPKA 3WK9A 1JU3A 4P9NA 5HFNA 1TQHA 1JI3A 4UBOA 2XLBA 5IKXA 5EIHA 1IUPA 2HU5A 3FVRA 5A62A 3A2LA 3HZOA 3OURA 2Z8ZA 2OGTA 4J7AA 4X90A 3H2GA 2QVBA 3KWJA 3RK4A 1B6GA 2JEYA 4C88A 3OPMA 3V1KA 3KSRA 1AZWA 4GECA 1XKLA 3Q0TA 3R41A 2GBIA 3AFIA 3GA7A 3LS2A 3D5EA 2PSFA 4ZV7A 2OCIA 3BE8A 1BEEA 5LZ5A 3HJUA 1VA5A 3VKFA 3E3AA 3ILSA 4FMPA 1H23A 1FSSA 2VSQA 1QJ4A 4G9GA 3C8HA 4EY8A 3LLCA 5ALHA 5KREA 4Y2SA 2RHTA 2Y6UA 2RAUA 5CH8A 3BF7A 5ALNA 3G9TA 5IVIA 5FXMA 3WL5A 4U2DA 4XWGA 3BIWA 3WKEA 1C4XA 4K5QA 3QVMA 1FFBA 4Q3KA 4Y2TA 4RPCA 1VJ5A 4DMFA 3L1JA 3TGLA 3H19A 1G5FA 3SC2A 4UHCA 4IH4A 5FPQA 1VA4A 1QIDA 1GT6A 3D0KA 5FRDA 4AZ0A 2WFZA 1ZI9A 3RLIA 3SK0A 3DL4A 4KE6A 2K2QB 3R3ZA 3V9AA 5A6VA 4OB7A 3BF8A 5AM5A 2P8SA 1YS2X 4Y2QA 4BATA 5DYWA 4P08A 3DYIA 4W1SA 5AHXA 1BN7A 4DLNA 3K9BA 4JYPA 4U2BA 1QLWA 3GUUA 5CW2A 3STTA 1CUUA 4I19A 5LKRA 3DD5A 1W1IA 3H2KA 1W75A 2RI6A 4UBMA 4DSZA 1QFMA 3EQ7A 3G0CA 5ALYA 3WKAA 4DNOA 2VAVA 1MAHA 3GROA 3FLAA 5AP9A 1K8QA 4WDRA 2HU8A 3TRDA 3CCCA 2WG1A 2XUIA 1WB6A 1DU4A 1PJAA 4CG3A 1QO7A 1WPRA 2OQIA 1XZMA 3O4GA 4FNGA 5JZ9A 4FWBA 5ALGA 5CURA 1MNAA 1CUWA 3AUKA 5KWIA 5IVHA 5AICA 1E5TA 5CH3A 4QZVA 1YSCA 1JJIA 1UFOA 4JEIA 2WQZA 3STYA 4TGLA 2OCLA 4FFVA 5AKLA 3OTQA 4G4GA 3DOIA 2PSDA 4GEGA 3K6KA 1WHSA 2I03A 1SCKA 1TIBA 2CUTA 2FUKA 3U1TA 3QMVA 2HA0A 3X3HA 1QIFA 4B81A 2XUDA 3V1NA 1EK2A 3WJ1A 4UHHA 5HFAA 5BWCA 5T4EA 1DWQA 4QLOA 5FUMA 1MX1A 3HRHA 5JD4A 1ZD2P 3DL7A 2ZYSA 2QUBA 5FPPA 5T4FA 4AN0A 1CPYA 5EI5A 3WK4A 2Y2UA 3D7RA 4MYDA 4CFSA 5K3EA 1SOMA 1VZ2A 3AIOA 2DHCA 1MNQA 2CB9A 4BCCA 1TCAA 3R0VA 5EFZA 1YAHA 5E4TA 1F8UA 1LPBB 4MWTA 2PU5A 1K4YA 1C7JA 3MUOA 3WWEA 3B12A 3HLKA 3GFFA 3E4DA 1MPXA 2V98A 2XE4A 3HEAA 4DTCA 4LYEA 2QZPA 4LXGA 1T4MA 4QDOA 1A8SA 5CT6A 3TJMA 1E3QA 3SX4A 5AH0A 2XUAA 4Y2JA 1NU6A 4PQEA 1THTA 3F8SA 6YASA 4LIPD 3TEJA 1GQRA 1KU0A 4EY6A 1XZGA 3CXUA 4J0GA 2XMRA 3T4UA 3F98A 3WYNA 4FKBA 5I9IA 4BAZA 5KBYA 3ESCA 4E15A 2IX9A 5ALSA 2PX6A 4GXNA 1E8MA 1ODCA 3DNMA 4OD0A 4X6XA 5AOAA 4HXGA 4H7HA 1FFAA 5D3KA 2XUFA 4G5XA 2DSNA 3C43A 4X7BA 1ISPA 3VXKA 3WIOA 4EUSA 2XMZA 1D07A 2DHEA 4AO8A 1CV2A 3LIIA 2G4LA 2XT0A 4EY4A 4Y2VA 4H7DA 5HKAA 2XUGA 5AM0A 1WCYA 4WFJA 3WJ2A 2XUQA 5ALPA 5C8ZA 1ZIYA 3NWOA 3QM1A 1AGYA 4KRXA 4AO6A 3O4IA 3BJMA 4MWSA 3FSGD 5JANA 5SYNA 3FYUC 4MEBA 1CRLA 3A70A 4E46A 5K3CA 2OG1A 4B6GA 2AJ8A 1TAHA 2JGIA 1QIKA 2H7CA 5AO9A 1F0NA 3QYJA 1OXMA 3OM8A 4H35A 1SC9A 5DTJA 3H18A 5BWBA 1M33A 1XRPA 5JASA 2J4FA 1CUHA 3A2MA 4E14A 4K6HA 3FCXA 1YAJA 1HBJA 3I1IA 4EA6A 2JGEA 3I6ZA 4XVCA 3WL6A 1F0PA 3M81A 4DNQA 4J0IA 3GZJA 4Q34A 5EIAA 3WQHA 5AI9A 1EVEA 2XLCA 4PSCA 3VJKA 4RNCA 2RONA 2HA7A 2JGKA 1QE3A 1MN6A 1TRHA 3HC7A 3WK5A 2XMCA 2JF0A 3O0DA 3DKKA 1FFCA 1CQZA 1QIMA 1Y7HA 2PL5A 2PU7A 1YCDA 3G0BA 3F9CA 4X97A 4A16A 4OU5A 1MX9A 1QIHA 2JBWA 2WTNA 1N8SA 4KR0A 2EEPA 3VJLA 1R4ZA 1QO9A 4INZA 1N1MA 2BUCA 1QZ3A 4G8DA 3FCYA 4DSAA 1O6FA 5CTAA 4ZWNA 4UBNA 2WUDA
chains in the Genus database with same CATH superfamily
4C30A 3N2GA 3SYNA 4B2IA 1Z7EA 4CU5A 4V1CI 3GLGA 3BQ9A 3BTUA 1SKYE 5ALJA 4B3CA 1TEVA 3T4EA 1B8PA 3KEFA 5FPTA 3A0RB 2V5UA 2IOYA 1YRQA 2YIVX 3SI7A 4FYKA 3U4MA 2JGLA 2JNWA 3KXDA 3FUUA 3V4FA 3WADA 4JJAA 2MTBA 1ULBA 2HK6A 2BF7A 1PL8A 3DVLA 3SPXA 3EOAI 4BE9A 4K40A 4H31A 3C6QA 2AZTA 2FY8A 2R8YA 3BE5A 3QYFA 3TLKA 3VHXA 4AF7A 4D8YA 3OJOA 1WXWA 2XWBF 4YAEA 4ZANA 1KSGA 4HGYA 1BFDA 1W48A 3C74A 2IC5A 3SJBA 2EYQA 3C3XA 1EHCA 4GVLA 3L07A 3VJMA 3RU3A 1RKBA 4O4IF 3QF4B 1LGYA 2FR8A 2JHAA 1W0JA 3OOHA 3Q3VA 4DCGA 4B83A 4DEXA 2F3QA 1K89A 2COEA 3CR3C 4IKEA 1ZJZA 3U13A 4A6DA 4CLRA 3W3AH 1S01A 4ZO4A 2Q7XA 1V3QE 4IO1A 1E2FA 3WNQA 2H18A 1J8DA 3CUSA 2H1HA 3JQDA 5LZ8A 1NYTA 2B7BA 3WL8A 2L17A 2KLBA 4X1YA 4V0ME 1EWVA 3PFKA 3B9BA 8ABPA 5K0ZA 4KVGA 1RFLA 4PRZA 3PNYA 4Z86A 5F1YA 2QL7A 1BRMA 1N4DA 3IJ5A 1KKMA 4DRZA 2HY7A 2Y1WA 4M6WB 3RUFA 1UK6A 2CXQA 1OSNA 2R68A 2F1RA 1T5LA 2XB8A 3A6DA 3PDCA 5IASA 2OFWA 3DZBA 5L6LB 5FNZA 1GPWB 3KZVA 4MV4A 2GFIA 1HLPA 1JRLA 2CXXA 2JI8A 5LYJA 1Q7GA 3H9CA 1X7GA 3AL3A 5ED4A 1R10A 2WABA 1M54A 2DPMA 2W8BA 4TZ0A 2JLWA 3RC9A 1MC5A 3AHHA 3F74A 1EIWA 2O05A 5HX7A 1U5AA 5C35A 3HO1A 4GI3A 2C9OA 2GETA 3JQCA 2XJ9A 3L7CA 3QU9A 3SEAA 2WJ3A 3UMCA 1DUSA 4JLSA 4M1YA 2NO6A 2I6SA 4BRZA 1GY8A 5LA6B 5B3JC 3WK6A 3DC7A 5JV5A 5BNWA 1XTBA 4PF1A 2YIDA 1TKCA 1Y7IA 2ZT7A 3BB3A 3DV2A 1FRQA 2BWJA 2PXHA 3IP1A 5HTOA 4ZVNA 1ZWLA 5HIJA 1PYOA 1FZTA 2EDCA 1BMTA 1U2DC 1PFKA 1ULSA 3FVVA 3JSXA 4OK3A 2X2EA 4FFMA 4FLMA 4A8JA 5GPBA 4B2PA 4BXOB 1BO6A 4DIMA 4RIFA 4NQRA 3L0BA 5I7AA 5B53A 3KWFA 3G9XA 4C05A 3JVIA 4TL9A 4ZODA 5DZSA 2J08A 1BE1A 5A7HA 1UDXA 5KYYB 3E9YA 3WYGA 3QG1A 1BE8A 3I6IA 9GPBA 2KJQA 2VDWA 1Q1EA 3KXPA 4PG4A 3X0DA 3X1JA 2QTNA 1I7SB 1BG6A 3I01A 4NK4A 4C6TA 3C39A 3ABSB 3G82C 5CPFA 1O96A 3WI7A 1XKTA 3DEIA 1R9JA 4AJOA 1BZYA 3ZC3A 3MB5A 3K0AA 3CLVA 2W2LA 4D8UA 2FPGB 1VKJA 3FM9A 5AXDA 3GU3A 3L2OB 5BYJA 1N78A 1NSFA 3L40A 1OE0A 2ZROA 1PGQA 4BNMA 4JLAA 4YFVA 1R00A 3I0NA 5C18A 3CMCO 4ZAYA 3INTA 3PYMA 3MMSA 4FYWA 1SM4A 4KXMA 4LOAA 3RUEA 5JJBA 1WCXA 4KDCA 4HGRA 2PRKA 5C4IA 1HQDA 1I9CA 4KQGA 4NOLA 1KFCB 1EFVB 3FAKA 2HF9A 3P9XA 4UTPA 1H69A 5JSZA 3QENA 1MZPA 1UPTA 2QAGA 3BXHA 3IVGA 2UZIR 4O4LF 5AOBA 4GDFA 2JGDA 2FMUA 3P4YA 2HWXA 4I14A 2AQIA 1Z62A 2EVWX 2FXIA 1XU4A 3LD9A 1M7BA 3SFZA 1L7VC 2ZRMA 2CMKA 3LU1A 4N3AA 3LBIA 4RVUA 4TWBA 3D64A 5ALRA 2DJ5A 1BGVA 5K20A 2IODA 3WWOA 1K6XA 3IA2A 3OT4A 4E21A 2B21A 4LBWA 2R7NA 3HUFA 4JQOA 3MQ4A 4IQ4A 4OU4A 2FHPA 1V4BA 4P4TA 3TQOA 4CHTA 5AVVA 2YZKA 2OMEA 1TJPB 3ZJUA 2A5JA 5C8YA 3SWWA 4CEJA 5HUHA 2AEJA 4Y9TA 2B82A 4TZ6A 1QTNA 2SKEA 4TUYF 5EP1A 4TSRA 4BEJA 2O8CB 3BTVA 1K7SN 3L8EA 4Y2XA 2B0JA 1BHO1 2PZLA 3TSOA 5DI3B 3O4JA 4ROSA 3TIXB 3PRHA 3A3PA 3DDWA 1N6LA 2O5CA 4BCDA 3UJHA 4D46A 1WU8A 1DO8A 1KO4A 1B73A 1U8ZA 4PX5A 3WMXA 3FBTA 3TAHA 3UW1A 3CEJA 4EZIA 4HYQA 3V8NA 4PHCA 1S2NA 1GWNA 5MN5A 2JLQA 3TG8A 2FQWA 2WWVD 1L7RA 3RQSA 4W1RA 2VF8A 1U7TA 2B8JA 3EVCA 2FSGA 1B1AA 3EIWA 5FWXA 2IU0A 2J3IA 1ZW1A 3TGWA 4FDMA 1ZN8A 3U4DA 3OOYA 1DIHA 5AW8A 1MTZA 1HMYA 4DUGA 3GOHA 5LZ7A 121PA 2PGJA 1E1MA 2VJMA 4P1ZA 1YUMA 3KLNA 3FFBA 4JC8A 5T7BA 1O4VA 2ZUDA 2V45A 1BMDA 3EEIA 4GZ5A 2H1CA 2B37A 2YZMA 4MIOA 1E6EA 1SCDA 3E3LA 3K0FB 3KXIA 4XD2A 4DAOA 2DKOA 3MPOA 4FT2A 4AMVA 1CEXA 3ZEIA 3KOWA 2B1IA 4L15A 3SX2A 2AI2A 3QEOA 1E3JA 1V11B 4R1MA 4CI0B 2ZG6A 4OQQA 2VQDA 2P41A 2O7RA 5DCUA 3L4BC 5ESRA 2KS6A 4CEIB 1A95A 3QVOA 4P38A 4E6EA 1W30A 1WD7A 2Q49A 3KQMA 3C98A 4WOKA 1CQWA 3ZCPA 2QN1A 2PV7A 3DCYA 4MGYR 3LTNC 1NVWQ 3KQUA 1VMEA 4GYKA 4MWDA 4P7KA 2ERCA 2WAAA 2P9HA 1WUTA 1QIIA 2QVZX 3EODA 3IDAA 4PZLA 3H9QA 3SKVA 3ZU4A 5L3QB 1KI6A 3B85A 5FL7A 3IELA 4EF4A 3WK8A 5KS2A 3BMQB 1ZESA 1G0OA 3VR6D 3IVAA 2O3QA 2X0DA 2OG2A 5JO0A 1B93A 1SK9A 1CZUA 4G23A 2YN2A 3C8MA 2Q2VA 4MUNA 2QQGA 3HA2A 5FORA 3OCVA 2HQOA 2ZJ0A 1IN8A 3RFVA 1SVWA 3T9DA 3TAXA 4ZO6A 1V1MB 2YASA 3PQFA 1LVGA 5LOVF 4P54A 3AINA 1J25A 4MJ3A 1PFYA 2CVHA 2PQ0A 4UE3S 2XWSA 4P7BA 4GT1A 3C6YA 1FX1A 1L9KA 2PWAA 5AJUA 2GAAA 3OUZA 3DR3A 3U5TA 1ZD8A 1SVUA 1D1SA 3U3KA 4BBZA 4AMZA 4MQMA 2WQ6A 3VBEA 1H6AA 1MZVA 5DHFA 2EIHA 4G1UC 5C7OO 2HX1A 4WN3A 4BPRA 2VTEA 3DTVD 4I1IA 5F2EA 5JVDA 1P80A 3DBLA 1CG6A 1J8MF 4PZPA 1TAUA 1WW3A 4G56A 4ZCIA 2XGJA 1OT3A 4KVZA 3F97A 1AZLA 4ZHQA 3SLKA 3BQMB 4CF6A 1Q6ZA 2Y0PA 4I55F 2P5YA 3LH5A 3KQSA 4R8KA 1BJRE 2MSWA 2FDXA 4V0RA 1AJEA 3PR2B 4DV2B 2GJ4A 1UKAA 1YVPA 4QSMA 2ATXA 2H16A 2GXSA 3DR5A 3GPCA 1R6XA 4XTRA 3NHYA 3CCBA 2N75A 4YT5A 5AK5A 5J40A 5JU6A 2RG1A 4LF8B 4BMOB 1TPZA 3V4VB 1DOHA 1M10A 2V9ZA 3E8SA 3Q3HA 2O48X 5HE8A 4JX8A 2NAPA 1GFIA 2CLHB 1NMZA 1L5QA 2GJAA 3EXG1 3MINA 4IJ6A 4MHSA 4XM0A 5JAQA 3OJ0A 4OIMA 4B85A 4W5RA 1F8GA 2HF2A 4Q4JA 3VH3A 1L7XA 5T4BA 3QV2A 3AP2A 4MW4A 4GYJA 1LU9A 4BVAA 1SKQA 2RCNA 1GO2A 1YE3A 4NBNA 5AKEA 2C97A 3ZHOA 2H9IA 1ZJYA 1Z08A 3U37A 3IUNA 1U0EA 2Q1YA 1QGZA 3OZCA 4YQYA 2FG7C 3FPHA 4R16A 1BU5A 1DUVG 1CQPA 1SZPA 1RJFA 2ADMA 2VH1A 4MEAA 3TZCA 3TZLA 3VGJA 4PYRA 2WUEA 1U4NA 1NBMA 4ZZ2A 4E12A 2JVKA 2ZUUA 2NUBA 2XYVA 1TJ5A 2XXJA 4KMMA 4YJHA 5FIUA 2X9VA 3H0EA 2FB9A 4X1KB 3ZCXA 3AY6A 5AJVB 3ED1A 4LEIA 2GCPA 2RI0A 3NCTA 2O8FB 3FXAA 2X1VA 4KFSA 1PD1A 1FMFA 1IVYA 1MJ5A 3WL7A 4LHXA 5JZBA 3AL0C 1OH6A 3I2FA 4Z4GA 4C03A 1GU1A 2IP2A 3RS9A 5ECDA 1EPUA 3IOYA 4R2KA 3RSZA 2PS9A 3S2ZA 3D43A 1U1EA 1RSZA 2OM2A 4D4LA 5FLEX 2K7ZA 5B58C 5KO2A 4TXJA 2ZSKA 3C41J 2X1MA 3QOXA 1E7RA 1WQ3A 1YK0A 2PX8A 4BO1A 2E1RA 4HNGA 1DI0A 3F9RA 5KYWA 1NYRA 2RGWA 3KL4A 4YPFA 4TTVA 4OQYA 2W11A 2Y1CA 1M2HA 2PVCA 3TFQA 3EVAA 1S7GA 3PK0A 3BWCA 3OF3A 1NW5A 3I4LA 4LXXA 5EC8A 3UJ8A 2O5RA 3E22B 3O2QB 4RE6A 3ZV6A 2OVBA 3A7DA 4ESVA 3A31A 4JP3A 3HDHA 3IXQA 4FCCA 5FTMA 4URFA 1D5CA 4E88A 4ZTUB 5H7XA 1BXRB 4GKKB 1SUEA 1VP9A 2DYKA 2WIJA 3BJZA 2M9MA 3AR2A 4XD7D 1E96A 4DLAA 1YTLA 4TYNA 2EX0A 2BGJA 5JS7A 3U6KA 1JA9A 3VKUA 1CVLA 2AW3A 4FHDA 1QQ5A 2JL1A 1TA4A 2UYQA 1TVKA 3DZFA 3ZXSA 1I3MA 1G4HA 1W73A 2WU8A 3TQTA 1IONA 4HVAA 3MRXA 4GIBA 1H85A 2MSNA 4WZBE 2OECA 4ZI3A 4Z3DA 3VSEA 2W6IA 3EXIA 2RJ3A 3WO1A 4TLCA 1Z4QA 2YX1A 1ZZGA 5B1IA 2QJWA 4JENA 4P0QB 1QOPB 4UVIA 3CWQA 5E2BA 2X3YA 1NW8A 2H07A 2CBGA 4L7QA 1U2RA 4CM8A 4JUIA 1Y7TA 3VHLB 1OFHA 4MQEA 3QK7A 4UEWA 4B4UA 2P90A 4FMCF 2XCQA 2X22A 2VJAA 4LSWA 1DHRA 5IYZB 2IS2A 3RFCA 4XH9B 2LE0A 3PE3A 4K46A 4A2CA 3AEQB 1Q1BA 3G3EA 1ZKDA 2W7TA 3O9VA 3VOBA 4GM0A 4BZPA 3AEUA 1FW8A 3A28A 2NYAA 2QY9A 2A5YB 2P91A 2WEKA 1RAFA 1YOVA 2I99A 2ZIGA 2ZR7A 2ZSEA 2VT6A 3IV9A 3NJ4A 4UMDA 1MF7A 4RKFA 1Y4DE 5HS6A 1IQ0A 2VK2A 3SGLA 5ALIA 1CZOA 5IBCA 4O3FA 2J30A 2OORA 2V6JA 5FBKA 1RJ9B 5T3YA 3RF6A 2H5JA 2RI1A 2PD4A 2VDQB 1KEVA 2WAMA 3GCGA 4QT0A 4AS1A 3CZQA 1TYBE 3CWZA 3C3JA 3CF4G 2F9LA 2WHRA 3W5IA 5JALA 3L8GA 4MR8B 1RP1A 4ZOAA 1FTWA 4HWRA 4DBVO 1A4IA 1TW2A 1HDRA 1RWQA 4Q9JA 3WYCA 1HDEA 2VNAA 3QWAA 3HA3A 1SU6A 2DPYA 3EUAA 5EWJA 1SHZA 4RMNA 2J87A 2FWIA 2WD9A 3KP1A 2ZZNA 2SKDA 3A4IA 3HBLA 3Q7TA 4Z53A 4BV3A 5HF8A 4BECA 4W63A 3DV9A 2TECE 4GDMA 1AF4A 2IZ5A 3NIFB 3ZKWB 4BE7B 4YR9A 2F8MA 5EJ2A 1P7WA 2QLFA 3CUUA 3IDQA 1UINA 4FD2A 2EBWA 3L0IB 4PXSA 5EGNA 2QUKA 1M34A 3IUEA 1YOBA 4KQ2A 3ONVA 4F12A 4L50A 2YXDA 2H3EA 4R0NA 5HTKA 2DFVA 3HXMA 5CJJA 3GLGE 4IUBS 2XIJA 5DRYA 2IUTA 2PH7A 1YA8A 2FE1A 3EPLA 2IXGA 4GX1A 4OHKA 4Y30A 4EO4A 2DEUA 1E66A 1PWYE 4YY3B 1JLSA 1MCZA 5H9WA 3PWKA 2B4AA 3TI9A 2HD4A 1Z38A 4Q3LA 5SZIA 4AICA 3IT1A 4F60A 1K4MA 2OGZA 2Q5IA 2GNAA 4QXQA 4EYOA 4WOCA 1DAMA 1JFFB 1I4WA 5FLKA 2IBTA 1DAEA 2EJTA 1XQVA 3S6JA 3I1YA 2Y0DA 3UPDA 2Q6TA 1N6KA 3M3HA 3PDUA 2DUWA 4RCVA 4RTOA 4P4UA 2ZS8A 3RABA 1N2XA 4GP7A 4A0RA 3GLQA 3SIXA 4E09A 1G5QA 4E3ZA 1OBOA 4MH0R 3IAXA 4B2YA 5JZOA 5JQGA 1YQQA 2QTBA 1DMRA 2LZ0A 4U00A 1JX6A 1DAGA 2G83A 2H0QA 5KVQA 2ZREA 1CF4A 2XMDA 3QBDA 2ZYUX 1HYQA 1YASA 1Z6AA 1W581 2ZS7A 4L2IB 4R9NA 4DR5B 4JVOA 1T6ZA 3CX4A 3I4CA 4Y0VA 3TPFA 4C4TA 4F6LA 2FHSA 1YVUA 3OZTA 4YDSA 2OPHA 3UYLA 2GF0A 5KUTA 1LJLA 3A7EA 3UZUA 4LYDA 3JS5A 1BIFA 2VP5A 2YV1A 1YIOA 1S02A 1Z33A 3UWOA 1S5PA 3KQTA 4MXDA 3ECAA 4PC1A 1DX4A 1SUFA 4O4HB 3PEEA 5LNK1 5JMTA 4DQLA 1S3SA 1IWOA 1O2DA 1A9ZA 5HF9A 1R37A 3JQ7A 1YU6A 1SZJG 4J6EA 5D6NA 5AKKA 3V97A 5HSGA 3CR7A 3UJ7A 1Q0SA 5JO9A 5NLLA 4F5EA 2FNAA 2CVPA 1N2BA 5BO5A 5HZHA 2QRUA 3P26A 4DG9A 3K9NA 1LB1B 1T0JB 2VZLA 2XCTB 1SRQA 1VHDA 3PR1A 3LBAA 3K9WA 1KRWA 3EIOA 3ZDCA 4FFBB 1A72A 3OFVA 3IQWA 4I3FA 3RJTA 5KX5F 1VRWA 5ECWA 4CM3A 3U62A 1Q21A 3HWSA 1EGMB 3BMCA 3K0CC 1VMIA 1Z15A 3T15A 2O1WA 4Y9UA 3GLTA 1XYGA 3VPXA 1SZCA 2RH4A 1GL9B 4RGQA 2IYRA 1VKOA 1L6RA 4ZEOA 4RDHA 1L1EA 2C20A 2WC1A 3RSFA 2QORA 1EQ2A 1FUUA 2VUTA 1KE2A 1YJQA 3U9TA 4LYYA 5AT1A 5C7YA 3ROQA 2QRNA 3GDOA 3DAFA 5CIQA 3PXEA 5KQSA 4MUGA 5F64A 3ZNQA 3K3PA 4HX2A 1FLNA 1WZIA 1DQYA 1DRUA 4QOIA 3BC1A 1YIAA 3JWIA 2J32A 2Y9MB 4LA4A 5KCMA 1DEKA 4BUJA 4P36A 2DUMA 3OHPA 4Q4LA 3G8DA 1EFRD 4YRIA 4XTCS 1G7TA 2DQZA 1TZJA 3LF1A 4Q15A 5EJMA 4RS3A 4X95A 1F2TA 4X7RA 5DHRA 4B4OA 5K51A 1NJ6A 1EFDN 1PIWA 4E6PA 3VZBA 4XR9A 3OX3A 1UMCB 5EMHA 1GCIA 3NRJA 4M1MA 1T5OA 1KPIA 1N2GA 3I2JA 3BN3A 3IMFA 3LCUA 1WNTA 3JWPA 4PGMA 4OCZA 1EJ0A 2AS0A 2GD0A 2OWEA 1LY1A 2PCJA 5H0IA 3TVTA 4HXEB 4LXTA 4Y6GB 3ZWDA 5KNDH 2GPJA 3ORFA 1J0CA 5CVEA 3U80A 3R3SA 4BFZA 3BE6A 1V3TA 4DZTA 2YMPA 4GBGA 4P92A 1P81A 3KNZA 3QVWA 3M1YA 3DKIA 2ZU0C 4GZMA 1CS0B 3HWWA 2QL5A 3RVSA 4D2IA 5E0OA 1LRJA 2CEKA 5J5VA 1LQUA 1C1HA 3DL0A 3I2KA 1T1SA 1TRKA 1AQYA 1HL7A 2BLLA 2R84A 3MC1A 3KAKA 5TVGA 3T35A 4GQIA 1GZUA 4ZRMA 2D5CA 5IHPA 3UTCA 1VOTA 1ODSA 2H11A 2F9MA 3BWEA 4QQFA 2UUBB 2GYYA 1H2WA 4OHUA 4I5EA 4DGSA 3I8OA 3PJEA 4MP6A 4F97A 3JYNA 3KJIA 2QTVA 1IRIA 3A9RA 1XZPA 1EHYA 2ZRJA 2PGOA 4TVSA 4JI1B 2AJLI 5KCZA 4AKGA 4F6RB 3KJXA 5H3LA 1BA2A 1L5SA 1PTJA 3CHYA 4PG8A 1Z18A 4LWOA 4O4JA 3ZQJA 2BHSA 2I7CA 5FI3A 1KKUA 3N7AA 4HDRB 3F5MA 3QEMB 5TX7A 5LMCA 4KYTA 1K75A 1MT0A 3GYGA 3IE2A 3ZLVA 3KWLA 3PNPA 3D2CA 1EX9A 2Y99A 4UZEA 4XGQA 1D8AA 4ZT3A 1MU0A 4RTJA 1ZJ5A 3JASB 1K9VF 3MAAC 1YHZA 2OCKA 3TM5A 4UAJA 3I28A 3L7MA 5AI5A 3UAVA 3HB4X 2PDAA 3E9EA 3NAQA 4YLYA 2APJA 2HA4A 2IVZA 4L3OA 3ZI7A 2XECA 1G5RA 4QUHA 1GAQA 3SHTA 1B0AA 4P81A 1NI4A 2QZ4A 5CYGA 5FBHA 1ZNYA 1ACJA 2EZ4A 3EW7A 1ZG3A 4MQ4A 5KQMA 4HRVA 4TS9A 5B30A 1K8XB 1D0VA 1G7RA 2WICA 1XEXA 2BGNA 3P2YA 4HWTA 4IWYA 1EG2A 4A0GA 4Q05A 3GJTA 4X91A 2G40A 5HIIA 2OYSA 4Z49A 2E55A 3FMPB 3RREA 1SC6A 3CRVA 1KYZA 1UANA 3X43A 1E5XA 3PD0A 3VJRA 3G7UA 2QYHA 3BA1A 4HDKB 4US2R 1GTMA 3G5AA 4Q7JB 5F21A 3RVJA 1NQXA 1D2RA 3I2IA 3GT0A 4C0XA 1B6SA 4N6GA 1YNOA 1RQLA 1UKBA 1Z6TA 2O2XA 5F5LA 4BRSA 4RW0A 3N53A 1DKUA 4ZOBA 4TMYA 4B4KA 4EUFA 2OO3A 2OCPA 1J56A 3KC2A 4GW3A 3LNCA 1LD3A 5EGSA 3DBRB 3JXEA 5ADHA 1R16A 3BHIA 4JQYA 3WWCA 5D3ZA 1N6HA 3N39C 3CKYA 4JT2A 4RHTA 4YBRA 4Z2YA 4O5OA 5DTMA 1Q11A 5FYQA 2FETA 4CBVA 1KA9H 1ZD5A 2C2BA 3QIAA 1SBTA 1T2DA 4YA6A 4WLOA 4LOIA 1ZONA 4GQAA 4YJFB 1WQ4A 3HADA 3SYRA 5TV2A 1I2DA 1P2SA 1BDMA 3QHPA 5HQ3B 1RWXA 2P2GA 2V58A 2HJHA 2WD7A 3O84A 4RH0A 3ZU6A 4A23A 3W9SA 4QG3A 1DWPA 3PHHA 4DR3B 2VL7A 2FRDC 3QMMA 1NP3A 4BQOA 4KGXA 3HJBA 4G25A 3NNDA 3AVUA 4LHYA 3U4CA 4I1PA 1CUAA 1FK8A 1Q0HA 4NOJA 3IIKA 1NC1A 3LYLA 5GM2A 3IEPA 1XCMA 4O2AF 5D7BA 4GL4A 2OV6A 3RM3A 3FSEA 1ODLA 3WQBA 1NOJA 3AU9A 1LK7A 4MMZB 3Q7QA 3BOSA 5HVNA 4XD7A 2Y0CA 3K2QA 3D8RA 1RRVA 3OBBA 3AJ8A 4RGYA 4KLAA 3O8QB 1KSFX 5CXSA 3ZHRA 2XZPA 4P3PA 3DJYA 1U0LA 2JZNA 4W1QA 3UO8B 3DA8A 3RVKA 4FFLA 1QK3A 4NJEA 1XRLA 2ZJ4A 4HAZA 3RU7A 3UNXA 5BSUA 3WHLA 3CX7A 3ND7A 2UYCA 2C82A 3K4QA 3NQ41 2R8XA 1L7EA 1ECFA 3MEQA 3VYWA 2Z56A 2X77A 3EYWA 3T7EA 1ULHA 4KFCA 1N25A 2REQA 4YWJA 5C31A 1YRLA 4ZVQA 2DERA 1KSHA 2MMGA 1CNMA 3ZD8A 1Q0PA 4CODB 1POWA 2HCFA 3IOMA 4I50A 4JL5A 2NP6A 3N6XA 4WGFA 4GPZA 4AZSA 3MBOA 3SDBA 4E0BA 2PZGA 3O4HA 1P4GA 2HL6A 4P93A 1ARZA 4DLYA 1YULA 1VYUA 1GKKA 2FSUA 4Y7DA 1JNXX 1QOQB 1WIWA 2FFRA 1UFQA 4KNVA 5FUWA 4EGCB 3EW9A 3PZBA 5TC4A 3T5GA 3TECE 4QOGA 2OXEA 2ZRBA 3DTYA 4MV1A 2DQKA 3B1YA 4EGJA 1KQ3A 5M5BA 5LXTB 3FDZA 1ESNA 2C83A 5CJ2A 2QVLA 1J2TA 3LT0A 3PXAA 1M1NA 3PTZA 1Y8CA 1YKFA 2QE7A 1E9SA 3BXXA 3O8OB 4GR9A 3ZWPA 4LMPA 5CB4B 3IHWA 2FOLA 4PTLA 2VKQA 2RAVA 2VDVE 1ZUWA 4K6OA 4K9PA 4RD4A 2ATVA 1UFRA 4P5PA 4BYGA 5ITZA 1IZ7A 3EN0A 4IVQA 4OGFA 2C7OA 2HGSA 3ZW7A 1O03A 3LECA 4C1BA 5JSYA 2X9NA 5WRFA 4R1TA 4OFWA 1DOZA 3DDUA 2MSDB 3KDAA 3OLZA 4RD3A 3PIRA 2QN3A 4WXPA 4M1SA 4WQMA 3LL7A 1IUOA 4RESA 3LYAA 2R96A 4YRZA 1ZJWA 1SHKA 4ZXPA 4B6QA 4J0HA 5DF1A 1ATIA 1U7HA 3G59A 3SX0A 2Q2QA 3A9CA 3DVSX 6GPBA 1I6LA 4NZZA 4PYOA 1QGUB 4DIFA 4TROA 2Q0XA 2FP4A 1PDWA 1U0OC 2VHXA 4FEYA 4IWNA 3WE7A 3U26A 2NSHA 3TRKA 2GB4A 5LIPA 1G18A 1JMYA 1QHEA 1S2MA 5H81A 3IUJA 4H7FA 3QW4B 4BB0A 2QBYA 4KE8A 2IWHA 1V35A 3U31A 1K63A 5E3HA 3LRXA 1FW6A 5BYKA 1NUTA 1EA5A 2RK3A 2QPAA 4L16A 3DCJA 4WKOA 1M2FA 2C57A 4I99A 4RM3A 4HDNA 4Q66C 1BGXT 3WFZA 1G291 4L72A 4Z9FA 4C4RA 2ARKA 4QNNA 1C3EA 1NKVA 3CUTA 2H8KA 2VWGA 3BH7A 3IERA 1HSZA 3PTLA 4WLEA 5TY0A 4OHZA 2W37A 4EEZA 2QXTA 2VBFA 3NONA 4EYQA 3GFRA 4KGZA 1P5RA 4FSHA 2JIZD 3RIHA 3NBYC 3TVYA 4AQYB 3EMDA 1RPAA 3D4PA 1NT4A 1MAUA 3I73A 2CHUA 2JFGA 1U2GC 3FYHA 3OM9A 1RPTA 4DV3B 4XRGA 5G3ZA 3TZKA 1XJ5A 4NE2A 1ZH8A 5FWYA 5JBQA 2YXPX 4G4SO 3SG0A 5MN6A 2NU7B 4R54A 1XDWA 1Y9ZA 2QX8A 4KN9S 4DPKA 4EB6A 2ROQA 4LSZA 3T7JA 3CJTA 3G8YA 4KQHA 3THYA 5FDFA 3GVCA 3U60B 3S2SA 1CYEA 2ZJAA 4Q18A 5JT1A 1T1IA 4L5CA 2YHAA 2YFYA 1JUDA 4HB2A 4KWIA 4YR7A 4BMCA 1RWVA 4D79A 3WO0A 1AKMA 3HCWA 2OHOA 3PWZA 4GLJA 1TQ2A 4OYRA 4FNAA 3UOAB 1GGKA 621PA 2DFKB 2H1RA 1ID8A 4Y18A 1G1AA 1XCLA 4BQNA 2BISA 3CFYA 1U7ZA 5DN6D 1KH3A 1SKBA 4R1QA 1W87A 2XZTA 4CVNA 3HWX1 4QGSA 3QVXA 1J5PA 2MMCA 1F17A 3QKSA 1O4WA 1B6TA 1KOJA 1X19A 1YS1X 3LLSA 1RFGE 4EUKA 1CUJA 5BQ3A 3LDGA 1XXHB 2JIBA 2OLEA 2VXOA 4BLWA 2ZZMA 3GDGA 4UMVA 4H18A 5I5GA 1K7XB 2OR3A 4HJXA 2BOVA 3OZXA 4HNQA 3KBOA 3NEYA 3SQLA 1E4YA 2HJWA 1WLSA 4OQLA 1I3LA 2I3AA 1NQVA 4QEDA 4R84A 2XQIA 4DSTA 2C7PA 4BX8A 3D8BA 4J6FA 3QBEA 4IGEA 3QXHA 2HSGA 3OM1A 2WIBA 5F35A 1TQDA 2BPOA 4LW8A 1D8TA 5EKUA 1RR6A 1W85B 2R1UA 1OWPA 5G2OA 4B0PA 3WMEA 2I67A 1ZINA 4GBJA 4R81A 4B84A 5HYVA 2BY4A 2HYDA 2MINA 4A4DA 2W2XA 4BFSA 1OZFA 3BORA 3A1FA 2JASA 3SU8A 5JFOA 4HZIA 4M98A 3AK4A 1FYFA 4R1OA 5FO0A 3A1EA 1VP3A 5A3JA 3A1UA 3R0JA 3ABZA 3K5PA 4FC6A 1EDZA 5E9WA 5G53C 1KMHA 2EC5A 2XGGA 4ZCMA 4FP9A 3TTSA 1TW3A 3GRZA 4P83A 3WNVA 3TCKA 4MHTA 1DINA 1L3IA 2HSWA 3AT1A 3PD7A 1MP0A 3B20A 4AL4A 4DTIA 1JHOA 1DWOA 3ON5A 1M8FA 2AI3A 1YL7A 1D7OA 1WSDA 4ON9A 5FP0A 5TMPA 1B1CA 1C7IA 4OP3A 2V74B 2P9JA 4G41A 4BEBA 1DO0A 3PA6A 4CQMB 5I5EA 4DR7B 3C3YA 4G0OA 3SZRA 1NLZA 4DDKA 4JODA 4EGFA 2PL3A 3KUXA 3H99A 1BE0A 2CK3D 3JATB 5AESA 1A1VA 4B80A 3SYKA 3LX6A 4HX9A 2GEVA 4YK7A 1ZSVA 1DZ3A 4CL2A 3OA2A 5C5DA 4M22A 1JQAA 4BNDB 1JDBC 3H87A 2DUNA 1C0LA 4PLWA 3W05A 5JAUA 4LQDA 1XF1A 3MJ4A 5JD3A 5TGTA 2Z1NA 3ZZMA 1IN7A 3AUFA 2Y1DA 1A8UA 3EVFA 4ZAVA 4ZCTA 4KREA 3S8YA 1ZGGA 4HUQA 4N8EA 3LUFA 2QVXX 1AT1A 2ZITA 4YCSA 2J67A 5BSEA 2C7QA 1F6WA 1COWD 1GZ5A 1LLQA 4BNTA 2A7XA 3QX3A 1FTQA 1YCHA 2B4RO 1PT6A 1DT3A 2ACKA 3AXSA 3GUYA 3JQBC 3TLJA 5JDIA 2JLZA 2FWPA 3LPMA 1RAEA 1UMDB 1CE8A 2WFAA 3OF2A 3R3WA 3O82A 4Q9NA 4YRJA 4F71A 5I47A 4CG1A 4X66B 5TIIA 3UMJA 2H57A 4FMDB 2AJDA 2XCIA 3AO0B 3F6BX 4PZ0A 1FUIA 4PY2A 1E6UA 4WKGA 3W2EA 3TX6A 1QZXA 3KAPA 4Y1FA 4JJ8A 4XX1A 3EEOA 4FR2A 1LPNA 1T8YA 1OLUA 2IEIA 3M4XA 3OE5A 1FCJA 2Z04A 3FHLA 3QFFA 1GM5A 4MROA 2AVNA 2ODWA 4ETNA 1NFQA 2Q2NA 4LBVA 5IPFA 1GCAA 1IOLA 3IULA 1N2OA 7REQB 2VDOB 3UV7A 3VSDA 3ABRB 4Q37A 3WIDA 1Z6ZA 5H3HA 2WMNB 1P7VA 4EX7A 1DXOA 4XZ3A 1ITZA 3VC2A 3ZK9A 1KFEB 4E30A 1EUDA 3NTQA 4B1FA 2OBFA 3DE0X 4QUJA 5FX2A 3L7BA 1TQ6A 2GPTA 4RLSA 4LISA 4QE3A 3CZ9A 5BT9A 4PLYA 3VNUA 1TD1A 3V1UA 4UU7A 1ORIA 3KQOA 1WSAA 1I0IA 3VTKA 4ZIRB 3H9JA 3DZDA 1XDGA 5J2UA 2C5GA 2ZB2A 3QUSA 5CB0A 5CJPA 3RK1A 4BVGA 3NLLA 1VZ3A 2FK7A 2IIQA 2X4LA 2H2HA 1RADA 3G23A 1OPRA 4Q9DA 2CZCA 3MJCA 3W7VA 3GJ3A 2ZANA 1T3SA 2YDYA 4L9RA 3RYFB 5CCXA 1EZ1A 4NU0A 4TYMA 4DGQA 4ENRA 3G5MA 5DHAA 5AI6A 4IIUA 2NM0A 4ME6A 4RWEA 5FFMA 1JTFA 2CNDA 3W3AD 1X7WB 3OZUA 2ZUCA 4IX9A 5CVUA 1ICIA 3QEKA 1K06A 3OZRA 4R9UC 4BDSA 4HQKA 2VJQA 3JAKB 2YHIA 3CC8A 3PPVA 4OQ4A 5BORA 4C3OB 4PQYA 4QIHA 3IUQA 1Q3KA 2GWHA 4F1JA 5D51S 3G5UA 4K2AA 3T06B 1GUZA 3EZ7A 1C80A 4KOAA 4KO1S 4WBXC 4XEHA 4ARSA 2H9YA 3RHTA 4FKZA 2UXBB 2M1ZA 2ZJZA 3I5AA 3WZMA 1XT6A 3EHDA 4ZREA 3F78A 4D82A 1QQBA 2X8LA 2WF6A 3D4NA 5JS2A 4LZLA 1E98A 2AJTA 4IHJA 5FTWA 4RZIA 3K70B 3MLBA 4PBRA 2C9DA 4XWAA 5BSRA 2GCEA 4PGFA 3SF8A 2HC9A 1ISJA 1EFKA 1E3DA 1Z2CA 4TPKA 4M4SA 4RX1A 4A6EA 2WU0A 1EM8A 1Z7YA 3R3VA 1GGMA 1WB5A 4L75A 1C9JA 1K88A 3DFIA 1DTWA 3GGGA 1NN3A 5B12A 3MT0A 3SQXA 1FJ2A 2XMBA 3FGZA 1OX4A 3BSSA 3IAUA 4RMHA 3MWLA 2CJWA 5CD9A 1Z2DA 3TZBA 3QYPA 5BV1A 5EJ9A 1LDNA 1L8QA 2X23A 4M1QA 4KX5A 4UBIA 1A8PA 3QUQA 1NE2A 1GZSA 3KCNA 1XWWA 2VP2A 1GGHA 3ND6A 4HEQA 3KKPA 4IDNA 4RZXA 3FCSB 3PUVA 3VYVA 5IEJA 2QM7A 5KYNA 2Y1KA 3DH0A 2F6RA 3PEWA 2JA2A 2WHQA 4JP5A 1HFJA 2H5EA 3SXPA 3NVAA 1GHTA 3PB3A 1CETA 4YO8A 3RH0A 3FG9A 4EF6A 2K6GA 4DJEC 5KOYA 3ZD6A 1IMOA 2P4SA 4Q1VA 5CX4A 3TLYA 1B7GO 1Y6QA 5CXUA 1Z5GA 4XOUA 4EYKA 1KFKB 2A14A 4Y2UA 2JHCA 4L8VA 1QTIA 3ES9A 1FDIA 5KMGA 3DEYX 4W5HA 1W9MA 2MR5A 4R83A 3D6NB 2FRXA 3M5WA 4OMFG 5AQEA 1Z2PX 1NV9A 1NAIA 1K3FA 1MD9A 2C84A 1UBFA 1LDYA 2QP4A 1DAFA 4BNKA 2Z0MA 1IEXA 3G2KA 3KHUA 3O4FA 3SSNA 1DEXA 2GK3A 3CRQA 4JWTA 1ZXXA 3TUJC 1UBGA 1MEOA 4J7XA 1MC8A 4KO2S 2FF7A 1JDPA 2QT0A 2XNCA 1L5RA 4ZVLA 4MA5A 3GY0A 1OGIA 1WKBA 2X4DA 3ANTA 2HJVA 3C7AA 1H22A 1Q12A 4YAWA 1EVLA 2ZGVA 5KJ1A 1VL5A 4P4SA 4P0PB 4QXPA 5DM4A 5C9ZA 4MVJF 2LBPA 2A9RA 3HCRA 2IYOA 2C29D 2QGZA 4NBRA 5AI0A 5CVCA 3RSCA 3A6KA 4Q4CA 3G0DA 3WYFA 4G5HA 4QBGB 4M1EA 4XWTA 5ALDA 2VI5A 1L7DA 3E7FA 4DY4A 4KH1A 1HZZC 1P7YA 4PCUA 2B61A 3I30X 4Q21A 5EE1A 1TZBA 2Z95A 1M6VA 1X7XB 2KW5A 2ZWIA 1JHRA 3FZEA 3GUCA 3ND5A 3NWJA 4RK6A 1L8AA 1E69A 5D00A 1JHVA 2Z8YM 3RSHA 3T7SA 4B0OA 1EXVA 3LCCA 1P0IA 2G67A 4FSDA 4OYHA 1YQGA 3LY5A 4GE0A 4Y2HA 1HYBA 1Y1QA 4Q7KA 3VVLA 2BZ0A 4HMPA 4UXIA 8LDHA 1OFGA 3AMVA 3HBFA 4B6RA 2ZIZA 1P5FA 2QX9A 4H0CA 4YTEA 2ECPA 2WU4A 3O93A 4TM7A 3ED5A 4MV6A 3PICA 4P3NA 4JXJA 4M1WA 1XLTA 4MS3B 1FX0A 1JR4A 1YMUA 1RKXA 2ZYHA 3STXA 4C0KA 4MVWA 3F3MA 4JP2A 1T29A 4UU8A 5JNTA 2ODEA 3H75A 2XQGA 4L08A 2ZRHA 1HDXA 4FN4A 4QPCA 5HK8A 1Z8HA 4JYCA 3V4PB 1EQUA 5IH7A 4O02B 1B23P 1J2EA 3DMTA 3LUKA 1QKIA 4MLPA 1OIVA 3H1AA 2GCOB 3CRZA 3MWKA 5K09A 3LX8A 2WF7A 1AS3A 1OU0A 4J0DA 1W4LA 2BDEA 2PX4A 2JJ1D 4G36A 3GN2A 1AHNA 3H2BA 4P53A 1D6NA 4TXNA 3M83A 3WQSB 1J2YA 3QU5A 3W8EA 4C06A 2AD5A 2WHPB 1H0HA 2WWRA 2VZ9A 3AEZA 1JT2A 3HY4A 4Y6LA 3HVJA 4BVBA 3FYDA 3O21A 2NUTA 1QYRA 2CXHA 3R8XA 2O52A 2O8DB 5BPFA 3BD6A 2GAJA 1OAOC 4JOCA 2VYNA 4RQBA 4JCOA 1SXIA 1DRVA 4P80A 1KU6A 3QE4A 3BXZA 3RKRA 5KI6A 1TYZA 2HK8A 3V8PA 1L1QA 4DANA 3LKVA 2A5DA 3ONWA 5HCUA 1QMPA 1VRVA 2F90A 3AEYA 4AVYA 4Z1OA 2AFHB 1NNUA 1NRWA 3QXJA 5IAKA 3WZLA 1U8AA 2GARA 1RQXA 1ZLXA 1E9FA 3EXHA 3MWEB 2W2QA 5ENVA 1WW2A 5LMUB 3C5WP 4J90A 2GNOA 1ODTC 4XRRA 4X7MA 3L92A 1T0HB 1LSJA 1L7OA 2IT1A 3AU8A 4NPCA 3RVDA 4NV1A 3CZRA 2D2VA 4BC0A 3SM9A 3X1XA 4RZ2A 4BZQA 4QXMA 4JUCA 4KN6A 1JI0A 3Q1LA 1BS2A 2CNKA 4O4IB 1P6QA 1QH8A 1SG0A 1D9ZA 1XFDA 3RADC 2G82A 4AJKA 1F4LA 2F00A 5IJ0B 1SUIA 4JJIA 3HM9A 5A9SB 2NU8A 2DT8A 4LF5B 1Z82A 2C4WA 4NMLA 3UN1A 1Y1RA 1YH3A 2D1RA 2VAPA 4L27A 5ESXA 5DN6A 2GK7A 4NF2A 4OHMA 3EEBA 2WJJA 1J2UA 1S2DA 3T5DA 2WPDD 3AFMA 1AD2A 3T9AA 8GPBA 3O73A 1KSJA 3EMVA 3RHZA 3GFPA 1E63A 1XU7A 1CF9A 4WH0A 5B7PA 5JD6A 4O59O 5K8LA 3ZCQA 1WZ2A 1DARA 1B74A 1GTL1 1ZM9A 2P4EA 2JZOA 2DF8A 3GEHA 3LQFA 2BEUA 1IBCA 2EG9A 2WUDA 4IJQA 5JEEA 3EIHA 4RVHA 3OQVA 2DHQA 2EDAA 1NVMB 3EQZA 1QRTA 3VZCA 3NM6B 4HZUB 3SOPA 1Q0TA 1A5ZA 1O95C 2X8AA 1CR2A 1O9GA 3DBHA 3MCZA 5DYNA 1U3UA 3JYQA 4Z0HO 1H3NA 4UTZA 5IC6A 3SLRA 5DPMA 3U17A 3H8VA 1LTQA 1N1DA 1GNSA 2NNWB 4LV6A 2B4YA 2JRLA 2WJPA 3CKLA 3HFRA 4CKZA 1JQEA 4GNKA 2V59A 4ZCLA 1TZKA 1JJBA 2W6JD 1Z0UA 3DDNA 5JR3A 2FWJA 3VPHA 3GJ4A 2JKVA 2WDPA 1I6WA 3FNHA 4K0RA 1S8AA 1FEZA 2C4TA 2ACWA 3CPHA 4KTTE 2EJWA 3AVVA 1NF9A 1UCFA 2R85A 1E99A 3WGIA 4EHIA 1YI1A 4KSCA 3JYOA 2JHPA 4WUVA 2RBKA 3FOEC 1ECGA 1I10A 5LQSA 2OQ2A 1EXWA 1N5MA 1YJCA 2FMFA 2NX2A 5DBIA 5EN4A 1CW2B 2PGNA 3SJZA 3P32A 3OPVA 1HF3A 1W88B 1KY4A 2P40A 2NO0A 3EUWA 4YDQA 2BFOA 4H3VA 3NAGA 5L4LA 1JU4A 5DLPA 4LYAA 4PO1A 4E22A 1KDRA 1V7QA 1Z8DA 2CK3A 3T1VA 1VECA 4QBHA 1UXIA 3WLAA 2C98A 4KW7A 1CBUA 1PL0A 2I7DA 1F6BA 2XJ4A 5LSAA 2E89A 2CMGA 4LY9A 1TB4A 1VI6A 2HSEA 2XVZA 3MERA 1UDAA 4PSVA 5E7IA 5B1YA 1UBNA 4I9HA 4RL4A 1PGPA 3DUFA 1TA9A 4AXBA 1GPNA 3PX2A 1NZJA 2HIMA 3RWBA 2M6KA 1E60A 4BV2A 3FMVA 4WMLA 1QUFA 1ZU4A 2SCUA 4NCIA 4OAOA 1YACA 2Q3DA 4L5BA 1Z74A 4HTAA 4P7GA 2V8OA 3I6QA 5ERYA 5SY9A 4O4LB 2REOA 3RHSA 4F0JA 1KYQA 4JVLA 1ZR4A 1BKYA 2BGWA 3NXKA 5G0WA 4OMUA 1MHTA 5H70A 3IAAA 4MV0A 3N74A 2Q5OA 3VU0A 5FNVA 3TNYA 1HFEL 2HNBA 2E4ZA 5KJFA 3AM1A 4B4VA 3ESAA 1OJLA 1Z12A 1UOPA 1NM5A 1Y89A 3Q9UA 4MQFA 2QMUA 2IELA 3IUMA 2IHJA 3TN7A 2QV0A 3QLUC 4Q0MA 3NTOA 4JZKA 1L6IA 4KRYA 1PR4A 1GLGA 4BNJA 1QV7A 4Z4CA 5KKNB 3JALA 2M6LA 2QP9X 3C6KA 3QMPA 4KQCA 3TO5A 2H29A 3Q8LA 1JWLA 4TUYB 1E1QA 1ZI8A 2V65A 1KHTA 3FPBA 2ZSBA 3L7NA 4XX0A 1XE3A 3AVOA 1ZUHA 1H1LA 4TQGA 1U8XX 5C46F 5FOVA 4AUNA 3R6DA 3A1TA 3JYLA 6REQA 4PWYA 5IT0A 3O2SB 4KQ6A 1T3ZA 2GA9A 1VL2A 2Q29A 4PC3A 4AYTA 2DQ4A 1GTVA 2WKRA 3TQFA 3QGMA 3SJCA 3JU3A 5EZ5A 4M2LA 1J8YF 1ZM4A 2ILTA 1ADFA 5I9MA 4YV2A 3NBMA 4IDHA 1NVKA 1QG6A 2ETXA 4DDTA 3W5CA 2Z6QA 3JD2A 5BSVA 5L6MB 2EXXA 3KHTA 3MHPA 3JVVA 5KINB 3W0LB 3UYKA 4M0UA 3GLIA 1NPTO 4NEGA 5CFZA 1CERA 1MA3A 4HAWA 5BN5A 4CL3A 3W3AA 4PYLA 1T4DA 1JEEA 1KEUA 3QUCA 1VKZA 3R7WB 4ABTA 3R2JA 5E9JA 3KTAB 3V7WA 1PEYA 1JPNA 3O5AA 3CIFA 5E4FA 4AD8A 2C9MA 4YP7A 3F7MA 4UTNA 5IAOA 3ZV7A 4M9CA 4UREA 3FZGA 4WTOA 1V3VA 3D6AA 2GJ8A 3EGWA 4HEHA 4XIFA 5B55A 3OZ7A 1ZCJA 4I8DA 3WIBA 3EC1A 4UCXA 4H0FA 3ZYZA 1BQ3A 4XA8A 4Y8VA 4MQLA 1ZJ4A 4E7OA 3EVGA 4WY5A 2JGRA 5CVDA 3I9KA 1PDOA 3UCEA 2H2AA 2WF5A 1FNCA 3D6FA 4J0QA 5KHAA 4F3YA 5JS6A 1W35A 4OFBA 2GEDA 1U0JA 2OAEA 2YZGA 4ZEVA 5LDDC 4EKGA 2XXAB 3LXMA 4N6NA 4E2YA 1J33A 4KGVA 4RLHA 2BE7A 1CFZA 1LLUA 1SHLA 1Z29A 4HN9A 4R6XA 4YASA 1SFRA 3TQQA 1LA2A 1ZHHA 4DIKA 3LP5A 3RWMB 3QFHA 4D4MA 2OY0A 1UK8A 3HJNA 1P1CA 1HA3A 3L7LA 5HUJA 2ZRLA 1RRFA 2PQMA 3U4GA 3COPA 4ED9A 1NNEA 3FJYA 3ONFA 2YMMA 4QGHA 1MABA 3MILA 4MCJA 1OB2A 3CSSA 4Y1RB 1PYGA 2YOGA 1T2NA 3BDIA 1JG1A 5LOVB 1UPBA 1NASA 1BS1A 1R0KA 2QJOA 4F2WA 3FIUA 1UZMA 1K5PA 1RLOA 4AU1A 2PMBA 3H4TA 2VPXA 2H4FA 3JV7A 4RYDA 1DJPA 2GVZC 3JX9A 3HA7A 4Q16A 3ORRA 2NV6A 3RVNA 4AUMA 1EDBA 3H2IA 4WT7A 5LD2C 4YJGA 1ELOA 2VPWA 2G06A 4WK6A 5EJ4A 1G21B 5DLQC 4E4TA 3EZLA 2F4VB 2H48A 4G4SP 3MPUA 1R5NA 1ZOIA 2GLXA 4Q93A 1Y8QA 4O2LA 1NW9B 3GPDG 3WK9A 1JU3A 3FJOA 4B3FX 3FY4A 5DMXA 3CLSC 3THWB 3DW3X 5JPCA 2Q6KA 3NM5A 3CF2A 3OOJA 4GGMX 3IDZA 1SEPA 1AHHA 4I55B 4U5XA 4UBOA 3FWYA 5EIBD 5B6IA 2UZ1B 3HP1A 4D8VA 4F6CA 2HBRA 2HU5A 5EIHA 4GLFA 3ZHCA 3DC2A 3HZOA 4OIFA 2BBSA 2ZXEA 4GGPA 5IJZA 5CDGA 2Z8ZA 3THSA 4ZO9A 4J7AA 4AIIA 2W00A 2PMEA 1GGNA 3GGJA 2QVBA 2BGTA 3JRXA 3KWJA 1B6GA 1SG6A 4NRDA 4N5DA 1D1QA 3CPSA 4UJ3A 4HO1X 2HWUA 4WKPA 4DEVA 3AHCA 3OPMA 1SA0B 4LYFA 4A73A 5BSKA 1M1YA 1YZUA 3LM8A 3N2IA 2J0SA 2LKDA 4GECA 1XKLA 3EVEA 4IGKA 3AEKA 4BIIA 1EXNA 4XPIB 4IILA 3C7TA 3ZKAA 2ZE8A 2GBIA 3L93A 3PXGA 3FDIA 2IDMA 4UEOA 4EVQA 1DQSA 1TKAA 3D5EA 1H1TA 5K0NA 1MB3A 3IVRA 3TLBA 2JKZA 4TWIA 1EFPA 3MBIA 4YAJA 1BEEA 3GCWA 1L5KA 5LZ5A 4AF6A 4CCAA 2VP3A 2CXUA 4P3XA 1PZFA 1Z3CA 3LKZA 1VA5A 4W8GA 4I2VA 3VKFA 3E3AA 4MR7B 1W36C 4X62B 4NICA 3VQTA 1JR6A 1FSSA 2AN3A 4QFMA 2JB9A 4EPRA 4PC2A 4YLGA 3DKVA 1F4PA 4M1OA 3SE0A 1T10A 2I71A 4DNXA 4EG1A 5IM4F 2ZBPA 5I8ZA 4EY8A 1G2QA 1ZH4A 2IIPA 3OCWA 3QPBA 3LLCA 4PLHA 5ALHA 2JPDA 3PNKA 2J5BA 4BZXA 2RHTA 5C80A 1IN1A 4MYTA 1HETA 5IBPA 4DBZA 2RAUA 1TTHA 4MK4A 5E8RA 2FZVA 1L4HA 1HE2A 2AYXA 2CFSA 4HTFB 3F5SA 2RCYA 3UJBA 4DM4A 5C5CA 2F8SA 2BBOA 3G9TA 5IVIA 3CF4A 4U2DA 3FKSD 2MYPA 4UE6A 3GFGA 4XWGA 4ES6A 2AEMA 3DAYA 1XA0A 4YHBA 5CEJA 3TLGB 3UMSA 3KVRA 3T9FA 3DE6X 1DIBA 1SXJC 1DTSA 1C4XA 3G2PA 5A3VA 2WWWA 8MHTA 1JKIA 2CNWD 3DE5X 4MRNA 5LJLA 2K2WA 4WEOA 5JY6A 4JD5A 1OC2A 3QVMA 1EGQA 1NJGA 5CIWA 2PZKA 2H4ZA 2VXYA 1XEAA 1B8OA 3TYXA 1UT8A 4RPCA 5SV2A 5TB5A 2GHQA 1VJ5A 4DMFA 4LF6B 1IM8A 3LMKA 1Q20A 1QCYA 4FQ8A 4FW8A 4CGZA 2P78A 3JVEA 3QEJA 1JHPA 5JAIA 5J58A 1E2DA 2D2EA 3ZGNA 4IH4A 4S1VA 1ADJA 3PSHA 1BA3A 3KJEA 4RDXA 1VA4A 4CKEB 3STHA 1DJLA 5KNDD 5CLLA 1YVEI 4LDPA 4OX9Y 1R6TA 2BH9A 3B78A 3REOA 1XXHE 2N1BA 4C22A 4BMNA 4PNPA 3QF4A 1ZI9A 3RLIA 1R6BX 5COAA 3V9PA 3NCHA 4KE6A 1JQLB 4E5SA 2QW0X 2ZT6A 4YREA 1MOQA 3LP6A 5DK4A 5E6SA 2QZJA 2UUPA 1KJNA 3R3ZA 4HADA 1GIAA 4K26A 3W2IA 4ALNA 4OB7A 3VTFA 4EBFA 2DFNA 1DB3A 1MW9X 4HLUC 1ZGJA 2INGX 3LLVA 4R3UC 4URWR 5LQRA 3O8DA 3N2KB 4R1NA 1EJ2A 1YS2X 4Y2QA 2X0KA 2A5LA 2VG8A 3BWYA 4D8XA 5EESA 4FMCB 5IBRA 2DP4E 2WPDA 1DIAA 3FRHA 2FSVA 4M9RA 1BCSB 5TMBA 1MRSA 3LUGA 3LWBA 2RGRA 2Q7DA 5LDGA 3K9BA 3QX8A 2F2TA 2QMYA 4JLUA 4D9NA 4JMPA 4UDOA 4NI5A 2GEJA 3HU1A 1WJGA 4G0XA 4U2BA 4JHXA 4CMJA 4D9CA 3I58A 1CLUA 1T3GA 5KAMA 4MUIA 3TBHA 2FZLA 3GUUA 3ZHZA 2V3CC 3DOUA 1PK8A 1PLLA 3T1TA 1ACMA 3OOEA 2NPFA 1XD9A 4B3GA 4AS3A 1I4LD 1CUUA 5C51B 1JSZA 1I13A 4QU8A 3VO2A 4JROA 2Q46A 3DD5A 2UKDA 4LS3A 1W1IA 2F64A 4WK2B 3RDPA 4P5DA 3H2KA 2FR8C 1CY0A 2WTAA 3TWOA 1IDOA 1XELA 5G1NA 2WTUA 1P7PA 2H0RA 4Q9HA 1QFMA 2ECKA 2XA1A 3IEKA 2W6JA 4X8LA 1J24A 4ECAA 4FOLA 1BDBA 2OHGA 4MPRA 3GROA 2E9SA 4DNOA 1UPXA 2HTFA 3ER6A 2B36A 1J7JA 3L01A 4GOMD 2BMAA 5DISB 5E2AA 4ZC8A 2F4NA 4YAGA 4WBNA 1FJGB 4HT3B 1SAYA 3EDMA 3Q3JB 1YS7A 1Z8FA 4EVSA 5DNEA 5KYYA 2IY7A 1WP4A 2IBSA 1JIVA 5EE0A 3E2IA 1CY1A 1RLMA 4JBNA 2C3UA 4BN5A 2VO1A 3ZCTA 2JD0A 1J20A 2O20A 4JSRA 2PD6A 4V38A 2QY6A 3N75A 1RHRA 2ATIA 1YDHA 2DECA 3F47A 3K9GA 4HAXA 1NXPA 4DIEA 4DN6A 4EKIA 2D6FA 1GUDA 2QD1A 2ACVA 2JFWA 5B4VA 1NSYA 1QV9A 3GNTA 4TTRA 5JWOA 1V45E 2FPGA 4ZT5A 1XZMA 3TK1A 2NO1A 2XDYA 2XOKD 3ULKA 3TMAA 4L28A 1WW8A 3BJEA 3R5JA 3E4CA 2XNHA 3C3BA 5TE9A 3GEPA 1MNAA 4TL8A 4HV4A 3OH8A 1KEPA 5ANRB 5IWAB 7ADHA 1KK1A 3AUKA 4OP1A 1OI2A 2BFCB 2GJKA 3A6LA 2AE1A 2E0IA 2QTRA 1G8AA 2OBNA 2CFTA 3M3PA 1EE9A 1EFVA 5DEIA 5C4MA 3KTOA 1QHHB 4DA4A 1ZEMA 2QX6A 1YSCA 1ZMRA 2NUPB 1CC1S 4GSLA 4A8JC 1E2MA 2C5LA 3A9SA 3E8MA 3UXYA 4JEIA 1UBCA 1C1DB 5K8CA 1SUCA 1FDWA 2PYZA 5EG5A 4R05A 4UASA 4GS5A 2OBXA 4RA6A 3KKZA 1CY2A 3VFDA 3AUTA 3STYA 3JQQA 3UK0A 1DAOA 4TGLA 1NXQA 1O6CA 4QXOA 1CD5A 4XI9A 2C5SA 1WDLA 3TCNA 1NJ1A 4G0MA 3MCVA 1PWXA 2O50A 4FFVA 4PC6A 4TWRA 2OAP1 2Y1GA 3ACCA 3DZJA 3MTJA 4JC5A 3VSAA 5EJ7A 3L0DA 1W6UA 4E5DA 4KCGA 3LFUA 2YRFA 3BQNB 3M2PA 4MRAA 3OZSA 3FF1A 2YY5A 2W58A 3DOIA 4X45A 3SP1A 3RBVA 1DKOA 1GPBA 3V3TA 1SU8A 5DI3A 4F4IA 4ITUA 3H1FA 3H5LA 3NJ8A 3AM4A 4A8TA 4BVEA 5K9ZA 1RACA 2X7JA 2F1HA 1NVVR 4YJ3B 2CEAA 1TIBA 1Z34A 4DSOA 3CZMA 1FNNA 1T8UA 2ZI6A 3TPZA 2OXFA 3QMVA 1I2AA 3FB1A 1XYYA 2YL2A 1OFUX 3O94A 4PXAA 4DA9A 1U7UA 1QFXA 1UADA 3FMFA 2KBEA 1TE2A 4FI3C 3PS9A 3V1NA 3DE4X 3E6AA 5C7IO 5KX5B 3MELA 2VJKA 2ZBDA 3RE1A 3VPAA 2FQXA 3DPIA 5HFAA 2CMHA 3D31A 1DWQA 3NT2A 4AP5A 2A3RA 1GV1A 3TW8B 2I4TA 4DWVA 4H6VA 3NTVA 2Q45A 5EWLA 1SQGA 1CZHA 1W8IA 1ZVKA 3CJRA 4UNIA 4EEXA 2UXCB 4FDTA 3GGDA 1WCIB 4GRIA 4MARA 1YE8A 3VH2A 2CBXA 3F6YA 1IYZA 1PYDA 1TZMA 2ZE7A 2QUBA 2ZYSA 5T4FA 3KQLA 3ETDA 1SXQA 2EKBA 5CX1A 3GR6A 3WK4A 2G7MC 2BZ1A 3K5HA 4YN3A 2V7QD 1NXTA 5IABA 4XFKA 1SOMA 2C77A 4E2WA 4E5KA 3HGQA 4QTTB 1T4CB 4WJKB 4DV7B 3BMOA 4KRGA 1LDGA 5FBLB 4CEIA 5LMZA 1UJBA 1Z4IA 1CJUC 3OCXA 4BO7A 2IS6A 3UA4A 2WZBA 2VP9A 4PZDA 3OIDA 2Y1LA 5B3LA 3V7UA 1TM2A 1NQAO 4I3GA 1R8YA 2J3LA 3MUOA 3QVTA 3TR5A 3B3FA 4TTTS 3MQFA 1LCIA 2CKDA 3G2LA 2C1ZA 2GGSA 5K3OA 3TSZA 2WMYA 1T4BA 4DYDA 1Z6GA 2VJYA 3B12A 3B1WA 4Y2GA 3FW1A 4IM7A 1V8DA 3IKLA 4CDRA 2PIAA 2VNHA 1Z5NA 3QVSA 1OF1A 4MGZR 5AUQA 1GARA 1XD2B 1C4OA 1ZIPA 2E82A 3MJDA 3KQHA 1V8FA 1NR1A 4DJDC 2Z1MA 1RQNA 3H6KA 5EINA 3PFGA 4HF7A 3WQQA 3QJYA 3VU9B 5J23A 4YCAA 4R2JA 1Y8ZA 1JEOA 1N9GB 1OI3A 1T4MA 3D3WB 3LQQA 4QDOA 4IKOA 2A0FA 1MO4A 4LI3X 1UFKA 3AF6A 3SMVA 3ZUPA 4C14A 1FVFA 3VR4D 2VRBA 2BTEA 1G7CA 2BZSA 2Z57A 4M60A 5ESWA 5AH0A 5BMVB 3UJDA 1Z28A 5EUCA 5K0BA 3O74A 1F2VA 1T15A 5B4TA 1J8VA 3IQEA 2D5IA 1RW4A 2LR0A 3EA5A 4NABA 4U0JA 5TQ2B 3UANA 3PJRA 3TEJA 2PXXA 3JQAB 2B8TA 1S89A 1N2EA 3H05A 2B4TO 2DLNA 3TLAA 3WNZA 4PNEA 7GPBA 1W5SA 2C78A 2QAIA 1W4CA 3ESXA 3CH4B 4J0GA 4J1TA 3F98A 4LBZA 4BNWA 2VQ3A 2BDUA 2VUIB 2X3UA 2XSZD 2O59A 2BI4A 4ZOLA 3WGVA 2IS1A 2FPSA 1L3BA 2KSQA 2X0FA 3OQNA 1V39A 3B6ZA 3P9PA 1GGFA 3P9NA 4DADA 1SUBA 5ALSA 1NN0A 1OYWA 5CDTA 3IL2A 3P52A 1E8MA 1ODCA 3DNMA 1G20B 4MDFA 2XHEA 2BEKA 2JHGA 4C3VA 5E4YA 1T9GS 3CNEA 2C2KA 2VWQA 1SCUA 2BV3A 4HXGA 1EA7A 4AJ2A 1N6PA 3GGSA 4IXDA 4MRVA 1FFAA 3VPSA 5IT5A 2YS7A 1W4RA 1VCNA 1D7AA 2E37A 2FUCA 2PUAA 2H00A 3ROPA 1VSQA 3Q3GE 1OA0A 3ZH9B 4CFYA 2GZAA 1EFTA 4J43A 1CP2A 3DM5A 4XXHA 5JI2E 1TM5E 2IYUA 1FOEB 4X7BA 1QP0A 5IAGA 4EUSA 3BGVA 4ZVPA 1G8YA 1JAIA 1CV2A 2OQRA 2W2MA 2WUVA 3AM5A 3S2GA 3WBKA 3E7PA 3IAHA 3LA6A 3I8SA 2C7GA 1VHWA 2D54A 2PKCA 4I4TB 2XT0A 4GXQA 1HG1A 3ZV3A 3HB7A 3UK2A 4Y2VA 4CU2A 2WJGA 2QRZA 3DWGA 1DBIA 2YMQA 1SR8A 2ANBA 1VMAA 2DBYA 3FTNA 3HU3A 1WBJB 1Z6PA 1SVNA 4WFJA 3IUSA 1BDIA 3AHEA 5ALPA 4Y1EA 3ZDYB 4CKWB 3KEQA 2OCAA 1UJ5A 4OY3A 3TXYA 2IU6A 1HNXB 2GSWA 1C9EA 2QF7A 3DEKA 3WV4A 2O8FA 3INYA 2EX1A 1FS4A 1CDZA 1TU3A 2IF0A 2OBYA 4GRDA 1FF9A 3FSGD 1FXUA 2VPYA 4JZYA 4BLPA 3L6UA 1LNQA 3ROFA 2C2HA 3X1WA 3F4BA 1PG5A 1JFSA 2NSLA 3JD1A 3U61B 3H9UA 2F17A 2IOHA 3EZ9A 3T0IA 2AFHE 3EGXB 1SUDA 1QIKA 3WSVA 3TM4A 2J1LA 3QUBA 5IT9A 1SY7A 1SZDA 4MUHA 1B14A 1E4EB 1D0IA 2YJZA 1Q92A 1OXTA 3NHJA 1UJ6A 1UBLS 1QYCA 1OWNA 4NECA 1IEVA 3WG9A 3REGA 4RIGA 3Q7EA 3QVLA 2CNWA