2C7BA

The crystal structure of este1, a new thermophilic and thermostable carboxylesterase cloned from a metagenomic library
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
294
structure length
294
Chain Sequence
LSIAASPQELRRQVEEQSRLLTAAVQEPIAETRDVHIPVSGGSIRARVYFPKKAAGLPAVLYYHGGGFVFGSIETHDHICRRLSRLSDSVVVSVDYRLAPEYKFPTAVEDAYAALKWVADRADELGVDPDRIAVAGDSAGGNLAAVVSILDRNSGEKLVKKQVLIYPVVNMTGVPTASLVEFGVAETTSLPIELMVWFGRQYLKRPEEAYDFKASPLLADLGGLPPALVVTAEYDPLRDEGELYAYKMKASGSRAVAVRFAGMVHGFVSFYPFVDAGREALDLAAASIRSGLQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYLESTERASE
publication title Crystal Structure of Hyperthermophilic Esterase Este1 and the Relationship between its Dimerization and Thermostability Properties.
pubmed doi rcsb
source organism Uncultured archaeon
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c7bA00
4OU5A 2CB9A 4B9EA 1HPLA 5LZ8A 2HA5A 1AQLA 3GZJA 3O0DA 2P8SA 3WWOA 2JEZA 1HL7A 4KAAA 4G9GA 2I78A 3WA7A 1QGED 4P92A 4PSDA 1XRMA 1FFCA 5LZ4A 1CEXA 4GWLA 3WWDA 1VXRA 1SCKA 3ANSA 4W9RA 3W9UA 4U2DA 3IUJA 4X91A 4H77A 2WUEA 4CG1A 4FKBA 5AM2A 1UXOA 3MGAA 1X2BA 1ORVA 4PO3X 3W06A 1ZD4A 5AM0A 3STXA 5LYYA 1DWOA 1ODTC 3DDUA 4C88A 2QR5A 2GBCA 5K3CA 5ALDA 3D3NA 4H7EA 2CEKA 3C6YA 3STVA 3DJYA 5JD6A 3DLTA 3D59A 1XZMA 5DJ5A 1MAHA 5EHXA 5HQ3A 5AHXA 3V9AA 3WK8A 4RGYA 4UFNA 4C6HA 4J3JA 1XRQA 1UK9A 2ORYA 5AI0A 2XUAA 4PW0A 1HBJA 2HU8A 2VT6A 3FSGA 1CUFA 1QJ4A 2GBGA 2PSDA 2HADA 4S0XA 2XQKA 3QYJA 1VXOA 2WQZA 4JYMA 4C01A 4X94A 4OD0A 3QMWA 4C89A 4KAJA 4MWTA 1GXSA 4BCBA 4EBBA 3TEJA 2C5FA 2BJHA 2OAEA 3L1JA 4PNZA 1MNQA 1QTIA 4X00A 2PKYX 5AM5A 5HK9A 1WB6A 1C4XA 2O7VA 5AKKA 2YH2A 4HS9A 3ESBA 5K3EA 3WKEA 4QWMA 4QDTA 1WB4A 1ZI6A 3JWEA 4B84A 2WIDA 1QIJA 5DTIA 3WK5A 4WFIA 5KREA 5JANA 3S8YA 2ECFA 4KE9A 3FNBA 3M81A 3ZWQA 5AM4A 3V1LA 1C7IA 1BROA 4IHAA 4BAUA 1SCQA 3OG9A 3EIOA 1W75A 4GBGA 4DTCA 1UK7A 3BXPA 1G4HA 4F0JA 3R3VA 5ALJA 1ORWA 5JYCA 3A70A 4FBLA 1H22A 3VKFA 4AMZA 1RP1A 2YXPX 2CBGA 5AI6A 3HC7A 5JAUA 3M3DA 2AJLI 1LZLA 4GHWA 4LKOA 5AK5A 3WKAA 4CCWA 1CIJA 2XMGA 1XZJA 4PSUA 3QVMA 2DHDA 1O6GA 3STYA 4P9NA 2XUDA 3KWFA 3UMJA 5A71A 3WL6A 4PV7A 4QLAA 4G5XA 3HRHA 3AUKA 1QIEA 5AI8A 2PSHA 2HU5A 3Q0TA 4HXEB 2C4HA 4BAZA 1IUNA 1XROA 1YSCA 4KRXA 5ALVA 3G8YA 4QLOA 4LXIA 2JBWA 3A6ZA 1XRLA 3F97A 4C4XA 1LBTA 1SOMA 3PDCA 3P2MA 5CBKA 1DWQA 1UFOA 3F96A 2G4LA 4Q3OA 1K5PA 4LYDA 1XRNA 3AFIA 2XT0A 1GKKA 1ZJ5A 2HFJA 2RAUA 2VT7A 1TK3A 3KOOA 4FFWA 1FSSA 3OOSA 5DNUA 1XLUA 3GBSA 4K2AA 3AZOA 5J3JA 2ZJFA 4KACA 4A16A 4DSZA 3ZLTA 5AP9A 5FOQA 1QO7A 1QLWA 3H2KA 1LBSA 2WIFA 2ZJ6A 2JGMA 4YASA 2XUGA 4WFKA 4EB0A 1BEZA 5FXMA 3HABA 4UBLA 2BGRA 3DKKA 1Y7IA 4ZRDA 3A2NA 1MPXA 2XMQA 3FSGD 4DMFA 3O4JA 1ZGCA 3WQHA 4KE7A 1IUPA 1LGYA 3I2HA 3C5VA 5HQ3B 4J7AA 4B81A 1C7JA 3VDXA 5HK8A 4CG2A 3V1NA 5KWIA 3STTA 4M0FA 3ZI7A 1A8QA 2QVBA 2OGZA 1AZWA 4QDXA 5CH8A 2BFNA 2YASA 4BVJA 2VEOA 2Y6UA 5FV4A 2QXTA 4HRYA 1N1MA 3NUZA 1X70A 2O7RA 2JEYA 3GROA 1DU4A 4H7IA 4CIAA 5JAPA 2OLEA 1XZGA 2ACKA 5ALWA 5A7FA 3O4GA 2AJDA 1LPAB 1U4NA 2PU7A 2WSLA 5CTAA 5JATA 4L9AA 4W1PA 5IVIA 3O4IA 2VJBA 2Q0XA 4N8EA 1CLEA 3R40A 3BF8A 4AZ0A 3B5EA 1N8SA 2JF0A 2EDAA 3I2JA 1TRHA 4WDRA 1BRTA 3ICWA 2GZSA 1BCRA 3PF9A 2PM8A 3ANTA 1K4YA 3O4HA 2V9ZA 2JGLA 4PQEA 4JUIA 3CN9A 4J0GA 4Y2QA 3X3HA 1N5RA 3H2GA 3DYVA 3C6BA 2RI6A 4Y9SA 2WTNA 2QM0A 1QO9A 4FLFA 5K3FA 2HA0A 3GUUA 4LIPD 5HKAA 1WPXA 5JZBA 4L3WA 3BF7A 4XWGA 1CRLA 1QIHA 1U65A 5CH5A 1UKAA 2H7CA 5AOAA 2V98A 3I28A 3DOHA 2WG1A 1AUOA 3WKDA 4QDUA 3I6ZA 4HZGA 5C7YA 1Y7HA 2QTBA 1S8OA 3BIWA 1DQYA 3G02A 2XMCA 1JMYA 3EQ9A 2AJ8A 2PSEA 1B6GA 5IVHA 2D0DA 5ALNA 3C87A 2BCEA 4Q1VA 4EA6A 3RM3A 5HKBA 3FAKA 5EIHA 1CQWA 2C0PA 3O9VA 3IUQA 2PU5A 2HM7A 3ED1A 1VE7A 1R4ZA 2C7BA 4FBMA 2XUQA 2DSNA 1EA5A 4Z49A 1DWPA 4BC0A 2C5GA 1WHSA 1G66A 1PV1A 3WYDA 4JEIA 4GI1A 3DS8A 1BS9A 2DQYA 2PBLA 3QMVA 4X93A 4AZ3A 2ZYSA 2B20A 4AX4A 1LNSA 1TIBA 3DD5A 2WFLB 1THGA 4G8BA 5ESRA 4G1FA 5C8ZA 3SK0A 4J0JA 1YAJA 3EBLA 1ZD5A 3AIMA 4N5IX 3H04A 2WM2A 2Y1KA 4DLNA 2B4KA 4H7FA 3QM1A 2XQIA 5D6OA 1YB7A 3A2LA 3IB3A 5IVKA 5JARA 4KJXA 1XZKA 1BN6A 1R3DA 3EF3A 4ZXFA 4H18A 1ZIYA 1CPYA 2B61A 1EH5A 2XUKA 4B0OA 4TGLA 3HXKA 1MX9A 3D0KA 4Q82A 1THTA 1CUWA 5T4EA 1QFMA 1R88A 4LHEA 4TPKA 3DL7A 4AMYA 3G9UA 5LLSA 1EB8A 1DX4A 1JJBA 3I6MA 2FJPA 3OTQA 1ZIXA 3G0DA 3H2JA 3WK6A 2WIKA 3ESDA 5CT8A 1M33A 2HDWA 1ODSA 2RHWA 3W9BA 6YASA 4Y2TA 3DKRA 1JJIA 3D2AA 2DCMA 4AQDA 4FOLA 3D4LA 5HF8A 1ZI8A 5HF9A 4OYYA 4IH4A 1K8QA 4GEGA 4E14A 1BE0A 5DWDA 1E3QA 1JU4A 3C5WP 1KU0A 2W22A 3QITA 1ZOIA 3V48A 2GBFA 1SFRA 2FJ0A 3MUNA 1MNAA 4QEKA 4X71A 3VXKA 2VJCA 4ROTA 5JD4A 2GYVA 2XUOA 4HXGA 4CFSA 1W52X 4BDSA 5DNWA 4WY5A 3W2TA 2NW6A 1NU6A 1QONA 2CJPA 5K5EA 1XQYA 5AH0A 3E1GA 5KBYA 3FYTA 2OPHA 4X3CA 3PF8A 1A7UA 4BRZA 5CRIA 1JT2A 2ZYHA 3D5EA 3C6XA 1KEZA 1CUBA 3TRDA 2Z3WA 1EDDA 4PSCA 1CUZA 1UWCA 2ZJ7A 3HYSA 1XZDA 3ZLVA 5HF5A 1DX6A 4WJLA 1UOQA 1MJ5A 5DYWA 2ZYIA 1ZJ4A 1MN6A 4AN1A 3WK9A 2VSQA 4WY8A 4OB6A 4C87A 2H9YA 1CUUA 5K3FB 3FLBA 4QE3A 2JGFA 2JGIA 3FYUA 4QWWA 1SCIA 5CXXA 5AKEA 1EB9A 5AIAA 3G9TA 2WFZA 5EIAA 4DSAA 2XMZA 1AKNA 2VTVA 4ZV7A 1QIKA 4JYPA 1WCYA 5T4FA 2VATA 2O2HA 1QZ3A 3VVLA 3DEAA 1A8UA 5HFNA 3FOBA 3IULA 1W4LA 5F4ZA 2X8BA 4BATA 2XB6A 1UZAA 3I1IA 3BJMA 1AURA 4FTWA 1LPSA 5DYYA 4BVLA 5T4HA 4N5HX 3B12A 5AM1A 1CUJA 3T4UA 3I2KA 2VF2A 1RYYA 1JU3A 1WM1A 4N8DA 5AKYA 3IBTA 4DYHA 3CCBA 4F21A 2GYWA 2QUAA 4ZI5A 1BEEA 4BTVA 2QKYA 1J07A 1EINA 2WKWA 5AI5A 1R9MA 3U0VA 1ZD3A 5YASA 1BCSA 3N0TA 3RKSA 5CURA 5A6VA 3F9CA 4ARAA 1EVQA 1E66A 3WYNA 5AK3A 5DYTA 5AOBA 3BWXA 3BE8A 3C45A 5ALZA 3LS2A 1JFRA 5JD5A 1VA5A 2LIPA 5JZSA 2E3JA 2OG1A 1XZIA 1OXMA 1ODCA 3WK4A 1DQZA 2QMQA 3DNMA 5C8VA 3WZMA 4UHCA 1L7AA 1GKLA 1B41A 3LIPA 1AMNA 1TAHA 3I2FA 4RNCA 1QIMA 1F0NA 1WB5A 4A23A 3D2CA 5ALUA 1HQDA 1H2YA 2W6CX 2AJBA 4Q3LA 5CXUA 2J3QA 2WLSA 3R3YA 1J06A 4KE8A 4CI9A 2WFLA 2QJWA 1UKCA 3C43A 2DHCA 2HRQA 2Z5GA 2V96A 1CV2A 1P0IA 3WK7A 3STUA 5E4YA 1D07A 2PL5A 1O6FA 4ITVA 3WIOA 5AKHA 3SC2A 7YASA 4J0IA 4EY7A 1ZGBA 2OCIA 1YAHA 1YS1X 1E89A 1K63A 1R9NA 2XLCA 3KWJA 4Y7DA 1H2ZA 4I4CA 4Q34A 5JADA 4MEBA 5T4BA 1VKHA 2R11A 3AZQA 1VOTA 3FCXA 3UUEA 5LZ5A 5ALEA 1XQVA 5LZ2A 4Q05A 4X6YA 2WUFA 1AC5A 5ALXA 4H7JA 3WZLA 5A2GA 2JGJA 4I3FA 4EHBA 5AKIA 5ALRA 5LZ9A 3H0CA 1T2NA 2Y2VA 5C81A 1CUXA 4XJVA 1UOPA 3HEAA 1OCEA 3OC0A 4K6GA 2BUAA 5ALSA 5AM3A 2CUTA 1VJ5A 2PUHA 3IDAA 2CZQA 1MX1A 2WHPA 5SYMA 1J2EA 4V2IA 3QPCA 4CG3A 2XUPA 4AN0A 4MYSA 1UK8A 4Y2RA 4ARBA 3UUFA 2QRUA 3AILA 4UBOA 2Z3ZA 2UZ0A 4X97A 4UFPA 2XLBA 2HA4A 4W63A 3E3AA 5LKAA 3R0VA 5AKLA 1H2XA 4IH1A 3FYUB 4MQMA 4OUKX 4K6HA 1PFQA 3WWPA 5AI9A 4H7KA 1CUHA 1LPOA 3M83A 4BZWA 4UBIA 3RARA 5ALTA 1LPPA 2PVSA 4MQLA 2HHAA 1QIDA 3R3ZA 5ALMA 4XX1A 2ONCA 4M0EA 4CCYA 1W1IA 1GPLA 4BB0A 4W1RA 1G42A 4H0CA 4C4YA 5HF6A 4AB1A 2VQ6A 4BE9A 3HZOA 3H17A 4IO0A 4UBMA 1XLWA 4BTLA 1IVYA 5FLKA 2VJDA 1F0PA 5ALQA 2WHRA 3N2ZB 1DT3A 2XUIA 4YK7A 3DCNA 1VLQA 3ZV7A 5JALA 4BYMA 1W76A 3VJKA 3IUMA 2BUBA 3WJ2A 2JGEA 3PI6A 1VA4A 2XMBA 4GECA 4QZVA 5AK4A 1TCBA 4NVRA 5AICA 2CMFA 1P0PA 5EFZA 2OQIA 3OPMA 1TKRA 4H7DA 4Y2SA 1XRRA 2OAGA 2IIVA 3NOXA 2O2IA 3C6ZA 3H19A 3L1HA 1XKLA 3I2IA 1H23A 4U2BA 1IUOA 4B6GA 1ZI9A 4X6UA 3ILSA 1UT6A 2ROQA 2Z8XA 3FCYA 3SWWA 3RLIA 2K2QB 2FUKA 5JAHA 4OYLA 4CIBA 1QIGA 3ESCA 5AIBA 1CR6A 1XZLA 4EY8A 1EK2A 4E11A 4B0PA 4INZA 4DNPA 3IURA 4ZV9A 1DT5A 1LPBB 2CKMA 1ACJA 4B80A 1MU0A 1FFAA 1MT3A 1FJ2A 1FFBA 4FNGA 4X85A 2JIDA 4LXGA 2QOEA 5EHZA 4TVKA 4FLEA 4QNNA 3MVEA 4QDOA 2PSFA 4J03A 4B9AA 3H2HA 4JNCA 1SC9A 1MX5A 1F6WA 3WMRA 1VE6A 3HACA 2BKLA 3EQ8A 2EEPA 3F8SA 1YR2A 4P08A 5ALIA 2HU7A 1CUVA 1U2EA 1GT6A 1XQWA 3JW8A 4BDTA 3FLEA 4B85A 4HXFB 2WG0A 3TJMA 1CUSA 3YASA 5K3AA 5ALFA 1QOZA 2QJRA 4AXBA 3WL7A 1XKTA 4UHFA 1K6EA 2HA7A 4DNQA 5AK6A 1GPKA 4DNFA 4UHHA 3WL8A 4EZIA 4BC1A 2G5TA 5ALHA 1E8DA 4LYEA 3GFFA 2C58A 1UK6A 4O08A 2HA6A 4OB8A 4HTAA 2H7YA 4HAIA 2JGKA 3BL8A 2QS9A 3QPDA 1TQHA 3KD2A 1DINA 4WFJA 3F67A 1MTZA 2V97A 4J0HA 3SX4A 4FHZA 2WHPB 4JH0A 4UUQA 3WA6A 1CUDA 2XQGA 3FBWA 2VAVA 1XZEA 4K6KA 2ZSIA 5CT4A 1OILA 3HSSA 3V1KA 3BIXA 3E0XA 4EY4A 5CW2A 4BRSA 4H35A 4AO6A 2OCGA 4K5QA 4Y2XA 1R50A 1Q0RA 4KE6A 4I19A 2OQVA 4E15A 3WWEA 1XLVA 1IZ8A 1CFJA 1U8EA 4U2CA 5EGNA 2OGSA 3C8DA 3VISA 4DM7A 3DL4A 4D9JA 3G0IA 4MEAA 1YA4A 4X6XA 5LKRA 3NGMA 1EDBA 2PSJA 2Y6VA 4DMKA 5FRDA 4P93A 2QZPA 4CCYB 1CUIA 4QDZA 3QPAA 4B82A 1A88A 5BWCA 2ZVDA 5ISMA 3OM8A 3VJLA 1GGVA 3FVRA 3FVTA 4A5SA 3A2MA 3IUNA 4H7HA 3FLAA 3KXPA 3VJMA 3I2GA 4G8CA 4BBZA 1CUCA 4BZZA 1CUGA 1GZ7A 3AINA 1Y37A 4FDMA 1XRPA 1GQSA 1GPNA 5DNVA 3K2IA 3W05A 5IH7A 2QUBA 3GELA 3WKBA 5A7HA 5FKJA 3FWHA 2XQJA 4OB7A 1ZD2P 2J4CA 3CCCA 4G4GA 4U2FA 3HJUA 3TGLA 1A8SA 1L7RA 2OCKA 1YB6A 2XE4A 3PE6A 3WKCA 5AKJA 4RPCA 3F98A 4Y2VA 1EHYA 3K9BA 3IVMA 1XZHA 3H1BA 3C8HA 2ACEA 4MJ3A 4WCVA 2XUFA 1W6RA 3G9ZA 5BWBA 4AO8A 2XI4A 1ZICA 4EY6A 2J3DA 1HDEA 4FWBA 4DGQA 2WJ6A 4RE6A 2DR0A 3R3UA 1QTRA 1BU8A 1F8UA 2WFMA 4EY5A 1YA8A 5ALPA 1LLFA 2XMRA 4OSEA 1XZBA 2ZSHA 4NS4A 1MO2A 1QFSA 1YCDA 5A7GA 2PUJA 5DLPA 5CT9A 2R8BA 1PJAA 2VAXA 1VZ2A 1WHTA 1EVEA 1CQZA 4M0MA 2HFKA 4QA9A 2HL6A 4WDQA 2WUDA 1RWQA 3U1TA 1P0MA 4X95A 1ISPA 4MXDA 3H2IA 1VZ3A 3PFCA 4W1SA 4Y2YA 1GQRA 4J0KA 3FYUC 4Y2PA 1JKMA 5KWJA 3CN7A 1L7QA 3WI7A 5D7BA 5E4TA 5K3BA 3WL5A 4DNOA 2WUGA 1YASA 4FMPA 5C8XA 5EHNA 1AGYA 3H18A 1Q83A 2WIGA 1I6WA 4UPDA 4YPVA 2VJAA 4BAGA 1E8MA 1E5TA 1R1DA 1J1IA 3R3WA 5LP1A 2WHQA 1TCCA 5ALLA 3ICVA 3V1MA 2WG2A 3GA7A 2HIHA 4EUSA 4BP8A 1CUAA 5EI5A 4J0CA 4XVCA 2Y2UA 2FX5A 5D3KA 4UHDA 1XZCA 2QT9A 1WOMA 1UOOA 5IKXA 1UKBA 3JYHA 4L0CA 3QH4A 5AOCA 5AKZA 4PF1A 2PX6A 3ZLUA 1CVLA 3AZPA 1FFDA 4NZZA 2B9VA 4LXHA 5D3ZA 1FFEA 1NU8A 2RIPA 4BP9A 3E4DA 3OURA 1IZ7A 5LZ7A 4BVKA 3AIKA 1EK1A 2OCLA 2I3ZA 2G5PA 4UFOA 5ALGA 5HFAA 4ZWNA 3KDAA 4IH9A 3S2ZA 3AIOA 1LPNA 2HA3A 2WU4A 3H1AA 5CT5A 4E46A 2OGTA 1Z68A 5HCUA 4Y2UA 5JZ9A 5A62A 5HZGA 1H2WA 2XUHA 2WTMA 2H7XA 3WJ1A 3BJRA 5JAOA 2IITA 5H3HA 4UBNA 3RK4A 4UBJA 4F5ZA 4AO7A 3PUIA 4IQ4A 4MWSA 5BV7A 2QXUA 2WJ3A 4FNMA 4GDMA 3LIIA 5FP0A 5FDFA 5I9IA 4HRXA 3MUOA 5SYNA 4DMCA 2DFPA 4FLMA 3G0GA 3LCRA 1N5MA 2X76A 4ZGBA 1EDEA 4DIUA 1G5FA 1IMJA 1USWA 2O2GA 2RONA 5ALKA 4KAFA 4L72A 3LLCA 1EI9A 4B7ZA 1X2EA 2WU3A 2ZYRA 3DQZA 5EIEA 4UBKA 4G8DA 2H1IA 1QIIA 3IA2A 4X7BA 2GZRA 3D7RA 3ZPXA 3DOIA 4OCZA 4U2EA 5FUMA 1HKHA 1TCAA 2I3DA 5AKXA 1WPRA 4ZREA 2G63A 1CUYA 2BGNA 3IIIA 5DTJA 4Y2JA 3QMMA 5JIBA 4GW3A 3WIBA 3VVMA 3O95A 2J4FA 2XUJA 1Q84A 4X92A 2PPLA 1HLGA 4KR0A 2XDWA 2C0QA 1XZAA 1KU6A 3BDVA 2WJ4A 2HRRA 1JJFA 1QIFA 1LZKA 2GYUA 2XMDA 3ESAA 3Q8WA 4G4JA 3M82A 3NWOA 5CMLA 2WILA 4Q3KA 3QZUA 1QE3A 3G7NA 1BN7A 5ALYA 1MAAA 1EX9A 5K3DA 1DTEA 5BOVA 5CT6A 4FFVA 2ES4A 5LIPA 4U2GA 4B83A 4MYDA 3PFBA 1AX9A 4NMWA 1E8NA 4J0DA 3STWA 3BDIA 5CH3A 1Q0ZA 2YYSA 4BCCA 4KEAA 2HA2A 3I6YA 4RE5A 5ALOA 2DQZA 3G0CA 3WLAA 5AKGA 4OU4A 2XQFA 4G4IA 1LPMA 4W1QA 3DYIA 2DHEA 4G9EA 2AXEA 3CXUA 4UHBA 4N8SA 2BAGA 1YS2X 1ACLA 2RGUA 2BUCA 4YX9A 5I8PA 4BCDA 1EXWA 3WWCA 4BE4A 5IVDA 4HVTA 3R41A 5AJHA 5FPQA 5AO9A 3R3XA 4GLBA 2GBIA 3W04A 3EQ7A 3AJAA 3HLKA 4KRYA 1ETHA 3D2BA 4F60A 4KYVA 4DMHA 4X90A 3I1YA 4OPMA 5E4JA 1T4MA 2VA9A 5EHQA 3KSRA 1XQXA 3G9XA 2X5XA 2OXEA 2IX9A 4XIIA 2AJCA 3PUHA 3QBJA 4GXNA 3G0BA 1XZFA 5FPPA 3LP5A 2Z8ZA 5AI4A 3O9MA 2I03A 2EDCA 1JI3A 3K6KA 2D5LA 3B3QA 1NX9A 3L1IA 2XMSA 3C70A 1CUEA 5E2IA 1JMKC 5I7UA 3T52A 4ETWA 2RHTA 2WIJA 1XFDA 1P0QA 4UHEA 3PICA 3HI4A 5JASA 4C4ZA
chains in the Genus database with same CATH superfamily
1ONOA 2WV9A 3OUTA 5E6RA 3QUCA 5C5IA 3RS4A 2C03A 4P4LA 4MDYA 1J9GA 3PHBE 3BXZA 5FNVF 2HA5A 1RW4A 1C9EA 1W19A 1GYQA 1FFSA 2VHZA 4P4SA 1XPUA 2O4CA 4QUIA 4D3YA 4CTOA 3OE5A 2YHIA 1HL7A 2P9QA 4KAAA 5TSDA 3TFOA 1P81A 4RD2A 2Y1GA 3KUKA 1OFVA 2JD1A 1TU0A 4OGLA 4QYIA 4Y6GB 3KWMA 3WO0A 1DHRA 5HUHA 1OA1A 1NI5A 2YFKA 3QELB 1ONNA 1JKFA 1D2RA 4ZMRA 4X62B 1T13A 5HM6A 3VHRA 2G83A 2JH8A 1RSZA 1AGNA 4G1CA 2RHCA 2CLLB 4I08A 4RTKA 1SCKA 1GTMA 1OIXA 3GBVA 4L07A 1KE2A 4Z0NA 1CZRA 3W9UA 2R8EA 3IUJA 4FFRA 1DC6A 3L9WA 5CYGA 2VHQA 1AZLA 4C3ZA 2HRBA 3BWYA 2H4YA 5FOSA 4JJ6A 1PZFA 2QX6A 1ETUA 3QEMB 2J5KA 3RU3A 4FKBA 3BH7A 1RRMA 3KLBA 4FS3A 5AW7A 1D4FA 4FGKA 4GKJB 3L7NA 1T9KA 3MGAA 2FR8A 4Y1RB 3JWHA 1RXIA 4ZICA 2PX5A 1I30A 1ZD4A 2OV2A 4RKYA 5AM0A 5LYYA 2ZETA 1DWOA 2BFPA 1ODTC 3CUWA 1TX4B 1GVHA 2LTAA 1KVQA 4ALLA 1QQTA 4D4JA 4WESA 2RHMA 4MVWA 2FOLA 1ZHHA 5JH7B 3ELDA 4R0MA 3DLHA 2OWDA 1E99A 5K3CA 5EE5B 1DUSA 3U4AA 1D5CA 3BRWA 3HU2A 1ZK3A 2HSEA 2ZQYA 4HHEA 4LWZA 2FPGB 4L6IA 2DWPA 4Q9AA 4XYMA 4F1JA 2JHGA 4CR7A 2PZGA 5JD6A 4R1QA 1MHTA 1SKBA 3OTOB 4EK9A 1NNI1 3PLRA 4NZOA 5DJ5A 4QJIA 2XA1A 3D9QX 4GP7A 4KX5A 5EHXA 2VDLB 4F6RB 4YT5A 5DHPA 1M2VA 3OOWA 1XEAA 5BT9A 3KX2A 3ZBTA 2FMIA 2AFHE 3HUTA 3V9AA 3WK8A 5F9FA 3GHHA 1C4KA 3DTVD 4Y6SA 1LB1B 2C2HA 4UVIA 2J3HA 1V7PC 1O9BA 1ZVKA 2FDRA 3A25A 3M9XA 4C6HA 1XRQA 4QRHA 1I7LA 3WGYA 2W6ID 5AI0A 4HFNA 5JQGA 1MH9A 2CF6A 2YWFA 2HF7A 2HU8A 2VCEA 2R4QA 3DP9A 1CUFA 1G5IA 1QJ4A 3WIDA 2CMKA 2PSDA 1WS6A 1QRTA 3CZMA 2NVUB 5B58C 3I37X 4DDVA 1V48A 3VH4A 3OZRA 5E7IA 3W8FA 3GWGA 4YRZA 3UC9A 2PKEA 2YQ4A 4BX8A 4HC4A 2RH9B 2ZRLA 4BQOA 1QKKA 4HDOB 1EEHA 2QX7A 4C01A 1QRSA 2OV8A 1NVKA 5B5SA 1I6LA 2NYRA 3F7MA 1UR5A 2MYNA 1J4AA 4M0UA 1DJLA 2RDMA 3DZDA 4TYPA 2QZ4A 1GXSA 5U4XA 2FZGA 3Q7RA 4M0PA 4LYJA 1PBNA 1BE6A 2YIDA 3KJHA 3EQ6A 4KC0A 1ECJA 2I0FA 1T6YA 3LSYA 4LZJA 1GJRA 2PX2A 2VXOA 5FA6A 3RSQA 1GZSA 3TEJA 2B1GA 1H4TA 2ZBGA 3K09A 3JAWA 4IG4A 4XYLA 2QPOA 5BOSB 5FTLA 3K8YA 5JLAA 1YXMA 1D03A 1ZUWA 1QTIA 2W8BA 4WRRA 5HS4A 1FDOA 5HZKA 3KOXA 4X00A 4D44A 4RBNA 3FNEA 5HK9A 1IATA 2V6MA 4FN4A 4FKMA 1CS4C 2QM3A 3UANA 1WB6A 2REQB 3L0ZA 4LF6B 4QOSA 5G1OA 3QFTA 1R0XA 1YTUA 3WLRA 1PDOA 3PR1A 1JXMA 3QBDA 1XHEA 3OTGA 2EL9A 3M4NA 4BMNA 4A2WA 1BFKA 5DLYA 4BMSA 2Q49A 2AOTA 1JR3D 4K6CA 3WKEA 5ANRB 3OCVA 1K3TA 1H85A 1JKJA 2EJBA 2OBNA 1VKJA 2XCQA 1LDEA 1VPTA 2HQRA 2IY9A 3P94A 2HBRA 3I5YA 3DDHA 3F6BX 5LMNB 4G89A 5JNTA 3OIUA 4WA8A 4G0ZA 5BWOA 2R66A 1QIJA 1YCFA 4EFKA 2L18A 2WWWA 1EFCA 1E7SA 4OLFA 3NP9A 3Q2OA 2JAOA 2P69A 3CPJB 4PZCA 4X65B 3S8YA 2IW3A 3SLGA 3ZCXA 2ZR7A 4K9QA 1RHKA 1Q7TA 3Q2KA 5AM4A 3ZDQA 4NONA 3GGCA 1XPRA 1EG2A 1Z4OA 1ZDMA 1J7KA 3AI7A 1NM5C 2XF2A 4NENB 4TM8A 3IDOA 3KZCA 1C7IA 2Y9MB 3MINB 3OZSA 2BI4A 5JAMA 2PCJA 1MIOB 1EZ1A 1KZ4A 2D5IA 4J43A 1FRNA 1SCQA 1N7JA 1R0BA 5AW3A 2AG5A 3EIOA 1UK7A 3BXPA 3N2GB 2PFKA 4NRDA 1AUPA 2JIZA 3HLTA 4FHCA 4FNOA 4MQ6A 4TRJA 1QTQA 4W5NA 3IJ5A 5C9ZA 4UVEA 3MWEB 1WEKA 3JCZA 3WTCA 1AMOA 2VRCD 1KY2A 3RS7A 2ECKA 2Q50A 1JJAA 1ZGZA 2OHHA 3EIEA 3V2UA 1H22A 1ZH0A 1QAMA 1Z5UA 3RSGA 5DXAA 3OJCA 3D6UA 4L8YA 3VOAA 2ZAGA 3CG0A 1YBAA 4YP9A 5K2MA 5J4VA 5HIAA 3UGJA 4J7XA 3TS1A 5AI6A 2F8LA 1ZC3A 5FAXA 4MIYA 3TIFA 3HZZA 3O9ZA 3VH1A 3AM5A 1Q1BA 5DU2A 4RA6B 3BB3A 2PUDA 1G9SA 1RLTA 2QMYA 4JK3A 4U0KA 4CM7A 3G2JA 5GVSA 1P2FA 1JKIA 1FXWA 3ZCTA 3KL2A 5K3SA 2ZQZA 2WQ7A 3IE1A 3M6XA 1CIJA 5DP2A 5B37A 2XMGA 3RQIA 1WPGA 5IF3A 1TYEB 2ONZA 2XOKA 4JMLA 5JDCC 4LOHA 3IGFA 3CM0A 4Z2YA 4XSHA 3K5IA 4PGFA 3WGOA 3WLEA 4ZANA 3STYA 4AJ9A 3K8ZA 1A7AA 2HPAA 3V3TA 1ATIA 4P9NA 2F43A 2XUDA 1G2IA 4RHUA 3KQUA 4KQWA 5JS1A 5A71A 1O97C 1IPEA 3ET5A 1TKCA 2VK2A 4M3NA 4AN4A 3DHYA 3LUDA 4PV7A 1D3AA 5CG1A 1GLNA 2B0CA 4TOIA 1ISHA 1Z22A 1AKVA 3AUKA 5L3QA 1GM5A 2HDOA 3NIFB 1R3UA 4MUHA 1ZP6A 1RAGA 4PLVA 5AI8A 5AIAA 4I5DA 1R0LA 2L82A 1OU4A 3NHZA 4OI1A 3BK7A 1W85A 1DXOA 2NQ8A 3UUWA 4BAZA 1RHRA 5DI9A 2W0MA 2RD2A 2J9GA 3TW6A 4IJ6A 1U3DA 1Y33E 1KQNA 1EBBA 2VWPA 4KTVE 3ZK8A 1XROA 3JYQA 3SAJA 1T9HA 2J32A 3BJEA 4FD3A 2REBA 3D3WB 5AYVA 4QLOA 4MARA 2CLCX 2AI3A 3CEMA 2JBWA 4ECAA 3GPLA 1XRLA 3EXHB 5JISA 1SOMA 1L4UA 3QFSA 3H7IA 3L8MA 2PX3A 3NG1A 5E6RB 4GUDA 2QMOA 4IMPA 5BN4A 2V7PA 5D84A 2I34A 1ZH4A 2OLKA 5TB5A 1MC1A 4YMSA 2GCEA 3GEDA 3WB1A 1PR5A 3QXHA 4FNAA 2YR0A 1V8FA 2EW8A 2W6PA 4FW8A 4DA7A 2GHIA 2VYNA 1Z4LA 1CY0A 1ZD8A 2JATA 5F7ZA 4YJ3F 1U8YA 1ONPA 4XGRA 4P4SB 1QQ7A 3EAQA 5JJKA 2EZTA 2D7CA 2Z9CA 3EIQA 3BL6A 5LMZA 1K5PA 1JHXA 2YHIB 3MYRA 3IP8A 3KAKA 2AC7A 2OBMA 2OG2A 3CZ4A 1E6MA 2UYYA 3IXQA 3K9LA 1GKKA 3CX6A 4UAUA 1ZJ5A 1VG8A 2HFJA 2RAUA 3F9IA 3JQRA 4P31A 4QYIB 1WU8A 3ZOKA 1GSHA 2BM9A 4Q9HA 1Y89A 3PS9A 1FUIA 2FZ5A 2VP5A 4FFWA 2F3RA 1WF6A 3E9QA 1H6AA 2EBUA 3KT0A 4Q02A 2Z4SA 1O6ZA 2C5EA 3OOSA 3QFCA 1UJ2A 3C3CA 5JI2E 3QVWA 3L0CA 2DXIA 2Y92A 2W9XA 4KB5A 5LA6A 2OORA 1YFLA 3TI7A 4LZZA 4MV6A 1OV4A 2WPNA 1O6BA 3AIIA 4A16A 4Y2GA 5A3QA 3HWX1 5CA1F 2FG6C 5CLLA 1DG1G 1JHUA 2PT7A 3HL0A 4QBHA 5GJVC 3EWSA 1NTRA 2XNJA 4AI6A 4K9KA 4PLYA 4L08A 2IOFA 5H83A 5JMPA 3RBAA 2XYPA 1EXVA 2DFKB 3GDOA 1R00A 3DBVO 3MD0A 2QTTA 3HCAA 3P9QA 1NW7A 2XUGA 2NTEA 3FZNA 4LJ5A 4OA8A 3ZJVA 1N1EA 3MT7A 5F1PA 1MEEA 1IFXA 1YVDA 1NG9A 4WESB 5FXMA 1SB9A 4MVJI 2GLTA 3GJXC 4ER7A 2CFOA 5DM70 4TZTA 2GSWA 3DKKA 4KQGA 4WOBA 3C1OA 3HO6A 2CXPA 3LY7A 3PEVA 4HYYA 2ARKA 2JAHA 3IUPA 3O94A 4DMFA 2RGAA 5DVZA 1JQEA 3DWFA 3IMGA 4LHZA 2AB0A 1NKTA 4BASA 3L6UA 2LKCA 5EP1A 3VNAA 2QRZA 4KH0A 5KQGA 3O4JA 1E1RA 1ISSA 1NJ1A 4ZJPA 2HCTA 1RBQA 2Q5OA 4RK4A 5DBHX 1DZIA 2CMDA 1MV5A 4NKRA 1RI3A 4CTJA 4EB3A 3BTOA 1BGXT 3A6LA 1QPZA 3MCVA 3HVIA 3MM4A 1R18A 4WT7A 4W5QA 1UOEA 5CD9A 1ILEA 4J7AA 4ND2A 4WNYA 1M2VB 3SHVA 1NMYA 1SCBA 4B81A 2A0UA 4XQ0A 3ESQA 1ZWLA 3VDXA 4MINA 4EABA 1C0KA 1P6UA 1WMSA 2JIOA 2R68A 3SIWA 3UKDA 1YE5A 4W5HA 5JQGB 1YRHA 1KIAA 5REQA 1KGSA 1UL1X 3WLHA 3ZI7A 4GRDA 3E1KA 4PLTA 4II2A 4XB1A 4YRRA 4YLYA 4UQLA 5ICCA 2IP2A 1BQEA 2UV8A 2QVBA 1Q1EA 1BQ3A 1QOQB 3JD2A 1VE9A 1YJ5A 4FYXA 4LECA 3IEXA 2AW3A 2FEXA 1AZWA 2X9VA 2Y1WA 3AP2A 1FLVA 1HMPA 2ZI3A 2GERA 2ZUWA 3HBMA 1ZU4A 3LXMA 5HJ7A 3CF0A 3TZKA 1XNQB 4TSKA 1SHLA 3AETA 4HRYA 2KJQA 3O2JA 1EUCA 5BXYA 1N1MA 3LT1A 1CZNA 1X70A 4HEJA 2EKQA 5C1OA 4CWAA 1GXSB 1KDOA 1B6RA 1N2JA 5CA1A 4QM6A 1PHPA 3I9OA 1RZRD 2AK2A 3AFOA 1JZTA 4N76A 2WWRA 3K1JA 2OLEA 1N2CE 4A82A 4F85A 4BFTA 2C2KA 1LBQA 4DLPA 2YIJA 5DB4A 4NYIR 4XDGA 1ZUIA 4KVGA 4RABA 3JAWB 1EUQA 2IOFK 2GFHA 3IUBA 2AJDA 4HNSA 1NRWA 2WSLA 2BFBB 2KS6A 4DR1B 3C5EA 1KI3A 5GWXA 4L9AA 5JATA 4W1PA 2W8BB 4F93B 5CB4A 3NHJA 1SXHA 1USIA 3O4IA 3D4BA 1I5OA 4DBVO 4URZR 3S2UA 1LF5A 5AVRA 1P5RA 2IOQA 5I8WA 4TQ9A 3EW7A 4MDEA 4NICA 2DQKA 4CHTA 4EYQA 1VE5A 3O1JC 2QD3A 4M7RA 1ORIA 2YFYA 2FMXA 3CRQA 1CVRA 2POQX 2P6PA 3Q0EA 4E5NA 3O84A 3QVUA 3KAJA 1PLLA 2WT9A 3TX6A 2JF0A 5IAOA 2EDAA 2XZPA 2AOTB 3AX6A 2JH3A 1FP4A 3QPBA 1PQPA 4JYZA 1JKJB 2BRUC 4HN4B 4YJ3B 2FEKA 1V0JA 2HGSA 4IQ0A 1X6VA 3P45A 1SOVA 4KVAA 3MJCA 4XWAA 1ZA2A 3G23A 4KKVA 2V9ZA 2VF8A 1RIFA 3EGVA 3O3MB 1MW9X 4MWGA 5K09A 2ZUBA 4ZQGA 5FPKA 1WCXA 4K9DA 3RYTC 1U31A 3CN9A 4P1ZA 5IDXA 5IZCA 2ZUVA 3CXRA 2HK9A 4AYWA 1TVCA 2CDRA 2OFWA 3QW2A 1SKAA 5DTMA 5G41A 4R5HA 5EMLA 1R6BX 2GD6A 2VYFA 4JX9A 4FWIB 3K8OE 4F3TA 2CD9A 3GJ7A 4PXSA 5SY6A 1KMIY 5BSWA 3ISJA 1R7RA 4TV8A 3TSZA 3AEUA 2RI6A 3FYSA 2GAIA 3MGBA 3UT6A 1H5QA 1OF1A 2YJ4A 4I50A 1N2GA 1QO9A 1MFZA 1WE2A 3LCJA 4PG6A 1RKVA 3U7FB 4HMQA 4RGQA 4UD6A 5TY0A 2ZATA 2XRFA 5C37A 1I2BA 2CXTA 3CE9A 1JECA 1W2GA 2RAPA 4LIPD 1TB4A 3R5HA 1J49A 1ZRMA 2P9GA 2X5JO 2ZB8A 1E4YA 3L4BA 5BVGA 3NDIA 4OHRA 5M2QA 3NBQA 4L3WA 2PBRA 1C1XA 5JZMA 3DYBA 1WKVA 2PH3A 2CK3D 3RIMA 3UNXA 4CT0A 4O5AA 3BYZA 4F2WA 1QZZA 1LW7A 1WMEA 1LQ2A 2J31A 4UZFA 2HMVA 3WSWA 1IJBA 1P4AA 2XWSA 1K7YA 3IQGX 2WG1A 4HSEA 4XD7A 4B34A 4HNAA 4MRNA 2AQHA 1JIQA 3IEIA 4O2BA 5CJ2A 3W9YA 4ACAA 5T6MA 3UMYA 4B3TB 4QDUA 5IWCA 4HZGA 1SVLA 4QUKA 2GRAA 3W5AA 3SMVA 1SNYA 1Y7HA 3R7WA 2QTBA 1RWPA 4O0LA 2RH5A 3TLGB 4L15A 1ZRHA 3BN3A 1MIHA 3BIWA 3P9SA 1JT9A 4HEA6 4LE2A 1MP0A 2O3RA 4O6VA 1JMYA 2L2QA 3EQ9A 4KI0A 5LQRA 3HBLA 2NAPA 1NF3A 1PJ3A 1B6GA 1O94A 3QXXA 1M34A 2OMEA 4L95C 3CX7A 4LJAA 3SDBA 3S2EA 3SKVA 1SXJD 5IVHA 3H16A 4DDMA 1EK5A 2O3TA 2F43B 5G0TA 3WV4A 2BCEA 2R6R1 1QK4A 3RM3A 2FFQA 1Z56C 4LNUA 3RIXA 1G2OA 4BECA 2C0PA 1BMTA 1JHZA 3CKMA 3KNZA 1AKYA 1Y7TA 1ZGGA 3F9RA 3P96A 4PONA 5L3QB 2OXFA 1Z4QA 4N7BA 3TKLA 5F5NA 3NVKI 2BPOA 4OY3A 4RQUA 4WV3A 2AQKA 3K4QA 4YV0A 2G0NA 3QENA 4R9RA 2ZWPA 2WAOA 1YQ9A 4NBRA 2AJTA 3WFZA 1WHSA 3U3MA 2GXUA 1I3OA 5LBUA 1QGUA 5MN5A 1E63A 1TPZA 3BQNB 1E96A 2QYHA 4OXNA 2Q6LA 3IA7A 5F3RA 1BS9A 2QVXX 5CDSA 3JRWA 2PBLA 2O59A 2UYGA 3P9KA 3ZQUA 1E32A 4AZ3A 2ZYSA 4C7XA 5HWSA 2NTJA 4JC0A 3E48A 3EH1A 1TIBA 5BN4B 4TKVA 3NIBA 5ADVA 1THGA 4L1KA 5T41A 3IVXA 4CUKA 2HMAA 3LA6A 4XPIA 5C1BA 4ZD6A 2ZWAA 3F0TA 4QVIA 1II8A 5ESRA 2RGGA 1QRRA 4WE3A 1VYTA 2F62A 3SK0A 1WTAA 1YAJA 3EBLA 1UBSB 2NPOA 3GD7A 1SK8A 2XKAA 1YKSA 5CX4A 5JLJA 4RZSA 4DSOA 2IHJA 2ZP1A 1W2WB 4OBBA 5IEBA 4A2CA 3UOWA 4K6FA 4N5IX 2QAJA 3AEZA 4NEGA 5DO9A 2XCSB 1GPUA 1ZHFA 1FQJA 2KBFA 3BD9A 5JPDA 1QHHB 1O03A 5LXTA 4X64B 2Y1KA 3HPQA 5EERA 4D3ZA 4L74A 1EJBA 4U0JA 4DLNA 3I30X 1ZOPA 4ABTA 4Z3OA 3QM1A 4M21A 3IOCA 5IANA 1VMIA 2RHHA 4RK6A 1CU1A 5D6OA 2QU7A 2GTHA 1IQ0A 3RYIA 3VYTB 1CJTC 3A2LA 1JNYA 3VR1A 3LM8A 3V4RA 3GJ4A 3PZBA 5TJ9A 3TE6A 3PNSA 1Z26A 5IVKA 2O1EA 5FHQA 3IPYA 1OOEA 2XCTB 5C1IA 1POXA 1Z13A 2R5WA 2H4XA 2ODTX 3NVDA 3USES 3Q5DA 4L5CA 4PLGA 5ES4B 4IDFA 3EXEA 4AVYA 1R3DA 2YZ7A 5FUWA 2VNKA 2OV6A 3D8BA 1ZIYA 4MOWA 4P38A 3DEJA 4HQKA 4Q93A 3V9PA 5AW9A 2PJDA 3QFRA 1G8PA 1O95D 2OOKA 2XUKA 4YLEA 4X20A 4B0OA 5MFPA 1I8TA 1RXSA 4E2YA 4TGLA 3HXKA 2P41A 4AS3A 3HHPA 4D5GA 1Y1RA 1SCUA 4HQLA 4K40A 3PD1A 1VFNA 1VLMA 3QE3A 2MJLA 1LBEA 1CUWA 1ND5A 3KQOA 4IYJA 1SUWA 1KAHA 5LD2C 2O8VA 2NZUG 3NM6B 5BUCA 2GAAA 2WYIA 1QFMA 4M8NE 5JSKA 4EFNA 3H1EA 1KAMA 1V6AA 3QTLA 2EHDA 1Z4JA 1FTNA 3D3QA 2I87A 4ZAZA 4JEMA 5LLSA 1NHWA 3TB4A 1EB8A 1KKLA 3R7AA 5DHSA 2CJFA 2VDKB 3Q7SA 4RHYA 4C2TA 5MGBA 3A31A 3I6MA 2BSAA 3AB3A 5F3WB 1QUFA 2BR3A 3FN4A 1SB8A 3WK6A 1U8AA 4E12A 5EZ5A 2WIKA 4CN9A 3VDQA 1M33A 1IJKA 1Z08A 2HDWA 1ODSA 4OHZA 3WIUA 1B26A 2GPBA 2RHWA 1HZJA 5KWVA 2XF8A 3IBYA 4KFSA 3E7PA 3VYVA 1BFUA 5ULLA 1GGHA 3DPIA 3OTIA 3E8MA 4DUZB 5REQB 1ICEA 1Y8QA 3DMGA 3D4LA 3SQOA 4TVBA 1IBMB 1E3IA 1PGOA 1H6BA 3CLRC 3HEBA 4LHWA 4OYYA 4PO8A 1CNFA 1OT5A 2NAFA 2WWGA 4IH4A 4Q18A 4J1TC 1N8TA 1USUA 3MJHA 4KXUA 5M7EA 4BO6A 3JVUA 1Z5OA 5DWDA 3TGPA 1V8OA 5LNK6 3P0FA 4UDXX 3C5WP 3AETB 1HTWA 3HJHA 3HNPA 1EUCB 3T38A 1QJCA 1BXRB 1MZVA 3NANA 4OQMA 3ITKA 1RRKA 2CMHA 4QHYA 5FYDA 3MRXA 3N59A 4G5SA 2Y1FA 3V4ZA 1QO0A 3EF0A 2FJ0A 4UMEA 5CA1B 1E2UA 2CFSA 1X92A 5ADWA 4QEKA 2G08A 2W2TA 3MGGA 4KGXA 3SDZA 2E4ZA 4EO7A 1XSEA 3FKSD 3H4VA 5U9CA 2IXTA 4JQSA 3ZE8A 1MV8A 1GZVA 1SK9A 4CFSA 3W1VA 4BDSA 1AGXA 2JAQA 3O2SB 4WKBA 4JI0B 3VZSA 3T4PA 4EM6A 4M87A 3TOSA 2NO1A 1UPFA 2C4WA 3F3KA 5HZHA 1OAAA 1VMAA 3GFSA 5CB4B 4MPRA 1QONA 4G4SO 5LU8A 1WZCA 4P80A 4FHFA 1GYRA 5TX7A 1T1EA 4KUEA 4M7WA 5FWXA 2DFTA 3E1GA 4UJ5A 5KBYA 1WZ2A 1VP9A 1KK3A 3RJ9A 2GT1A 1QKIA 2Q27A 3PF8A 3LPCA 3D6VA 3KEGA 4INAA 1CZOA 4LSGA 3T4EA 3DCJA 4ZU1X 1H2AS 2R1UA 1L5RA 2ZYHA 3DOOA 2XITA 2GYYA 3HU3A 5CLQA 1DJNA 5D86A 4OOFA 3G82C 3MF4A 5E7MA 3PV0A 1FP4B 3NV9A 2Z3WA 3PB3A 4HGRA 2ZUTA 3BCUA 3NHFA 1CUZA 1NOJA 1UWCA 5D3MA 1N6RA 1G8SA 3CO0S 3HYSA 3KYCA 2AUMA 4G07A 3I9V6 4HXYA 1Z17A 2GEUA 3LLUA 3ZJUA 4N5DA 5BV2P 1PTJC 4X63A 5EIWA 4ARIA 2QWXA 1EE1A 3MW8A 4MQ4A 3KQNA 4MVJF 1L5KA 1EZ4A 5TARA 2OYRA 4B8WA 3DEYX 5TXGA 3HCWA 4LX0A 3MJRA 4C2AA 4YCCA 1RD4A 2HJSA 1RHJA 3CF2A 4WN9A 4Z9XA 1ZJ4A 3H6HA 1CY8A 1XCPA 3OECA 3VQTA 4JT2A 3QKSA 2SBTA 1YDFA 3JQFA 4PPNA 2RBGA 4ZPXA 4KO2S 4H4DA 5HG0A 4AN1A 1D9XA 4IJMA 3OZXA 4TV8B 3ZIAD 1FNCA 4B7XA 4DSUA 3AEUB 5FA8A 1CF9A 4C87A 3M2PA 4IHJA 2AFIE 2R6JA 3DMHA 4I50B 3THOA 3VPHA 3N8HA 5CNKA 2B7BA 3WRXC 1XA3A 2YTZA 4A2PA 4IJVA 4MKHA 4BNFA 1PZGA 4HLCA 4Q9LA 1P4RA 4QD3A 1I80A 3IT3A 2E4XA 2JGFA 4UE3S 4WCDA 3X1XA 1PJTA 2ZSEA 3U1BA 3SGLA 4QWWA 3G2OA 3UGQA 3IIMA 4UEWA 1SCIA 5BVGB 5CXXA 4JLJA 3AGQA 2D1TA 1EB9A 1YONA 3CZAA 3NO4A 4U2KA 2WFZA 1IN4A 1C1XB 2ZUUA 3ICCA 3K20A 4K9OA 2PKWA 3GUCA 1D6MA 4RFSA 5DSZA 5EP3A 2M9MA 2QBYA 2K2WA 3JQAA 1CP2A 1AKNA 2HF2A 1P39A 3TG2A 2C9CA 2VTVA 4LMPA 1TEZA 5L7YA 3QE0A 3HN6A 3OZCA 1E1NA 3PC8A 3D4OA 3G2KA 1VG1A 4HWSA 4Q6BA 4HNAB 1TU3A 3KYDA 4O2BB 4CV2A 1KBOA 4EH1A 2VATA 3TRJA 5D2CA 4KPUA 1G1AA 2DF8A 3M33A 4PICA 2XNHA 3O3OB 3IR5A 1QZ3A 2QRJA 4JBGA 4L5JA 3VVLA 4AP5A 3L06A 3KBBA 4HYTA 3R7WB 4FOTA 1A8UA 3HL4A 3AI1A 3RK0A 1I0ZA 2RGCA 3UQYS 4OLHA 3B6IA 5ERXA 1Q0HA 2IVZA 4R9NA 2GEBA 4M9CA 1G21E 1W4LA 3F7TA 1CVIA 3UAZA 1E2DA 2X8BA 4BATA 1MVLA 1M34B 1EUDA 4NBTA 2Z5VA 1UZAA 4AP6A 2UYOA 3BFJA 3GPDG 3HU5A 3BXGA 1FTWA 3I1IA 1YNSA 4WW0A 4D9NA 1AURA 1TI7A 1U9JA 1BO6A 1L7XA 1K86A 1CJMA 1HLFA 1RLJA 1UZLA 1W73A 2V55B 3CQ9A 3ZHUA 2Q8QA 5T4HA 4LNUB 1Z2OX 3B12A 3Q8KA 4H27A 4CVNA 3NHRA 3MTBA 3QLUC 3HA5A 3OFVA 4TUYF 1VCHA 3RHZA 4WFQA 3AOEC 1XX6A 3MB8A 4Q24A 4UKDA 3WS7A 2IH2A 3TR5A 2VAPA 4EEKA 3V55A 3JQ9C 1JXQA 4YMLA 3ND9A 4FJ1A 3KJGA 5AXDA 5CVEA 5IFLA 2Q1SA 2GYWA 1G16A 3R9KA 1WHSB 1AKWA 3DKPA 1QGUB 3VC1A 1PYDA 3N8IA 4FBGA 1SQ0A 4KQHA 4EUNA 4S05A 2WKWA 5AI5A 2QLLA 4FE7A 2I7DA 3SZRA 1L8OA 2PMEA 1BKYA 3UMSA 2A9KA 4AZ3B 1IVSA 1ENZA 1BCSA 2FZ4A 2C57A 2KLHA 1NUHA 2R97A 4I4LA 1A04A 1BX0A 2B69A 3ER6A 3IE0A 3MGCA 4TKVB 4D45A 3NC1C 3K92A 3T9BA 1G3QA 3UKJA 1JFSA 4MGKR 4XPIB 2ZYWX 4X66B 2Y1LA 3H4TA 1A8HA 1PFWA 4X8OA 5DT2A 1II8B 4DQDA 3HQ4O 2EKBA 2C2WA 4DUYB 1KVTA 1YS4A 4HATA 2V0NA 4MTLA 5B1DA 3BQ9A 4GKKB 3GNLA 3WO1A 2VRNA 5CVTA 2YC2C 3G88A 3MCUA 2W6QA 3C45A 1NXQA 5AJUA 3AU9A 1U2DC 3CUKA 4NL4H 3T95A 5ITZA 1JFRA 4A8JC 2WUWE 3IFSA 1IH8A 2LIPA 2VJYA 1DARA 4JA2A 1GEGA 5K1ZA 3L6RA 5EC8A 1AA9A 5LXTB 3HYRA 4EFMA 2H63A 1FFGA 4TSFA 4IFEA 1KHHA 1LY1A 3NHPA 1ZBDA 3C3YA 1XXHA 4WNCA 3ZY5A 2HMTA 1M5TA 2ID9A 1TW3A 1V8PA 2CK3A 3MT8A 4B87A 2X1MA 4Q4JB 1JYSA 2PPVA 3RYIB 3KQQA 2PS0A 3W5UA 3JYNA 3RWMB 1J25A 3GLHE 4LCJA 1UBHS 3T5CA 2QD4A 3NKLA 4BP1A 4GPAA 3DNMA 2IBSA 5ETJA 2X7HA 1R4AA 1RYHA 2I76A 3EJ6A 3OMLA 4JP8A 3OF3A 3EXEB 4UHCA 4Z4GA 1XCLA 3A6HA 1GADO 2E7ZA 2XTNA 4MNTA 2O2JA 3LK7A 3TRHA 2WWIA 3A58B 5AWFC 4DGSA 4P2GA 1IULA 2GXSA 2GRUA 4K3UA 5BR1A 4X20B 4BO8A 1JQKA 1Y1LA 4IIUA 4CCSA 2I55A 5DBGA 2IUUA 2G67A 8ATCA 1SCUB 1P74A 4QUHA 4FB4A 1I4TD 1RTTA 2HSJA 2Z6VA 3C7KA 4KRGA 4S1VA 4JB2A 4EG5A 2YHUA 4I2VA 4ICIA 5EN4A 5GTDA 2VDOB 1P61B 4TWBA 1H2YA 4L4UA 4Q3LA 3VPDA 3ZZ0A 1M2EA 3FROA 3KOYA 2IU4A 1T2DA 1KJ8A 4QUBA 3QYPA 2BLNA 2JCVA 5JWRA 4DEXA 1IK4A 4CLRA 4RK1A 2I22A 1S7CA 3KELA 4ZAGA 2QSJA 2VJOA 1X1DA 3V8RA 1PFKA 4O8CA 4B8YA 1ZAYA 1BSVA 2HRCA 4NQRA 3DC7A 3RC8A 3HVRA 3C43A 1JR4A 4IUDS 1V8BA 1K8RA 3N53A 2ZM6B 1JN0A 1WDKA 1UEXC 1CV2A 2VNIA 1Y5MA 1GNPA 3LXUX 1PJ4A 3S2GA 4NOLA 4QU5A 1RJ9A 1Y8QB 5ILOA 3PC7A 3B1JA 1O6FA 2QZZA 1KZGB 3FWPA 5DTEA 4YRKA 5CLIA 3RSHA 2HMWA 4GS5A 4Z7NB 3K73O 5LUAA 2YY7A 3SC2A 1J33A 4AG5A 1WP9A 5G0UA 2Q9AA 1P2DA 3EYAA 4D9MA 5ERGB 3MSCA 3FNGA 2F17A 1FK8A 1P5FA 2VO1A 2FZVA 5HM8A 3PEFA 3RK1A 1ZGBA 1ZH6A 4UCFA 2CL5A 3WHPA 1P9NA 1ZVMA 4QQ8A 2VP9A 4TMYA 5IM5A 1XYGA 3HB1A 4AL4A 1E89A 1K63A 3EB9A 1W36B 4GE0A 4PS0A 4UNQA 4ZYUA 3NAQA 2C4MA 3WOHA 3VPBA 1E0DA 3CLUC 3TVYA 5KEIA 1I4EB 2GPSA 4LDNA 3CW9A 1KAQA 3AFMA 2AI2A 1H2ZA 3OO1A 4HVCA 1DKLA 1EUZA 1XTKA 4IGIA 4QGAA 5LUBA 1NPYA 1LFDB 4G5GA 3DL2A 3N8KA 3S3TA 3SYTA 1F7UA 2JIRA 1G5RA 1M6NA 1YFKA 2CUKA 2K6GA 2YDYA 4OQLA 1WV0A 4JWKA 4PZZA 4NMHA 4W9NA 4YS6A 4UM8B 1FLNA 4BB9A 1NUTA 2G04A 3ZJ5A 1IU9A 6PFKA 2EQBA 3IT0A 2R11A 3H9UA 3AZQA 4AWXA 3TFWA 1VL1A 2DFNA 5ALEA 1RYNA 4X5OA 3K6RA 4H1TA 5TMBA 1XQVA 4JVLA 3AR3A 4L3VA 3WXBA 5FWXB 1E2JA 2VP2A 2I1QA 4Q05A 1F8FA 3GRRA 1TUIA 4Z0TA 3WBJA 2IS4A 1T0UA 1VKZA 4WUVA 2YXNA 5ALXA 4B8ZA 3NZEA 3WZLA 1V7CA 2JGJA 3VPFA 4F2GA 1E3SA 5AKIA 3A9VA 1ZIDA 4ITUA 1FEZA 1L4GA 2J09A 4P4GA 1CBUA 1O95A 4RHTA 3VSBA 5CYFA 3V46A 3R24A 1KO8A 3QSGA 4IG9A 1Z45A 2RHRA 5L3RA 2JFOA 4V1CI 3HEAA 5CFMA 3KJZA 2NUAA 1B8UA 5TGTA 3E61A 1O77A 5D3MB 1MD9A 2ENWA 3OC0A 3T3PB 3KYCB 4K6GA 4DLZA 1UJ4A 2CUTA 2VPIA 1VJ5A 5A0VA 2PUHA 4N01A 2FFBA 5HMLA 1EA7A 1MX1A 1PN3A 1TEVA 1YDWA 2IYLD 2JCGA 1TXGA 1LCIA 2PK3A 4PNPA 3SZLA 4COOA 4EHKA 3ABIA 5C3UA 3P0JA 4I4TF 3MAGA 4DN6A 5BR4A 1M5RA 1J5EB 3BWEA 1N2CA 1O5OA 1RQRA 1S5PA 2P2YA 3JVIA 4WINA 2GETA 4WN3A 1GZUA 3G5AA 4HUQA 4WN9B 3W6OA 1RWMA 1WO8A 2XUPA 3GZNA 5AUQA 3HI6A 3QKSB 4MYSA 4DMMA 3OZBA 4LMRA 1ZPDA 1BE8A 2EXXA 4U3JA 1LF0A 4MRPA 5D01A 4IHJB 1EQ2A 4UBOA 5EMNA 3WP0A 3ZR4B 1EXDA 3E7WA 5I7VA 2Z3ZA 1CF4A 3O1IC 2Y99A 3WHIA 5CB0A 2RHDA 4UFPA 1EE9A 2HA4A 1Y3DE 1JEJA 4F2PA 4ZDWA 2G07A 3OIWA 2D7DA 5AKLA 1TT7A 4IH1A 4LX8A 3A1CA 1N92A 4LC1A 1XF1A 3HV2A 3UHFA 1YZYA 4YRGA 1U81A 5AI9A 2B82A 2EZ8A 1D2AA 3B20A 4RFSB 1KO5A 3VZBA 3WGTA 4ZOAA 1CUHA 3JQAB 4G0XA 4XPZA 1LPOA 5C53B 2QBYB 4LF7B 3GGJA 2HWXA 1AB6A 1DC5A 4BKOA 4DXDA 1Q0TA 3PI7A 3NYRA 1B3RA 2NU6A 2WHXA 3RARA 4K81B 2MSNA 1LPPA 3QUBA 1U2SA 4FEGA 2AL7A 2PVSA 3MTAA 4G63A 3KYDB 5M3BA 4HPJB 3R3SA 4KPUB 2B78A 3ZWXA 2HHAA 2PD3A 3H5LA 3OKCA 2ZIVB 1U9YA 3SFZA 1XQ1A 4MROA 1PGPA 1U0TA 3MCAA 3PK0A 5ALMA 5A3JA 2OSVA 3DVQX 4C78A 2ONCA 1Z16A 2CL7X 2ESRA 1PT6A 1WW8A 1W1IA 2P78A 2ZJ2A 3D54D 3DMTC 3NT5A 3SIRA 4AUMA 4DT1A 3N2NA 4CMIA 3KALA 4BQFA 4OHXA 2VDNB 3P9PA 4IL5A 1OWMA 2P77A 3IKLA 5FULA 4W1RA 1EUDB 3TLXA 4BB0A 4B75A 1XCMA 3Q9UA 5CUQA 2QSUA 4OF4A 4EX7A 4C4YA 2AG1A 4RJTA 4AB1A 1ARZA 2VNHA 4OMDA 2VK1A 2XCUA 4BEJA 2CNOA 2BGUA 3H17A 2NXWA 4LJ7A 1BDBA 2FQQA 4PG5A 1EVLA 2B8EA 5J4KA 1BVHA 2ZUSA 1IVYA 4NU0A 1NVAA 5FLKA 1X1AA 5TT1A 4XD2A 5BW5A 1T9DA 1EESA 2APJA 2OZPA 1KHTA 5K0EA 2W7TA 4EEXA 4ZZIA 4MHTA 1WXWA 2Y68A 4D0SA 4WHMA 2O1XA 2AX3A 4YK7A 3ZY2A 1YWGO 1X0XA 2VNAA 3FD8A 3L1KA 3MELA 3HCBA 2Q9UA 2OENG 4F97A 5D1HA 1AB5A 1JQLB 4Q00A 2HMUA 4OYHA 3IUMA 1FTSA 4YAKA 5JAZA 1Y6GA 2BUBA 5FCDA 6CHYA 1A3CA 4RKQA 2JBAA 1BCSB 4QOJA 1RKUA 4WECA 2A94A 4EB6A 1L4FA 5AXCA 3PI6A 4BFVA 3TH5A 4CE6A 4HRAA 4RVOA 5I7HA 1PU2A 3UHOA 1WETA 3CVVA 1U5BA 1IK6A 4QZVA 5AK4A 2CXNA 4LZNA 1V3QE 1ZY2A 2BGWA 3IYLW 4OH1A 4EECA 3QPUA 5FYQA 1H4QA 1UBUS 1XZPA 2JJQA 2B4QA 5FWDA 5JSFA 1QZXA 3QSYA 4FEAA 4H7DA 3LBNA 4Y6RA 4M9XA 3EUWA 4WK2B 7MHTA 4DEVA 1Z62A 4EL5A 2F4NA 1SRQA 2G7MC 4XSVA 5ITZB 2B92A 2OAGA 2V7WA 1WEHA 4D7AA 3AHHA 5HOEA 3ZHZA 1PGNA 3QLTA 1I2AA 1Y6QA 3TRIA 4CU5A 1DHTA 1ZI9A 2Q5JA 1XXHB 4NE7A 3CMCO 5EJMA 1X15A 4MW9A 3V80A 4LXTA 1UT6A 1AG9A 1RLIA 3K2EA 4WI1A 5TJHA 2IDMA 2VN8A 1G55A 1OHHA 2JRLA 4YCDA 4I1PA 5CW1A 3LDFA 4Z99A 4C1NA 5T3YA 2HO4A 3MJVA 5IVPA 4XQ9A 2FUKA 4CIBA 1QIGA 1CR6A 2V6JA 2ZI6A 3H1FA 1V8DA 5I51A 2QTRA 3MTGA 2YWDA 3R77A 4M1WA 4Y0NA 4BY9E 3RS5A 3Q1LA 3L01A 3U4CA 1EK2A 4C20A 1DIBA 1U2RA 3L5OA 4E11A 1EGMB 1GV1A 2X9LA 4PO1A 3AHJA 4UC0A 5E1MA 1N1GA 2J0UA 4HR7A 4P84A 3FRJA 4RIEA 3DMDA 3WHKA 5EUQB 5JCXA 3ENNA 3M6AA 4HH4A 3ZVRA 4B3HA 1P44A 3GAAA 4OM8A 2X41A 3QX9A 1FFAA 2DFLA 2DQSA 1FFHA 5IJZA 1TOAA 2CB0A 3WGKA 5FT9A 1NZJA 3AQ4A 4NMXB 2GN0A 4AF6A 2XUZA 5LDGA 1FFBA 4D8UA 1B43A 2FRDC 2HB6A 5AHKA 4LXGA 3RF7A 1Z0UA 2WT8A 3O92A 5DBFA 3PKZA 4CLRB 3LTEA 2O14A 3ICOA 3K96A 2COKA 1GQOA 1Q2XA 1V71A 4UUMA 2VSXA 1A5TA 4HNHA 2R2AA 5CEFA 3SC3A 4DWJA 2EFGA 4KXWA 4MPJA 5IDQA 4R0NA 1E9BA 1HE5A 2Z8YA 5ECYA 4CTNA 3HVJA 3H2HA 4TL7A 1QR2A 3LJKA 2YICA 3DEIA 4CMKA 1RE1A 4C0JA 4DPMA 4ZZ0A 5C8YF 5CITA 3U7JA 2O2XA 1NN1A 3M4XA 5THXA 1XMJA 3K70C 3UW3A 3A9TA 3JARA 3Q3EA 4GP6A 4KO1S 2WRZA 3CT4A 4XLLA 3TNDA 1RJ9B 1T35A 3OA2A 1VE6A 4EYKA 4FFSA 1H6DA 2H7VA 4J2TA 1P1JA 4QARA 5FAKA 2MHCA 2B1QA 3EQ8A 2AG8A 2J5RA 3DMRA 1XJ5A 1SUDA 3HR7A 1DTWA 4B3FX 1P1RA 1Z5WA 2FEPA 5IKEA 2ZWVA 2HD4A 3JZAA 3JYOA 3ZVMA 4IKOA 2O8NA 1UINA 4P08A 2PY6A 5DM4A 1P9WA 2HU7A 1CUVA 1NR5A 3LC2O 4V38A 4DWOA 1U2EA 4DDWA 1G38A 4GNRA 3ZDEA 1XMVA 4J4BA 1E9AA 4Q4AB 2QMHA 1SZCA 4KQ9A 4BFWA 4HXFB 4L8FA 4IOJA 2WG0A 4PQFA 3HCPA 3T3GA 1ZEMA 1F2TA 5K3AA 3HUEA 3CSSA 3LW7A 3PQ5A 4UM9D 2F64A 1QOZA 4GH5A 2PD6A 2OBBA 3G3EA 3TW4A 2IEBA 3FGPA 5TRTA 1TQ2A 4AK9A 1W4ZA 1XQ6A 2MYPA 3C5CA 3LC1O 1EFAA 2OHJA 4DNQA 4CR6A 4LS3A 4Q7MB 3KB1A 2OA0A 1GPKA 1SC6A 3OZVA 1NSFA 3R0QA 4R5MA 4UHHA 3IQFA 4DNFA 4UOEA 2C5LA 2X0IA 1XOIA 1PNQA 4MVJE 5JSYA 3BD6A 1KRHA 2Y4OA 4ZP1A 4LWPA 5HHTA 2P27A 2BDEA 3WMFA 3H5OA 3H8VA 4DV0B 2D74A 3BDAA 2H17A 1YS9A 3NH6A 4KGDA 4YO8A 4EL0A 5K4GA 4HTAA 2FR1A 2JCYA 1KP9A 4RJKA 4MGIR 4G9BA 2Q7OE 1M7BA 3ZE1B 3MJFA 4G1BA 3WRYA 3QPDA 1OLXA 1XC7A 2C29D 5K51A 2NUAB 2LV8A 4O02B 3MHPA 1LU9A 1HQKA 4UNNA 5JHHB 2H2IA 4HS4A 4M1MA 3F67A 1MTZA 3PYLA 4MGEA 1JG1A 3ISVA 4R1MA 4CM6A 1ZIPA 1YKFA 3KVOA 2IK8A 3NHSA 3SX4A 2KW5A 1EKXA 2ZYUX 4P5EA 3NJ4A 4R2LA 3RG2A 1PJQA 1NPDA 4OQNA 1OFUX 1HDIA 1R0YA 2EVWX 4JH0A 5J40A 1A4RA 2O8BA 3WA6A 4NBLA 2V9PA 1CR0A 1E9CA 4YTEA 2W2LD 4PO9A 1GAWA 2MSCB 1XVUA 3DE2X 3FBWA 4PCVA 3TW0A 2N42A 4LBZA 3GZNB 4LTDA 5DM1A 5CT4A 1OILA 3RYFA 3DT8A 2I67A 1M1UA 2ZSAA 2BMFA 3BIXA 1ADYA 3ENKA 3N0VA 3ZW8A 5IYZA 3E0XA 2QDKA 4U3JB 3UAYA 2Q1YA 3MTDA 4P7GA 1P80A 4BIMA 3QUQA 1ABBA 5BXQC 4H35A 1NLYA 5EIFA 1MBZA 3G2PA 1N5DA 4S1PA 1QC5A 4IV8A 3NPMA 1U28A 3KSUA 4RADA 2Q5CA 4IOLA 3VNQA 3WWEA 1XLVA 2V58A 4E2WA 2NN3C 1B15A 1KMCA 1CFJA 2WC1A 1YUMA 3S8MA 3THSA 3H75A 1U4OA 1CX9B 4EQZA 3C8DA 1DAHA 3H4IA 3K31A 2A9JA 4D9JA 1VBFA 3MN1A 3QA9A 3GT7A 2WOJA 3GYGA 3RSCA 2NU6B 4X6XA 3RABA 4M99A 5DLDA 1V7QA 1EFKA 3GHYA 3HJAA 3Q3VA 2XYQA 1TRKA 2EU8A 4LPSA 3UA4A 1GTJ1 3DD1A 5JCOA 2A4KA 2LDXA 4MRSA 2O6HA 5DGDA 2GHQA 2XIQA 3NGMA 2AEFA 4COKA 2A9PA 2YC4C 4J75A 2Z6AA 3D5TA 4ZOLA 1I6KA 4B35A 1N0IA 1RXEA 3JQCA 1PKEA 4LTNA 2IHUA 4QASA 4DT1B 3RVDA 4G5OA 5B57C 4X54A 3TIVA 5F77A 4YUYA 1N5KA 4CMIB 1N3LA 4D8XA 1JLSA 1SVNA 2D06A 3EDRA 1NNEA 3M6IA 5JT1A 1IOVA 3B85A 2QYTA 1UIRA 4QXAA 2CXSA 1QK5A 3KTAA 2FZEA 3OZTA 4XRGA 1QHNA 4ZU6X 2AFIA 4A5SA 2KLBA 3IUNA 3L92A 2IKQA 3FLAA 4H7HA 4FYVA 2I4NA 4G8CA 1U04A 3UK7A 4ZI7F 1Q21A 2GCIA 4GMGA 1ZJ6A 2ZRBA 3TNFA 1GZ7A 4NPAA 4HAXA 3O8QA 3ACDA 1GZ6A 2G71A 1OJLA 3AINA 3OI7A 1IBKB 1I3CA 7AT1A 5DLEA 4LJKA 5CR9A 3VV2A 3R8FA 3EUAA 5H3CA 2GRJA 1MGPA 2LBPA 2R7KA 4REOA 3FCAA 4PQRA 3QJGA 3T7DA 3K2IA 2NX2A 3KPUA 4KQIA 2QUBA 2W4MA 2QNBA 2YX1A 4QUDA 3W05A 3WKBA 4EYGA 5J4HA 3GRFA 4OB7A 1PNOA 3H3XA 1E2BA 4OL0A 2Q2QA 2W6JD 4HAWA 2FEWB 1QQBA 3ZQ4A 1G8HA 2RB4A 2JBAB 3VNVA 4EB6B 1UPXA 2GA9A 3ZWYA 1M6HA 3TGLA 2DY0A 2CWDA 2OCKA 1PIWA 2WMDA 3I1JA 3OWHA 3W9SA 5LCXA 1U5BB 2XE4A 1PG0A 4CUJA 3ZD7A 1XLTA 3CNHA 1G21A 1HA3A 3F98A 1M1NA 4H08A 4Y2VA 4JJKA 3GGOA 3QWFA 4Z8XA 4HLUA 4OFWA 2ECOA 2WKPA 2WJHA 4P0TA 4UUBA 5BSUA 3U6BA 1X7YA 1XZQA 1SULA 4RGVA 2QW1A 4FXPA 2ACEA 4CTMA 2IXGA 3WGUA 2BZ0A 5KYXA 3KOWA 2UDPA 5TPZD 2TECE 4LOJA 4BJ3A 3FPCA 5BWBA 4FHGA 4RTSA 3FOCA 3TZEA 5ILQA 5AVOA 1ZICA 1JAZA 5EINA 3IP9A 3FF1A 1HDEA 1U0RA 1O54A 4FWBA 4JLNA 1M8JA 1XBTA 5DFAA 3R8XA 3H2YA 3A1EA 4DGQA 4MO2A 4ZYTA 1V6SA 1F8UA 1G3MA 3TVDA 2M6SA 2XTMA 4DV6B 4PVDA 4YAOA 5GM1A 1C3JA 1MEJA 4EY5A 3EPRA 4Z4FA 1QORA 2ZANA 4UHKA 4HFJA 4UMVA 4KYTA 2Z2YA 3EGWA 1S02A 4OSEA 2ZSHA 2HBYA 4O4HA 4IIYA 4ERXA 4L8VA 1JR2A 1RWBA 1N8NA 2ISQA 4PYJA 1E2NA 3DAPA 2J0UB 2I99A 2ZJYA 1WKBA 4LJSA 4JGBA 2IGTA 2RB5A 4A6EA 3OIFA 1ISIA 1VL2A 2UYHA 5E6UA 4DS3A 3H6KA 5BQOA 2PUAA 1UBMS 4TXMA 4GAEA 4G5QA 4L73A 3B1YA 3LRXA 2H06A 4FFDA 3HEMA 5CT9A 4IDPA 4Y6QA 5LDHA 3AY7A 4OGFA 3O8CA 4CDMA 4DRXA 1X86B 4L0QA 4R2KA 2X8JA 4BNXA 1COWD 1EVEA 2Z83A 3DF7A 4EJ2A 4RDHA 5AVQA 1BJKA 2J5QA 4GEKA 1Y4DE 1NN0A 3Q5GA 5A2QA 2Z6UA 4HO1X 4F1WA 1BMFD 3DT9A 1Q14A 1AGPA 2J3LA 4KXFB 3EMKA 3U7QA 1E2EA 2XT6A 3ZI0A 4JUCA 5SZJA 1UEJA 2VKQA 3HB0A 2FKAA 2QE6A 3EODA 4WDQA 3WGGA 3O5AA 4RJLA 4EO4A 4D6XA 3M6WA 3HGQA 1BHO1 1U9ZA 2O5VA 2WUDA 1L9KA 3GLHA 4YJDA 1ZH8A 3RBZA 4PRLA 4MVJD 3JARB 3VU1A 4GLLA 3EA4A 1Q1NA 3U1TA 3L7OA 4GOJA 3KTDA 3NVMB 4GICA 4MXDA 4P5DA 4AD8A 1AQUA 5J43A 1E77A 4M0CA 4I1SA 4ZOCA 4JSRA 1DTWB 1O4WA 1DQPA 3FPLA 2QD1A 4UUAA 4YV2A 1S8FA 1J2JA 1CZUA 1M72A 1FA9A 3DPUA 2ZXFA 3GAFA 4Q7JB 4CYMA 3L49A 4HB4A 1MOPA 1RJGA 1Z5VA 2Y93A 3EK2A 5BQXA 2X4LA 1IVNA 1SD1A 2H16A 2JHPA 3O47A 3TIGA 1NW3A 3CN7A 4EG7A 1L7QA 1J24A 2A67A 3MMZA 4RXTA 2P2ZA 3WQSB 5JJCA 2YHBA 1C1DA 4LRQA 1F2TB 3T3IA 4DNOA 2CUZA 1B16A 4JY7A 1FNSA 1SU7A 2IPOA 1JQ5A 3H0EA 3K32A 3PDWA 4GXRA 4RPGA 3GC6A 1NYQA 1AK2A 2P5SA 4Y9UA 4YY3B 4MX8A 1JW9B 2WI8A 1YTLA 2ZR9A 4KLAA 4Q12A 5K99A 4DR2B 2YBEA 2E5LB 1T2FA 4NCIA 3ZTWA 4CHGA 5C8XA 1FIUA 1GRVA 4FYJA 4HQNA 5LQCA 2IIPA 2XA9A 5EIHA 4C76A 4JJZA 3RNOA 2ZWIA 4FJ2A 3NALA 5FBRB 1Q1QA 2GDJA 1Q83A 3KKEA 1NBHA 2WIGA 3KE9A 4R0VA 1I6WA 3MZ0A 2VHUA 4ARUA 3HADA 5JNRA 5BYKA 4DSTA 4II7A 5D51S 2GKOA 1KVRA 2IW1A 3FPJA 4LXXA 2VJAA 3ZCRA 4WXHA 1GY8A 4YCAA 1MF7A 1H05A 1SCNE 1PEDA 2DGDA 3D7MA 2ZRFA 3M5CA 3N5KA 4U02A 1ISMA 3GRKA 3A1TA 4IILA 2N75A 4LCBA 4S12A 3UMMA 2OMKA 2VYVA 4U7WA 3PEUA 3BWVA 3FZYA 1TGVA 4TMVA 1Z82A 4WCFC 3U40A 4MJLA 1N5JA 1YI0A 2WHQA 1SWWA 1TCCA 3SXUA 1OPRA 3T41A 3OJXA 3KQTA 3ORQA 2IF0A 2E1PA 3QRWA 4JL6A 3FNHA 4UEKA 4EI2A 4YMUA 2DPYA 1VSBA 5IU6A 3OVMA 2V7TA 4TTVA 4AQYB 1G5PA 4HFMA 4FGWA 5KHLB 1BXKA 1HDYA 1UBKS 3DWGA 2HUPA 3E8XA 1QMPA 3IVGA 4OJTA 5GONA 4CQLB 1YQEA 2GEJA 4LY3A 1Y9ZA 2JI4A 2AR0A 2VZEA 2XGGA 3EXIA 4DIEA 1CUAA 2HHCA 3A36A 4PIVA 1EK6A 3AUFA 2A8YA 5EI5A 1PT7A 3WBFA 4BNLA 2Y2UA 5D3KA 1RAFA 1IQUA 1FYWA 2K7ZA 5LP6C 1WOMA 3QHPA 3ZGYA 3E22A 4XX0A 5K8LA 3AM3A 1UOOA 4BX0A 2CYAA 3L0PA 1O0BA 5AOCA 3RYFB 1EWVA 5C7OO 2EFEB 5IYZB 4DWVA 3U3DA 1SUPA 1ESNA 1P75A 2PX6A 3R3JA 3KFVA 4I9NA 3GJYA 3ASYA 2GPJA 5ENVA 3QVOA 2YVQA 1OWLA 3LOPA 1SPXA 4OYRA 1I1NA 3M7IA 2CV1A 1EDZA 1QC5B 3SYNA 3TTWA 1OZ0A 5E0KB 3BCSA 3I01A 2B9VA 2GHRA 4HDMA 3DLPX 4YIKA 2FSHA 5HDQA 3M1AA 3OT1A 2L19A 5FWAA 3ER9A 2IYYA 4A15A 1DV1A 1NU8A 5B4UA 1RWOA 2RIPA 1WUYA 3EEIA 3OURA 2LIVA 2D1YA 4ZQFA 5LZ7A 3AIKA 3RAEC 1EK1A 2HV8A 2OCLA 1NY5A 1N7GA 2SCUA 5LM3A 2OZVA 1XU4A 2GZ2A 2ZBFA 3ZHXA 1GZDA 4LJ6A 4A8HA 4ZWNA 4MS4A 3W7VA 4FWTA 3I72A 3HCFA 2HNKA 4MMXB 4JSTA 3IX7A 2OC9A 2V3WA 3E7FA 5GQSA 4CETA 2Q29A 4ZOLB 3VVBA 4UTPA 1WV1A 4NEHB 2C4TA 2NZ8A 2ZBEA 3QKRA 5EJAA 3L8ZA 4IH9A 3U4DA 4E0BA 1ZGHA 4QICA 4XUEA 4C08A 4WXMA 4YALA 1HL3A 3HCOA 2BCGY 4MYUA 4N65A 4I6GA 1LPNA 3UV3A 3DZFA 4HF7A 3WIVA 4MW6A 3KTAB 4KR7A 3SP1A 3BAFA 1E1DA 3PIRA 3ZCUA 5CAEA 5HCUA 5HKOA 2LR0A 4JYBA 3KETA 4OOEA 3MWKA 1TMYA 1CJUC 1T5TA 5GJCA 5A62A 1H2WA 1Z38A 1BWPA 2WTMA 3KOMA 3BMOA 3O8QB 4BX3A 3ZWWA 5IULC 3RANA 2IEAA 1GDHA 1VCIA 4LSWA 1I3KA 1QKJA 1ZOSA 4FGUA 5HA5A 4UBNA 1JHAA 3UJPA 4B71A 1OX5A 3PD0A 1MQAA 3IQIX 3OM1A 1KTVA 1U7HA 1IZZA 2FPMA 4M1EA 4UBJA 4IS3A 5DXFA 4F5ZA 4XKJA 3LPLA 2B9EA 3B2QA 2ZCVA 4IQ4A 4DYVA 4RY0A 3ADBA 2CLKB 2QXUA 1QDLB 4A6PA 3L4KA 3LIIA 3FPHA 4K03A 4DB2A 2V9CA 3AV3A 2C42A 3AKEA 1CCWA 1O97D 1OIVA 4TL9A 3C3DA 1G1MA 4ZYVA 4F4CA 3RI3A 4BN5A 4EPRA 4F9TA 5SYNA 2D1RA 1Z7WA 1K7XB 2JDID 1PGJA 4MV5A 3KQHA 1S1MA 4R83A 5LSAA 3LUAA 1YVEI 3G0GA 5CIWA 1VB5A 2FPOA 1HNZB 2PRJA 1XCOA 2W2LA 3AP1A 2CWWA 4R8KA 4RY9A 3RHFA 4ZGBA 2WJVA 1CW2B 4JHLA 1G21B 3AR6A 1M1NB 4UDYX 1GZHB 2IUSA 3GNTA 1IMJA 3K53A 4W7IA 3ZE6A 1GCAA 1C8BA 1K8YB 2YNMC 3WHLA 1X7YB 2P3OA 1MC8A 3HKEA 4JQYA 2ADMA 1GPH1 1EI9A 4RZ2A 3ZGVA 4HY3A 3E82A 4ERNA 3GK3A 3OJLA 5KYXB 4EA7A 5FWYA 2WU3A 1EHCA 1XTBA 2ZYRA 1GG2A 1ZNWA 1B14A 1QMGA 3KUCA 3VYSB 3L9XA 1QIIA 3IA2A 2H5EA 2R7AA 3DE4X 2GZ3A 1ZVVA 3SJAA 3TNLA 1PWZA 3VHXA 1M8PA 2BEUB 3KB6A 3ZK9A 3C7CB 1S3GA 1NF9A 3JVEA 1G7TA 2DLDA 1T0HB 2XB9A 3ZPXA 4CIXA 1XDUA 1L1FA 1KNQA 4QQKA 2VJPA 5F1KA 3UIEA 3MT9A 2C83A 2XX3A 3VOTA 1EAYA 1TCAA 1GQ2A 3NT4A 1OPXA 4J2HA 4QFCA 3E03A 4ZREA 3T5AA 1A4XA 2R1VA 1CUYA 4O4HB 4HUTA 4BFXA 4JBXA 1E9EA 3LWDA 3QEAZ 2X0NA 3GJ0A 3W2HA 1YU6A 4JDPA 4DYDA 4DKJA 3NASA 4E22A 4F3CA 2P7HA 4J6EA 4KVFA 5E6UB 4IJWA 3QMMA 1MA0A 3GB9A 5JIBA 3CLTC 3JTMA 3K0FA 4D0LB 1N0HA 1I7PA 5IUKC 1N5OX 2RGEA 4R41A 3VVMA 2BH2A 2NV2B 2JIQA 4QXMA 1MB2A 1KXJA 4FQ5A 4TT8A 4DJDC 3C14C 2ZUFA 2XUJA 2MINA 4FKZA 1Q84A 3TD6A 4DRXB 4ZOBA 4JT8A 2X8JB 2BTQA 4WZAB 1IXZA 4KR0A 2OYSA 4EGSA 3N87A 2VJQA 4C0KA 2C0QA 3Q4GA 2HMSA 2BFDA 4PY2A 4A8PA 6GPBA 4NI5A 2HRRA 4J1SA 3U7QB 2B5OA 1VC2A 3WLQA 5IZ4A 4ZODA 2RAFA 4QTTB 4D0GA 2GYUA 3PLAE 3OKFA 2WJGA 2O7NA 3ESAA 4EX6A 1L4NA 4ZYZA 2XIJA 1O57A 4DLYA 3T9EA 1WXQA 1WLSA 2G8LA 1QHSA 2QRKA 2IWRA 3NWOA 3GLHB 1QX4A 4MI6A 3OOHA 3OCUA 1M8KA 2Q3BA 3RTAA 1BJTA 2Q9BA 3QZUA 3G7NA 4A27A 3G1TA 2G8NA 1QG2A 1BG6A 4L76A 4ZIRA 1UXIA 3GWZA 1KNXA 4ZDIA 4JXZA 2I66A 3CB2A 2YCLA 3ZWNA 1TGYA 5K3DA 1DTEA 1RHUA 3EDYA 2CHEA 5LDDC 2A57A 3DAHA 5KNCD 4BUZA 1EP2B 3A4YA 4O4JF 5J2TF 2GLXA 1JYEA 4IICA 4FT4A 3DTYA 4I55F 3T94A 2UYQA 3BIJA 4PWYA 4YFYA 4MCHA 4F12A 4B5KA 2INGX 2ZJOA 2ORED 4BVEA 1C1DB 3G8CA 4BCCA 4EVQA 1EAMA 4AJ1A 1N6KA 4KEAA 1WSBA 4ZZ3A 1QR6A 2NTNA 5C34B 4AS2A 1JU9A 2DQZA 1UP4A 3JATA 5AKGA 5C51B 2TMKA 1XK7A 4H3KB 4OU4A 2JB9A 3SBDA 3VX3A 4JJ7A 4G4IA 1KQFA 2H48A 2X6RA 1U4SA 3PA6A 4AKIA 2YW9A 4E5KA 4G41A 2GHTA 3I0NA 3TDMA 4A7PA 1LPMA 2W70A 1P1IA 3ZDYB 3OQ1A 1Z25A 1INLA 1QHEA 4EBFA 2DHEA 2YKGA 3OQIA 3R0ZA 5AOVA 5JNSA 3WQRA 4YRAA 4G9EA 3ZLBA 4EIWA 1DC4A 2FUG6 1D8TA 3CXUA 3ROMA 3WNCA 2YJ6A 4DE5A 1KA9H 4N8SA 4R71A 3UWPA 2DX7A 4B47A 4Z6KA 1R8SA 1ADBA 1EGQA 3NNDA 3RAGA 2O8DB 3U9LA 4JUBA 2GCPA 3EE6A 3ORHA 4K3VA 3K0HA 4HDRA 2YOGA 4WERA 1PWXA 1EXWA 1J0XO 1YZGA 4R1LA 4LHXA 2VI5A 2JIMA 3KYIB 3R41A 3M5PA 4ZU3A 3OMWA 3R3XA 4H0NA 1OLSA 4IBOA 3PKJA 1Y5IA 3DDSA 4IPTA 2VK8A 5IM4A 2Q5FA 1TZKA 2OCBA 1AHNA 3E9MA 2HDNB 2D59A 1J8YF 1LS6A 3C1AA 3H9GA 3IEPA 3OLYA 2H4WA 3EQ7A 4H59A 4JJ4A 4WZBE 4QGFA 4WEQA 4BEVA 2QVLA 2PLAA 3DE6X 4FYYA 5GONB 2AZXA 3LHDA 2Q4EA 3R5FA 1U63A 3EXIB 3B1FA 3HCEA 1E7QA 4F60A 2BGGA 1H8EA 5TC4A 2NYUA 4KYVA 5LQUA 3S40A 1K27A 1SZDA 1UJCA 4PLWA 1BMFA 1HSZA 3HSYA 4ML3A 4XX0B 1USKA 3IEKA 4JLAA 4JQZA 4CMAA