2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
1NTOA 1EBFA 1GZ3A 4U0JA 4PZEA 1J6UA 5IJZA 1LDBA 1PL7A 3A1NA 3GFBA 1HXHA 3D4OA 1R4MB 4PG7A 2PZKA 4JN6B 3LYLA 2BD0A 1SPXA 3DBLA 2I99A 5IZ4A 1G1AA 1UZMA 2CDBA 5JPIA 1ZFNA 4MOWA 2WEKA 3P2OA 1LBEA 3DTTA 4ND2A 4IDDA 1EVYA 2OO5A 3B1FA 1R4NA 3DZIA 1FDUA 3NGLA 5CDYA 1P33A 1NFFA 1I10A 1BXGA 4CUKA 2W2KB 4E0BA 4J9VA 1CERA 2VWPA 3CUKA 3R0IA 3QWFA 2EGHA 4MIOA 3Q0EA 4URFA 5A9TA 2X5JO 1PS0A 1UP6A 2CNBA 2JFGA 1GZ4A 3HG7A 4HNHA 4IS2A 4XYGA 3H9EO 4PLGA 2FRDA 3KYDA 4OKIA 3BTUA 2AE2A 3MTGA 5BR7A 4O59O 4KUHA 2ZYGA 3FRJA 1RYEA 3V1YA 4JP2A 4EUEA 4E2YA 2DQ4A 4J4BA 4E31A 4NH4A 3G1TA 2CMDA 4NJMB 3KYCA 4NU5A 4CMEC 1HKUA 5IN4A 2ZYDA 4WOKA 3D3WA 3FHLA 5A3JA 2ZATA 1ZJZA 1D7OA 4OKNA 1JTVA 2ZTUA 3AUTA 4HKTA 1IL0A 2VRCA 5AVOA 3DOOA 1HYGA 1D8AA 2C54A 4NBTA 2C07A 5IDQA 3E03A 3NGXA 4JX8A 4IQ8A 3VPGA 1B8VA 1H5QA 3SEFA 3B70A 1UH5A 2NSDA 1C0LA 1E3IA 1IPFA 5JDCA 3OECA 2BI8A 3MOGA 4M87A 3TWOA 5BSEA 2GN6A 2IZ0A 5G0TA 3PTZA 3DBHB 1PL6A 4FC6A 4FJ2A 4AJOA 3TN7A 3K2BA 1QXSA 3WTBA 2UUOA 2OBYA 3FSRA 4GL4A 4I9NA 4PLPA 1U8FO 1KETA 1KVTA 2C29D 1T2AA 1VI2A 5K0ZA 4CQMD 2JAHA 3E9MA 2VZ8A 1PWZA 1WNTA 5TC4A 1VL8A 3W4KA 2I3GA 4Z9FA 2GO1A 2QZZA 4RPGA 3PQDA 3HUDA 4UVIA 5ILGA 3LQFA 4J4HA 4CV0A 4M55A 3GPIA 1WXDA 4QFCA 1PJBA 3PJEA 4PLZA 2X0RA 3GAFA 2CY0A 4FGWA 4WNIA 4YQZA 5HM8A 4JBGA 4FJ1A 5C7IO 5CPBA 1P1HA 3FI9A 3Q1LA 1ZMTA 3WNQA 3A4VA 1PZEA 3RVDA 3Q2IA 1VRWA 3TRIA 1WWKA 3S8MA 3DO5A 5FI5A 1FK8A 2ZTLA 4A5OA 4O5OA 2A94A 3ZV5A 3QVTA 2EKPA 2X0NA 3CE6A 2QQ5A 4GX2A 4YJGB 4J1SA 4WLOA 5AQ1A 3QHAA 4CODB 3MJSA 2A35A 2CVOA 4RO0A 4RCVA 4Z0TA 5DOZA 2TMDA 4XYEA 2B35A 1GYPA 1ZUD1 4KWHA 4E12A 2EP7A 4MIYA 5KKCA 1T2FA 4B79A 1PIWA 5A4DA 1LSSA 1GQQA 1ZJYA 1KVQA 3HADA 3KTDA 1BW9A 4FS3A 4MVJI 3I9KA 5EESA 3ZNQA 1NAIA 2VN8A 1TT7A 1Y5MA 3IKVA 4IDFA 5HWSA 5F1OA 3VVCA 2O7SA 4FBGA 1X0XA 1F06A 4D45A 3GMDA 4A10A 2OUIA 3VHRA 3RUAA 3DBLB 1YRLA 3C24A 4AJ1A 3JQAA 1V3UA 4ALMA 4M54A 4ND3A 2UYYA 1K2WA 4OM8A 4D79A 4NHEA 5EPOA 1AE1A 1U2DA 3QY9A 2HRZA 1NVTA 1ZZEA 1A7KA 1QG6A 3F47A 3GN2A 4TVBA 3CTMA 3DAGA 5AXAA 2Q2VA 4IY1A 1PZGA 4LVUA 2FN7A 2DT5A 3BAZA 5JAZA 1RM3A 1BXGB 3KBOA 1UAYA 1NHWA 4TRMA 4PVDA 4ROSA 3D3EA 1EK6A 2Q3EA 2FOIA 3ZWNA 4EUFA 5CDGA 3K5PA 2C2XA 4MKXA 3AM5A 2VRBA 1XWFA 3KYDB 3R1IA 2GRAA 3QP9A 4CM9D 4BNZA 5DZSA 2EXXA 1N5DA 3ITKA 4PLWA 3TZ6A 5B4VA 2P9GA 4P4GA 4RPHA 3K92A 3GNTA 4YRBA 2YV2A 4EJ0A 4QFDA 3GG9A 3DB2A 1U7HA 1AXGA 5HA5A 4IPTA 1VJ1A 4BNLA 3KEQA 4HV4A 5DOVA 2Q45A 3GRKA 3KYCB 4YT5A 4E2XA 3FN4A 1YKFA 3D3WB 4GQAA 3NT4A 3SJUA 3SXPA 2WYVA 5KKAA 1NASA 5FFFA 4DRYA 3BTSA 3JQFC 3HN2A 3ZU2A 1K89A 4GLLA 5L3ZA 1C0IA 1IY8A 1JWBB 3K6JA 4IDGA 3VOSA 1D1TA 4NJOA 1WP4A 4ALNA 2X86A 2PV7A 1I24A 3H5AA 4YA6A 2DM6A 2VYNA 4IIVA 1E1LA 1NR7A 1ISIA 3RU7A 4YXFA 3RFXA 3G1UA 1EDOA 2Z5LA 1XU9A 1Y9AA 4GPD1 1CIVA 2Y1GA 4IJVA 4DPLA 5ER9A 4E5KA 3H6KA 3L4BC 3CH6A 2D0IA 2AHRA 3WGIA 4BO0A 2RIRA 3P7MA 3RBXA 5DP2A 1P1JA 2CSUA 3K30A 3VZQA 5JDIA 2B69A 3FPLA 2PK3A 4OQZA 2DBVO 1MV8A 2PWZA 3DC2A 3PLNA 5DCYA 5A3VA 1YDWA 3ZWOA 4DWVA 2FWMX 2OOSA 5JAQA 4O63O 1DHTA 4BKRA 4PRKA 4AJLA 7MDHA 3HJAA 3OP4A 4BQRA 1HE4A 3EUWA 4IQ0A 3WIEA 2IRWA 2QRLA 3V1UA 4MP3A 1M66A 1KBZA 3I1JA 3PRJA 4DIOA 3BMQB 2X5KO 3OFSA 4ND5A 8ADHA 4XQ9A 3T4EA 3PK0A 3JQ8B 3RC7A 5B1YA 1Y8QB 1A4IA 4J6FA 2PNFA 1EVJA 2J5KA 4O0LA 3WQQA 1HDZA 1X1EA 3CZMA 4EJ6A 4R9SA 3UCFA 4XJTA 1ML3A 3WGYA 3TZCA 1N1GA 3HDQA 4KUEA 3S2EA 4DLAA 4CUZA 5CP8A 4PLYA 2ZQZA 1UJMA 3INGA 2AE1A 3I9JA 4CJXA 5A9RA 5JFOA 3AUUA 2W4QA 4NI5A 2V6GA 5ES3A 4ALIA 4R69A 2VHVA 1U8XX 3I6QA 3OQ1A 3C7AA 3RUEA 3R3SA 1JW9B 1U28A 2NU8A 3AY6A 4NBUA 2NVBA 2BI7A 4W6ZA 3VKUA 3NAQA 4BMNA 5DBFA 1RM0A 1ONOA 1UP4A 3MTJA 2YDYA 1D3AA 4N7RA 3VAZA 4E2ZA 4FCCA 3I23A 1T1SA 1JN0A 1XEAA 1XQ6A 2JD2A 4Z0PA 3TNLA 1OBFO 4YRAA 4M86A 4UVGA 1BXKA 3JQAB 1E1KA 2PD3A 4FFOA 1VJ0A 3EMKA 5BSFA 3VTFA 1X1TA 1QYDA 4BNHA 2B5VA 5KWEA 3NV9A 5TX7A 2UDPA 1EK5A 3UCXA 1GEEA 3AU9A 5HS4A 4Z9XA 3U4HA 3M2PA 4TZTA 1PGOA 1QYWA 4IMPA 4E2WA 5T8KC 3Q9UA 5KJEA 3CSDA 1A9YA 4MKRA 4ZQBA 4ZU3A 4DYDA 4JJIA 4OAQA 3ZWXA 1XELA 3UXYA 4AJNA 3W6UA 2GASA 4WKGA 3WMWA 4YYZA 1PJ2A 1O89A 1MFPA 1B3BA 4B7UA 1P1FA 4GVLA 3WWZA 5IZCA 3QWBA 1YOVA 4IIUA 1ADCA 2I67A 4B3JA 1PQUA 4EW6A 4H15A 1P1IA 4OXKA 1T4DA 1NPTO 1XDWA 2Y05A 3E9NA 3JCZA 3ZV3A 2P2SA 3BMNA 1EEHA 3JQCA 1KC1A 3GGPA 2ZB8A 3BHMA 2WM3A 5L7WA 2PLAA 1ZCJA 4FSHA 3OHSX 1IULA 1V0JA 3VZPA 4Q3EA 5FI3A 2Q99A 4CMBA 2C7VA 3CZRA 4BNIA 2WDZA 5T64A 3VPHA 4I9HA 5JCJD 2DFVA 4PLVA 1VC2A 3O8QB 3PEFA 4B3HA 2D59A 3RC9A 1DRVA 3GVIA 4Q3BA 1B2LA 4UULA 5THQA 3OQ6A 2VOEA 5EMHA 4CUJA 4AJJA 3R3JA 2XXBA 1V3VA 2J6IA 1UXKA 4W4TA 2ZB4A 4IJKA 2VNSA 5GZ1A 2VUTA 1GY8A 1F12A 1UAGA 5K6AC 1RKXA 2C0CA 1W73A 3PHIA 4ILKA 5CG1A 2CF5A 3EAGA 1HLPA 3CMMA 3PJFA 1F8FA 2X8LA 2HCTA 4BB6A 4WGGA 4XGNA 1VPDA 4BGIA 1MB4A 2AA3A 4RZHA 4JROA 4R3NA 2BFMA 4GMGA 1C0KA 2JFFA 3LC7O 1YQXA 2RBEA 3JQDA 3L0DA 5TS3A 1LRKA 3B1KA 3GDGA 3U0BA 4AJKA 4XEHA 3GVHA 2VHWA 5TIIA 4BKUA 2VYVD 2Y0CA 4TQGA 3WLEA 1B3RA 2EEZA 1DLJA 2DBRA 4PLTA 2JHGA 4Q39A 2EW2A 1EUDA 1GPDG 3OJLA 4GMFA 3V5NA 4FFMA 3GDFA 2JFHA 2DLDA 1ZEJA 4QECA 4HFRA 2YFQA 1CRWG 4BNVA 1P77A 1DC3A 4HNGA 3T4XA 1FXSA 1PX0A 1XLTA 2EGGA 1T2DA 2EP5A 3JQBC 3ZV6A 4J7CA 4JJFA 5I9MA 2ZCVA 1C3VA 3C1TA 3NUGA 3IJRA 3O38A 5DBGA 1E3EA 3C7DB 4NK5A 1T4BA 3QLJA 2JCXA 2NTNA 1O8CA 2X9GA 3IQDB 1B16A 1I0ZA 4IS3A 4OGWA 3ZH2A 4P4LA 5JBIA 4CQMB 2IXBA 1PGJA 2RH4A 3Q9NA 4N5MA 3AJRA 1H9BA 4QQRA 2P4QA 3B6ZA 1K3TA 1F17A 1LXCA 3KXDA 2ZJ1A 4C7KA 5BNTA 3GFGA 1R0KA 3LT2A 1V6AA 4LRTB 3PJDA 4TWRA 5G4LA 4IXWA 4DA9A 5T67A 1FJHA 4R1TA 1EQUA 5KJ1A 4WASA 1K0UA 4AFNA 4AJHA 2B83A 4I08A 3ANMA 3OSUA 2E49A 2WE8A 4W99A 4CR8A 3UVEA 1HDXA 2ZKLA 5JYEA 4TRNA 1YQDA 1HDRA 5AYVA 4BNFA 2I6TA 2FMUA 2I65A 1BXZA 3HDHA 4OMUA 4W82A 3SLKA 1DEHA 4CLRB 4M8SA 4CM8B 1ZK4A 1Z75A 3DBRB 3DWFA 4CMAA 5G0WA 3ROQA 1MC5A 3H9GA 4G5HA 3ANLA 3L07A 3VPXA 4LCJA 4K1LA 2BHLA 2E4AA 1LSOA 2GUGA 4PGFA 4Z3DA 3G3EA 5HRUA 1S7CA 4UUOA 3VKVA 2ZK7A 2NLOA 3PGXA 3RUIA 3DBHA 4HUJA 4J1TA 1YOVB 2BH9A 2R6JA 1HSZA 1LDMA 2B4QA 5BSHA 2X1HA 3HFSA 2AG8A 5DNAA 5B4UA 1PWXA 3PHLA 4UUMA 3BMNB 1JWAB 1N8KA 3IP3A 1K6XA 1ONPA 1XYGA 2GCGA 2HJSA 3FTNA 3KM0A 1K5HA 2HLPA 1GDHA 4MKZA 3VDRA 4MJLA 1JVBA 2X6TA 3UKOA 3NX4A 1Q7BA 3GA0A 5IXYA 1P31A 3I9MA 3UHAA 4FIZA 4D3SA 4JQCA 3D0OA 4HFNA 4JNKA 3WFIA 3GH3A 4XB1A 3WSWA 2VHXA 1TA4A 4DBZA 3MJ4A 3NTRA 5JMWA 3TSCA 1NWCA 3QIVA 3ZN2A 4Z0HO 1WVGA 3WBFA 2VWHA 1LRJA 3PDUA 1G6KA 3P2YA 3AY3A 4A7PA 4FN4A 1QLHA 2G0TA 4YB8A 1Y7TA 1X7DA 4ZQHA 3WLFA 4PCVA 1NPDA 4PG6A 5ENVA 3AI2A 3PWKA 3WJ7A 4L74A 4MVJF 3F4LA 1GFSA 1HF3A 2H63A 2XF8A 1XKQA 1PSDA 4JBHA 3WB9A 4XYBA 3RCBA 1ZSVA 3ZWWA 3ZCXA 3MJVA 3VDQA 4ZHSA 4DQXA 3PQFA 2B5WA 2EIHA 3ZWAA 1MXFA 2YHUA 4YR9A 2BMAA 4NZ9A 3QVXA 3SC4A 5KJ6A 3WGHA 4DMMA 5A02A 1KS9A 4WUVA 4H16A 5C37A 2R00A 1K6JA 1EMDA 1V9LA 3ZNPA 3UH1A 3WYEA 1U3VA 3LC1O 5DF1A 1UUFA 4IDBA 3RFVA 3RUFA 5B4TA 1TT5A 2D8AA 3BTOA 2SCUA 3RFTA 4B4UA 3IC5A 4Y98A 4E30A 1LEHA 2X0IA 2NM0A 4IJWA 3WWYA 3H5NA 1XQ1A 3JD1A 4B4OA 4ZD6A 4BNJA 3IS3A 1Z82A 3WBBA 2PD4A 4B7XA 3VH1A 4EEXA 1E7SA 2V6BA 3AY7A 2Q2WA 4AJEA 1DC5A 1UXIA 4J16A 4BGUA 1BRMA 1OC2A 3DZKA 2ILTA 3JTMA 1ZSYA 2Y1EA 3ROMA 4E5PA 2HMUA 4BO6A 1LLDA 3NYWA 3OIDA 5L45A 1FDWA 4E5NA 5L95A 1DIHA 1YQGA 3JYPA 4L4XA 4RF3A 4BO3A 5JY6A 4JCOA 1ADGA 1MXHA 1N1EA 4DC0A 4NDNE 3GOHA 4DIFA 4CV3A 2VYND 4WJZA 1LQTA 4G2NA 4L9RA 4Y6PA 5L7TA 3W8EA 2VT3A 3WYCA 3U09A 1SOVA 2ZB3A 4PRLA 4W7IA 5DCUA 4XRGA 1PQWA 3H4VA 1ZK0A 4XB2A 1X7HA 1T1RA 1R12A 1ZMOA 1I2CA 2IXAA 2IEDA 2YQ5A 4RZIA 1GUZA 1RM5A 2FR1A 4W9NA 3WIDA 3L9XA 1RM4A 4I8XA 4BO4A 2DPGA 2C2YA 1DBVO 2DTDA 3HE3A 1HYEA 4CM1A 1FF9A 1I32A 1NYTA 5JY1A 2RAFA 4L4RA 3C85A 1WW8A 4DQUA 1NVMB 3DMTA 3V1TC 1U3UA 3ADPA 5A5FA 2FPPA 3DOCA 2H6EA 2AQHA 4Y6SA 4R51A 2Y1OA 1EUZA 2UV8A 2V6FA 1BMDA 1OZAA 3NDRA 1T24A 4GX5A 3V2HA 1E92A 4MP6A 3I5MA 3GF4A 4RVUA 3FNHA 4G65A 2AQIA 3F1LA 3F6YA 4Q9NA 4BNGA 4NFHA 3PVZA 3HZZA 3NT2A 4J3FA 5AXCA 3O4RA 3GGOA 1ZH8A 5KOIA 4CLEA 3OIGA 4INAA 1H6CA 2FZEA 4WEOA 1E5LA 1E3JA 1HZZA 1PJQA 4OXYA 5JYDA 1R15A 3N58A 3KEOA 3MOIA 1IHYA 4RDIA 2AMFA 4TRJA 3EYWA 3JQ9C 1NBOA 3BMQA 5L7YA 1HDGO 4DIBA 1JAXA 3JQ8A 1WDLA 3ITDA 4D3DA 4BMSA 1Y8QA 3SVTA 3GUCA 3QSGA 1N2SA 3C1OA 3G79A 2YV1A 1O5IA 1SEPA 2V65A 3PXXA 3INRA 4IXTA 1J4AA 3U3XA 2Y1FA 2OORA 3U49A 4N54A 5EQDA 4DUPA 4N5NA 3TF5A 3ZWBA 1VSVA 1PU2A 2BFOA 1Q7GA 2NWQA 4ZJUA 1EVZA 4GKVA 2IZ1A 5U9CA 5A5EA 1I3MA 3GHYA 4FDAA 4BO9A 1YL5A 4FOOA 2HJRA 1W6UA 3SJ7A 2GR9A 4LN1A 3EHEA 1T25A 4PG4A 4GLOA 4F6CA 4RF5A 1EQ2A 2J8ZA 3AOEA 1GL3A 5JCXA 3O26A 2I76A 4I5EA 1GUFA 3KSZO 1WDMA 2QYTA 4CMIA 5DCWA 3K2EA 1G0NA 5A1TA 3BHJA 4ALLA 3JQ7A 1SC6A 4AICA 3M1LA 1TT5B 3P5SA 3QA9A 1R6DA 4CV2A 2J3JA 1JU9A 3VC7A 5EJ2A 4A0SA 1ZK2A 4YAEA 4DL9A 2CDAA 1DPGA 3PZRA 2ZCUA 4XIJA 1I5RA 1BG6A 5B12A 5L40A 1P9LA 1KYQA 3JD0A 4OSOA 4TVOA 3VTZA 4B4WA 1EFLA 1H2HA 4ZQGA 2JAPA 1U2GA 3ZHXA 2OL4A 3L6EA 2DFDA 2HMTA 3OM9A 4O6VA 3BIOA 4NNJA 4DXHA 1DC6A 2GN8A 1BDMA 1J5PA 3GEDA 4IJUA 3HB4X 1NXQA 3KRTA 2P9EA 2W2LD 4MVJM 2BGLA 1ISJA 4FFLA 2X9VA 3ZV4A 1I2ZA 2PGDA 1RJWA 4TSKA 3WJAA 2DKNA 2J3KA 2O3SA 2IEBA 4XD2A 4CMKA 2GYYA 1ARZA 4D7AA 3ABIA 3SBOA 1Y8RA 4P8RA 3BXXA 1EZ4A 2EKLA 4KQXA 3ZDFA 2P5YA 4RVSA 3LSYA 2B36A 2QX7A 5JE8A 3GEMA 1PJ3A 3NDIA 1KOLA 3O03A 5TLSA 1Q0HA 2C7GA 3PHJA 4QX6A 4OQYA 5I8ZA 4BV8A 3OH8A 1B0AA 1HSOA 1UDAA 3WGOA 2B37A 5JS6A 2PH5A 1T2EA 5TJHA 5GZ3A 2DTXA 4YACA 4XDYA 4XA8A 1BVUA 2G76A 4M1QA 4NG5A 2FPIA 3ZWMA 3I6IA 3MEQA 2OP1A 3O8QA 2YDXA 5I7VA 3DL2A 4RVHA 4HWKA 3RSHA 7ADHA 3GDOA 1ENZA 3NEPX 5L51A 4NPCA 3UAGA 1LLUA 2RCYA 3TOZA 3ZW9A 4OH1A 4RPJA 4J1NA 5GZ6A 5U1PA 4S1VA 3WICA 2VOJA 2DAPA 3LDHA 4IBOA 4BNKA 2POQX 5BNIA 3ZU5A 2UVDA 1PR9A 4NMHA 5BT9A 3I52A 2W98A 4L8VA 1MUUA 4J7UA 2E48A 3GY0A 1QV6A 4X54A 4XKJA 4LW8A 2Z95A 3GRPA 4MP8A 1LLQA 3UF0A 4D0SA 2C59A 5IF3A 1LDEA 3DZHA 2YHIA 4WCFA 5G4KB 2WYWA 3BTVA 4I5DA 4CPDA 2OMEA 1RPNA 5EQFA 1E77A 1WZEA 1E7WA 1FDSA 3OF2A 5KNLA 3OETA 1NAHA 2C5AA 4F46A 3LLVA 1NFQA 4CV1A 3KVOA 4GGPA 4R5MA 4RGBA 1PGQA 1I33A 4YAIA 5TNXA 3ZU4A 4CLOA 1ENYA 1PJ4A 4NQZA 2C5EA 2YV3A 2D1YA 1E7MA 4XZ3A 1SZJG 3U62A 1YS4A 1NR1A 3AUAA 1CF2O 2P5UA 3ZGYA 4D42A 3NJ4A 4FJ0A 1CJCA 1ZNQO 2AG5A 1CQIA 4K28A 4QT0A 1WAMA 4I9UA 3JV7A 3SC6A 3LK7A 4UUNA 4BGEA 1OOEA 1JAYA 2JCVA 5ICSA 1LA2A 2ZTMA 4CMIB 4CQMA 2XXJA 1LX6A 4BMVA 2IYOA 2DBZA 1MLDA 3H2SA 1EUCA 1HL3A 1Z73A 3JQ7B 3LT0A 4JXKA 4W7HA 2GZ2A 5ITWA 3F1KA 4LVCA 1M67A 5LCXA 2YJZA 4LMPA 3W4JA 1UP7A 4FOSA 1JQBA 1LUAA 3GZ4A 3KSUA 2GGSA 3DZJA 4ZQFA 5KTKA 5EIOA 1DIGA 3RIHA 3N74A 2AXQA 1SBYA 3GT0A 2O4CA 2Q1UA 3JYOA 3IDSA 1ZK1A 4L4SA 3GNSA 4MVJD 4RF2A 4A26A 1LC0A 5I9NA 3WQRA 4HP8A 5KVQA 2ZYAA 5JNLA 2QW8A 4PZCA 1YH3A 3IOYA 4ZQEA 4ESOA 3PHHA 4UUPA 4CLRA 4CM8A 1E7QA 4XWYA 1Y5RA 3DBRA 3DDNA 5TF4A 3VH4A 5JDCC 2BF7A 4GSLA 4PIVA 5CDSA 1GV0A 1VE9A 3ENNA 2HK9A 2OZPA 1GQYA 1KVUA 3FPCA 2Q1TA 1GUYA 2WD8A 1B26A 4RL6A 4QEDA 4A2CA 4CMCA 5F5NA 3V2GA 1O6ZA 4XGIA 3RJ5A 5CHEA 1VL6A 5T57A 5H81A 1A5ZA 4R1NA 2YQ4A 4UEJA 2NUAA 1QV7A 1Y8RB 1QP8A 3CEAA 4QTZA 3I9OA 3LT4A 4IMRA 3OIFA 5TRTA 4J91A 4QO7A 3TL2A 3OBBA 3WQSB 1Q0LA 2HRBA 1EBUA 1IHXA 5DBIA 1OAAA 2ZQYA 2I3AA 4GKBA 5IAAA 1XG5A 1SMKA 2GF2A 1LRLA 9LDTA 4IM7A 3LC2O 4DLBA 3M1AA 1I2BA 4YAGA 5HTOA 4CMJA 2V6MA 2G5CA 4YPOA 1B8UA 2I9PA 4WNCA 1LDGA 2XAAA 5IG2A 2OHXA 5JAMA 3PFFA 4L75A 4BVAA 2GZ1A 2NVUB 3STHA 1SB8A 1L1FA 1ZVMA 3OMLA 1DLIA 5CEEA 4PN3A 4GWGA 1DRUA 2V7PA 2X4GA 4J2HA 1MG0A 5COQA 4ND1A 4AJIA 1I3NA 3EVTA 1AHIA 1J49A 3JYNA 1M2WA 3HDJA 3MJTA 1VL0A 4KP7A 4ZVVA 4YRDA 3L4SO 4EITA 1HDYA 2RHRA 3WGTA 3ANNA 4J90A 1YXMA 3PPIA 4CMEA 5J23A 2A9FA 4E5YA 5IDWA 1NQAO 3DHNA 1G0OA 1QYCA 1MC4A 2P4HX 2GN4A 4YCAA 3WYBA 1XGKA 4E4YA 4L76A 4YAKA 1J0XO 3ZZNA 4P22A 4CM9A 3AOEC 4MINA 1Y6JA 2AQ8A 4KMSA 1NFRA 1E1NA 2HSDA 1PJSA 2YHIB 4WCFB 2AW5A 3DXFA 1TEHA 2HMVA 4JP3A 3TL3A 5F1PA 4Q3NA 1UXJA 1P0CA 2F1KA 1UXHA 3RD5A 4CMHA 3WGZA 1DIBA 1AUPA 1E3WA 2DUWA 3GAZA 3K8ZA 1PZHA 4GI2A 5JW6A 3MCVA 3ONFA 2NU7A 1MP0A 3PYLA 5EL0A 4E32A 3D4PA 2HMSA 5FF9A 3GG2A 3WOHA 4CLOB 1PL8A 3GZNA 3H8VA 3AWDA 3PP8A 5G2OA 4D44A 1VKNA 4YTEA 4CLHA 4ALKA 4WLFA 3X2FA 4LGVA 3I9NA 1ZXLA 1T2CA 3LZ6A 1KVRA 4OOEA 1CYDA 4NR0A 2JD1A 4UVEA 4K9DA 4Z6KA 3D5QA 4Y9DA 4U5QA 1YB4A 2VRCD 2J5RA 1B14A 4B4VA 2VZ0A 1DAPA 4JIGA 3S2GA 3D4NA 1UDBA 3QVOA 3RUDA 3HHPA 1H93A 1O0SA 2AQKA 2J3IA 1AN9A 3TPCA 4EEZA 3HSKA 2FR8A 1R16A 1F0YA 1ISHA 3UW3A 3FF4A 4NBWA 4WECA 1LC3A 2Q1SA 5L9AA 5BQFA 4EDFA 2CD9A 1U3TA 5ILOA 1PEDA 4MVJG 3GGGA 1QORA 2PH3A 3I9LA 2FR0A 1PTJA 4N5LA 1DDOA 4EYEA 1ISGA 2EHDA 3OA0A 3BMCA 3PWZA 2BRUA 4EJMA 2WJPA 1U1IA 4JK3A 3F46A 3C7CB 4H3VA 3RAJA 1WPQA 4CM7A 2HDHA 1MA0A 3FR8A 3A28A 3E5MA 1EDZA 5JDIC 3AI3A 3QWIA 3EC7A 4FFRA 3MJCA 4DC1A 4L0QA 3UICA 1JDJA 2X22A 4ND4A 4RLHA 4YDRA 3UOGA 1LI4A 3UCEA 3IJPA 3VH3A 4B7CA 4CL3A 3H9QA 4J49A 4BOYA 2HK7A 4CMGA 1P74A 1KVSA 1XU7A 3D5TA 3RKUA 5KVCA 2QYSA 5L4SA 2BLLA 2PKQP 3KYBA 2Q46A 1YJ8A 2OP0A 3U4CA 3L6DA 1HRDA 3Q6IA 5I7SA 1FDVA 1HE2A 4AJ4A 3IL2A 1W4ZA 3ZWVA 4WLUA 2NVWA 1BVRA 3C8MA 1Z45A 4BNNA 3QVWA 3P19A 4FD3A 2CFCA 4LCEA 4TKMA 5DN9A 5DULA 1SO8A 1DIRA 2VHYA 3DZBA 1O94A 3QV1A 1YDEA 1XHLA 2JKVA 4IGFA 4Z9YA 1LJ8A 1WMAA 1IB6A 4NFSA 4NK4A 4U6QA 5A04A 3G17A 1ZW1A 2D5CA 4YJHA 1D4FA 1VJTA 3ZI0A 2DC1A 2DVMA 4K6CA 4RVDA 4ZGWA 4OL9A 3BZUA 4TMFA 4IUYA 3MWDB 1IYZA 1ULSA 3JQFA 4BS9A 4NFYA 4IINA 3S2FA 4DLLA 3JQAD 4ZRNA 5COBA 4BO5A 1B7GO 2Q1WA 4P4NA 5DDIP 3VZSA 3I3OA 2G17A 3AU8A 1Y9EA 3KO8A 4R5HA 1HETA 4R3WA 8LDHA 5G0VA 4RF4A 1YB1A 3AFNA 4U8GA 4MDHA 4UAGA 3L4BA 4F6LA 2FP4A 4PFJA 3WNVA 3ZW8A 2G1UA 3QRWA 3H3FA 3AOGA 5IDXA 1BGVA 1E3WB 2GSDA 2Q2QA 3KLMX 3KOUA 4KUGA 4NBRA 3EVNA 3EY4A 4RLSA 4TRRA 5H83A 3TOXA 3N7UA 4D43A 4XRRA 3FNGA 4HFJA 1DRWA 1FDTA 3PQEA 3IP1A 2YW9A 5JCJA 3TFQA 1ONNA 2IDZA 1IUKA 5KVVA 2WD7A 3GZNB 1Z6ZA 3GC6A 1I3KA 1M75A 1MG5A 2Y66A 4IDEA 3RWBA 5JAIA 3M6IA 2Y68A 2R2GA 5T6BA 2XPCA 3L6OO 1QKIA 1ZEMA 2EW8A 1KEUA 3ASUA 1I8TA 3CIFA 1XA0A 4U6SA 1HWYA 1OC4A 4FB5A 3WMXA 1X13A 1LU9A 3AFMA 5IFLA 1AGNA 5IZCC 3MZ0A 1A7AA 2EKQA 2VQ3A 2NV6A 4R1SA 3ORFA 4BNXA 1R37A 4FC7A 3PWSA 2JD0A 1C1XA 4ZRMA 2D4AA 1UZLA 3AW9A 1B8PA 2Y0DA 3C1AA 3ETEA 6LDHA 3Q3CA 3RU9A 3I4CA 1ADFA 2ET6A 2LDXA 4PLCA 2VYVA 4EZBA 2EV9A 2C20A 3FWNA 2B4TO 3CXRA 4II2A 1I01A 3QWHA 3VVBA 2E6UX 3BMCB 1I36A 4CM6A 3O9ZA 5K9ZA 1NQTA 4WEQA 3ULKA 1YBVA 2GLXA 3HDYA 3GEGA 1C1DB 4CLDA 1N9GA 4BIIA 3OICA 2O48X 3E6AA 1HDOA 2HK8A 3NDJA 4JLWA 2B0JA 1CETA 4PZDA 3GNQA 1BDBA 3ZU3A 3DFUA 1RWBA 4E5MA 1HE5A 4GBJA 3PFWO 2YYYA 3L9WA 1A4UA 1IPEA 1QMGA 2CVQA 3FD8A 3VPSA 5JXWA 3PIDA 5MGBA 4XDZA 3H5RA 4K26A 4EBFA 1HT0A 1PJTA 4P38A 1GV1A 1ID1A 5T5QA 3IAHA 2ZTVA 3QWAA 4PVCA 1SCUA 2PZMA 1IE3A 2WSBA 3C3XA 3WG9A 2NACA 4II3A 4BO2A 4K6FA 1H6DA 2JJYA 4IZHA 5T8KA 2PGJA 3D64A 5JLAA 3CMCO 3W1VA 4GX1A 3KUXA 3H2ZA 3CKYA 3TJRA 4J0FA 4QXMA 3MJEA 1LLCA 5EINA 2W90A 2O3RA 4NBVA 2E82A 3DEYX 3E82A 4ID9A 3TDKA 1IZ9A 4OO3A 5G4KA 2O3QA 3ZHZA 2PZLA 3BHIA 1GD1O 3OJEA 1TXGA 4CR7A 1UXGA 1V3TA 4FR5A 1LDNA 1PJCA 3OA2A 3WDSA 2PKQO 4E33A 4D3FA 1R0LA 4HX5A 1GYQA 1YVEI 4XGKA 3ZNOA 5C7OO 5F5LA 4YJHB 3ROKA 3VZRA 4DBVO 1WLYA 5CG2A 2HAEA 4KTVE 2CZCA 4I1IA 4HY3A 1SNYA 2NU6A 4WCDA 1HDCA 3WSVA 4DREA 1NM5A 3JYQA 3JQEA 4FFNA 3JYLA 1PS8A 3W6ZA 5JC1A 2BFAA 4LMRA 5DT9A 2QG4A 2O23A 3E18A 4AVYA 1WDKA 1X7GA 3PYMA 2OXIA 5TT0A 5F1KA 1QSGA 4TKLA 3GLQA 2VTDA 2QRKA 3D1LA 5GY7A 3HNPA 3AUSA 1VSUA 5EERA 1D1SA 1L7DA 1NQOA 2DBQA 2YZ7A 3DQPA 3GK3A 3F9IA 5AXDA 5HS6A 4JBIA 4KQWA 1I30A 1GAEO 2B4RO 5L53A 1F8GA 2PA3A 3F4BA 3GVXA 3D7LA 4XCVA 1ADBA 5K6AA 4BNUA 2WD7B 1ULUA 1KIFA 3QJ5A 2E37A 1P45A 4RORA 4NIMA 1Z74A 3RUHA 1TB4A 4DPKA 3COSA 3MWEB 4RQTA 3WXBA 2VWQA 3W8DA 4BL5A 2O2YA 4R41A 1L7EA 2IE0A 3T7EA 2O50A 3E9QA 3AI1A 4D46A 5CDUA 3ICCA 4A27A 1M76A 1ZXBA 2ZB7A 4KTTE 1R0SA 4LISA 1ZIDA 2FSVA 1IOLA 2WYUA 3FR7A 4FW8A 5A06A 1MX3A 2D3TA 1YWGO 4FFPA 1C1XB 4F45A 4PLHA 3ZNNA 4BO7A 2EERA 1E5QA 1HEUA 5LC1A 1NVGA 2D5AA 5IDYA 1X14A 4KDFA 1R4NB 3AK4A 1U7TA 5JO9A 3UUWA 1E3SA 3G0OA 3JQBA 4BUCA 4G81A 2HKIA 1I3LA 3LU1A 4J0EA 3KSDO 3WX0A 4JGBA 4BB5A 1A9ZA 3U4IA 4GSKA 3WR5A 4DVJA 3INTA 2WMDA 3E48A 3ZWYA 3GR6A 3H7AA 2PGLA 4WE3A 2Y67A 2CVZA 4J43A 3WFJA 1TVEA 1DOHA 1BTOA 3GN1A 3F5QA 1EFKA 2PD6A 4IZIA 3A14A 4YBZA 3RBVA 4R1UA 3TQHA 4I5GA 3F3SA 1BWSA 2EG9A 4CM5A 5CFZA 1TLTA 5L4LA 4ALJA 4BV9A 1N9GB 3RQSA 1P1RA 1KY5A 3FWZA 4XR4A 3H9JA 1GTMA 1O95A 4RDHA 5EN4A 4EGFA 3LVFO 2NVUA 4QUKA 4UEKA 1MGOA 3TZHA 3KETA 3OJFA 3EGOA 3G49A 2CDCA 1DJQA 3DAFA 3RI3A 4YVFA 2TMGA 4PG5A 1X15A 3U5TA 4YQYA 2W8ZA 2A4KA 4OHUA 4R68A 4YEDA 3GVCA 1JLLA 3PJGA 5A05A 3FBTA 1YB5A 3LT1A 3E1KA 6ADHA 2UUPA 2DUUA 5C3MA 1PR3A 4BNWA 1PS9A 2IODA 2XOXA 3DONA 1Q1NA 1NQ5A 1XR3A 2Y93A 4XYLA 2Q4EA 1QLJA 4E6PA 1MFZA 5JSFA 2WE7A 2JL1A 1QYXA 4H7PA 5LDGA 3KZVA 4OSPA 4M49A 1YBMA 3K96A 2R00C 3CINA 1SOWA 2GD1O 3K31A 3JSAA 4MVJH 1RYDA 2J3HA 4R4JA 1YL7A 2HUNA 5JO0A 4O1MA 9LDBA 1HYHA 3RBZA 4BO8A 2H1SA 1LSJA 2HU2A 3RC2A 4BKPA 1JKJA 1E3LA 2GDZA 4YT4A 4XQGA 4J7XA 4J4TA 3HQ4O 3GUYA 3EK2A 1GQ2A 3IMFA 2Q4BA 4UVHA 2NQ8A 1E6WA 4AG3A 3PI7A 1W0CA 4NU6A 2VWGA 2VTEA 4ITUA 3EZYA 1SEVA 3H3JA 3WTCA 4I5FA 1HZJA 3E5RA 3E8XA 4Q3DA 5TQVA 4RQUA 1DFGA 1U5CA 1AXEA 3GVPA 2EWMA 2NTVA 3UGKA 1SAYA 3ETGA 2GN9A 3L77A 1ISMA 1AHHA 3WGQA 2CUKA 5I7FA 2QHXA 1H0KA 1A71A 4GGOA 2O2SA 5A03A 5LDHA 2FPGA 1DC4A 3JD4A 4OYRA 4OJNA 4W9NC 1OMOA 2NNLD 3OEWA 4KOAA 4MIEA 2NU9A 4PLFA 4YWJA 3EW7A 1OFGA 4E13A 4B3IA 3DHEA 2ZIZA 4WLNA 4MPDA 2NTJA 4JJGA 5AXBA 3V8BA 2GNAA 3PIIA 5H82A 4CM4A 1PGNA 1Q0QA 2HO5A 3BYZA 1KY4A 3LF2A 1BW9B 5ADHA 5ENDA 3Q2KA 1YGYA 2OGUA 1H94A 5KJCA 1ENOA 5BNFA 3DMTC 3R6DA 4CR6A 4F3YA 4LSWA 4R16A 4DQVA 3KHUA 1KEPA 4EUHA 4TZKA 2Z1NA 4WPGA 5I9LA 1ORRA 1NWHA 2WWRA 3ON5A 3DMYA 4MVJP 4UEOA 3NKLA 4E21A 1YE3A 3RJ9A 1VM6A 3NJ8A 3RKRA 1GR0A 4FGSA 3DHYA 2Y1DA 3JD3A 4WK6A 1K6IA 1QYVA 2IYPA 1EE9A 4QSMA 4LRSB 4B8ZA 5KJFA 1GYRA 1Z7BA 3RC1A 4XJSA 4N18A 2H9IA 4DTIA 4IDCA 1A27A 1E7RA 2BFPA 2A92A 1DJNA 2EF1A 1A72A 3BA1A 1DB3A 1SB9A 1H6BA 3ENKA 3DOJA 2X23A 3KV3O 4J2OA 1ZKMA 4CL8A 3OJ0A 2X0JA 1XIVA 1LDYA 2VUUA 4XX0A 3WGGA 1BHSA 5CDTA 2D2IA 3S1LA 2G82A 3ZHBA 3FNFA 3K9QO 5IXSA 2RHCA 1YONA 2O4UX 4BO1A 4MVJE 3BMOA 4S3MA 4AJ2A 2WTBA 4WOJA 3ZWPA 3KLPX 3IUPA 2AEMA 5FYDA 3FBGA 2PR2A 2VZ9A 2HQ1A 4YJFA 4FPXA 1C14A 2BGMA 3WS7A 2YY7A 3JD2A 1H2BA 4Q3AA 5KVSA 2YUTA 3PHGA 3SX2A 5A9SA 2W2LA 3ZWCA 4CM3A 1JA9A 1ZSNA 1EVIA 1GPJA 3EDMA 3PGJA 5CPFA 2X58A 2VCYA 1Y81A 3JQGA 5IN5A 4RJTA 1YO6A 1CEQA 1PZFA 3AM4A 4ZA2A 3UFXA 2DPHA 3FCOA 1PJLA 1WMBA 2JCYA 3M2TA 3S55A 3ST7A 1PGPA 3K73O 2PKRA 1E6EA 1ENPA 1U3WA 1DSSG 3T7CA 1NP3A 5HBRA 2VUSA 4C7JA 3TFOA 3LF1A 1NNUA 3ETDA 3H65A 2GERA 5GMOA 4OOFA 3LLSA 1P3DA 3DTYA 4XR9A 4BNTA 4Z3KA 1E7YA 4DPMA 2H5LA 2BKAA 4L73A 3VH2A 3DZGA 4KWIA 4BQPA 3H9UA 3Q11A 5TJ9A 5BSGA 1VKOA 1T26A 2DTEA 2X7HA 3KB6A 1Q2XA 3A06A 1XCBA 3DAPA 3HN7A 1ISFA 5B37A 4ONEA 1W8DA 3V2UA 4BNMA 4R9RA 2FY8A 5F3RA 2F00A 2P91A 3QQPA 3X2EA 1HLDA 1TI7A 4QO8A 3ADOA 2P9CA 4GWKA 1C0PA 5THKA 1QR6A 4Y67A 3NT5A 3SLGA 1M6WA 3JQ9A 4IQGA 4J9UE 4CQLA 5L4NA 1DFHA 3PDJA 1GCUA 3DFZA 3B20A 2Q49A 2I5PO 4Y8VA 3GPDG 2FZWA 1R4MA 2VHZA 3DZFA 1DXYA 3OQBA 1EE2A 3W4IA 2UAGA 5COAA 1KEVA 3U4DA 1KERA 3RASA 1YL6A 2IZZA 2CF6A 2Q50A 4HXYA 2BGKA 3UN1A 5JC8A 4XQEA 4BHTA 1DAOA 2VNAA 2EJVA 3IUSA 5F21A 4TROA 1H9AA 4HBGA 1KEWA 2QZ9A 4FQ8A 1GZ6A 1GADO 1V35A 1Y1PA 2Y99A 1U4OA 4D0RA 1GCOA 4YT2A 1Q7CA 4YT8A 3F5SA 4RV9A 5ITVA 4CM4B 2JHFA 2W2KA 1S6YA 1JKIA 1O9BA 3PYXA 1F14A 1JKFA 3NTOA 1H6AA 3HWRA 4LK3A 1FMCA 3VPFA 3NTQA 3OJOA 2HMWA 4ZN6A 2O3UA 4YAJA 3OEYA 4R54A 4UVDA 3TZQA 5ICMA 2Y0EA 2O7QA 1C1DA 1YJQA 1KC3A 1CDOA 1E6UA 1P44A 2GPTA 4RPKA 4BGVA 4ZICA 2J5QA 4A73A 2DU8A 1P1KA 2RH8A 4NJMA 1Z7EA 3PLRA 1U5AA 3RROA 1VLLA 5U4QA 3ONEA 5CEJA 4Q3CA 2PTGA 2PY6A 3QW2A 4BKOA 1UZNA 5C7LO 4GH5A 4GX0A 1DHRA 2O3JA 2LDBA 4EI2A 3GMSA 1X0VA 4OXNA 1UR5A 4E3ZA 2X5OA 5I7EA 3IIEA 2BELA 1YBAA 4LSMA 4XIYA 4B8WA 4WCFC 3IKTA 4BNYA 1GEGA 1E0DA 1GU7A 1JVSA 4U7WA 3DR3A 4M89A 3GQVA 2NQTA 3BMOB 3DBVO 1LQUA 2Y1CA 5ER6A 1CQJA 1WZIA 1ZBQA 1N7GA 4MVJA 2AEJA 4AL4A 3AM3A 1PQPA 4IGEA 1P0FA 3W8FA 4D41A 5FWNA 3ROPA 4C4OA 4YJFB 1QRRA 2C82A 4XQCA 5FEUA 3U9LA 3FNEA 3JQ6A 5A9SB 1B15A 2P68A 1DIAA 3QVSA 1E1MA 1NX6A 5CEFA 1U9JA 4CLXA 2PFGA 3JQGB 4RVFA 4DYVA 2PZJA 4YJDA 1NHGA 5MDHA 4MO2A 4GAEA 1U4SA 2QIOA 3EZLA 4GVXA 4BKQA 5C5IA 4XYMA 5KIAA 2NADA 4HFMA 1HTBA 2I66A 4WLVA 5TSDA 4DGSA 5KCZA 4J1QA 2Z1MA 2OBNA 1OI7A 3B1JA 3QE3A 3PZBA 1IZ0A 4PG8A 1BSVA 5DP1A 1N7HA 1LNQA 1NPYA 4OIMA 2QRJA 4DMLA 1HE3A 2YFHA 3ONDA 5JMPA 3NRCA 5TGDA 3HFGA 3RUCA 3A9WA 3GHHA 4Y6RA 1ZK3A 4YJGA 5AOVA 4AJPA 2FSSA 1R66A 2X9NA 2ZJ0A 3ASVA 4U0KA 2VT2A 4IDAA 3FTPA 4KDEA 3S2IA 1UDCA 4WLEA 3CPSA 5TT1A 5G0SA 1LSUA 1XSEA 2GZ3A 1CWUA 5I8WA 4RPLA 1LTHR 3I4FA 4R01A 2O3TA 3ZHYA 2FHSA 3TZKA 1N92A 3ICPA 1ZO8A 2OFPA 1DFIA 2EJWA 1V8BA 4UREA 4KZPA 3HB5X 2AEFA 4HADA 4A03A 1DO8A 4CQLB 1M6HA 4RVGA 3I83A 5CAEA 5G0UA
chains in the Genus database with same CATH superfamily
1USGA 2BR4A 5I48A 1C9JA 1J6UA 2Q3LA 1F6WA 2DBYA 4OMFG 3RQIA 4AC9A 5IJZA 1LDBA 1PL7A 3A1NA 1KDTA 4U7GA 2C78A 3D4OA 4U7HA 1R4MB 4PG7A 4F92B 4BFSA 3LYLA 2BD0A 3U48A 1KE1A 3KU4A 1JHRA 1I4OA 1PG0A 1W0JD 1G1AA 1UZMA 2ZIXB 3DAYA 3GBSA 3JPWA 4G89A 4B6PA 4CIBA 4WFKA 3K0KA 4MOWA 1PT8A 2IPMA 2WEKA 3RRMA 2PO7A 2FTKE 1U90A 3EBLA 2GTIA 1R4NA 2ZDHA 2ZJFA 1MCZA 2XNDA 3EAQA 3VR5H 5AW8A 3GARA 2V4MA 1U8EA 5G3ZA 4U00A 1P33A 4AG5A 2WM2A 4YRJA 4HJRA 2W2KB 1I4EB 2ADMA 3E4CA 4U9UA 1CERA 1ODIA 5FXMA 5A9TA 1W29A 2EGHA 2Z58A 3FFXA 4EFNA 2X5JO 3O8BA 4JQOA 2JGIA 2IBMA 4HDAA 1H4VB 3E53A 1GZ4A 1RCFA 3HG7A 4MIOA 4R1LA 4DG8A 2MINA 3VYUB 4H7JA 4XYGA 1ZC4A 5HIMA 2V7XA 2A9PA 2QRGA 3KYDA 1BDHA 3ZS8A 1Q12A 3ETCA 3IBFA 2AE2A 3PUXA 4A3SA 1DAHA 2C4VA 3BM5A 2WJYA 3PUZA 1CUWA 5CX1B 3CRRA 4HTFB 5U4XA 4B1FA 5BR7A 5A7GA 3OQHA 2L42A 3HYLA 4KUHA 1MVOA 2ZYGA 4PYJA 4UTPA 2X76A 4JP2A 4BTLA 1TM4E 4ARIA 1Z08A 3VQTA 1E9DA 3E2MA 3FTQA 5HHTA 4R8SA 4NH4A 1XZCA 4RIHA 5AI9A 4QQNA 3KYCA 5ALMA 2GK6A 3K32A 7MHTA 1YJBA 5A3JA 1D7OA 1H23A 4R2IA 1JTVA 4YCSA 1DOAA 2ZTUA 3TGPA 2Q8QA 3RRZA 1D8AA 1YQEA 4IHJA 1NXPA 2AGVA 3AEUB 3IPXA 4L8YA 1KHTA 3N0RA 2J3QA 1HH4A 2VDJA 4UTZA 1B8VA 2JAXA 2PWPA 3SEFA 3WKCA 1X39A 3WLAA 5BVHB 5K51A 4WZZA 4TWIA 5IKOA 3MYYA 1IPFA 3FI0A 1X80A 4L51A 5JDCA 3OECA 4L5AA 2BI8A 1O3YA 3N53A 3QI7A 1MOZA 3K4QA 4ZV4A 1TQ8A 3O8LA 4IIHA 4WACA 4JWKA 1ORDA 1JVNA 1MEEA 4P6VF 3I2YX 5B6IA 3DCYA 3PJRA 3COZA 2ARKA 4DA0A 3SZGA 2COUA 4PX5A 1JMVA 2HF2A 2OBYA 5DK6A 3AJEA 3FSRA 2YRWA 4ZC1A 5AVXA 5JHHB 1BEUB 1QH0A 3TE6A 4BX2A 1U8FO 3JRXA 1G19A 4X71A 2FF5A 4ZJYA 3B38A 2I6XA 4LYDA 1SD1A 4QAJA 1RWMA 3ACDA 3PPVA 1WNTA 1EXDA 1UFQA 3T5DA 1RQGA 4BZWA 2GO1A 3S7ZA 4UCWA 2E5WA 2Q5QA 3ZC3A 1UBMS 3L7NA 4UVIA 5K45A 2D54A 4CV0A 1IZZA 2FPUA 1JHUA 1NT2A 5YASA 5CCBA 3PJEA 1F6BA 2X0RA 2Y76A 2F59A 3GAFA 1NUQA 4PLZA 2Q7DA 3RU3A 2W6IA 1NQUA 3IQIX 3V34A 5DM60 2QAGA 1O5OA 2YWDA 2QRPA 5C7IO 3L8YA 2J4FA 3ETLA 3O31A 3Q1LA 3JRWA 4F71A 3LDGA 3C6ZA 3JR3A 4UAUA 1ZBDA 2YYAA 3A4VA 1PZEA 3DLPX 4XSVA 3RYCA 4IDOA 4QBIA 3WRYA 1VRWA 3TRIA 1ZGGA 3EEFA 5GOZA 5HQ3A 1QC5B 3S8MA 3DO5A 1L4GA 4DABA 2ZTLA 2VSYA 2XZTA 3ZV5A 2CVHA 5AW3A 2QPTA 1UCFA 2QQ5A 3RS4A 2DG2A 4BVGA 3SR4A 2H5EA 2P9BA 1QU3A 1N33B 1D07A 4YJGB 4WLOA 3KCNA 3RTBA 5AQ1A 3MGCA 1I5OA 2XMGA 2J7KA 3MT7A 1JFRA 1EGQA 4EMUA 2JATA 5HVNA 4CW7A 2A35A 2CVOA 3DWEX 4W1PA 1M8KA 5BWOA 5LQRA 4LJAA 4FYKA 4RCVA 5EIAA 1KS2A 2NUTA 1DCFA 1BS2A 1P4JA 1ZIYA 1YB6A 2O20A 4IJMA 4L4UA 4Z0TA 1PTJC 1PHPA 5ESXA 1SULA 3O8DA 1JJBA 5EP4A 3B5EA 4KWHA 4MVWA 3RSFA 2VDWB 4MR7A 3VDNB 1M0TA 3W1WA 3W2IA 1XP8A 4U63A 1ZD9A 5A4DA 2GPNA 2CV2A 1GQQA 4C04A 3KTDA 1WR8A 2OT3B 3L7KA 3H7IA 5CFRA 2W2VA 4GI5A 1A98A 1YFZA 3OZRA 1RIFA 1YDHA 1CUFA 1U3GA 3AR9A 5HK8A 2PU7A 5IMBA 2YC4C 4IZ6A 4A10A 4Z4HA 2IX3A 4M60A 3CVVA 4JC8A 1DAKA 4CCAA 1XPRA 3GV0A 1WVIA 4YECA 4RHXA 3VR4D 5FQNA 4M54A 2VP3A 4FR2A 2CB9A 4OM8A 1S2GA 5EPOA 1EHCA 3T3OA 1C3LA 1A7KA 1AQLA 2EQBA 2ISQA 3NB0A 3BS4A 4HWSA 4TVBA 5AXAA 2EX4A 2GXQA 3KQVA 4IY1A 2ECFA 3ZQ4A 1OYWA 2DT5A 2WU0A 4DNPA 5JAZA 1RHMA 3P0RA 1SJ9A 3O8RA 4Y2UA 4PPYA 3KBOA 5BUCA 1NHWA 1PL0A 1VKRA 1L6RA 5H4HA 4ROSA 3D3EA 2Q3EA 4F1WA 1FFAA 3UGJA 2OCDA 4LS3A 5ANRB 1GWNA 2PAAA 2C2XA 3K5PA 4MKXA 2R4QA 2OGTA 3AM5A 4O2AA 3VKWA 1XWFA 1EXNA 2QMHA 4C0SA 2GRAA 2WSSD 2FQ1A 4KMMA 2IKQA 4FILA 3KU1A 4LJ9A 4C05A 3OO1A 1N5DA 3ITKA 3TZ6A 5B4VA 5KWVA 4M1OA 1JIKA 4P4GA 1P91A 3MWYW 1YBFA 1HFKA 1R6BX 2YV2A 4EJ0A 2DY0A 3I01A 1O4WA 3GG9A 5BN5B 1K8YB 3CLSC 5HA5A 4ZI7A 1VJ1A 5DX8A 4XAQA 4L72A 4B9AA 4MWZA 4MIKA 4YT5A 2PX8A 4DAEA 1YKFA 3CNBA 4A6DA 3QXCA 3GP8A 3NT4A 3ACCA 3W9YA 2WYVA 2IL1A 1KGSA 1VG8A 1AB6A 1M6VB 2PJUA 3JQFC 3HN2A 3S1AA 2DCMA 5C8DA 1PLLA 1II8A 3TZBA 2F4VB 4IDGA 3VOSA 4B6QA 3M4XA 3QFSA 4NEHB 3RW9A 1J2EA 4MHTA 1DBIA 1WW2A 3M6FA 3P0EA 3MWFA 5KWSA 4NCIA 4WZBB 4RA6A 4C7BA 4Z7OB 3G1UA 3MTBA 3N2NA 4S12A 1NDQA 3HZRA 4QYIA 3OFKA 1J97A 1CIVA 3OZFA 5B1EA 4DPLA 2CXTA 2JNWA 1SCBA 3EODA 3IAAA 1IK4A 3H6KA 4HAUA 4JXJA 3ADKA 3BWVA 3K05A 4O2AF 1J2JA 3KV1A 2DFPA 5K3SA 2AHRA 5CA0F 4BO0A 4EHAA 3II6X 4H7HA 5NULA 1MPXA 1HFJA 2CSUA 1GARA 1PTKA 2N3ZA 2OCAA 4KVAA 3MQFA 2I1WA 2VXBA 4N3CA 3RJTA 2BFFA 5JXIA 1LF5A 1RJ9A 2UZ1B 3FPLA 5ES4B 4CEIB 2QGNA 2F90A 1MV8A 2CL6X 2PWZA 1XTUA 4LXHA 3ZWOA 4ZI7F 4DDKA 2KLHA 1QP0A 2H00A 2XDQA 4UTVA 3V7FA 2OOSA 3INNA 3VU9A 5C8XA 4AJLA 2QRVB 1UOPA 4JUAA 4WK4B 4CDMA 4UXIA 5B53A 4YUXA 4TT8A 3C6BA 3D3NA 3EXFA 3OPVA 4GGMX 4LOJA 3IBGA 3EUWA 2OBLA 5E6RB 2IHZA 3WIEA 2QRLA 2XOKA 2GHQA 1YQQA 2HNAA 1M66A 3GRVA 3I1JA 3JSXA 4MP3A 1ZINA 2O7RA 2B0CA 3PRJA 2VAVA 5A4FS 4R2JA 2YJ3A 2VCEA 1C7RA 3A3NA 1I14A 3H83A 4PICA 1K9VF 3GJ8A 4LA4A 4EMSA 1IWOA 4F5EA 2PUGA 4HEJA 3VBEA 3RC7A 4C2BA 1A4IA 1R5BA 1SPBS 1D9ZA 2PVCA 4J6FA 1U6JA 4QKQA 2PNFA 3BRWD 1EVJA 2PSDA 4FE3A 4O0LA 4QTXA 3WQQA 1Z6QA 5SYNA 2VQFB 1N6PA 5K0LA 5DW3A 3M82A 3HK2A 3CZMA 5ALEA 1S2LA 3BBLA 1SN7A 2GBIA 4REQA 1NP6A 3GFTA 2O9JA 1ZOPA 2FJUA 5D01A 1PBTA 3AIKA 3WGYA 5A6VA 1RLTA 3HXPA 1TCVA 3BXEA 1RXUA 3DXXA 3OZBA 2OESA 4CUZA 4CQNA 3D6HA 4NENB 1ODJA 3CRVA 3B6EA 1DUSA 3I9JA 4DRZA 3NAZA 3EYAA 1GVNB 2OR3A 3CT4A 3ECAA 4UM7A 1U6KA 4TYQA 5CVVA 5JANA 3H86A 2IWRA 2W48A 3TBKA 4QREA 4R69A 4OTZA 2GM5A 3I6QA 1RS0A 2HHLA 5E8RA 2HBRA 2HQRA 4Q12A 4N3BA 3RUEA 1KQ3A 4AQDA 1THMA 1XZNA 2NU8A 3VSDA 4EKDA 2PXHA 4FCWA 3FMIA 4W6ZA 5JFGA 5KWJA 5BN1A 1C8BA 3UV3A 4TX1A 4EL5A 2IIQA 3SSNA 1ZH4A 3C4VA 4C76A 5HMMA 1W4RA 2D0DA 3K6RA 3L06A 4IL5A 1UP4A 3RT1A 3TOCA 1J7JA 2YRFA 5JYCA 3GQBA 4OYLA 1E1RD 3VAZA 2O8EA 1XJQA 1T1SA 2H29A 2C5SA 3C4JA 1XEAA 1XQ6A 2ID9A 1CUUA 2LKDA 2WJ4A 3M5WA 1OBFO 5DB4A 3ZJUA 2QOEA 1GM5A 1FCJA 3NBKA 2QP9X 3JQAB 2DWUA 5JNSA 1LKZA 2PD3A 4FFOA 1M2KA 1I1QB 3HO1A 4KE7A 5DJ5A 3SFZA 4LHZA 2QLFA 3H1PA 4B44A 4BNHA 2G8NA 3A4NA 2H0AA 2PMDA 1MORA 2V8BA 5KWEA 2WHRA 3FIJA 3NV9A 4LZZA 1A1VA 3DFIA 1EK5A 5HS4A 1GEEA 2JGDB 3AU9A 3U4HA 1C7FA 1DXHA 3SC3A 1JA0A 3EISA 3LQ2A 1QYWA 3CLSD 4KRYA 3AMVA 4IMPA 5IW8A 3T3HA 5KTPA 3ZVKA 5T8KC 3HTXA 1CY0A 2FHPA 5EZ6B 2Q0SA 3PNVA 4EUKA 1G38A 5KC9A 4BNDB 4MKRA 3REQA 5FFMA 3IKJA 4JJIA 4JB2A 1BOOA 2FN3A 4D8YA 3T6KA 2GRJA 4Z7JA 2JASA 3BF7A 3DMGA 2PRSA 1XMVA 3MUEA 4WKGA 3WMWA 4YYZA 5JI3E 4LQCA 1LZLA 2Q6TA 4RSHA 2OE2A 2Q5HA 2XYQA 3HLKA 4MARA 4O5AA 3TTYA 3ZCVA 5KQMA 1DEXA 4OP2A 3C3BA 4NG4A 4OU4A 4IOMA 3B60A 1YOVA 4IIUA 1ADCA 2I4RA 2I67A 4WOCA 3GAMA 1OWLA 1W5FA 3EY9A 4BU0A 4K87A 4COKA 1TVMA 3KQHA 3SHQA 2IF0A 1DAEA 2V6JA 2PSSA 3ZV3A 3IT3A 2GK7A 3CX3A 3BMNA 2GJ8A 2Z6AA 4A4DA 2AN3A 3CLHA 2ZB8A 1D6JA 2PLAA 3M5PA 3QEMB 1FP7A 3OHSX 3OLVA 3UUEA 1UQRA 2C7VA 1AGRA 3BULA 3ETJA 4P0TA 4RABA 4X8MA 3DE5X 3WLJA 3KKZA 4P4SB 4P54A 4HEHA 4GZ3A 5T64A 4BQEA 5JCJD 3LPMA 3LTNC 2DFVA 3EVFA 4B6FA 4MR9A 5KPDA 1VC2A 2VYFA 3ELBA 3EULA 3NBQA 1RC8A 3PEFA 1TO2E 1IOVA 1EFVA 1DRVA 5FHRA 5J40A 3GVIA 3DE2X 4Q3BA 4QYMA 4UULA 1DV2A 2V9ZA 3V1LA 2VF8A 2LCFA 4OJKA 3U5ZB 1DBWA 1MB9A 2VNKA 3G6WA 4UBKA 1JHDA 3T8YA 1V3VA 1BXRA 1W9MA 2ZPUA 1RQNA 2XMCA 4OXIA 4PZLA 4BCDA 3PS9A 4L4ZA 2VNSA 5DTMA 4C4AA 2FE4A 2VUTA 4I1SA 3ZGXA 5JAUA 4XGRA 2KI5A 1UAGA 2JFOA 1RKXA 2QU8A 2RB5A 3FYHA 4B2LA 4QVGA 2ZXEA 1P2FA 3IUMA 1HLPA 1PDWA 4OBXA 3CMMA 3OM0A 3R0JA 2NO9A 3DNFA 3ENZA 1F8FA 3BWBA 5BRJA 2J0UA 2RGYA 3DXYA 1E2JA 4I1UA 4YGXB 2V3CC 3KTFA 1GXSB 1M6NA 2O6HA 4KN6A 4XGNA 4BGIA 5HPYB 1E8MA 2K7ZA 1DADA 3DE1X 4RZHA 1YS2X 4R3NA 4FYWA 1PLJA 4U39A 1JMKC 3A3YA 1I6MA 3A6JA 2VF4X 4YV1A 4DG5A 4PXYA 3LC7O 3C2QA 1U81A 4UU1A 4M6WB 2RBEA 2C4WA 4GMKA 4N3AA 2WWIA 1LRKA 1OLXB 1G60A 2OC9A 3B1KA 1G18A 4MLPA 1HPLA 3FF1A 3NU1A 1PUIA 2QD3A 4HF7A 5TIIA 4P4TA 3RC8A 3FWHA 2VYVD 2Y0CA 4PYMA 3K8YA 2F1IA 4MKGA 2JHGA 4FYHA 4DV3B 1T0HB 1CUDA 1UJCA 1WTCA 1W0KA 3JARA 4GMFA 1GPDG 3BL5A 4LAFA 5T6MA 3ZCQA 1WL8A 2AFHE 2ID4A 3GDFA 2JFHA 4DB4A 2H1WA 2KQUA 3HJNA 4NP6A 5LP6A 1L9KA 2MHCA 1E0JA 2LV8A 2Z5FA 3EZ9A 4PAMA 2WOOA 3KALA 4AZ0B 1CRWG 1ESZA 3KD2A 5K3DA 3SK0A 4DLWA 1P77A 4HDCA 1KJWA 3GXOA 5FNZA 1XXHA 3JQBC 3VC2A 3NBZC 4H6XA 3A9SA 4ES6A 3I0MA 3CY6A 3G2OA 4KVZA 1N78A 1K68A 1WHSA 1QUFA 4PQRA 5BR4A 5TQ0A 2WYIA 3AH8A 3O38A 3KC2A 2RC5A 1E3EA 4N6GA 3C7DB 4ETNA 2HBYA 2CMFA 3HCCA 2JCXA 4IEFB 4IS3A 1B16A 1VSTA 4P4LA 4AM8A 2G6BA 2XQKA 2XVMA 1RJEA 1PGJA 2XT6A 1QHHA 2H9AA 4N5MA 3G0HA 3AJRA 4LFCB 2H85A 4DF3A 3B6ZA 1K3TA 3T1HB 1ZH6A 3KXDA 5I7UA 2WYOA 3GFGA 1TEXA 4EHHA 1UK9A 4LRTB 3CPEA 3PJDA 2E6KA 4QOHA 5G4LA 4DA9A 2LWIA 3T38A 4R1PA 5KUTA 1E5VA 1EQUA 2O54A 1Y7IA 5KJ1A 4WASA 2QL7A 4II7A 2FPSA 4AFNA 4CRWB 4EA9A 2B83A 3JALB 4ZYWA 1DT5A 3NEYA 1TEVA 4DGQA 5DYNA 5IJWA 1AHNA 3KSMA 1QHFA 4CR8A 1EINA 2X0KA 2RONA 5BP7A 5ABPA 1HDXA 3VZCA 1SCAA 3OTQA 1X7YA 2ROQA 4NTZA 4P31A 1CJTC 3X1ZA 5JYEA 1K4KA 4RYLA 1O0BA 4BNFA 1GTG1 5CXUA 2W22A 1N57A 2DECA 3IA7A 4ZOAA 4EA8A 1R8SA 1CUGA 1GITA 4O4HB 1Y42X 3HH8A 5EWJB 5FHQA 4BBZA 1IBSA 4UBIA 3MCZA 3TZEA 1APBA 2R85A 4DV4B 1FBTA 4JI5B 5AH0A 2ZJZA 4D92A 5EYPA 5JMTA 3L07A 1UIMA 4ZC8A 3Q98A 1K97A 221PA 3EWIA 2NTEA 5WRFA 3LG2A 5H02A 3GLVA 4DLSA 1H8HD 2H06A 1E1QD 1H9CA 2FPLA 1Z3CA 1AQYA 1TK2A 4Z3DA 1W30A 4EY3A 4ZPXA 3KKNA 3TCNA 4KQEA 5F4BA 4QTUB 1JIQA 2NLOA 3PGXA 3GWGA 3DBHA 3PITA 4UMDA 1F9AA 2YXDA 3FMFA 3W3ZB 4BN4A 4YAFA 1P1CA 2FQYA 4TKUA 1RE1A 3I5UA 4UDOA 3T9EA 5BWLA 3HFSA 2AG8A 5GM1A 1JLRA 3Q88A 4N1AA 5DNAA 4UTOA 1QIFA 1JB9A 1PWXA 2D1RA 4ILEA 2IU6A 1JWAB 1G3RA 2NYVA 1K6XA 2HJSA 1XYGA 1KJIA 5BN3A 9GPBA 2G9QA 1XVIA 2HLPA 3C3CA 4GECA 4MJLA 1Z18A 4Z54A 1BE1A 4BATA 1UC5B 3EIXA 3PUJA 4LOHA 4PRYA 1KJJA 2QRZA 4LXYA 1RRPA 2H1FA 4O4JB 3PXBA 4A0RA 4LJRA 3VR3A 4BC1A 4KWCA 4LEIA 4HOYA 3UHAA 2ZUSA 4GS5A 1NRXA 1CY4A 4MHSA 3ZUPA 4DEXA 1J1ZA 2Q1YA 2ONZA 3N0TA 2ORWA 3JATB 4HXGA 4JNKA 1FQWA 3EEOA 4GU5A 4WN9B 3GH3A 2QDXA 1P5JA 1TA4A 1QDLB 1JT9A 1L7RA 2WMOB 2XYGA 5JMWA 2Q5CA 2AZXA 1NWCA 3NHPA 3QIVA 5EUMA 3WBFA 2VWHA 1GAJA 3L7IA 4M83A 4R1QA 4V1CA 4JT2A 4ZANA 1DGQA 4KR2A 3C3EA 3P2YA 2WYHA 3AY3A 2HJVA 2GAJA 2PWYA 4A7PA 4CKBA 1OAOA 1QLHA 2G0TA 1Y7TA 4I4IA 4B3MB 4KZKA 4JS0A 4PCVA 5DBOA 1E79A 2J0SA 5L3SB 1GCGA 1NLMA 4I3GA 5A5GA 1O6CA 4RTJA 3URMA 3LA6A 2H1CA 2WM9B 5SZJA 2BGRA 1GDDA 3N2YA 2NW6A 3S7TA 3F4LA 3ONWA 1BX1A 1GFSA 1HF3A 2AOXA 2H63A 4CF4A 2I6UA 4MYUA 3LQYA 1QIMA 5AJWA 1KSGA 2G1AA 2QRHA 4DCSA 1ZI8A 1TVKA 2NZXA 1R8XA 1G21B 1WXHA 4GG1A 5IANA 4PGMA 3WB9A 3F98A 1GQOA 2P4EA 3RCBA 1ZSVA 4L02A 3ZWWA 2FW8A 3CF4G 1QX4A 4RACA 3O0TA 3IE2A 3MJVA 5ALUA 4ZHSA 4DQXA 4CXMA 3CW2A 3E3MA 3ZWAA 1QONA 2EFEB 1MXFA 4EW1A 1L8LA 2KB0A 4YR9A 1BQ3A 2GSWA 4NZ9A 3SC4A 2CGEA 1VPWA 5KJ6A 1G4HA 2RHWA 4HQLA 2YCLA 4ZZ2A 5A02A 2QMUA 3ZY2A 2CNNA 2XA1A 5KSYA 1ZD4A 4YGYA 3TEMA 3JR7A 3QF4A 1BWRA 1L1RA 2FSPA 3CT6A 4ZXFA 5B57C 3FUTA 3GLTA 1X1QA 3T9CA 5CB4A 2HPVA 1WY7A 5EMJA 2O0LA 3CEJA 3WYEA 3LC1O 1UUFA 3LX5A 4OGGA 3BTOA 4B4UA 1PFWA 1DTWB 3QVKA 1LEHA 1PR6A 4I7EA 2X0IA 5ILQA 4E30A 4IJWA 5TQ2B 3T15A 3WWYA 1XZDA 1P9RA 2IHUA 1FYXA 3EA5A 3H5NA 4ZD6A 1V16A 3SJBA 4B4OA 4BNJA 4B87A 2XB4A 3VH1A 3V8EA 4YHHB 1PWYE 2CJFA 4AJEA 3PFCA 4PZPA 1FYWA 4Z7NB 2X4DA 3DZKA 1RWKA 3FWYA 1WPGA 1IHPA 5CXQA 5CD9A 4IXNA 1CJUC 2HMUA 2Z08A 2KHZA 4RA9A 4BO6A 3L6BA 2R1TA 4HX9A 5L45A 1YCDA 3COVA 4EGCB 3BRQA 2ZVQX 4MDFA 4LDQA 3UMVA 1AUOA 1YQGA 3N2EA 3W2GA 5IVPA 4RF3A 1SCDA 1EK2A 4LYGA 1MXHA 3H2GA 3B78A 1GNRA 1GKLA 1N1EA 5BSVA 3VAAA 4US2R 2A1UA 3W90A 4CV3A 1HG0A 1OT5A 4Y6PA 4EPRA 1U31A 1R4AA 5L7TA 5CB4F 3NWOA 1IAVA 4YC7A 4IV0A 3AR2A 3WYCA 2ZB3A 1D9XA 4W7IA 3A6KA 4Q00A 3ZHQA 4QPCA 4ENSA 3ZXYA 2J07A 2QKYA 1GUDA 1ZK0A 4MHOA 3TR5A 3I0ZA 1T1RA 1IBLB 2RH9B 3NRBA 1WETA 4N47A 2I78A 2IXAA 5EHXA 1Z06A 1CHNA 3GFVA 4PAWA 4AO6A 2FR1A 4AMZA 4G0XA 5A5VA 3L9XA 2AOTB 5LB4A 3E9RA 1NJFA 1RP1A 1MX9A 2CBGA 5M29A 2C2YA 3G0DA 3CUWA 1DBVO 3HM9A 3ZYZA 3HE3A 3IIKA 3C6YA 4HNVA 3FFBA 3WHIA 4GPBA 1NMEA 4L4RA 4PINA 3VKFA 3ZDCA 2ZG6A 4RULA 3P9NA 3PRHA 5FOTA 3ABOB 4EB8A 3I42A 5IJ0B 4ARUA 3DMTA 3QXGA 5E9QA 1T2UA 2Z5VA 4Y7DA 1U3UA 2CHGA 2DWPA 5A5FA 3BQMB 1Z2PX 3RYFB 2EKZA 1Z17A 1NW4A 2F8LA 2EZ8A 4L8LA 4R51A 2B7CA 2XUKA 3GRZA 3R7FA 2X2EA 1EP2B 1EUZA 3UJHA 4IUDS 2W9XA 5BN4A 1I3OA 2RK4A 2WA1A 3TI7A 1KI6A 2Z09A 3NDRA 3V2HA 4FUTA 1E92A 1UK7A 4JSYA 4MP6A 3VU1A 1YJXA 5BMOA 1A9RA 4EJSB 2CNLA 2VHEA 5JRDS 2WNIA 3ECCA 1RCUA 4ZFNA 2BIFA 2QD1A 3TMAA 5JSUA 4XWOA 5ICEA 2AQIA 2EBFX 3F1LA 1I7PA 1RJDA 4JJ4A 4KIGA 3FSGD 4BN5A 5F9HA 5AXCA 1E0SA 2RKWA 4JVOA 5FUYA 1QTIA 4BLOA 5SV2A 2UUAB 4ER3A 3BKXA 2XECA 1H6CA 3GJRA 3G2KA 4RSGA 4WEOA 4WY8A 3V1KA 4BXOA 3FIUA 3GFSA 3I28A 3OCCA 4CGZA 3M6XA 1NBMA 2B21A 1OXBB 1MNQA 3AHGA 1IHYA 3DE3X 3K0AA 4Q9DA 5BWNA 3ZHOA 1FFXA 3BWYA 2PMEA 1UKVY 3BMQA 1HDGO 5D86A 4DIBA 5ALTA 2JJ2D 3ITDA 1QO0D 1Y8QA 1I13A 1NI4B 1N2SA 2RHOA 3ZQ6A 2IHKA 1XTBA 4IKOA 1FXWA 3K09A 2HGSA 3IB6A 3WQHA 3INRA 4IXTA 2HI0A 3NJRA 3X1YA 3UT5B 1X9HA 1QE5A 3GT7A 1ZCAA 4N54A 4DUPA 5DLYA 3VJLA 2JA1A 2WJIA 3RK4A 2AFVA 2KMLA 1WCV1 2NWQA 4HMPA 4ZJUA 4DWOA 2KM1A 4L95C 1G7CA 3GHYA 4FDAA 1Z0DA 1UBLS 2GYUA 4UQPA 4QNNA 5E4FA 5LBIA 2HJRA 4NCXA 3VGJA 2C5GA 3P27A 1NOKA 2GR9A 2QQFA 4PGHA 4KXNA 1T25A 2Y4NA 3N2ZB 5DLQC 4EVIA 4PG4A 4KL8S 2J3MA 1EQ2A 3AOEA 5EKUA 4BBAA 2AR7A 5ADWA 2IIVA 1YQWA 2I76A 2O5VA 4BQSA 3V4OA 2IP4A 5ECGC 2DKFA 1RCTE 2WZCA 3FZYA 3MVEA 5I7RA 5GM2A 2AVNA 2A0XA 3HP1A 2RBKA 3UWKA 1PJRA 1E4OA 1KOFA 3WIBA 1PFGA 1GA1A 4EB6A 2VZLA 4LC9A 2R7NA 2H4JA 2JFWA 2I3ZA 3M1LA 2X6QA 1D2NA 4JUFA 4OUKX 4PAGA 1FXWF 2IS6A 4CV2A 3C6QA 4C30A 4B17A 2FGKA 4DE5A 3FYTA 4A0SA 1HKHA 3EDQA 4YAEA 4KR6A 1E96A 2CDAA 1XZ8A 3U1VA 1DPGA 3PZRA 1QO7A 3WGJA 3ZXIA 1I5RA 4A9AA 3R09A 1DU4A 4QBTA 2EVWX 3TPZA 3QPWA 4M38A 4OSOA 2VZEA 2R7KA 5KTNA 2HSWA 4ZQGA 5HZGA 2RHDA 3EMVA 4CKWB 1NIPA 5CYFA 4F6RA 4NNJA 3DKIA 2ZI6A 1BDMA 1J5PA 4Q03A 5TS3A 1MN6A 1KJYA 2ONYA 3OCUA 3EF0A 4M8LA 4GNKA 3HB4X 1I0LA 3ZQKA 3DTNA 1M83A 5GONA 2G5GX 1QWOA 1G2IA 1UPXA 1FTSA 1I2ZA 2E4ZA 3LBFA 4WZAB 4Y7CA 3TQOA 3ZV4A 4PBSA 2DKNA 2ZT8A 4RTNA 1SHTX 4X97A 2P5TB 4ZT6A 2GLUA 3ITNA 4PEVA 1TGYA 3KIPA 4KN8A 1OIXA 4QUHA 4H59A 1ARZA 3OZAA 1PV1A 1YDGA 3ABIA 1HQDA 3EWAA 3F7NA 1Y8RA 3IV7A 1Z5NA 1II9A 4P8RA 2CLEB 4TZ0A 2R8BA 3FYCA 4J07A 4DSAA 4UPDA 1OWOA 3UHJA 1TIPA 3GEMA 1KDRA 1PJ3A 1XTQA 4J94A 4B73A 1VB5A 4XVRA 4YXWD 3MCTA 5TLSA 1Q0HA 4PTZA 3DDUA 3MS2A 1T3SA 1EJ2A 2QU7A 3LECA 4QGFA 2ZANA 3MWGA 5EWMA 1HSOA 4M99A 5KOJB 2PZEA 5FDFA 4IV5A 1B1CA 1T2EA 4NOLA 4LIPD 5GZ3A 1G5HA 4XA8A 1DPFA 2G76A 3L0PA 4NFLA 4QUGA 4BWGA 2FPIA 3M4ZA 4GEKA 4WESB 3ZDZB 1ZOSA 3DL2A 4OJQA 4X1OA 4UZSA 3U39A 5GONF 4YRSA 5J2TF 3EVAA 3ZPXA 4C29A 2O8FB 3H42B 1GGMA 3PRYA 3TOZA 2RCYA 3UUGA 2I7XA 3GP3A 3FTEA 1AKNA 1YFKA 2OZLA 3HCEA 4PU0A 4CKCA 3NH9A 4YI3A 3EGDA 3D9QX 4GYYA 4J1NA 3ZS9A 1FNSA 2IH5A 1KU6A 1XE3A 3AF5A 5U1PA 4MRAA 5L3QA 4UHJA 4IILA 5J58A 1L8QA 4C01A 1CQWA 4L5YA 1QHXA 3MAGA 2A4MA 3DS8A 4G1BA 3ILXA 3QU2A 4H9GA 5BNIA 2UVDA 2WT9A 1WCIB 1MC8A 3W0LB 5BT9A 3I52A 2P9JA 3C5HA 4BB0A 2E48A 4WKCA 1QV6A 5EE9A 2GA9A 3PQ3A 1L8XA 4A8JA 2M2IA 1T8SA 4CCYA 5LYJB 3GRPA 1WPXA 3IT0A 1ZN9A 3LQKA 5G4KB 2HRRA 1JFFB 2QI9C 1EPUA 3ENVA 4CPDA 3BTVA 5GGYA 1CK4A 5EQFA 1JILA 3DUFB 3V48A 4BFYA 1C3JA 4CL0A 3J7AC 4OSEA 2FQXA 3OETA 1NAHA 2C5AA 2FVXA 2IYSA 4OGLA 5CNJA 1MTOA 1G1MA 2AN4A 1NFQA 4GYJA 5E95A 4M53A 2X2PA 1DX9A 3KVOA 3TM5A 3TRHA 3VNSA 2P67A 4R5MA 4YIHA 3IBYA 3NHRA 4M37A 4ZVMA 2WAMA 4QC2A 1M1YE 3KQTA 3OEHD 3PD1A 4IGAA 5TNXA 5KNCH 2OO5C 4L5BA 2XHEA 4FMDF 1EGMB 5LA6F 4KWEA 3T7TA 4GXNA 2D1YA 2J85A 2ECPA 1F3LA 3VMFA 1H05A 2BE7A 4XZ3A 2P0AA 3GDHA 4C6SA 3TLAA 1KNQA 1NR1A 4OHMA 1C8KA 2ZQ5A 4I1PA 3NTXA 1ZNQO 1XCJA 3AEQA 4K28A 3L18A 3ZJ4A 2YOFA 2CFTA 3DYBA 3FKJA 1FW6A 1Q11A 2MT9A 1YVUA 4OK5A 1XQ9A 3LK7A 2ACVA 2BTQA 3C8DA 1Z5ZA 1VZ2A 4HPWA 1CUIA 4QOGA 2GT1A 5JZBA 2D2EA 4EARA 5AVSA 4Y1RB 4KDRA 4L9AA 1X8XA 4BMVA 2IYOA 5JTTA 4EHBA 5FJJA 2WICA 1MLDA 2BFEB 1EUCA 1Z73A 2GD0A 3LT0A 1W7AA 1HT1E 3LWZA 3O7MA 1GSOA 4W7HA 5C1PA 3NOXA 1JZTA 1T9HA 3RVQA 2QXYA 5KDOA 1ZRHA 4B5LA 2BBSA 2C1XA 2WMNB 2QTCA 3D6FA 3V8VA 4Q02A 2FOLA 5KTKA 4G0NA 3GLUA 2BYTA 2R8XA 1T9BA 3ZGLA 4I4CA 4UAVA 4Q9IA 4HH0A 1DIGA 3N74A 1X7ZB 3KPWA 4V39A 1N3BA 2JKZA 4QDXA 2PU5A 4O4LA 5THXA 3GNSA 4RF2A 3WQRA 5LP6B 1YCGA 4PZCA 4EG3A 2FH5B 2RAPA 1X87A 2C9YA 1UXOA 2EL9A 2J09A 3O2JA 4MUAA 2PO5A 4YQFA 2LVBA 4ESOA 3P94A 4UUPA 1OFVA 4MW7A 3WYFA 4A0GA 5IBCA 4J0CA 3ZE7A 2R6CA 4EB3A 1Y5RA 3VH4A 3I9V6 4FDLA 3ENNA 4FE7A 2HK9A 1QAOA 2OZPA 4RL6A 2Q1TA 2Q3BA 3JYHA 1B26A 3LOQA 4MB2A 4PONA 4QEDA 5J5AA 3T7IA 5EE3A 2G08A 3F78A 1O6ZA 1ULZA 4Q1EA 1M2EA 1CUXA 1LNZA 1PCXA 1QM5A 1X70A 2QX6A 2XBUA 3KT6A 4LXIA 4PQGA 4R1NA 3GLFE 1POWA 4MYCA 4UEJA 1FFHA 1ZH0A 4XTCS 2FZGA 2G4LA 4H7EA 3O91A 2BFWA 2M6SA 3OIFA 1OX6A 5TRTA 3EBOA 3NBXX 1ZR4A 3RNOA 3TL2A 4EHIA 3DVQX 1HY3A 1U0BB 1IHXA 3ILSA 3K8OE 5DBIA 1OAAA 4EM6A 2ZQYA 1M1NA 2I3AA 4GKBA 4BFWA 4ZCRA 1XG5A 1GPYA 1L6IA 4FNAA 3UMCA 4IM7A 1P39A 3E7DA 3FVVA 5ESDA 4DLBA 1X2BA 1I2BA 2RJNA 3MUOA 4MPTA 4D02A 5HTOA 2VUHB 2GM3A 3IP6A 4IJQA 4ZQIA 1SOAA 3W6NA 1LDGA 1V7ZA 5CK4A 1M5RA 1TQDA 3PFFA 2EKBA 1A7UA 1WB5A 1SB8A 2HSJA 2YMPA 2ZTSA 3OMLA 1L1FA 3STHA 3ZU6A 5CEEA 4QNMA 1CB0A 4J2HA 3T4UA 3MBIA 3C8HA 5COQA 4UHCA 1G98A 5C51B 2HXYA 3NTUA 1AHIA 3GOQA 3A9RA 1VL0A 3OEEA 4ZVVA 2GCPA 1OZGA 2XRFA 1OFUX 1CUVA 1V5WA 4EITA 1SQFA 3KL2A 3GPBA 4KPUB 4M1MA 3AVOA 3WIVA 1U7PA 2V7TA 2ZUCA 1QS0A 1PFUA 4TQUS 3L8HA 2R60A 2N42A 5IDWA 4PS0A 1G0OA 1EFRA 521PA 2GN4A 4YCAA 4YAKA 3GFOA 2ANBA 1EE1A 2I1VB 3MWDA 4Z1MA 4CM9A 4ZYZA 1G2QA 3AOEC 1CY6A 4FSXA 1VL1A 1JLSA 2DWQA 1VP9A 4KMSA 1NFRA 4H6WA 3SHTA 3UKJA 2GEDA 4OUDA 3H2BA 2BBOA 3IQGX 4E03A 4QHYA 3A11A 2WKWA 5AIBA 3SVLA 3RRNA 4IWYA 1CQZA 1E1NA 5FJIA 2YHIB 5FLYA 2JIMA 3DXFA 2W6OA 3HKEA 4NCJA 2B7LA 2FJ0A 2O2ZA 5FL3A 3CU5A 3QITA 1K3UB 5E2AA 2B1GA 5BORA 1AS0A 1SXPA 5JWOA 1UXHA 2P9FA 4LVOA 3FGZA 4NMXB 1EX6A 3K8ZA 2NPIA 2ZYSA 3JQRA 1DEAA 4DLYA 3A04A 2ZJAA 1C30B 1PZHA 5AK4A 3CX4A 4XPIB 4MTCA 5FPHA 4JLMA 5E3IA 1D6MA 1QIDA 4I36A 3UJBA 4B6JA 2I2WA 5HFJA 4M0MA 5HZMA 4CLOB 2HMSA 2W2QA 3EH1A 2GVNA 5EJMA 3SF8B 4L0MA 1C4KA 2ST1A 3PP8A 3U7IA 4R0MA 4YTEA 4FD2A 5I45A 4ALKA 1RQXA 2RGUA 1NJGA 3WMEA 3X2FA 1Q0UA 3ZTWA 4EI8A 1DXQA 4LGVA 2WWGA 3I9NA 4JL8A 5LKRA 1P6XA 1XZAA 2CLKB 1T2CA 5FP0A 3HCWA 3LZ6A 3BE6A 1TO1E 4IQFA 2VYQA 3D1VA 4OOEA 3U3DA 4B46A 3IV9A 2IHBA 4Z6KA 2J48A 3D5QA 4Y9DA 3KT3A 4U5QA 2GN2A 2VRCD 2YOHA 3W5JA 5KU7A 2M6KA 1CE8A 2F3QA 1B14A 3V97A 4DCVA 2AJ8A 2QX4A 2RGRA 1MO3A 2WQZA 1U0RA 4ZXPA 4F4FA 1QRSA 4YNBA 3JQPA 3QE0A 5BXYA 5TPZA 3QVOA 3FA2A 3RUDA 2G8LA 1XHEA 5AJHA 1ZHFA 3SYKA 5BW8A 4DV5B 3ZKAA 2UZ0A 3U4QA 2P8SA 1LPPA 4ADSG 2XE4A 1XDDA 5KTRA 1J09A 5IK2A 2IS4A 4RXUA 4F96A 1UOOA 2WHXA 4NABA 5HOQA 5EUQB 2OILA 4QATA 3N2GB 1R16A 4UD6A 1ISHA 3SE0A 3WGVA 4DIEA 4NCAA 3ZJVA 2O7NA 4NBWA 3R5TA 3TUJC 3I76A 5ILOA 2CDRA 2IIBA 2PH3A 2R6DA 3H84A 3RYIB 1FUUA 3I9LA 4KIWA 1GNTA 2R6ZA 1YJ5A 1ZA1A 5FA8A 4EYEA 1H3FA 3QTLA 3OA0A 4HDRA 3PWZA 4GKKB 3MJRA 1Q7EA 1JIXA 4EJMA 2C1EA 2HDWA 4EENA 3DLBA 1AZWA 3R5JA 4WCVA 5JS8A 1DDGA 2OZKA 1SXHA 1A9XA 2HDHA 3FR8A 3A28A 2R1VA 2JLAA 1H2FA 2VI5A 3TLKA 5JDIC 3QWIA 3EC7A 2XVZA 2BAGA 2KW5A 2L82A 2X7XA 3BH0A 3FGPA 4FFRA 3MJCA 4DC1A 1HBJA 5JSZA 3AESB 4NCBA 2WVGA 2X22A 4L16A 4MXDA 4I50A 4RLHA 1F38A 1UFRA 4BQFA 3V1MA 3IJPA 5AK0A 2WNHA 1OW3B 1JUDA 4J49A 1BHQ1 1OWPA 3LI2A 5AJVB 1FYFA 3UYLA 2PR7A 3WK4A 2CV0A 1S1MA 1QGED 3P32A 4BP3A 5B1DA 5K3CA 2P2YA 5L4SA 2BLLA 1ZISA 1KR2A 3A70A 3AINA 3B1YA 3IQXA 4I8DA 4RK0A 5F9MA 1JR4A 1QCZA 4E07A 5MFZA 1BN6A 1E1DA 1KH1A