2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
3IKTA 1NHGA 4UVGA 4YAGA 5IZCA 4U5QA 2J6IA 1LDNA 1TEHA 1MG5A 3CIFA 2HUNA 2C20A 3KEQA 3H5NA 1GUFA 3PHIA 4PZDA 4ILKA 2DBRA 3PDJA 1P44A 4RCVA 5KNLA 1QV7A 1X7GA 3C85A 2YV1A 5JDIA 1C0LA 1LBEA 1XA0A 2PD3A 3ZWNA 4AJIA 4J49A 4CV3A 4E2YA 3GDFA 1DIHA 2QG4A 3WIDA 5JNLA 3OH8A 1IB6A 3D64A 1TXGA 2Q2VA 4IZHA 4XR4A 1E1NA 2Q1TA 3R0IA 3WGOA 4CMKA 4XWYA 2NM0A 5EESA 3ZV4A 4ROSA 4XZ3A 2Y05A 4CLOA 1PGOA 1UP7A 3JQ7B 4GLOA 4BV8A 1YB4A 3JQGA 4RQTA 5AXAA 2DM6A 1NTOA 4GH5A 3RC7A 1IYZA 4UUMA 5HA5A 1DBVO 3HB4X 4OQZA 2O3UA 1NFRA 3GOHA 1QSGA 2QZ9A 3IDSA 4Z0PA 4ALMA 4DBZA 3OICA 2YHUA 3HJAA 4EUEA 4F6CA 2OO5A 3GRPA 3WQRA 1KETA 5DCWA 2V65A 1C0KA 4RORA 2EKLA 2CF5A 1WVGA 3CSDA 4DLAA 4W6ZA 5A1TA 5HWSA 3NTQA 2ZB8A 3ZWYA 4ZJUA 1N7HA 4YT8A 4YR9A 3IS3A 4J3FA 3PVZA 2VWGA 4XCVA 1FMCA 4D79A 2FRDA 1ZW1A 5C37A 4M1QA 5JO9A 4Z3KA 5ITVA 3MOGA 1IHYA 2D3TA 2H5LA 4RPLA 1YBVA 1GEEA 1U7HA 3HDJA 3MJ4A 1JQBA 5KKCA 2VHXA 4MVJH 1A9YA 1J0XO 1E3SA 1GPJA 1JTVA 2O3JA 4KQXA 3ASVA 4YJFA 4RF5A 1BG6A 4IZIA 3NV9A 4OH1A 1EBUA 4UVHA 1DRWA 2ZCVA 2PLAA 3N7UA 5IDQA 3GRKA 3NT2A 2JJYA 1KVSA 2R2GA 5BNFA 3GPDG 2V6BA 2PZJA 1KBZA 2JCXA 1P3DA 1YH3A 1UXJA 1ZMTA 5T6BA 4OXYA 4DGSA 2JFFA 1LJ8A 5IDYA 3OIFA 4DUPA 3CZMA 1I3NA 2PKRA 1VC2A 4PZCA 1MV8A 1K6IA 4ZQEA 2X9NA 2Y66A 4Q3EA 1ZUD1 3SX2A 1TI7A 3NKLA 1BMDA 2IDZA 4HFRA 1NFFA 1R4MB 3EW7A 3EZYA 1HE5A 1ZIDA 3EK2A 2I99A 1VL6A 3LVFO 4P8RA 5A06A 3HDHA 3BHJA 3I1JA 4LSMA 2C29D 1FF9A 2GASA 3NTRA 3VH2A 1S7CA 4B8WA 1YBMA 4OOFA 6LDHA 5TJ9A 1QLJA 3ONEA 4RO0A 2VHWA 4NNJA 4D0SA 5F21A 1DC4A 1LI4A 1SAYA 2DTDA 1BSVA 3PIIA 4R51A 3DAFA 3QVOA 3DXFA 4RLSA 1W6UA 4DVJA 4RF2A 1EFLA 4D44A 4DRYA 3GEMA 2Z1NA 4GSLA 1X0VA 2AG8A 4BO9A 3HN2A 4JJIA 1UDCA 4NIMA 2IEDA 3TFQA 3AM4A 5DP2A 4DTIA 3ONFA 1NR1A 3OFSA 5L3ZA 5EMHA 4AJNA 4CUJA 1E3JA 2PTGA 2NV6A 1FK8A 1ZK2A 2Y1FA 4E2XA 5B4UA 1XKQA 4JBHA 3N74A 1MP0A 1RYEA 4GWGA 3WGGA 4J1SA 3RFVA 3RU9A 1Q7CA 1AHHA 2GZ1A 4TKMA 4BVAA 4CPDA 2Z95A 4E5KA 2X6TA 4KDEA 4OSPA 3ANLA 3U62A 2Y0CA 1T1SA 2YV3A 3JQCA 4FQ8A 4R16A 3KZVA 5EQDA 1A71A 1IE3A 3C1AA 3RASA 3V1YA 4J7CA 1A5ZA 1U3VA 4HNGA 1F17A 2W2KB 1SMKA 3PYXA 4QUKA 1TA4A 1A27A 2XXBA 4CM4B 2NUAA 3CINA 1H9AA 1DAPA 5TT0A 4RDIA 2JFHA 2J5QA 1E1LA 3C1TA 3Q9UA 3QLJA 3B20A 1HEUA 1T2CA 4RPHA 3BXXA 1EK6A 4YVFA 5FFFA 1KIFA 1NYTA 1LSJA 2C7GA 1P31A 4BKUA 3D4PA 3OF2A 1LDBA 2VHZA 3RBXA 1C1DA 1ZJYA 7MDHA 5C5IA 1MLDA 3IP3A 2HJSA 2Q50A 2AXQA 3WDSA 2NADA 3WIEA 1ADGA 1YQXA 3QVTA 4ND4A 3BMOB 4UULA 1UP6A 1I10A 3UVEA 5CDSA 1UH5A 3DZJA 4IINA 2RBEA 3ZI0A 1I5RA 2ILTA 2WJPA 2VUSA 3K92A 3EUWA 4LSWA 2HKIA 3JQFA 1ZEMA 3JQGB 2BH9A 5KJEA 1ARZA 2XF8A 3Q6IA 3MTJA 4I5GA 3HADA 4W7IA 5I8WA 1K3TA 1PSDA 2CY0A 2GGSA 4RPKA 4HX5A 3VTFA 1ZSVA 1EVZA 2FN7A 3PP8A 5G0WA 2C7VA 1DRVA 1SOWA 3PRJA 5JC8A 1AN9A 3GT0A 3WICA 3B6ZA 3I9MA 3NTOA 1H9BA 5A9SB 1P45A 1BDBA 1G0NA 3DAGA 3VZPA 1LQUA 5BR7A 2OL4A 4E2WA 2FSSA 2WD7B 2A92A 3QVWA 4IJVA 4ZICA 3KOUA 1NAHA 3PZBA 3E9MA 1OAAA 3GNTA 1Q0LA 1ZXBA 3U4DA 1ENPA 1PGNA 4O5OA 1N2SA 4E32A 1NM5A 4CLXA 3P19A 4GGOA 4R54A 3ADPA 2NVWA 1GUZA 4JCOA 1S6YA 3U49A 4DIOA 2RHCA 4NBWA 4BO5A 3Q0EA 3WTCA 1FDUA 2BLLA 4E5MA 3DZGA 3ABIA 1I3LA 1V8BA 3D1LA 1UP4A 1NQTA 4FBGA 1DDOA 3F4LA 4YT4A 1DIBA 2CMDA 1TT7A 2A35A 1T1RA 4ALJA 4I1IA 4XGNA 3E9QA 4IJKA 4KDFA 4OKNA 5LDGA 3W4JA 4AFNA 4IDFA 5JO0A 5F1PA 3GAZA 2GRAA 2UAGA 1PL8A 4E2ZA 1ISMA 2UYYA 4IXTA 4XRRA 1F06A 1KVTA 1R0KA 3V5NA 1ENYA 1V6AA 5TSDA 4A03A 2HMVA 3KM0A 5CFZA 2CDAA 5JDCA 3QIVA 2F1KA 1NFQA 2O3TA 1E3WB 3BHMA 1ENOA 2O7SA 5IG2A 4YJGB 5J23A 3LU1A 4B8ZA 2AQIA 1SB9A 5A5EA 3GZNA 3INRA 3O03A 3OM9A 3GDOA 3EDMA 1MX3A 2Y99A 1U5AA 3ITKA 1T4BA 1KEUA 3R3JA 2GDZA 1ISIA 3C7CB 4BKQA 3KSZO 3MJCA 1KEWA 2CUKA 2G17A 4M89A 1YDEA 5FF9A 3PLRA 4H3VA 1ZJZA 1M6WA 2AMFA 4XYBA 3JYNA 2D8AA 1PJSA 3AFMA 4FFMA 4QTZA 4NBVA 2DKNA 2PY6A 2E49A 2HCTA 4MKZA 2PR2A 5F1OA 1N92A 3EZLA 2POQX 3FBTA 4J4HA 4RVGA 3VDQA 2YFHA 3PGJA 1ZBQA 1Q2XA 3PHHA 3MZ0A 4BNXA 3G49A 4L73A 2VYVD 1F8FA 1E5LA 2RIRA 3N58A 3GFBA 5H83A 1GADO 3DL2A 1LUAA 1WAMA 3AOGA 4I5DA 3KYBA 3RWBA 1XU7A 4WCFA 3U4CA 3ZV3A 1SO8A 3QJ5A 2A94A 4BGEA 4R9RA 3QA9A 1LRJA 1XQ1A 3DMTA 3KBOA 4JX8A 1H0KA 1LDMA 2ZB4A 3PHGA 3KSUA 3TJRA 3QY9A 5IJZA 4DBVO 2RHRA 1G0OA 4WECA 3HB5X 2NTVA 1QYXA 2RH4A 2VTEA 1BGVA 4CM4A 2HO5A 3RUHA 1EVIA 4ZQGA 4FB5A 1JW9B 4FFOA 3JQEA 4XB1A 3LC1O 3DHEA 3AJRA 4ZHSA 5GMOA 1B0AA 1V3TA 3R3SA 4IS2A 3WBFA 4YAKA 5JCJD 1N7GA 2W98A 2OZPA 4PG7A 3UHAA 1H2HA 2DQ4A 3CPSA 4GPD1 5A03A 2X9VA 4FGSA 1CRWG 1A9ZA 1DFIA 2E6UX 4UAGA 1DHTA 4TZTA 1C1DB 5KVSA 2AA3A 3I83A 4Y6RA 4WPGA 5HBRA 4A10A 4NJOA 2JL1A 3TFOA 1KEPA 3PJEA 1B26A 5LCXA 4XGKA 1ISFA 3DAPA 1X1EA 4FSHA 2EWMA 5B4VA 3FF4A 3WXBA 2B37A 2FOIA 3GEGA 2O48X 4D41A 1B16A 5F3RA 4Q3NA 5U1PA 4TVBA 2HMSA 1GCUA 4MVJD 1BVUA 2WWRA 1TT5B 4YACA 4PG8A 4WLOA 4QO7A 3LQFA 3DOCA 2PZMA 4AJJA 4CQMA 2Q4EA 3KRTA 3L4BC 1D1TA 1E7RA 1MC5A 1M66A 5JAZA 4CM3A 2O50A 2PH5A 1AUPA 3QE3A 3TL2A 4M49A 1A7KA 3U4HA 4TROA 3JQ8B 4IQ8A 2A4KA 1DO8A 1I30A 3DZHA 1XGKA 4PCVA 5TX7A 4LVCA 4P22A 3LLVA 1GZ3A 3AUTA 3I9JA 4L76A 2CVZA 1XQ6A 4FJ0A 1NX6A 1ZO8A 2VTDA 1JN0A 2DT5A 2RCYA 2WD7A 4GX0A 2CF6A 2ZJ1A 3E18A 4NJMB 1KC1A 2CVOA 1P74A 1PJQA 3D3WB 1BXGA 1NPYA 4AJ1A 1P1HA 4BO4A 3WS7A 3MJTA 4CUZA 5TLSA 1K0UA 3TZQA 4E13A 2VHVA 2JCYA 1HXHA 4PIVA 2D5AA 2EHDA 1I36A 1SC6A 4D3DA 4K6CA 3S2FA 5IXSA 4CR7A 4XD2A 2YDYA 1LRKA 1E7QA 4YA6A 4RF4A 2IZ0A 3DBLB 4NDNE 3DHYA 3JD2A 3UICA 1R6DA 2CZCA 1JA9A 1AGNA 4R41A 1B15A 1EK5A 5DCYA 5BSGA 4GVXA 3HHPA 1YONA 1QYCA 3GDGA 1ORRA 1U3TA 3OJFA 1HF3A 2B5VA 4EUFA 1YXMA 4KOAA 3UF0A 4IMRA 4CQLA 2QZZA 4CL3A 2LDXA 1Z75A 1T2FA 3D4OA 1P77A 2D59A 1UZMA 1HE2A 1E3WA 5CEEA 5B4TA 2QRLA 4YDRA 1V3VA 5B1YA 2Y0DA 3OECA 3IJRA 4DPKA 4I8XA 2P68A 1E0DA 4WNCA 1L7EA 3TRIA 2CDCA 1LLCA 1N1EA 2AQKA 3HUDA 1B2LA 1CIVA 3H3FA 5BT9A 1C0IA 4OGWA 2FHSA 4OJNA 3ZH2A 3F4BA 1WDKA 1WLYA 1ZKMA 3QWIA 4EDFA 4PG6A 1ZEJA 1DIRA 1Z73A 1CETA 1SCUA 5TC4A 5FI5A 3SC4A 3GMDA 4WLEA 2ZQZA 3T4EA 4PLFA 4CJXA 3DWFA 1VJ0A 5I7SA 1J6UA 4KQWA 1F8GA 1NBOA 1VSVA 2EIHA 1QG6A 2WD8A 3L6EA 5DT9A 1PX0A 3PYLA 2NWQA 2W90A 3VC7A 2IXAA 3ZWBA 2YV2A 1P1IA 5U4QA 1Y6JA 1GV0A 4DPMA 3GNQA 4WCFB 1Q0QA 3KVOA 1ONNA 4I5EA 2H1SA 4L4RA 4K6FA 4R01A 2NACA 4AL4A 4II3A 4BUCA 3AM3A 1PZEA 1EVJA 3KYCB 4NH4A 4CM7A 2EEZA 5FEUA 2PNFA 4PLVA 4IDAA 3UGKA 3HWRA 4FCCA 5C3MA 3JQAA 3DZBA 3GG2A 1I2CA 2PWZA 1IL0A 2B4TO 2ZB7A 1MFPA 3DDNA 3ICPA 4CMEA 5G4LA 3NGXA 1BW9A 1YOVB 1GV1A 3G1UA 1EUDA 1B8UA 2EERA 3ZW9A 1X13A 1RKXA 2UDPA 5DULA 5ADHA 1HDGO 4CMIB 1CQIA 1HDYA 5F5NA 3ASUA 5IF3A 1IOLA 3E48A 2FR1A 2YDXA 1W0CA 1P33A 3WJ7A 4HP8A 3JV7A 4S3MA 3ROKA 4PLTA 3ENKA 3LT4A 1M75A 2C59A 2C2YA 3I3OA 3DZFA 4P4LA 3U0BA 4BNTA 4PN3A 3JQ6A 3ADOA 1I3KA 1D3AA 4OHUA 2WTBA 1HWYA 5AXCA 4U8GA 1F0YA 3ORFA 1M2WA 4FW8A 1G6KA 2FWMX 3ENNA 4BGIA 1EBFA 3P7MA 4NZ9A 4W4TA 1O8CA 2EV9A 4FFNA 4DLBA 2JAHA 3FI9A 4AJEA 4I08A 5F5LA 4FJ1A 3GVIA 2IEBA 5COAA 2VUUA 4LVUA 1E3LA 2VT3A 2X0JA 3INTA 3PJDA 3OQBA 4UVEA 4YJHA 1PWXA 2EJWA 5DOVA 3TNLA 4D45A 4LRSB 6ADHA 2PFGA 2ZYAA 3ZCXA 3RQSA 4Q39A 1O9BA 1PEDA 4E5YA 5T8KC 4FN4A 2IE0A 2O4CA 4BKPA 2FMUA 3DC2A 3FN4A 4IGEA 5IZ4A 3D3WA 3BHIA 1W4ZA 1KERA 2HDHA 1T26A 4IDGA 4K9DA 4NR0A 1GL3A 1TLTA 3CMCO 3ZWPA 4A5OA 3AUSA 4R1NA 4B79A 2X5KO 3WOHA 3PZRA 2JFGA 3JYOA 1ZK0A 5CG2A 3W6ZA 2VYNA 5I9NA 2BF7A 4BNJA 2BKAA 1ISGA 4J1QA 4W99A 5JE8A 3VKUA 4IDBA 1WDLA 5L45A 2Q49A 3LK7A 3MJEA 4MOWA 2OHXA 1XWFA 2PH3A 5K0ZA 4PLZA 4YB8A 3DBRB 1MA0A 1PJ3A 2BGMA 4HUJA 3DBLA 5BSFA 3X2FA 1ZZEA 3HNPA 4TMFA 3TZ6A 4XIYA 4YYZA 3FWZA 2B35A 3VH3A 5COQA 3D7LA 1NQAO 1L7DA 5ICMA 2Q2QA 2AQ8A 2VWPA 3VDRA 3WLFA 4TRRA 4Z0HO 4ZRNA 4N5NA 4MP8A 2CVQA 3FTPA 1VE9A 1BRMA 2V7PA 3H65A 1DIGA 5GZ1A 2HQ1A 3UN1A 3VPXA 4OO3A 4E33A 3H7AA 1PQWA 3PPIA 2HMTA 3IMFA 5EQFA 2C5AA 1R4NB 1WMBA 2C2XA 2Q99A 3K5PA 1YB5A 2G82A 1DFGA 3QWHA 4IPTA 1CF2O 3O9ZA 3RUAA 3E9NA 1A4UA 4L0QA 3ETGA 1R16A 3MJVA 8ADHA 2X0RA 3FTNA 4BNHA 3RBVA 2O23A 3GC6A 4N18A 4UUNA 3WGZA 4F6LA 4IIUA 1MXHA 1Z45A 5L9AA 5DZSA 3W8FA 4BNGA 1MGOA 4LW8A 2YY7A 3WGHA 1P1FA 5CP8A 1DOHA 4BL5A 4BO2A 2QRJA 3WGQA 3F9IA 4QXMA 1HDZA 5G4KB 2WEKA 4OMUA 2DPHA 4O1MA 3ZNNA 1C3VA 1ZMOA 2PD6A 3OA2A 4BMSA 2B0JA 4RL6A 3JQBA 3FRJA 4JBGA 2EKQA 1WXDA 3DOJA 1VL0A 9LDBA 1HLDA 2DU8A 1NAIA 1RM3A 1PS9A 5T57A 3ANNA 2DBZA 2OXIA 4DYDA 4I5FA 4YT5A 4ALNA 3H2SA 4G65A 1MFZA 4RGBA 1EQUA 4Y6SA 5H81A 4E31A 5HM8A 4BGUA 5TGDA 5ER9A 1GYQA 1HE3A 4DYVA 4D46A 4YAEA 2WE8A 1KC3A 3TL3A 1CYDA 3H8VA 1U3WA 1H5QA 4W82A 1H94A 3GUYA 1L1FA 4PZEA 4DC1A 3BMCB 1QRRA 1EMDA 2BHLA 2IYPA 5A4DA 4BMNA 4Y98A 1LC0A 3ZWVA 1K6JA 1K5HA 4NMHA 1IULA 1E6WA 2FR0A 4KTTE 4GWKA 2DBVO 2Z1MA 4R5HA 1OZAA 3H9JA 1QLHA 3KYDA 4GMFA 4DQXA 5L7WA 3BZUA 3CUKA 4BV9A 2AQHA 1EUZA 3E8XA 5JW6A 2ET6A 3W8EA 2GLXA 3K8ZA 1EZ4A 1A72A 5KJ6A 3GVHA 3E03A 2GO1A 3ZNOA 4TKLA 4J90A 1OOEA 2DFDA 4LK3A 2BFPA 5ER6A 3L9XA 3X2EA 3BTOA 4GMGA 2HAEA 3H9EO 4B7XA 1Y8RB 4NBRA 1HYHA 4FD3A 3QW2A 5K9ZA 3RKRA 5CAEA 2B36A 1QXSA 5L4LA 2A9FA 2DTXA 4IM7A 1T24A 3I9OA 4ND1A 3AY6A 4EZBA 3IL2A 3O38A 4QEDA 1KOLA 2AEJA 2I65A 1ONOA 2FPPA 4TZKA 3GQVA 3GAFA 5AXDA 2DUWA 1J49A 3EY4A 4BNMA 3OJ0A 2YQ4A 4UVDA 5TQVA 5CEJA 5ENVA 4GX1A 3V2UA 4CR8A 3K2BA 3RCBA 1UDBA 4O63O 5BSHA 3Q3CA 1SNYA 3IQDB 4YJDA 3KSDO 1GTMA 4Z9FA 1Q7BA 1Y9AA 3QVXA 1XCBA 1H93A 4MPDA 1Y5RA 2NU8A 1BTOA 3V1TC 1NWHA 4ALLA 4LCJA 4LMPA 3G3EA 2P9CA 5THQA 3RJ9A 5JFOA 1UXGA 1Y8QB 3C3XA 5FI3A 5JAQA 1ONPA 4E3ZA 5JMWA 1XU9A 3WFIA 5TT1A 4ZN6A 3AY3A 4D7AA 3H4VA 3GF4A 4BMVA 3SBOA 3W6UA 1JKIA 4JP2A 4L75A 1R0LA 1CDOA 2F00A 1OC2A 4WKGA 3EAGA 4EJ0A 4WE3A 4PG5A 5AYVA 3WYBA 3JSAA 4IIVA 4QT0A 1N8KA 3MWDB 1UR5A 1PWZA 3OIDA 3G17A 3K2EA 4EITA 2Y68A 4DXHA 2IZ1A 1NPDA 1C1XB 5T5QA 3A9WA 4RZIA 1IPFA 4MVJA 1PL7A 3HFSA 5DOZA 4LN1A 2H63A 2FZWA 4K28A 4CLRA 4GL4A 4WEOA 3K96A 1F14A 4JN6B 3U5TA 4YPOA 5BNIA 3IUSA 5EINA 3ZU3A 1M76A 2Y1DA 3L6OO 3AI2A 1R4NA 1R15A 1I3MA 4HFMA 2JD0A 4GAEA 4OQYA 1H6AA 1M67A 4NFYA 2XPCA 4RPJA 1LX6A 4JIGA 4HADA 1IY8A 2QHXA 3RI3A 1LXCA 1HDXA 3JD4A 4B3JA 5L7YA 2OFPA 4D42A 3TQHA 3IP1A 1UDAA 2PKQO 2GD1O 1UXKA 1VPDA 3QWBA 4JNKA 5AQ1A 5T67A 4B4OA 4E6PA 3L0DA 2O2YA 3GGGA 4MVJM 3W8DA 1N9GB 3F6YA 1LC3A 4RVUA 4GSKA 3H5AA 3I9LA 2AE2A 3WNQA 2I6TA 3ANMA 4YAIA 3K31A 1U7TA 2BGKA 1TVEA 3WMWA 3JQDA 1PZHA 4EEXA 2IXBA 3Q9NA 3UCEA 2P2SA 3M6IA 1PGPA 4JJGA 4P38A 4XJTA 4Y6PA 3GR6A 4L4SA 4YTEA 4Z9XA 3IUPA 4Y67A 3E1KA 3JQ7A 4OIMA 3SC6A 2VOEA 3AW9A 4BNWA 5L4SA 2VQ3A 2NTJA 1E7SA 2EP7A 3DTTA 5A3JA 4PLWA 2HK9A 4EBFA 1H2BA 1GQYA 3KEOA 4H16A 4BQPA 3AUUA 3LYLA 4XX0A 2PKQP 3L77A 4N5MA 3DBVO 4EW6A 1AXEA 3JCZA 2OUIA 1LDGA 2BI8A 4H15A 1U3UA 4BO0A 3PHLA 3WQQA 1EE9A 2DTEA 4A2CA 3Q2IA 4BNLA 3BMCA 1DRUA 1GD1O 1QP8A 3HSKA 4XYLA 3VPSA 1O0SA 1HZZA 5IZCC 4HWKA 3TN7A 4AG3A 3OQ6A 4ITUA 3ZU4A 1WZEA 4TQGA 3LSYA 1QR6A 2X8LA 1Z7BA 3HZZA 4YRAA 3PFFA 4YRBA 5KVVA 1WNTA 1C14A 1KVRA 1WWKA 2VWQA 1Z82A 1V0JA 5JY6A 4FR5A 2C5EA 3GMSA 4NFSA 4OAQA 1R0SA 4RV9A 3ZGYA 4QSMA 4D3SA 1PL6A 4XA8A 5BNTA 1CJCA 1EE2A 4YJFB 1PJ2A 3FPCA 4ALIA 2GPTA 4DC0A 1BXKA 4ZQFA 3ETEA 2DLDA 1E3EA 3RC9A 5HS4A 3STHA 1NQ5A 4XQEA 3GY0A 3SLGA 2VT2A 3F5QA 3PLNA 1DHRA 1DLIA 5B12A 5T64A 3CZRA 4CV2A 5JPIA 2R6JA 2J5KA 1LTHR 2I66A 3M2TA 4QFCA 1O94A 2ZB3A 3B1KA 3NUGA 4J2OA 3ROMA 1VM6A 3NT4A 3C1OA 2R00A 3PEFA 2VCYA 4BB6A 2QYSA 2Q45A 2BFOA 2ZK7A 4K26A 3A06A 4TSKA 5KWEA 3I23A 3PJFA 3ONDA 1EFKA 1PR3A 5B37A 1PU2A 1WMAA 4CLOB 1Y5MA 4D43A 2UUPA 4PLHA 3C24A 4WLNA 1HYEA 5L40A 4CV0A 5I9LA 4AJLA 4OXNA 3KV3O 2GN8A 2WDZA 4ID9A 1V9LA 4WCFC 3BMQA 3E82A 3OQ1A 1YJ8A 5LC1A 1KS9A 5I7FA 2J8ZA 3UCXA 3RC2A 1X7DA 5MDHA 3AK4A 3FHLA 2IZZA 1NNUA 3EVTA 4BNIA 1DFHA 3IAHA 4NPCA 1LLUA 3DFZA 2AHRA 1ML3A 1T2DA 1VL8A 3GPIA 4TRJA 3ST7A 1LU9A 4AJ4A 1VJTA 3QVSA 2ZKLA 4PLGA 1P1RA 4H7PA 4XDZA 5ES3A 4ZA2A 1GYPA 4QECA 3FNHA 3FPLA 1UJMA 2NTNA 4WNIA 4G2NA 4CM9A 3TSCA 1W73A 1OFGA 2Y1CA 1VI2A 1YO6A 3RFXA 1T4DA 3LF2A 4U6SA 5JY1A 1EUCA 3WSVA 3VHRA 1EEHA 2FY8A 1EQ2A 2X7HA 3HDYA 1MC4A 2Y1GA 3ZU2A 1E7WA 3A14A 2W2KA 1ZNQO 3JYLA 3OJOA 4A73A 1NHWA 1YQDA 4WLUA 5I9MA 1UXIA 3I6QA 2EKPA 4J16A 4CLEA 1F12A 3NJ8A 4II2A 4RVDA 1YE3A 4GKVA 2FR8A 1E7YA 3TZCA 1PS8A 3MWEB 3PWKA 3UH1A 1V35A 3GNSA 4UVIA 1R4MA 3B70A 1JDJA 4Z3DA 2AE1A 1N9GA 3BYZA 2B83A 5A5FA 5CDGA 4YT2A 4IUYA 1ADBA 1PIWA 4YCAA 3S8MA 1ZK3A 1OMOA 4XYMA 2JKVA 4R68A 3BMOA 2AW5A 1RPNA 5IN4A 4U6QA 1MG0A 1M6HA 2YHIA 1GDHA 1UUFA 2BFMA 3EVNA 5TNXA 4LRTB 1WW8A 2GERA 4DLLA 3NEPX 1PZFA 4PVCA 5GZ6A 4CM6A 3TPCA 1HDRA 2NVBA 2ZIZA 2BMAA 2YZ7A 2O4UX 3LF1A 3RUEA 4E12A 1DEHA 4TWRA 1NVMB 3GN2A 4DIBA 1Z7EA 3PQEA 1PGQA 2VZ8A 1AXGA 4B7CA 1KY5A 4B4WA 4BNYA 2JCVA 3VPGA 4ONEA 3RC1A 3S1LA 3TZHA 1ZVMA 2VRCA 1ADCA 3VKVA 3SVTA 4J9UE 4J0FA 3SXPA 4J0EA 1D8AA 4FFRA 5A9SA 1P1JA 2JD2A 1DC6A 4F46A 2WMDA 2XAAA 3NGLA 2VRCD 2YYYA 1ADFA 1UAYA 3ZNPA 1U2GA 1QV6A 2P9GA 4MO2A 1DJQA 1PS0A 3E5MA 8LDHA 4B3HA 4M8SA 4EI2A 2OP0A 2P9EA 5CDYA 2W4QA 4CM5A 4X54A 1Y81A 1VKNA 4XIJA 3GZ4A 3ZWMA 2I5PO 2DPGA 4ND3A 4RVHA 3HQ4O 4PLYA 4KWHA 5TJHA 4PGFA 4BS9A 2X9GA 2NNLD 3WNVA 3M2PA 3GLQA 4F45A 1YVEI 3BAZA 4PG4A 2Z5LA 1DB3A 5TIIA 4IXWA 3RVDA 3O8QB 5A04A 4NU6A 4W9NC 1LEHA 3K6JA 4CM9D 2GF2A 2DVMA 4GX5A 4HXYA 1GZ6A 5JAIA 1XG5A 3NYWA 4L74A 2BGLA 4R69A 5KTKA 1U8XX 4OXKA 3VPFA 3WX0A 4BO7A 2ZTLA 2QYTA 3L9WA 4FJ2A 3UOGA 2EXXA 1O6ZA 1RM4A 3VZRA 4CMHA 4DQVA 5DBFA 3D5TA 4MVJG 3CE6A 3WTBA 3WR5A 5A3VA 3CXRA 4N7RA 1DXYA 1RM5A 1JWAB 1JU9A 1AHIA 1YDWA 1ZFNA 3C8MA 3NT5A 4E5PA 3FWNA 2I3GA 3D3EA 4OM8A 4OYRA 1NPTO 5C7OO 3GH3A 3WSWA 4XR9A 1K2WA 1E7MA 3AOEA 3FD8A 4UEKA 2IRWA 5C7LO 4J1TA 1QYVA 2GYYA 4BO8A 4M87A 3GVPA 4WLFA 1GY8A 3AWDA 5EIOA 4WJZA 1JWBB 4J7XA 5I7EA 2O7QA 2VYND 1BXZA 3BMQB 1EDZA 3W4KA 4MVJI 4RJTA 5K6AA 5DP1A 1YBAA 4N5LA 1U2DA 1R37A 2Y0EA 2C07A 3QQPA 3RKUA 1GQQA 3CEAA 3ETDA 3V2GA 5HTOA 3H9GA 1LNQA 4QFDA 3NDRA 3BTVA 3PYMA 3PXXA 3ZV6A 4UEJA 3ROQA 2BELA 3KB6A 5JDIC 3E6AA 2J3IA 4RVSA 3W1VA 3MJSA 3DFUA 3JD1A 4P4GA 3JD0A 5F1KA 4R9SA 4RPGA 1WZIA 4BQRA 1B8PA 2J3KA 1J5PA 3S2EA 2OBYA 3WYCA 3LZ6A 5DF1A 2CDBA 3FNFA 3OJEA 4JK3A 5BSEA 2EG9A 1RWBA 3NRCA 5A9TA 4JJFA 4BKRA 4DIFA 2WYUA 4LCEA 1P1KA 2OORA 4L9RA 1FDTA 1ZXLA 2C54A 2G76A 2QIOA 3P2YA 1GQ2A 2X1HA 3Q1LA 4AJHA 4CLDA 2PGJA 1KY4A 4CM1A 4YQZA 4S1VA 5EJ2A 3I4FA 4BO1A 4RQUA 1E5QA 1KEVA 3VAZA 4CQMD 4KTVE 1HRDA 1U5CA 3UXYA 4BB5A 1HL3A 4WLVA 5FWNA 3AU9A 2CFCA 3ZHYA 3OEWA 4J6FA 4P4NA 5G0TA 2H9IA 1KVQA 1NVGA 5KJ1A 3P5SA 3WQSB 3INGA 4MKXA 3OJLA 3Q2KA 2Q3EA 4ND5A 4RLHA 2E82A 2C0CA 4PVDA 4PLCA 1WDMA 1LSUA 1DC5A 4MIYA 5TS3A 4CODB 4Y9DA 1IPEA 2O3SA 4UEOA 3JYQA 5A02A 4WASA 3V8BA 2B69A 4A7PA 3NJ4A 1JLLA 4E5NA 4AJOA 3VOSA 2YHIB 4YJGA 3QRWA 1PJLA 1EDOA 3G0OA 5G0SA 3WB9A 1U28A 3GZNB 1ZK4A 3AM5A 3GUCA 4FFPA 2J3HA 4DPLA 4GLLA 2VNAA 2E37A 1AE1A 4JXKA 1EVYA 1P0CA 1KYQA 4BIIA 1PQUA 3ZHXA 5EL0A 4O6VA 1PR9A 3HDQA 1PGJA 4Q9NA 1NWCA 2SCUA 1T2AA 3T4XA 4JROA 5CPBA 2XXJA 3JQFC 5TF4A 3ICCA 3DMTC 3IOYA 3JQ8A 3OMLA 5DBGA 1DPGA 3I52A 3I4CA 3KUXA 3PQDA 1CERA 2P5YA 2W8ZA 3QWAA 4FC7A 1SPXA 1QKIA 4TRNA 1G1AA 1RJWA 5JSFA 2GCGA 3GGPA 5KJFA 4M55A 4Q3BA 1CWUA 3GK3A 3R1IA 3V1UA 3AY7A 3B1FA 4CMGA 1CEQA 4LISA 3RJ5A 2I67A 1BWSA 3AFNA 3E5RA 4NJMA 4A26A 4C7JA 5U9CA 5DCUA 4TVOA 3VVCA 2HRZA 1BXGB 4MDHA 1GCOA 5AVOA 1B14A 2J5RA 1I24A 3KLPX 2X0NA 1NXQA 4GKBA 4DWVA 4ZQBA 4D3FA 2ZCUA 2OOSA 4CMBA 1YGYA 1C0PA 1XEAA 4J4BA 4J9VA 4BO3A 1P0FA 3LT1A 1GZ4A 4C7KA 1PQPA 3WG9A 3AI1A 3NDIA 4R1UA 5GY7A 3QHAA 3IIEA 3NDJA 4XGIA 4C4OA 1XR3A 2GN6A 1E3IA 3MOIA 1CQJA 4O0LA 3O8QA 3A4VA 5JDCC 5JCXA 4NK5A 5L7TA 2X58A 4IGFA 4IDDA 1GEGA 2X23A 4CUKA 2PZKA 4MVJF 3H9QA 3O4RA 4Y8VA 3VVBA 3W4IA 5ITWA 4BNVA 5G2OA 5HRUA 4MKRA 1LRLA 4LMRA 1PJ4A 3F3SA 4EGFA 4IQGA 3JQBC 3PWSA 3OEYA 3OP4A 4CQLB 2YFQA 3RAJA 4OKIA 1W8DA 2FPIA 4NG5A 1E6EA 2NSDA 1WP4A 2XOXA 4KUEA 1XSEA 3WWYA 1I2ZA 2UV8A 1YWGO 4XQ9A 3DTYA 5ILGA 3VTZA 1TT5A 2X86A 1FJHA 5JXWA 2UVDA 2LDBA 4GI2A 4U0KA 4CQMB 3GGOA 1FDSA 4KP7A 4JQCA 4ESOA 1SOVA 1YJQA 3ON5A 2C82A 1ENZA 2ZYGA 4CM8A 4AJ2A 3SJUA 5IDWA 1U4SA 3F1KA 2EW8A 1UAGA 3K9QO 4OOEA 1MB4A 4Z0TA 4IJUA 3PI7A 3GVXA 4MINA 4A0SA 1HSZA 1DSSG 2OP1A 4R3WA 3WYEA 4DMMA 4FFLA 4DREA 1YL5A 3JD3A 1LA2A 2NU9A 4KUGA 1T25A 5L51A 1JKJA 4R4JA 4U0JA 5DDIP 3HFGA 2W2LA 1B3BA 3SEFA 2Y67A 1NP3A 2B5WA 4I9HA 2TMGA 1XELA 4RDHA 1N1GA 2VWHA 3CH6A 5JBIA 1ZCJA 2AEMA 3S2GA 4EJ6A 2FSVA 3C7DB 1J4AA 1A7AA 2GSDA 2J3JA 3BTSA 4XDYA 2V6FA 2HRBA 1HDCA 2OMEA 5H82A 3PHJA 4B4UA 2EW2A 4BNZA 4IBOA 4PLPA 1ZH8A 5KVCA 3RUCA 3OETA 1YKFA 4FS3A 5JAMA 3LC2O 3UCFA 3JQAB 3K30A 4ND2A 4I9UA 2NLOA 4Q3DA 4R1TA 4BHTA 1YQGA 1PZGA 3F1LA 1SB8A 1E77A 2ZQYA 1NR7A 1YL6A 2O2SA 3OBBA 4B7UA 2V6MA 1LSSA 3GHYA 4XYGA 2FP4A 1HDOA 5THKA 3MCVA 4AVYA 3ZN2A 5KIAA 4CMIA 1VJ1A 5T8KA 2NVUB 3ZZNA 4YEDA 4FGWA 4M86A 5AOVA 4HBGA 3ZDFA 3PDUA 1PJTA 3PIDA 3A1NA 3ZU5A 2EF1A 3DBHA 3LLSA 4QQRA 1GAEO 7ADHA 4GVLA 3ZWXA 1DAOA 4NI5A 3RROA 3GFGA 5C7IO 2Q4BA 1H6DA 1I2BA 5DN9A 4YQYA 3GEDA 3S2IA 1Q7GA 3H9UA 4WOJA 2E48A 2QQ5A 2WYVA 5CEFA 3VZSA 3ROPA 2H6EA 3AU8A 4F3YA 3OHSX 1DIAA 2EP5A 4WGGA 2Q1SA 2GR9A 5IAAA 4OL9A 5ILOA 1E1MA 4YBZA 2Y1OA 4YJHB 1IHXA 2O3RA 1JAYA 1QYWA 1XDWA 2G1UA 2QX7A 2YQ5A 4FOSA 3T7EA 5MGBA 1ID1A 4BNFA 4XB2A 5COBA 3TOZA 3QP9A 3RSHA 5CDUA 2ZTMA 1R12A 3MTGA 4N54A 1E1KA 2X5JO 1NVTA 3WMXA 4MVJE 1LLDA 1HYGA 4FC6A 2BFAA 2Q1WA 1GUYA 5CHEA 4NU5A 4EYEA 3ZNQA 2E4AA 3KYCA 3H3JA 1FDVA 3RUFA 3ZHZA 3K73O 4IDEA 1X14A 1UZNA 2Q46A 3BMNB 2VZ0A 3L4SO 3QWFA 5JC1A 3GVCA 1U1IA 3SLKA 4RF3A 5A05A 5CDTA 5IDXA 1P9LA 4MP6A 4CL8A 2FPGA 4B3IA 1K89A 4WEQA 1BW9B 1NQOA 1YOVA 3Q11A 4GQAA 3F5SA 3VPHA 1LSOA 4J7UA 1JAXA 4XQGA 2HMUA 1ULUA 5JMPA 2VRBA 4QO8A 2GN4A 1BDMA 4IMPA 1QMGA 2X0IA 3AI3A 5L53A 2WM3A 1Y7TA 1JVBA 2PK3A 2OGUA 2Q2WA 2OBNA 4GBJA 1O95A 3NAQA 3OSUA 4KZPA 3ZWWA 2P4HX 3DR3A 5KVQA 1E6UA 4HFNA 1I8TA 3ZW8A 5JLAA 2ZJ0A 4QX6A 4ZVVA 3UKOA 3EYWA 1B8VA 1XLTA 4RZHA 4BNKA 3LT0A 4MIEA 1JKFA 4AJKA 2AEFA 1DJNA 1SEVA 1BHSA 4BGVA 3DQPA 5GZ3A 2D5CA 1IZ0A 3EC7A 4HV4A 2CSUA 2NU6A 3FNGA 2X5OA 1WPQA 2HU2A 4CM8B 3JQAD 3UUWA 1HZJA 4Q3AA 4XEHA 1V3UA 2GZ2A 1MXFA 4E30A 3RUIA 3COSA 4G81A 4MJLA 1YB1A 3JYPA 3EMKA 1ISHA 2QRKA 2ZATA 4J4TA 5G4KA 3FNEA 5EPOA 3DZIA 4NQZA 3IKVA 3RD5A 5JYEA 4R5MA 4CLHA 2EGHA 4ZGWA 3VH4A 3VH1A 3OIGA 3ZWCA 4UUOA 3DO5A 4B4VA 4YXFA 3PFWO 3U09A 1HT0A 5ENDA 4JP3A 2DAPA 2YJZA 1PJBA 3UAGA 1ZK1A 4E21A 4XKJA 2X22A 2IYOA 2UUOA 1HSOA 3TWOA 3QV1A 4A27A 1Y9EA 4WOKA 2TMDA 1VSUA 2VYVA 5AXBA 1OBFO 1JVSA 2EJVA 2HK8A 4L4XA 3DBRA 5KKAA 4XRGA 1O89A 3BIOA 4O59O 2WSBA 3JTMA 2P91A 4EEZA 3I5MA 4JLWA 2PZLA 3DZKA 3LDHA 1H6BA 4IS3A 1DC3A 2GNAA 3JQ9A 4W9NA 4K1LA 5EN4A 1RYDA 2D2IA 3RBZA 4WCDA 5JYDA 4DQUA 3KYDB 3IJPA 3L07A 1UZLA 4R3NA 2NVUA 5G0UA 4BKOA 2VN8A 3M1AA 4J2HA 1LLQA 4JGBA 4DL9A 2BRUA 2Y1EA 3H2ZA 3HN7A 2D1YA 2NQ8A 3P2OA 1GPDG 3PJGA 3UW3A 3LC7O 3T7CA 3DBHB 3OA0A 1HLPA 2DBQA 3CMMA 2AG5A 2JD1A 3WGTA 5IFLA 4CMJA 3D0OA 1I33A 4RVFA 2I3AA 1N5DA 4DMLA 5G0VA 2G0TA 1H6CA 3B1JA 3DEYX 3U9LA 1RM0A 5L4NA 5JCJA 4FOOA 4W7HA 3RU7A 1U9JA 1TB4A 2YUTA 3RIHA 4I9NA 4DA9A 1D4FA 3H6KA 2W2LD 4BO6A 3FSRA 1FXSA 4PRKA 1T2EA 5DNAA 4KMSA 5TRTA 4CMEC 4XYEA 4CMCA 3CKYA 1GU7A 3IC5A 2I9PA 1XIVA 2G5CA 3KLMX 1U4OA 4YWJA 1SEPA 3BA1A 3F46A 2HK7A 2PGDA 2PD4A 3KETA 2JAPA 5LDHA 3AUAA 2V6GA 3VZQA 4FIZA 4AJPA 5FYDA 1XYGA 5IXYA 2QW8A 4CMAA 4HFJA 3ZWAA 1OC4A 4CR6A 3TOXA 3ZHBA 5CPFA 1Z74A 2BD0A 3U3XA 4ALKA 4KUHA 1QORA 4WUVA 3R6DA 1B7GO 1U8FO 1Y8QA 1B3RA 3D5QA 2B4RO 2D4AA 2VNSA 1VRWA 1KVUA 3BMNA 4MIOA 3KTDA 2RH8A 4GX2A 4PRLA 4MP3A 1VKOA 4ZRMA 1XHLA 1IUKA 4HNHA 5I8ZA 1I0ZA 1MUUA 3WWZA 3U4IA 3ZWOA 5HS6A 1PJCA 3RFTA 2GUGA 1GR0A 1NASA 3MEQA 4CV1A 3O26A 3HE3A 4Z9YA 1Z6ZA 4E4YA 3CTMA 2ZTVA 3L6DA 1ZSYA 3FR8A 5IN5A 3V2HA 2I76A 3DHNA 4UREA 3WGYA 4D0RA 1C1XA 4UUPA 1X7HA 4IDCA 2X4GA 3BTUA 3C7AA 3JQ9C 3WGIA 2GN9A 3PGXA 3ZV5A 5KCZA 1YL7A 2JHFA 4NBUA 1PTJA 4U7WA 5A9RA 2YW9A 4J91A 3DOOA 1X0XA 1YRLA 1X1TA 1GYRA 1Y8RA 4ZQHA 3WLEA 3WBBA 4Q3CA 4IY1A 2NQTA 5K6AC 4ZU3A 2VHYA 5KJCA 4NBTA 3DMYA 3S55A 1QYDA 4EJMA 3PWZA 3ULKA 2CD9A 3EGOA 3KXDA 4ZD6A 1Y1PA 1I32A 4BOYA 2WE7A 3WJAA 5EERA 1YS4A 3M1LA 4GGPA 4HKTA 1Q0HA 2IODA 4MVJP 5CG1A 3FCOA 3AOEC 5KOIA 4KWIA 1D1SA 4E0BA 3DONA 1SBYA 5BQFA 3HG7A 3PTZA 1E92A 5ICSA 2NU7A 2PA3A 1ISJA 1K6XA 3RUDA 1GFSA 2O3QA 2ZYDA 4EUHA 2GZ3A 3UFXA 4BNNA 4FPXA 3F47A 2Y93A 1LDEA 4YAJA 2ZTUA 4NHEA 3TF5A 2EGGA 9LDTA 3SJ7A 2HJRA 3GN1A 4AICA 3WFJA 1A4IA 2RAFA 1FDWA 3A28A 1BVRA 2PV7A 2HSDA 2CNBA 4L8VA 3I9KA 1X15A 1SZJG 1HETA 3G1TA 2VZ9A 2HMWA 4XQCA 2PGLA 2BI7A 1D7OA 5DBIA 2R00C 2D0IA 1ULSA 4WK6A 3GHHA 3DB2A 1UXHA 1O5IA 4BNUA 4NFHA 1DLJA 2JHGA 1IZ9A 4IJWA 4PFJA 1HKUA 4M54A 1HTBA 4Z6KA 3PQFA 1OI7A 3FR7A 4TRMA 4J43A 3TZKA 4XJSA 2P5UA 3GG9A 5JS6A 1LDYA 3NX4A 3LT2A 4JBIA 4INAA 2DC1A 3KO8A 4YRDA 2P4QA 3L4BA 4J1NA 2B4QA 4IQ0A 3GA0A 2HLPA 3QSGA 4OSOA 4URFA 3D4NA 3PK0A 3FBGA 1I01A 4R1SA 4CLRB 4G5HA 3G79A 1Q1NA 5L95A 2WYWA 4FDAA 4HY3A 3TDKA 4NK4A 3ITDA 5I7VA 2DUUA 1VLLA 3H5RA 1R66A 2VOJA 4LGVA 3I9NA 2FZEA 1HE4A 3I6IA 2Q1UA 2DFVA 3KHUA 3EHEA 1ZSNA 1LQTA 2VUTA
chains in the Genus database with same CATH superfamily
5BV8A 4Y2HA 5F98A 1KQ3A 2WSSD 3R5HA 5I8PA 1TEHA 2OXCA 1M6VA 4HWTA 4DM4A 3L1UA 1QYRA 2C20A 2PSEA 3KEQA 4HLUC 3EXAA 4MGIR 1PEKE 5LJLA 1O6FA 3SKYA 5HK9A 5FUBA 2Q4TA 3LCMA 4HDNA 5B2EA 3C85A 1XDBA 4E09A 2C2GA 1C0LA 1LBEA 2PD3A 4J49A 1YGPA 1VHDA 3PT5A 1BCRB 2N46A 4JFAA 1BFKA 3GARA 4FK8A 4QELA 1Y7HA 2PGNA 3T1HB 3B85A 4GOKA 4S1TA 3IKMB 5AESA 3AJEA 3T06B 1O97C 2Q1TA 1KEEA 4R05A 4ETNA 1KEKA 1MQAA 4GBED 1IXYA 5TQ2A 5LQNA 4CMKA 1G4HA 4QVGA 1RKUA 2NM0A 3ZIAA 1G8MA 4CLOA 1W75A 3JR7A 4GLOA 2ZJ7A 1YB4A 3TTVA 2QM8A 2ZYHA 1KMIY 3IDOA 4RQTA 3RC7A 4NCBA 4UUMA 4OVKA 3W1EA 1IM2A 1PEAA 3AJ9A 2HIGA 5HA5A 2HW8A 3LL7A 1MORA 2W2MA 3WLLA 5M2QA 1WPXA 3NOVA 3I34X 1M5UA 4ALMA 3JQRA 1CB7A 3RJTA 1E3QA 3OICA 5CW1A 5IMSA 2VXCA 2PBFA 4EF6A 4HAUA 5DCWA 4K9RA 3H5WA 4L7QA 5ALTA 3OUUA 4RORA 2EKLA 4H9GA 5ALXA 4BX9A 5A1TA 3FOFC 5JR3A 2I87A 4ZJUA 3OCZA 1I80A 2K2WA 4LY3A 4M0MA 1CK4A 1FMCA 5FUWA 4D79A 1IAVA 1SU8A 4V0LA 3RT7A 2HXGA 3LY9A 4BCCA 3F6BX 4DQKA 3BOSA 3BF7A 4ZAYA 4BKMA 5I6DA 2AUTA 5C1OA 5FPHA 4ODIA 4HEQA 2ACKA 2ONKA 2AG1A 2VHXA 5KKCA 4MVJH 2ZOSA 4PYMA 3PQ5A 4KQXA 3ASVA 4A91A 1OFUA 2PFSA 4BXOA 1SXGA 1BG6A 2FFBA 4C06A 4F5EA 1YA4A 2V7GA 1GPBA 4U7FA 4DT1B 3GRKA 1QG0A 4KN8A 4KI7A 2JIPA 4RABA 4N39A 1QQTA 4PS0A 4HGZA 4Q3OA 1F4VA 3N2GA 4RBNA 3I6ZA 5EYPB 1XLTC 5T6BA 4OLHA 1EM8B 1JA1A 2BFEA 3BGSA 4DJAA 4C05A 3RAFC 4FHFA 4JC8A 2RG7A 5TMBA 4RHUA 5FJIA 5DFAA 3WIVA 4DUPA 4C2UA 5BYBA 1VC2A 4TVSA 1MV8A 4PO8A 5ITSA 4WL0A 4MA5A 2EC5A 2EKZA 2V9CA 2Y66A 2AHOA 3KKNA 3E58A 4ZQEA 4EUNA 3AYZB 1ZUD1 1NDQA 3SX2A 1QAQA 2R86A 1BMDA 1D7AA 1NMSA 5FYQA 1Z0SA 3WK5A 3WRXC 4BQSA 2UYCA 1JR2A 2ID7A 1KMHB 2KJQA 3FMIA 3LHIA 4OHVA 4ZZ2A 5KTYA 2VH2A 2G1PA 3LNTA 3VPDA 3EK2A 3BUSA 2XA2A 5KQRA 1HR0B 1S3FA 3IHWA 1E2HA 4P8RA 3HDHA 3WYGA 3I9V1 2EQ5A 2WJYA 2FW1A 1YJCA 5HGJA 1CZLA 2A4MA 4MITA 2VH1A 2IIPA 4IDNA 3RKSA 2C29D 3NTRA 1RCUA 3VR6D 4KFCA 5TJ9A 8ATCA 2HCBA 1ZX1A 1QLJA 2SKEA 3BWXA 2XKJE 1VPVA 3ONEA 1TM2A 4B7AA 1E79D 3K5IA 1T8RA 2HU8A 4YNBA 1IBCA 1UJ6A 1X9HA 1DC4A 1SAYA 2H2GA 2QSYA 3EYAA 3K0BA 1GFWA 3DAFA 1GZ5A 3IVMA 3QVOA 4NMXB 5FAXA 3SFTA 4RLSA 3VDNB 2AFVA 4BU1A 1EFLA 4KGZA 3HVHA 4Z7QB 3ORRA 5K3FB 2QENA 1D2EA 2AG8A 4IHKA 3AEZA 3FYHA 2G08A 2G77B 3HN2A 1IJEA 2ZSFA 4YJ3F 3CX4A 2IEDA 3IO5A 1XVVA 4NYMR 4UHKA 1PR4A 2GK6A 3D7KA 2I4MA 2Q3MA 5ALPA 3SY8A 4KPUA 2WG0A 4KV7A 4P3PA 4UBIA 3E9CA 4U7JA 5LWHA 2ECOA 2IHJA 5FPKA 3LTNC 1NATA 1QLWA 3KR0A 2QB5A 1L4UA 1CY4A 3AHFA 2PUAA 1VCIA 1XKQA 1JS1X 3N74A 1MP0A 2E7ZA 3RFVA 4LYAA 3MRTA 1Q7CA 1S0UA 2ARKA 3QELB 1DWUA 1DPFA 4F6RB 5DGCA 4QYXA 1RDFA 1SFRA 4DSZA 4POOA 2UYHA 2X6TA 4ACAA 3O8OA 2DR3A 2YOFA 3E7PA 1NUUA 3U4QA 2Y0CA 1JNYA 3JZFA 1G5HA 1ZUWA 2YV3A 2W8BB 3B5JA 5HZMA 5IFKA 3UJNA 1EFHA 5ED0A 4PSVA 4C04A 3VGPA 4BN5A 2AYYA 2VP3A 3BWEA 3V1YA 3DO6A 2V55B 1Y63A 4HNGA 1F17A 3EGXA 1M5RA 5K8TA 3CO5A 3OHMA 4U39A 2Q5EA 2WINI 5EZQA 2Y4OA 5IAOA 4FWTA 3CINA 1K7CA 1ZCZA 1WZNA 3OFJA 4D8XA 1SCBA 1GTZA 2J5QA 3IEIA 3C1TA 2XADA 4INJA 5EXEA 2BGRA 2AMVA 5HJEA 3J80A 1HEUA 1V7CA 3DL4A 1WZ2A 1Q6YA 4L78A 3GRZA 3BXXA 4UDXX 4JI6B 3UFBA 2XCTB 1GTL1 1FU8A 1PT7A 4TMXA 5BO5A 3WY9A 3TTSA 3L02A 1NYTA 3CM0A 4HAYA 7REQA 1DKOA 2I71A 4LGMA 1S4QA 1OI4A 5JS8A 2D1TA 1OD6A 2Q50A 1T4GA 5BYAA 4R98A 5CB0A 3TLKA 4IIGA 4C29A 2JBAA 2XH8A 4DMHA 1UBHS 3BMOB 5L3QB 2QVGA 1I10A 2DJIA 3I5YA 4WXMA 5EPUA 3UVEA 2FQXA 3KP1A 3UAVA 4IINA 5JSHA 1JIVA 1KI6B 2GH1A 3MN1A 5FP0A 3ZI0A 2VUSA 5CJ2A 3IQXA 1CNFA 3M1YA 5HKAA 1HTTA 2VHUA 1KZ1A 3EZ2A 1U2SA 2XUJA 5H0IA 3M5CA 1JG2A 3R3XA 1YZTA 1UBFA 2QT0A 4DR4B 4NRDA 3HPRA 4CIXA 3OPQA 1A5AB 1TM3E 1FRFS 4W7IA 5EGNA 1Z2NX 1PSDA 2ZEJA 3FLMA 3W06A 1R4AA 1RPJA 2CMFA 2QUHA 4MCIA 1ZSVA 3F3YA 2FCAA 3O31A 5IHXA 5G0WA 2X2OA 5BWNA 1AN9A 3GT0A 4W1SA 1KGSA 3GCWA 3UJ8A 3AR4A 3C3BA 4OX9B 1QIDA 2PX3A 1OIVA 1VLZA 2VP9A 3EPPA 1MCZA 5ELMA 3DAGA 1G16A 3TXAA 4D8YA 1LQUA 1UQRA 5AMXA 4DLSA 2GQ0A 4J0JA 1JXQA 2FSSA 3R7WB 2ZI4A 4PQRA 2A92A 1BJTA 2L42A 4M7OA 3KOUA 4QDTA 3TYXA 3SC3A 4NYJQ 4XOIA 3IAM6 4YP7A 3VOBA 4P0PB 3E9MA 2IEIA 4HWGA 4L27A 1W49A 2IEZA 3T3PB 2NO9A 1ZXBA 3ZKWB 3RIXA 1PR5A 4WKCA 1DUIA 4O5OA 1PZMA 3JALB 5ALNA 1KZHA 1NM5A 1UBJS 1X80B 2XCQA 4KLNA 5EMJA 1FUYB 1II0A 4GGOA 3ADPA 1P61B 1NXOA 2DQYA 3WO1A 1S6YA 2ZE7A 4Q7LA 3DXYA 3WNDA 1AKWA 5JS2A 3UMYA 3U16A 2RGGA 3E9DA 2XCOA 3HN6A 5ALGA 1GPWB 1PYOA 5HTKA 2BLLA 3SD7A 4EJFA 1IXSB 2XLBA 1I3LA 2ZE5A 4V0OA 3D1LA 4JOSA 1UP4A 2BGNA 2XJ9A 4D81A 4YT4A 1HC7A 1YDHA 1HDIA 2JVKA 4PQEA 1D2RA 1T5OA 2ZXFA 5BNZA 3KQSA 1D9ZA 1G41A 3IOCA 1F2TA 5KOYA 1W5FA 1Z5VA 1RZ3A 3E9QA 4KDFA 5LDGA 3SEAA 3TLBA 4YQEA 5KNCD 2UAGA 3MLAA 4QOIA 1A4XA 3HJNA 4E2ZA 5JBQA 4ML3A 4MR9B 2VIIA 2VP2A 4X9XA 4F7WA 1V48A 4F93B 1PKXA 1V5GA 3A3KA 3FW1A 4YHBA 1F06A 4Z4QA 1YHYA 4QJ3A 5DX8A 4MDFA 1FXWF 1M34E 1O96B 1I7LA 4KXUA 2NYUA 3N2LA 4MTCA 2JIOA 2CDAA 1U5BA 4HYEA 2JIBA 2OLEA 1DXHA 5LYJB 4D26A 1UKVY 1ZD4A 1MO5A 2O3TA 3WYDA 1TDJA 3I58A 1BWRA 5EIBC 2P2LA 2AXPA 2GYWA 1V8DA 4ARVA 5J23A 3JXEA 1SB9A 4UM7A 4OP2A 1Q91A 1YZVA 4E7OA 2HDWA 4OAOA 2C4VA 2PZAA 3HXOA 1SG0A 1IVNA 4LFBB 1CPYA 3PRHA 4JJ7A 3ITKA 3N2KA 1N1MA 2GDZA 2KM1A 4BKQA 5JT1A 1ZI6A 1KEWA 3WWZA 2ZROA 4BFVA 3WFZA 4JUDX 3LNCA 1ZJZA 2AMFA 2ASEA 4P35A 4XYBA 2HYDA 5AKLA 2B6HA 3JYNA 1VLHA 5JZBA 4UNSA 4MDEA 3QH4A 3IAEA 5E7IA 4FFMA 4J75A 4QTZA 4NBVA 2DKNA 2PY6A 2RC5A 5HJ2A 5AW5A 2PR2A 3A27A 4PAQA 3GU3A 1Z0IA 1U1GA 3QE4A 1N2EA 1XEXB 4RVGA 3KZXA 2WWIA 1W35A 3BJIC 4WCVA 3COPA 3KS9A 2NXNA 1CQZA 1XMSA 4MEJA 5LL6P 1B0ZA 3WHIA 1ODFA 1DJLA 4Q4AA 3BGWA 2G1KA 1IJBA 2NSYA 2O06A 2GYUA 4DN6A 2R48A 4JKYA 4URUR 4BEJA 3OX4A 2FQ1A 5EJ9A 1GADO 3DL2A 1WAMA 3MQ2A 1KDYA 3N1UA 4ATNA 2JHPA 4WCFA 1JAZA 1BCSA 1SO8A 3QJ5A 4TMZA 1OFIA 3QA9A 4G23A 1XQ1A 4C0SA 3B3GA 2IBSA 3QNUA 1LDMA 2ENUA 3ZXUB 1N4DA 2AG6A 2QPAA 3KSUA 3PHGA 3QY9A 4PC6A 3TVDA 2WKWA 2ORIA 3P0RA 4QJ4A 1G0OA 4UBMA 5EWMB 1JKMA 4JLSA 2XVYA 1QDEA 1QYXA 2RH4A 5JD3A 1P6XA 4FB5A 2O2EA 2HO5A 4IJ5A 4ZQGA 3MT7A 2BCJQ 3PPWA 3HS3A 3E22A 3IPCA 3K9HA 1GNLA 2OY0A 4FFOA 4NMWA 1M3SA 4UDYX 1C9DB 1CQJB 1OWMA 4AQDA 5DJ5A 5ERGB 4YAKA 3WBFA 2GN0A 2GBLC 3E8SA 3HYSA 5A3SA 2EARA 1HT2E 3DT8A 3I2GA 4GPD1 3ZBPA 4FGSA 3DLCA 4JXJA 4WN9A 4C5BA 4EG0A 2ZJ3A 4JWKA 5SYAA 1Y3BE 3ROZA 3L49A 3ROTA 1DHTA 2WK1A 1KK1A 1MIHA 1SXJD 3F9CA 3I83A 1GSAA 2YIDA 3AB7A 4YUYA 2FJ0A 4NPHA 5GPBA 3ROFA 2DXIA 4G9GA 3P9SA 5FBWB 2QTAA 1KK3A 2GNPA 1XEWX 2GTPA 3RM3A 3TJZA 2JHCA 2C57A 3DAPA 3PFBA 4FS8A 4YGYA 2WTMA 3QKSA 3ZBQA 4ENWA 3FF4A 3KK0A 2FOXA 3WXBA 2FOIA 2VSOA 4D41A 3V7WA 2FPIB 2PRSA 2GHTA 4BUJA 5U1PA 2O8FA 1GCUA 4MVJD 4ZCQA 1JLHA 1P7ZA 2PMFA 1GSHA 2WRZA 5CTAA 4R31A 4YMGA 5KNCH 2WWRA 4CIVA 4PQYA 4YACA 4PG8A 2Y1KA 2XD9A 4BVKA 4RFSA 4ZOQI 3FYUC 1VCHA 1AK1A 2PZMA 4CQMA 4ZHQA 4ZJPA 3L4BC 2HHAA 4WNYA 2ZXUA 1DKRA 2VP6A 3S1AB 2GUWA 2AJCA 4CM3A 1N2OA 1OWLA 5TDHA 3TD6A 2ZSUA 5F7OA 3WK8A 1XJCA 1XD9A 2N42A 3AH8A 4EA7A 3CG0A 4O4JB 1OXTA 3OMWA 4NQRA 4DRZA 1VBFA 4PFSA 3TD9A 3DB1A 3DPSA 5DXAA 2DFTA 2JIZA 1L4FA 3IMEA 3IUQA 1XGKA 4Z5XA 3KEGA 3MCAA 4HNAA 2BI4A 1FMLA 3AUTA 3CS3A 3I9JA 4RWZA 4FJ0A 2VTDA 3NTVA 2PRKA 2DT5A 4ZU6X 2WD7A 4GX0A 1JDNA 2ZJ1A 4FEYA 5J1TB 2X40A 3WNCA 4NJMB 3D3WB 1NLYA 1P74A 1A9QA 1BXGA 3CCCA 4HTAA 4AWXA 5LZ8A 3Q5EA 1T2NA 3IV6A 1BROA 1USKA 1TQ6A 1XFDA 1YZKA 4Q7JB 3NS7A 1P1HA 1G2PA 1VKJA 1WHSA 3AF3A 4S1NA 5AJYA 5LU8A 1L8LA 3SFZA 4D9FA 1U3CA 4KIJA 1AIPA 1KA9H 3EOAI 2VHJA 5HVNA 3NB0A 5ELLA 3DE7X 4ED9A 3MB8A 4QHSA 4C7OA 2VHVA 2GO7A 4LYDA 2AC4A 2WIKA 2HMYB 2EHDA 4N41A 2BFFB 4ZKDA 4X64B 2NYVA 5HR5A 3BFJA 2O8CA 2W93A 2QE6A 1K92A 2H2IA 4YN3A 3EDRA 4XD2A 1LRKA 5TXGA 1E7QA 2CNWD 5ISMA 3P2IA 3JD2A 4U1RA 2PYZA 1JFFA 2D5IA 4OH7A 2R3SA 3AP3A 2WBLC 1DT3A 2R8ZA 3DTNA 4LNUB 4JUBA 5EOVA 1QYCA 1FUEA 2NO6A 1TM7E 2NYRA 5JV5A 3FSEA 1ES9A 2P3QA 3EC1A 2V5UA 2XRZA 1CQPA 2BYTA 1WEHA 4HCJA 3UF0A 3NPAA 4IMRA 1P0IA 1A3CA 3AYXB 4R8KA 3V3TA 3KJHA 3RVRA 1T2FA 2OBBA 2AF3C 3L1VA 2ODAA 1HE2A 1E3WA 1G8YA 2JFYA 4Y2RA 1E5VA 1YCGA 2QRLA 2WF5A 4WFJA 3O3OB 4YDRA 4NICA 2JAOA 1UBOS 1ODLA 2JI6A 1D09A 3HACA 3TE7A 1VOTA 4O4HB 2PUTA 4V0KA 3VJRA 3OOHA 4Y2SA 1N1EA 3A7DA 1EVEA 1SWWA 5T6MA 3RSCA 3TW8A 1PW7A 3HUDA 4MLCA 1IVYA 4US1R 1PK8A 4WNAA 2P6MA 3LA6A 4MUYA 2FEOA 4OGWA 3F4BA 2EKDA 1JVNA 3QWIA 1V39A 4X41A 4Y6LA 4PG6A 1S2DA 5KCMA 1YUMA 1QAOA 1Z73A 2O20A 5ALIA 1PNVA 1XFAA 4EZEA 1TYEB 4M46A 2ZQZA 1GN8A 3GI1A 1T10A 1Z0FA 4PZPA 1QOPB 3T4EA 3G2PA 5CCBA 1YFLA 1OZHA 4IMIB 3GYBA 3AVTA 2DY0A 1PUIA 1HH4A 2NVOA 3IMKA 4KAJA 4YIHA 2UUBB 1QG6A 1RSZA 2WD8A 1ZICA 4IO0A 4AK9A 2X41A 3L6EA 5FRDA 2OFFA 5C2JB 1MPTA 1WXIA 4HAIA 4KBGA 5JCPA 5DKFA 5CCEA 1HTWA 4KVAA 1Q0QA 3FVWA 3IH5A 4LI0A 4MB0A 4UPDA 2UZ1B 4X1OA 5AUPB 3FBWA 1O8BA 3KWMA 3TW0A 4DDMA 3D7RA 1QVRA 4EA8A 3RGWS 3OZUA 1YAHA 4ND7A 4L4RA 4ZZIA 1Q0PA 3IULA 3E3OA 4C4YA 1FYFA 2Q0XA 3ITNA 1TZBA 3I9V6 3I01M 2DHEA 2H3HA 2AI1A 3HI6A 5JRJA 4L51A 4M9ZA 1FZQA 3UHOA 3EXEB 1PZEA 1SUIA 3X3HA 1HRKA 5FEUA 1YAJA 4JJZA 2V0CA 4PLVA 4IDAA 3JASA 2AFIA 4HDOB 2VSYA 1R5JA 4QRDA 5C3MA 5CFMA 3LFHA 3A11A 5BURA 1I2CA 3PJRA 2ZSIA 4Q15A 2B4TO 3SQXA 3R9XB 3ZCSA 2VF5X 1JIKA 1K6MA 5ECYA 4LNAA 4CTJA 2XUIA 1FP4B 4ZYYA 5I7OA 1BW9A 4J3NA 1FJGB 3G1UA 4OHOA 1EUDA 4M99A 3I3SR 3M4XA 2C5SA 5IARA 2XXAB 1X13A 4XXHA 4EY4A 5C8DA 3L7NA 4D9CA 3PXDA 5DULA 5ADHA 1N5MA 4D6YA 1Z0JA 5CT5A 1CQIA 2FWRA 1NG9A 3UK1A 3TGPA 2Z2KA 2PYIA 3DJFA 5JARA 3H1EA 1GRCA 3NBZC 4FSDA 5DW0A 2QTMA 2FZVA 1Y80A 2PBRA 2XQJA 3BRCA 3JV7A 3SDZA 3U3JA 4PPQA 5KZMB 2C59A 3D6UA 3D8UA 3M9LA 4P4LA 2KHZA 2XCIA 2ZSEA 3JQ6A 4PN3A 3ILSA 1OJ7A 3ADOA 1BMTA 1U3DA 4CEJA 2FFHA 2Q1XA 2BRUC 2Q4OA 3BAFA 3C5HA 5KYVA 3ORFA 1G6KA 3FMVA 3IXMA 2JLRA 3U40A 6PFKA 2CXUA 3HO6A 3ELUA 1DCKA 3P7MA 3I05A 4QHTA 1O8CA 4N6GA 2F9MA 3MMNA 4AJEA 4RADA 4I08A 1YR8A 2DHRA 1JQJC 2TRSB 3GVIA 4FJ1A 5COAA 2ZRQA 3WNBA 2GEUA 4W5RA 2VT3A 2E55A 4Q02A 3LUFA 4QL3A 1IJFA 4FOLA 3UJ3X 4I3HA 4WJLA 2V9PA 2WHPA 2XNDA 4BWFB 2LIPA 4OQMA 4BAUA 1PWXA 2EJWA 4UBKA 3TNLA 1Z39A 3TXXA 1CQXA 1XRPA 3O1LA 2EVWX 4DCUA 2C7RA 1VE6A 3GELA 3LSTA 3O2QB 5EFZA 4LAFA 1O9BA 3QEMA 1P6QA 5AM5A 1JIXA 1ZL0A 3FZYA 5T8KC 4AKEA 5AHKA 4HWRA 2O4CA 4BKPA 1G8GA 4B6PA 2AB0A 4TV9A 5HIAA 4U2GA 2HDHA 1T26A 2JFBA 1UJ4A 2QN2A 4BQOA 1ECPA 4N0QA 4NR0A 2WWWA 1MENA 1DWPA 1MW9X 2IYXA 5F33A 3UMGA 1TLTA 1V11A 5DHRA 1G5PA 3WMEA 3SF8A 4S24A 5AVKA 5G41A 3ZE6A 2A8YA 2PIAA 5DNCA 2NTEA 1K97A 4BFTA 1YZHA 2AL7A 3M89A 5E6SB 4J1QA 1ISGA 4W99A 3GFRA 1IPHA 2R6DA 4M9UA 3LVQE 3DFMA 2QMYA 1ZIYA 1WDLA 3GJ8A 2ZBVA 5BV7A 3WHLA 1II9A 4UHEA 3RVLA 4CNBA 2PH3A 3N70A 5ICGA 4PLZA 3M6AA 5JXIA 5JJBA 4B3RB 2X6QA 3DBRB 2QAGB 4MI1A 4HOYA 1BMFD 4HUJA 3X2FA 4IW3B 2BDEA 2H54A 1SD2A 1W19A 2O8BA 1PF7E 4BTVA 4B1FA 1N5IA 4KHPB 1QF9A 5FXMA 2RIPA 3NOQA 1LNZA 5COQA 3DOIA 1R9MA 3G68A 4RLFA 1L7DA 2G5PA 4KK3A 3NNSA 4WBSA 3VDRA 3WLFA 1TEXA 2ZJFA 4NYJR 1YRAA 1VKRA 4ZRNA 2XTZA 4N5NA 5CURA 4Z0HO 3WKCA 2PSSA 3V8MA 4ZCIA 3EWSA 3EC2A 4MQ5A 1VE9A 2DFNA 2AOVA 1DIGA 4HYYA 5AD1A 2FW7A 4CDNA 1C7ZA 2HUPA 3UN1A 1Q7RA 3VPXA 4RUKA 3H7AA 1Z22A 5JS1A 2BV3A 4PPYA 1PQWA 2FFRA 2WWGA 3COZA 1UBUS 4Y3UA 1VL5A 1IZ8A 4RZQA 1R4NB 3U44B 1U6JA 4F11A 2V7UA 1JIUA 2Q99A 3IVGA 3KYJB 5HF6A 3ZZMA 5IM4A 3BCSA 3B9QA 1DFGA 5L6LB 2P67A 5A0TA 5CLLA 4MAMA 4XWKA 1DTSA 5JCOC 3DZCA 4BMDA 4UJ3A 3Q4GA 3RIMA 2CNNA 3RBVA 1KYYA 3D2CA 4CF5A 2O23A 3KT6A 4N18A 5JISA 1U0BB 2C5FA 2HIMA 2JK0A 1TUGA 4PHHA 4IIUA 1RAGA 1UPBA 3ZJYA 3MT0A 3R0XA 4QVKA 5DZSA 4F3CA 1JZQA 5D6NA 1R6TA 1DAFA 4BL5A 1DOHA 1A0OA 4BO2A 3WGQA 1OH8A 4LTMA 1OJLA 4YCSA 1T3ZA 4UHBA 1FQOA 4O1MA 2OAEA 3QTLA 5A6SA 1L7RA 2E89A 4KJXA 3ZNNA 4BFLA 1EUQA 2WKPA 3NIWA 4J3JA 1XVTA 3KHKA 4BBPA 4YPVA 3JQBA 1U2ZA 1FNSA 3FRJA 1X7YA 4TQUS 2EKQA 1NYRA 2IYUA 4FFBB 1P5ZB 1WXDA 3L05A 3QHPA 2HHHB 5AOCA 1HZZC 3K0FB 3TLXA 2DU8A 1NRWA 1NAIA 1Q17A 4IX1A 1YRWA 4IX9A 5DMHA 1BGWA 1XA3A 2ZI5A 3HL4A 3AVWA 3HLYA 3Q5DA 4LYYA 4YT5A 3ZLVA 5LQCA 3R24A 1EQUA 1L5YA 4E31A 1GAQA 2IXDA 3QU7A 4JJ6A 3DLIA 4JS0A 5HM8A 2V0GA 4J0HA 1HE3A 1KJYA 2BF4A 5ER9A 4YAEA 5KQLA 3NWPA 3S5UA 3V48A 3NHAA 1KC3A 4HL6A 1E2GA 2OV2A 2H4FA 2F3SA 3WQBA 3KAPA 1HM5A 2QP3A 1L8OA 2F8MA 5G1OA 1GLGA 1U3WA 3CLRD 4W82A 1H94A 3GUYA 4IV8A 3RVOA 2QBYA 3UYKA 5CXQA 2ZUEA 2UXDB 5I7RA 1IEXA 1EMDA 3N3BC 4LDQA 4BTLA 4E14A 4EHIA 1H5NA 5HKKD 2DF8A 2J0UB 4NMHA 1G60A 1MO6A 3GQBB 4QHYA 3O7MA 2HA0A 2FNAA 5CB4A 2BR4A 4GWKA 1XLUA 2A1TR 2P0AA 2EOAA 3KQYA 1E2IA 1U7PA 1T9HA 4HXFB 4DQXA 1HPLA 4OJQA 2DPMA 4F3KA 3E8XA 2RGCA 4OK5A 3OJWA 3W8EA 4A23A 3NHUA 4YMVA 1EZ4A 1A72A 2O7RA 2JLZA 2GM3A 3E03A 4MWCA 4CIBA 4C0LA 1PV1A 3WNZA 1FSGA 2DFDA 5CK4A 2BFPA 5ER6A 5JADA 3TRHA 3DCIA 3KKQA 3BTOA 3X2EA 4N5DA 1MR3F 4L5AA 2XAUA 5E7JA 4ZODA 2E2WA 3AHHA 4NEHB 3PQ7A 3NHRA 1RACA 1KE1A 2HLDD 2JGFA 2LP4Y 5AK5A 3VNVA 3L8EA 2QMOA 1FDOA 1TW2A 4L3VA 1FTGA 5GVRA 1U90A 1T24A 4RD3A 4WOPA 2H1WA 4XDGA 3IQGX 2A5YB 2J3QA 4ND1A 3K6SB 4OY3A 2CV1A 3O38A 1P18A 2OOKA 3PUKA 4RTQA 1GNPA 4QXPA 4X63A 3UJAA 1E0JA 1EWVA 2I65A 3E7XA 3UENA 1WZUA 2RGWA 5AXDA 4BNMA 4JY7A 1GTVA 4RA6B 1QO9A 3W5SA 3PE4A 3CRVA 1JBEA 1OX4A 1VJRA 4V3BA 5ENVA 3NP7A 4GX1A 4WFKA 5AKXA 5GGXA 521PA 2IL1A 4TLAA 3WKDA 1QYIA 2GZHA 3NWOA 3OZ7A 4EKGA 1KOGA 2AZ4A 2G1AA 2KWIA 1KTVA 3PC3A 4YJDA 1DVRA 4Z9FA 2FETA 2JEZA 3LUKA 1Y9AA 1A1SA 4EG3A 4O4IA 2ASVA 4G1BA 1Y8AA 1XCBA 5ECDA 4D4LA 1PLLA 1JR3E 1Y5RA 2FSGA 1DBRA 3IEXA 3JU3A 3P2JA 4RJKA 4G0ZA 1HNZB 4ALLA 5EVJA 5BUSA 3DUFB 4QWWA 4MWTA 2HPVA 4U7PB 4Z9AA 2P2DA 3KXKA 1RLMA 3BRSA 1M5TA 2HHJA 2H0RA 3LY7A 5DTRA 5JFOA 4MIKA 1JXAA 5IKPA 3UOWA 1ONPA 1PI3A 2J9XB 4C4ZA 1XU9A 1EX9A 3NAMA 4QNNA 3D02A 4ZAXA 3WFIA 4ECAA 2FQWA 4ZN6A 3GF4A 3KOYA 3MCTA 2PAAA 3H0CA 1JKIA 3SR3A 1S2GA 1T4MA 3DFKA 2F00A 3EAGA 4EJ0A 1TUIA 5AYVA 1E4VA 3CVOA 4IIVA 4ZYUA 4W1PA 1NKSA 5HDQA 3EVAA 1OYYA 3QXHA 2N1MA 3OIDA 4XGRA 1K1EA 2Y68A 2D0DA 4DXHA 4R9NA 4Y0VA 2IZ1A 3W8NA 2RHGB 4JBNA 2VHTA 3GFTA 3G2IA 1FYEA 4RD0A 1U6KA 1U04A 1DWOA 2HCRA 3CH7A 3P9YA 2GVNA 2PTHA 2IC5A 4I55F 1K4YA 2H63A 4KRYA 4ZOLF 3RRFA 4A8JC 4A36A 2FZWA 5FR2A 1EFCA 3L7LA 4MCAA 4CLRA 3NBAA 1RI3A 4MMZB 5LMNB 4A8TA 4YPOA 2REBA 1OILA 1ZH6A 3DT6A 4DY6A 1UC4B 4FZ5A 4KEAA 3HKEA 4TKUA 4JI5B 1SKAA 4F71A 1NXWA 4CTNA 4LWZA 1JR3A 3S28A 4LHWA 4WUTA 5JEDA 2LIVA 5E3JA 3ZIUA 3EEIA 3X1JA 1FCJA 2DWPA 1MABA 1L5GB 2JIDA 1R1DA 2DPLA 2PYDA 4TWAA 4UD2A 2JLXA 3IT3A 3OLZA 3P9QA 3C3CA 5EIWA 3F96A 4MKFA 4PO3X 2OA0A 3RI3A 3ZQKA 3AZQA 4DCMA 1N78A 4E70A 3JD4A 3U7GA 4TLMB 3NZEA 3PFGA 3I28A 3K53A 3N0XA 5FPSA 1UXKA 1VPDA 3M6UA 3OSZA 3QWBA 4FHDA 4URWR 5K45A 4B4OA 3EA5A 1QRDA 4NAUA 3W8DA 5BOSA 4B75A 1E6KA 5K0CA 3RV4A 5CFOA 4JI8B 4YCDA 4AKHA 4FZJA 3MFQA 4ZZ1A 3DEZA 3H5AA 3W05A 1JI0A 1C30B 3NOOA 4EPTA 4YAIA 1QG4A 2A9KA 2BGKA 3WMWA 2CDRA 3AI7A 2BW0A 1PZHA 1QS0B 5ESDA 3Q9NA 3MBOA 3QEOA 3VYWA 3SG0A 2GI4A 1PJ8A 2YH2A 3T1NA 4TXJA 3H4TA 1WCWA 1Z8DA 4AIRA 1RLJA 4Z9XA 4K7JA 3MTBA 4Y0AA 4H7HA 3M34A 1NVKA 2C9YA 1LKZA 2QLNA 1AZSC 3AW9A 4LX8A 5HJ7A 5L4SA 4ON9A 4WZ6A 2N0SA 4W8HA 3QLVA 3DTTA 4JEUA 4ZEVA 5JH7B 1ILWA 1Z5NA 4KX5A 4I46A 3BBPA 3QUCA 1CLEA 4P83A 4BQPA 4R8VA 2GM5A 3QIAA 3PNPA 4N5MA 5YASA 5KTMA 1E2FA 2VQ6A 3JCZA 4C0AC 1PKEA 4D3XA 4XTRA 2WV9A 2BI8A 2XWQA 5ABPA 4TL6A 3N53A 4A16A 1VHQA 1G5FA 1QBKC 2A3RA 2I6UA 3BE8A 1XF1A 2ZRJA 4CF6A 5GJCA 1GD1O 4B9AA 4XYLA 1B8NA 2BEWA 3GMIA 1HZZA 3H17A 1GCGA 1TK9A 4ZT2A 3GRAA 3K09C 2JFVA 1JH8A 2CC2A 4AG3A 1AK2A 1V9CA 4ITUA 2DWCA 4Z0NA 2BPOA 2DUNA 821PA 3LQ1A 3A6DA 1PT9A 4PZUA 1UMCB 3LSYA 5HILA 4JYZA 4GOND 2Z2IA 5AJHA 1QR6A 4FWBA 3OX2A 3VDMA 1JMYA 1O87A 1WNTA 3CF6R 2HX1A 4U63A 4MUBA 2P27A 3HM2A 5DHUA 3G2MA 3ZGYA 5BNTA 4D56A 2J3MA 4Q4HB 4XA8A 2BCGY 1OYVA 1YVDA 3AG5A 2WPDD 4GG1A 2HEGA 3IDFA 2GPTA 5FTLA 3QU2A 2Q0HA 3SM9A 3GEHA 1JZTA 2BC9A 1E3EA 2DLDA 2IUYA 3RC9A 2YNMD 3EFOB 5HS4A 3F8SA 4BFYA 1B23P 2QLBA 3KQPA 1A2OA 4FX5A 4Y2PA 4B82A 1CUSA 3V4OA 3QE9Y 4YFVA 1XP8A 3LBAA 3SLGA 1P9RA 4Z8YA 5DLDA 4PZZA 1GTG1 1DKUA 2AJTA 4G5SA 4PSDA 2DH5A 2PSFA 3CZRA 3N8NA 2KBFA 5GM2A 5T64A 4DDVA 4YJKA 3JAKA 2J5KA 2PFKA 1SQ5A 1KFCB 2I66A 1N2IA 1NM5C 2RI0A 3REGA 3ME5A 3QFRA 1LW7A 4FYKA 3PFIA 4WTOA 2F17A 3R7SA 5JALA 2NAPA 2BEKA 1IWOA 3HWWA 4J2OA 4O0MA 3QKTA 1RWNA 1TO2E 2ZSDA 2P9ZA 4MEBA 2Q7XA 5H02A 1XYVA 1VM6A 3MJDA 3ROMA 4EUSA 5IRCD 1P5HA 1SCJA 4AULA 3BILA 3LK6A 5DVZA 1RRCA 1WD5A 4AIIA 1TZMA 2CMHA 3PA6A 2PKCA 2Q45A 2ZK7A 5IW8A 3A06A 2NPFA 3TVTA 4E3WA 4X0EA 5K3EA 2AR7A 3UT5A 4ZI7A 4MR8A 1GKUB 3U9SA 5B37A 1WMAA 4D43A 3JW8A 1XROA 1WABA 1SXHA 3GLRA 4ESEA 1HYEA 1OKKA 2AUNA 3CGWA 4NF2A 4P3OA 2V4ZA 1AO3A 4CV0A 3VKGA 5I9LA 3IQFA 3KV3O 4ID9A 1M7GA 2FX2A 3GRYA 1NOKA 4H31A 5LC1A 4J8PA 3F5FA 2P4SA 4TMVA 3RC2A 1TZ2A 3C48A 1M0TA 1JHYA 4KBFA 5GADl 1X8XA 2CUTA 1G8FA 3KFXA 4IMJB 4I66A 1KI1A 1DFHA 2YYSA 3K1AB 3IAHA 1ABFA 1G8AA 3P71T 3TSYA 1KZGB 2GMWA 2VZLA 1OH7A 5ALDA 1H2EA 1W85A 2CZGA 1CZKA 1Z29A 3HV2A 4QE3A 2O0KA 4CN9A 3DLHA 1H9CA 1H1DA 3ST7A 1RC8A 5FI0B 2BSXA 3QVSA 3LUGA 3MWDA 4LV8B 1KRWA 4PLGA 3V2IA 1EFRA 1P1RA 3MUEA 2AN3A 3FDIA 3ABQB 4EZIA 3QI7A 4YDHB 1JG4A 1X7ZB 4QBTA 4ZVQA 3REFA 4XPIB 1P2BA 2QXTA 3ZY2A 1N1DA 1NIJA 1D6MA 2DSTA 1J8DA 3A36A 2VDPB 5AI5A 2ZBQA 4CT4B 1FW8A 1R5OA 3HY3A 2R8OA 2A1IA 1B8OA 2GPNA 1IY9A 2DKOA 4LY9A 1VI2A 4GE0A 5FLYA 1XZQA 3RFXA 5CFRA 1T4DA 3BZWA 5JY1A 1MZVA 1EUCA 4DNXA 2FY8A 3L0IB 1EQ2A 1QC5B 4PX5A 1GNTA 3HDYA 4HT3B 4ZEWA 5LMUB 4EYOA 1E7WA 3A14A 3H87A 4YMSA 2W2KA 5CU7A 2WOJA 4A73A 1YQDA 2PLWA 1PVDA 4S35A 1UXIA 3LGAA 4YASA 5I9MA 4J16A 2IFTA 1XRLA 2WSYB 3NJ8A 4J0GA 3G2KA 2AN1A 4W5OA 5FD8A 1YE3A 1AGXA 1E7YA 1PFGA 2IPNA 3BJEA 4JB2A 3OFND 5HW0A 3MWLA 3MWEB 3PWKA 3CLUC 1WL8A 1U9ZA 3OCUA 4OHCA 3UH1A 1V35A 3GNSA 3KU1A 4PPFA 4QXAA 3ZPXA 2BHSA 2I7CA 2YHSA 3D0QA 3NV7A 2IIQA 3HWSA 1JDJA 2A33A 4Z3DA 2RKBA 3BYZA 4P7BA 1YZYA 3FPKA 5C51B 1L1RA 3GDHA 3SYNA 5JLJA 4YCAA 2NX2A 2LW7A 1VJGA 5JYBA 4N48A 4R0VA 2NXJA 2Q07A 4R68A 3K70B 4Q9IA 2Z56A 2AW5A 2QD5A 4LRWA 4AS3A 5F2NA 1FDRA 1YR2A 1B0PA 1H3FA 1SU6A 1GDHA 4YIKA 5TNXA 4FYVA 3SHQA 1E1RD 1DUVG 1CUJA 4M37A 3QA3E 4IOMA 3RIGA 4YH1A 3QEBZ 1XTKA 2L2QA 4I3FA 3AESB 4CM6A 2F43B 1ZIOA 1CEXA 1F38A 1E1CB 2QAGC 3L8FA 5AIAA 1TVKA 4RKEA 3LPAA 2ZSKA 4TWRA 3X2SA 2XNHA 1ZN8A 5FB3A 1G20B 5AVRA 3Q1KA 1RQGA 3T3MB 1F8UA 3E0XA 3ND5A 4HDSA 1VZ3A 1KAOA 4HDAA 4B4WA 5KQGA 3MK31 2JJ1D 4IILA 2P62A 2HCJB 2ZVQX 4O2BB 2UYQA 2A1UA 3VJLA 2J0QA 3RHTA 5KX5B 1ADCA 1QQAA 4KFSA 4G0MA 1J0EA 4J0FA 4WOCA 2PUFA 2SBTA 4JB0A 1L5HA 4M8KA 4BVFA 1F3OA 4H1TA 2XAAA 3L8HA 2OZEA 2W43A 4H1VA 5I9SA 1MEEA 1Z83A 1SG9A 3GLIE 4AY2A 3G0CA 2JHAA 3ZK8A 1UAYA 1FVOA 1C8LA 1PR6A 3MQFA 3IXQA 5K3BA 3ZNPA 2PLRA 4YV1A 3PU6A 4Q9LA 1NI4A 2GD2A 3E27A 4B45A 2DETA 3E5MA 1M74A 1AV7A 4M8SA 3VR0A 1GAJA 3B53X 3H99A 1T43A 3E2IA 4P33A 2I6QA 3HKCB 1VKNA 3U3OA 5KYGA 3IQWA 3F73A 1YCFA 2FAXA 1SKQA 5KYYB 4X66B 1OTXA 2YHAA 3M2PA 2HR1A 2JFOA 3WDLA 1DKPA 3GLQA 4S0ZA 4U3JB 5IK2A 1YVEI 4B9EA 2CLHB 1SH7A 3L7JA 1IQ0A 3QX7A 4DLVA 3TBFA 2NQ2C 1DB3A 1FJXA 4LJSA 4REQA 3SSAA 4N82A 2CLEB 1RJFA 2CVFA 4W9NC 3KJQA 4K9NA 4MW5A 2GF2A 3Q9SA 1CTQA 3RJMA 2MYTA 4TTQA 5HCIA 3TLAA 1FPQA 1NP7A 3DMNA 4K8RB 4RACA 4R69A 4UTRA 5CCXA 1C9EA 1U8XX 4X93A 1WUHS 3K15A 2ZTLA 4Y7CA 1ZH2A 3VZRA 1J1IA 2EXXA 3HY4A 4CMHA 5K99A 1XX6A 5HK8A 4MVJG 2ES4A 3CE6A 4J29A 2WVGA 1RM5A 4HQNA 1IBRA 1ZJ5A 1AHIA 3AKYA 1T36A 3L93A 4DA0A 4NOLA 1CFZA 4LYFA 1AKTA 3HRKA 3IURA 5FBHA 3MYYA 2RI1A 1BDHA 3KR9A 4OYRA 1OBVA 3CO0S 4C20A 1LS6A 3GH3A 4ZV7A 3WSWA 5FAKA 2BGWA 4BEWA 1OTYA 2IRWA 2OD2A 4WRRA 1QYVA