2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
molecule keywords PTERIDINE REDUCTASE
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
1C1XA 2C2XA 2Q1UA 3V2HA 3I3OA 3TL2A 4E0BA 5BR7A 3U3XA 2B5VA 2BFMA 3JD2A 3PHGA 1DFHA 5CG2A 5ICSA 4E21A 3RC2A 3BMCB 4UVDA 3GVPA 5CDTA 4FIZA 2Y93A 1K89A 2Y1FA 3OICA 4OOEA 1OFGA 2RBEA 4UEJA 5DCWA 4FFMA 1I5RA 4XYBA 5AXCA 1WWKA 2EXXA 5DZSA 1T2CA 2ZATA 5JMWA 3K6JA 1SOVA 6ADHA 1E7RA 3FR7A 1A4IA 2WYVA 4GAEA 4J90A 3ZI0A 2CUKA 1ZZEA 5JDCA 3WSWA 1GUZA 1I32A 4XZ3A 3V5NA 4WEOA 3PGXA 3DXFA 1F17A 2HU2A 4PG7A 3RC7A 4B3IA 1G0OA 3DO5A 2Y0CA 1P9LA 4UREA 4TRMA 5ENVA 1QMGA 4DIFA 4GSLA 4RPGA 4TZTA 1PSDA 4EEZA 1C1XB 1MFZA 2AW5A 4WASA 1NAIA 3LK7A 1Z75A 3ABIA 4FFPA 1U8FO 4LVCA 4YAKA 1GZ6A 3WICA 1YWGO 1UP4A 2J5KA 4BO3A 1L7DA 2WYUA 3JQFC 3C1OA 4R5HA 3RFVA 1VKOA 2JAHA 2WWRA 5CDUA 4IQGA 2NVWA 1FDWA 3ANLA 2BFAA 3DAFA 2BMAA 3KZVA 3IL2A 1BXGA 3H5RA 1N92A 3KLMX 3L4BC 4E4YA 4FB5A 1ENPA 1GY8A 4HY3A 5MDHA 3HDYA 3PFWO 3VAZA 4U6QA 1ONOA 4B7UA 1RYEA 3ULKA 4FSHA 5C37A 2Y0EA 4RDHA 2IEBA 1NPYA 3JQ8A 4IXTA 4BGUA 2WTBA 1KERA 1I3LA 3WBBA 3NRCA 2O7QA 4MIEA 3PLRA 3WGQA 4YPOA 2GZ1A 3D0OA 1UR5A 3WS7A 2B69A 3G1TA 3QP9A 4MP8A 2QRLA 1I0ZA 2IZ0A 5T5QA 2J3JA 3I1JA 1M6WA 3RFTA 4AJ4A 4Z6KA 4AJ1A 3Q9UA 1Z7EA 5JAQA 3RKRA 3TZKA 4CM8A 4Z0HO 5BSFA 2GYYA 5KVCA 2YFQA 1P31A 1ONPA 3OSUA 3ZU5A 4BNNA 2QX7A 5HA5A 4LW8A 4L74A 2NACA 4YT5A 3BMQA 4TZKA 3ANNA 3FNFA 3PRJA 3GVHA 4AJJA 3UKOA 2P91A 1I36A 5B37A 1HYGA 4OGWA 4U7WA 1MC5A 1IHXA 2VWGA 2FMUA 3I9JA 2C82A 2FR0A 4LK3A 5LDGA 4XQ9A 1LSSA 2HJSA 4XX0A 3TZ6A 3CINA 1NQ5A 4NJOA 1YQDA 3FHLA 1DFGA 3H9QA 4CQMA 1UDAA 3PYMA 1DIAA 2OL4A 2IYOA 4WCDA 3WQQA 4GSKA 1X15A 5LC1A 3PPIA 4Q3NA 4OQZA 2BFOA 2VYVA 4TMFA 4I9NA 2C29D 1JKIA 1MFPA 3K8ZA 4PVCA 4EW6A 2GF2A 1D4FA 5GMOA 1Z45A 2X0NA 4KQXA 3QSGA 4CLRB 2P5YA 1EK5A 3SBOA 2CDBA 3WGGA 4YAGA 4GQAA 5CG1A 5L51A 4DC1A 4J16A 4QFDA 3O8QB 3O4RA 3PGJA 1Z73A 4ZQEA 5GY7A 3F4BA 3QLJA 2OO5A 5JC8A 4J3FA 4XWYA 4W9NA 1NR7A 3VDQA 2B36A 2I66A 2PZMA 1H5QA 5HWSA 1DHRA 2OORA 4FDAA 4HNHA 1YE3A 3HB5X 1RWBA 3F9IA 1UXIA 1B7GO 3E9QA 3ROMA 1YBMA 2DQ4A 2Y66A 3QWBA 5HS4A 3LDHA 3I6IA 5KWEA 2Q1WA 3V8BA 2POQX 1NFFA 5L4NA 5T67A 3TRIA 3CKYA 1QV6A 3JQ9C 5IDXA 1QR6A 1H2HA 3PYLA 3WR5A 3WFIA 2RHCA 4O0LA 1PJ4A 2HMTA 2VUSA 3EVNA 3OJ0A 3ZU2A 1ISFA 2CD9A 5B4VA 1TI7A 3D64A 1J49A 1ZEJA 4JJFA 3L9XA 4GH5A 3M1LA 4NDNE 4PVDA 1U4OA 2J8ZA 4WLUA 2B37A 2Q45A 4ND4A 4E30A 2C7VA 5G0WA 1U3WA 2DLDA 5IAAA 1HT0A 1GL3A 3IP3A 2QIOA 2A92A 1LUAA 5CAEA 2PWZA 2NVUA 3QE3A 1QORA 4RJTA 2O7SA 3DEYX 4B7CA 3VKVA 4XDYA 4CMJA 4J49A 1R37A 1T2AA 5KJ1A 1SB8A 2AQKA 2PZLA 4TVBA 1ZSNA 4GL4A 1U28A 4E31A 2ZTUA 4U0JA 3AI2A 3OM9A 3DBHA 3WLEA 1NWHA 3LLVA 2D3TA 4Z0TA 2A4KA 1AUPA 4Z3KA 2PKQO 4DMMA 1Q7CA 2XXBA 1O6ZA 4W6ZA 1GDHA 1ML3A 2VCYA 3DMTC 3I5MA 3U4IA 3F5QA 5DCYA 1GV0A 1PGNA 1YOVA 2YZ7A 3EY4A 3FNEA 2X58A 2D5AA 4O5OA 4XYMA 4YACA 3PFFA 5ENDA 4BKPA 1NR1A 4MVJG 2QG4A 4IDEA 4FC6A 4QSMA 3RUCA 2ZYDA 4BS9A 4CLDA 3INRA 2YV3A 3K2EA 4DLAA 1PL8A 3KYBA 4NIMA 1C0LA 1ENOA 3HE3A 2NVUB 5AXAA 4I5FA 1GEEA 4CUZA 4EJMA 1LDBA 4R41A 1T2DA 2FSVA 4PGFA 2H5LA 4WNCA 3GHYA 1B3BA 4ALMA 3K96A 3DHEA 5LCXA 5JSFA 4LSMA 1DFIA 4UEOA 1IUKA 3E48A 4R9SA 2PA3A 5KKCA 3PYXA 1B8VA 1R4NB 1V8BA 2HKIA 4CQLB 4RZIA 3V1TC 3Q11A 4PG4A 4A0SA 4YCAA 4BNZA 3AY3A 3U62A 1UJMA 3C1AA 4Y6PA 4R5MA 4EITA 1D3AA 1EEHA 1M2WA 2QQ5A 3AI1A 4AG3A 4FOOA 4YAIA 5KJ6A 2P68A 4IS2A 3QWIA 1S7CA 2CY0A 1W8DA 4IMPA 3UW3A 2CZCA 4NMHA 3L6EA 4K28A 3RBVA 3OH8A 4YQYA 3WGZA 1ISHA 3NDRA 3H3FA 3KBOA 1UDBA 3GFBA 1CWUA 1LDGA 3RC1A 5JO0A 4KZPA 2LDXA 4FPXA 1YBAA 1I01A 2V7PA 3PDUA 4EDFA 1LQTA 4ZN6A 2O2SA 4JP2A 1H6AA 4Y98A 2JFGA 4CLHA 4R1NA 3CZMA 3FD8A 1J4AA 1Q1NA 1YH3A 3ENKA 3UOGA 5DULA 2E82A 5HRUA 2RAFA 3HDQA 4WE3A 4MO2A 1EFLA 3JQCA 4WOKA 4CMGA 4MDHA 4J2OA 3BXXA 4F6CA 4YR9A 2FPPA 1R6DA 3OFSA 1XIVA 4EJ6A 1NQTA 5BNIA 2UV8A 3HDJA 4BMSA 1D8AA 3AY7A 4DL9A 2QW8A 4PRKA 1U3TA 3AOEA 4FBGA 1U3VA 1V9LA 3LLSA 1A7KA 2I3AA 2YDYA 4NPCA 3GFGA 6LDHA 4WK6A 3GEDA 5TIIA 4FW8A 4WECA 2RCYA 1ADFA 4D79A 4EYEA 3GPDG 5FF9A 1X14A 2ZJ1A 5C7IO 1PJSA 4CJXA 3PWKA 2X6TA 2EW8A 2DFDA 4UVGA 5T6BA 1E3SA 3H9EO 3LZ6A 3TQHA 4HNGA 5ADHA 2X9VA 5ILOA 5JPIA 5F21A 1IB6A 1LRJA 1XA0A 2QYSA 3NDJA 4MIOA 3AY6A 4PLPA 2HMWA 2W2KA 4MJLA 4N5LA 3BTOA 3KSZO 3ENNA 1NTOA 3G3EA 5IZCC 3P7MA 4GLOA 4HFNA 3SLKA 3NJ8A 3RUAA 1SZJG 1KVTA 3TZCA 4CODB 3ZHZA 3ZWBA 3AOGA 1ZXBA 2ET6A 5DT9A 1T2EA 1NXQA 3DZHA 3ZWOA 2VNSA 3O38A 1UZNA 2E4AA 5LDHA 2Q99A 3UICA 3EZLA 1SOWA 3AK4A 2RIRA 3BHJA 2IYPA 1EQUA 4RF4A 1WZEA 5KJCA 4CM3A 4ZRMA 1DLJA 1YXMA 5FEUA 4DQVA 3WTBA 1CDOA 1U5CA 2YUTA 5L95A 5JC1A 4Q3EA 2Q2QA 4D3FA 2B4QA 3W6UA 2PFGA 3TPCA 4IJVA 1PL6A 2YYYA 3H7AA 3GLQA 3HFGA 1Z6ZA 3EHEA 1PJLA 5T8KC 1N1GA 2P9EA 3TF5A 1DAOA 1WVGA 1PU2A 2UYYA 3AU9A 2O23A 4BNWA 2DFVA 2AG8A 3Q2IA 2ZCUA 4U0KA 2HCTA 1V0JA 5JO9A 2E48A 3ROQA 4FJ2A 3HUDA 1QYWA 1BRMA 2GUGA 3GHHA 4PLFA 4Q9NA 2IE0A 1Q7BA 2X23A 3TSCA 5C5IA 5A02A 2OFPA 3AM4A 1E1NA 4TWRA 3WJAA 1XYGA 5L9AA 1LLDA 1O5IA 3QWHA 3S2GA 4IJKA 2W2LA 4NJMA 4JIGA 4B8WA 1PJ2A 1WP4A 4RVSA 1DIGA 3WIDA 2GZ2A 1O89A 5G4KB 1B8UA 3K9QO 1ENYA 1A72A 5JCJD 4IPTA 5EQFA 3WQRA 1QKIA 1GQQA 1UXKA 1QG6A 3JQ6A 5JAZA 4MIYA 4UEKA 1MUUA 3ITDA 4WLEA 2HMSA 4BO4A 2Y67A 3E8XA 5EL0A 1QLJA 1FDSA 3DBRB 3ROPA 4E5KA 4EEXA 3PHHA 4OIMA 8ADHA 2CSUA 4XR9A 1GFSA 1XQ1A 1GUYA 4G81A 5THKA 2AMFA 3ORFA 5TSDA 2GSDA 4ALIA 1DHTA 4ZA2A 3VH2A 4J1QA 4MPDA 5I9MA 1EDOA 2HMVA 5KJFA 2ZTLA 3GY0A 1BW9B 3ICPA 1BXZA 3PIIA 4A2CA 4F6LA 3NEPX 3UH1A 4HUJA 5IDWA 2VWQA 3RU7A 5TRTA 5AVOA 3BA1A 3OJOA 4RO0A 5TT1A 2PZKA 3ZHBA 1XSEA 4EUHA 3F47A 1QV7A 4OAQA 4YT2A 5DN9A 2R00C 1GCUA 2B4RO 1UZLA 1YKFA 4PLCA 2VT3A 4DA9A 2HUNA 4CLXA 2EP5A 3NV9A 4J4TA 1X7GA 5JE8A 2EKQA 1AXEA 2Y1GA 5CFZA 3AM3A 2JCXA 3ZNNA 1ZK0A 1U2GA 4J1TA 4OSOA 4CR6A 4M89A 4OKIA 2VHYA 3JQAA 5DDIP 5A9RA 2J3KA 4WCFA 2JCVA 1PJCA 4NQZA 4O59O 4XIJA 2VQ3A 4GGOA 1DRVA 5G0VA 4Z9FA 3CEAA 1VI2A 1U5AA 4DRYA 3RC9A 1BXKA 3TJRA 5COBA 1FJHA 3DR3A 1R66A 3GGPA 1CERA 2WEKA 3GA0A 4FR5A 4CMKA 1RM4A 4FGWA 3GEMA 3OETA 1O8CA 3ZN2A 3GK3A 5B4TA 3AUAA 1GR0A 3RKUA 1V3TA 4FC7A 2E49A 2I67A 4F46A 3OEWA 1PWZA 1YL7A 1IYZA 1K6JA 3EAGA 4MKXA 1DC4A 2FPIA 2UUPA 3WWZA 1HTBA 4MKZA 3V2GA 3FBGA 4E5MA 4NI5A 5A3VA 4XGNA 3EC7A 3ZWXA 4DLBA 1SMKA 5EESA 4XYLA 1MV8A 1PZGA 3B70A 1HWYA 5F3RA 4CMIA 4JBGA 3TFQA 4BKRA 1Z74A 3PTZA 4WCFB 3SC4A 9LDBA 2VYNA 1AXGA 1P3DA 1PJ3A 3KUXA 1ZH8A 3LT0A 2X5KO 3ZWWA 1RM3A 3RVDA 1BMDA 4JROA 3GRKA 3ZV4A 1XLTA 1B15A 2XF8A 3ASVA 1YQGA 3R6DA 3P19A 2ZTMA 1TT5B 4ID9A 3TZHA 9LDTA 2B35A 2YJZA 3Q6IA 3R3JA 2P4QA 1Y8QA 1U8XX 2BHLA 3IKVA 4JX8A 5A06A 5AQ1A 4IBOA 1PGQA 4IQ0A 1AN9A 1LLCA 2BKAA 3JD3A 4I9HA 4RPHA 4W99A 2H63A 3RUIA 1NPDA 4RQTA 1GYRA 4IM7A 1XU7A 2YHIB 2J3IA 3O26A 1EBFA 5TT0A 2R2GA 2B83A 3PHJA 2FSSA 3KYDB 1B8PA 2WE7A 1ENZA 2IDZA 4LGVA 1OC4A 4I5GA 4K6CA 4NR0A 1QXSA 4R3WA 4XGIA 3WMXA 2JFHA 5COQA 2Q2WA 1PR3A 4CV0A 5B4UA 2G0TA 2VHWA 4YJHB 1QYCA 3KRTA 2YDXA 2ZCVA 1YDWA 4J43A 4QUKA 3V1YA 1KBZA 4B4UA 3EVTA 4DTIA 2GASA 4RL6A 3JQBC 1UZMA 2O50A 4R1TA 4EBFA 4OM8A 1C0KA 3JQFA 5IG2A 1P0FA 2YFHA 3E5MA 3X2EA 4MP6A 1KYQA 2DAPA 4RCVA 5U9CA 5BNTA 1E77A 2GNAA 3L4BA 1ZKMA 1V35A 4KWIA 2EHDA 3HFSA 1NASA 3TOXA 1MX3A 5DBGA 1V3VA 1NVMB 3HDHA 4CM9A 3KLPX 3OEYA 3L9WA 1U1IA 1YB5A 2X9NA 1RM0A 2W90A 1BDMA 3VPFA 1P44A 1QYXA 2J5RA 2VTDA 2OBNA 3QIVA 3IUPA 3P5SA 1ZIDA 4GGPA 1SAYA 5HBRA 5F1KA 4NH4A 1E6EA 2GN6A 4NBVA 1VC2A 4KTVE 1A4UA 2B4TO 4HBGA 1GZ3A 3GVIA 3ETGA 2CFCA 5ES3A 4IGFA 3LC1O 4FJ1A 3IAHA 1ZCJA 4ILKA 1I3KA 2C59A 2ZB3A 5IZ4A 1O0SA 4E2YA 1NQAO 1HRDA 1LQUA 2JFFA 3K5PA 2DBVO 1JTVA 3FCOA 4A5OA 3I23A 3C3XA 3ZWCA 2VUUA 1VLLA 1HDCA 4L73A 4HX5A 4AJLA 3ZW8A 2HJRA 1MXFA 2X86A 4HADA 4N5NA 1CF2O 2O4CA 4K26A 1J6UA 2DPHA 2V6MA 4A7PA 4E5YA 3PDJA 1TA4A 1E1KA 3WJ7A 5I8ZA 1WDMA 4DREA 1HYEA 7ADHA 3HWRA 4OL9A 1ISJA 3W8EA 4AICA 3I83A 4NFSA 5BSEA 1Q0QA 1XQ6A 4YJFA 3DHYA 1OMOA 2AG5A 5BSGA 3Q0EA 3B1FA 1DXYA 5DCUA 1FK8A 1PTJA 5TC4A 1Q0LA 5TLSA 3F1LA 4HFRA 1I30A 2X7HA 3SLGA 4DWVA 1GZ4A 3OA2A 3ZWPA 4UVHA 1E0DA 4Q39A 3V1UA 1HSOA 1FXSA 2YV2A 3C7AA 4D3SA 3OIFA 1XGKA 4J7UA 5KVSA 3PQDA 2GDZA 2SCUA 3INGA 2VRBA 3FI9A 4G65A 1YRLA 5JY6A 1EFKA 1LLUA 3N7UA 4CM6A 3IJRA 5F1OA 1Z82A 3FRJA 1BXGB 1IY8A 3DTYA 3MJCA 1R4MA 4IDAA 4ND5A 4OMUA 4JN6B 4QO8A 2Q1SA 4ZVVA 3KM0A 3VOSA 4C7JA 5TJ9A 3DOOA 1PGJA 2X5OA 4I8XA 4P8RA 4GWKA 4XQEA 2I65A 2XXJA 4C7KA 1KS9A 2CVZA 5JCXA 5I7EA 4PLGA 1NBOA 3MWDB 1R16A 4L9RA 2IXAA 5CP8A 1JWAB 3HNPA 5EIOA 5EPOA 2V6GA 1JW9B 1PQWA 3JQ8B 3GUYA 1LC0A 4JCOA 3JQ9A 4IIVA 5K6AA 3JYQA 3RAJA 5DNAA 3KYCA 3WDSA 3WLFA 2JD2A 3H65A 4UUOA 1WPQA 1GV1A 4YXFA 4NFHA 4PLTA 2CDCA 3HB4X 1E3WA 3WQSB 2NWQA 4CM8B 4N18A 1I33A 2F00A 1YJQA 1KEWA 2BH9A 1DO8A 2CF6A 1GQ2A 2OUIA 2WM3A 5FFFA 4J0EA 5IN5A 3T7EA 4NK5A 5BQFA 4CL3A 1C0PA 2Y05A 3BMQB 4JLWA 5TJHA 5ICMA 4H16A 3ZHYA 5IF3A 2O3UA 5K9ZA 3PJEA 3JD4A 4D43A 1PGPA 2GR9A 1F8FA 4HP8A 1B0AA 2B5WA 2EJWA 3S2FA 5KNLA 4MVJA 1HF3A 1T1SA 3GMSA 3E9NA 4OYRA 3WGOA 5JNLA 4CQMB 3EMKA 4JJIA 4KUGA 4DPMA 3LC7O 4TKMA 2D5CA 4BB6A 2GD1O 2ZKLA 1LSOA 3PWZA 1E3WB 2XOXA 3COSA 5A9SA 4BO6A 1XWFA 3TN7A 4ONEA 1HDGO 4J4BA 1R15A 1BTOA 3G17A 4F45A 1XKQA 2NV6A 1JVBA 2W8ZA 3B6ZA 2OGUA 4N7RA 4E12A 1GUFA 3K73O 2EG9A 4AVYA 5KTKA 1JN0A 3BYZA 4QXMA 3RU9A 4AJKA 2DBQA 1PS0A 3RIHA 4BGEA 2G82A 2RHRA 3BMNA 5A04A 3DZFA 4PG5A 3QWAA 4ND2A 4ND3A 5L53A 1J0XO 4RPKA 4XIYA 4NU5A 1HLPA 4Q3CA 1JQBA 1R12A 2HRZA 3RCBA 2VRCA 4LN1A 2BGKA 3H6KA 1E1MA 3ON5A 5KOIA 2NTNA 3CXRA 2PD6A 2PY6A 4J9VA 4UUNA 3MJEA 1DIRA 4UVIA 4TVOA 3KHUA 3IIEA 1YL5A 3GN1A 2VYND 1HE3A 3WTCA 1GU7A 3ICCA 3EUWA 1U4SA 3F46A 1NM5A 2BD0A 1XDWA 4CMEA 2E6UX 3HSKA 4YJGA 3ZNOA 5F5LA 1HDXA 4YRDA 3SJ7A 2ZB7A 1BGVA 4GI2A 1RYDA 3Q1LA 4MOWA 1X0VA 1GADO 3UGKA 5TGDA 3GEGA 3NKLA 4JNKA 4R01A 2JKVA 4WNIA 2VNAA 2D0IA 1BWSA 1F8GA 2C5AA 1K5HA 1YO6A 5CPBA 3S2IA 3TL3A 5IFLA 2WMDA 2Q3EA 1EDZA 4Y8VA 4XKJA 1TLTA 4UUPA 3VH4A 4BKQA 5L40A 3GR6A 4E5NA 5HM8A 3M2PA 4WLVA 3DBHB 4INAA 2VWPA 3KEOA 1LSUA 4P4GA 3QWFA 3A9WA 4W4TA 2D59A 4ROSA 4ZHSA 3D3WA 1VJTA 1Q7GA 1ZUD1 2WDZA 1OAAA 4HFMA 5H82A 3WYCA 1YOVB 1KVUA 3FTNA 3H9UA 4BUCA 4HFJA 3M6IA 2BFPA 3FN4A 4Y9DA 3UVEA 1W73A 1KVSA 1UDCA 3HN7A 1E1LA 2UVDA 3PXXA 2FP4A 5L4SA 2Q46A 5FI3A 5AYVA 3I9OA 3I9MA 3UUWA 2J6IA 4BOYA 3BTVA 4S1VA 4E33A 5DOVA 3ZWMA 5IXSA 2CMDA 1PJBA 4XD2A 3ITKA 1JVSA 2GGSA 3AW9A 4KOAA 3M1AA 3MOIA 3OMLA 2AQIA 3UN1A 3HJAA 1DIBA 3JYOA 1E3EA 2EP7A 1X7DA 1WLYA 3LU1A 2C5EA 3DZIA 2WD7A 3DWFA 5KVVA 5IZCA 1EUDA 3C7DB 2NM0A 1X13A 3BTSA 3E6AA 4LMPA 2VZ8A 3KOUA 4HKTA 2V65A 1HXHA 4M87A 3WNVA 2X0JA 1HL3A 1KETA 3UHAA 4CM7A 4RDIA 2EKLA 3ONFA 2NADA 3DBVO 3VZSA 1KY4A 2AE1A 4R51A 3OHSX 3D5QA 4IXWA 4JXKA 3I4CA 3QJ5A 3GGGA 2GLXA 5BSHA 5JYDA 4B4WA 1ORRA 1F0YA 2GPTA 3JTMA 3M2TA 4GVXA 1YB4A 3H9JA 5G2OA 3U49A 5JFOA 2YHUA 1F06A 4PFJA 1E5QA 2PGLA 1Y81A 4IDFA 3I9LA 3FR8A 4YDRA 3PZRA 5IXYA 4OOFA 5T8KA 3K31A 4BNHA 1CQJA 3F6YA 5A4DA 2GN4A 4JBIA 1P1IA 3C8MA 2W98A 1UXHA 2BELA 4DYDA 4RVFA 1GYPA 2PTGA 3FSRA 1GTMA 1ZSYA 3ZCXA 2C07A 5TF4A 2X22A 1PGOA 3PVZA 3CH6A 5DBFA 3SEFA 4BHTA 4W7IA 5G0TA 3NTRA 4BKUA 4RVDA 1L1FA 1WMAA 1F14A 2YY7A 3W8DA 3GT0A 5CEJA 1ADGA 3PIDA 5ILGA 3MCVA 1C1DA 1ZEMA 4BO5A 1BDBA 2G5CA 3WMWA 5L45A 4BNLA 1PQUA 3SX2A 1LDNA 4ZICA 3L0DA 4Q3BA 3ZU3A 3PEFA 2QYTA 4N5MA 3C24A 3KV3O 1UAGA 2HAEA 3DAPA 4RVGA 5KIAA 4RF3A 1ISMA 1UP7A 2FOIA 2OHXA 3S8MA 4XB2A 1NWCA 5TNXA 1Q2XA 1CETA 4R16A 3UCXA 2NSDA 4XA8A 1QYVA 3IS3A 4CLEA 5C3MA 2W2KB 4FOSA 2OMEA 1U9JA 1VJ1A 2WD8A 4MVJP 3IJPA 1ARZA 1NAHA 2AEMA 3AM5A 3ZV6A 4TRNA 3DAGA 2EIHA 1DIHA 4FFOA 2ZYAA 1WXDA 3E1KA 3JQGA 4YAEA 3ZV3A 1IE3A 4IDDA 3WGIA 4BNJA 1SBYA 2UUOA 1P74A 4F3YA 1QYDA 4FD3A 2JL1A 2QZ9A 5JYEA 5EN4A 1UUFA 2BI7A 2LDBA 3F3SA 4IMRA 5AOVA 2P9GA 4WLOA 3VH3A 4ESOA 1LBEA 1HSZA 3ZWVA 1R0LA 3PJFA 4DGSA 4GX5A 4NZ9A 4CQMD 3QVXA 3EZYA 3RJ5A 2DC1A 2Q2VA 1D7OA 3HQ4O 3JD0A 3MJVA 3CMCO 4RZHA 3OP4A 1XU9A 1EUZA 2VYVD 2X5JO 3D4OA 3N58A 4PCVA 5GZ1A 3BMOA 3CUKA 1WMBA 4LRSB 1UXJA 4BO7A 1I8TA 1UH5A 2NTJA 2Z5LA 4ZGWA 2O4UX 4AJPA 2CDAA 3QVTA 5FI5A 2Q4EA 3JCZA 4A73A 3VTZA 5DP2A 2DPGA 3ZHXA 3VPGA 2HRBA 4WPGA 1I10A 3GDGA 4ITUA 3VPXA 5L4LA 1W6UA 2VHXA 5L3ZA 4LCEA 4CV3A 1NX6A 1E7QA 3WG9A 4BO9A 5JDIC 3A14A 2PD4A 4OJNA 1TT7A 2EKPA 4EGFA 1LA2A 1HDZA 3K30A 2I76A 2VT2A 4J2HA 5EJ2A 2NUAA 4NJMB 3R0IA 4WJZA 4OXYA 1FF9A 2PZJA 3GGOA 3GNQA 4J91A 4N54A 4UUMA 1VRWA 1JU9A 3A1NA 3U4DA 2JD0A 4EI2A 4I5EA 1R0SA 4TKLA 1KVQA 2FR1A 1B26A 3OBBA 2H6EA 4Y6RA 2DTEA 1W4ZA 2X8LA 4YRBA 1WZIA 1IPEA 3KXDA 4AJEA 4IS3A 3MWEB 3L4SO 4BV8A 1W0CA 3RBZA 1E7MA 3H2ZA 2BGMA 3HZZA 3H4VA 3RJ9A 5L7TA 1ID1A 3W1VA 4BNIA 3NTQA 3F1KA 5L7YA 4P22A 3L6DA 4IDBA 4L76A 2NQTA 2EEZA 5CDGA 3C7CB 1AGNA 2FR8A 3LC2O 1KOLA 2PR2A 5C7LO 1KC3A 4I08A 3OJEA 3WSVA 1SNYA 3PJGA 4R3NA 1XR3A 5I7VA 2C20A 4NK4A 3B1JA 4CV2A 3SXPA 1XCBA 1AE1A 3PJDA 2AQ8A 2VHZA 1Y9EA 4RORA 4PIVA 1I2BA 1CIVA 1WNTA 4HWKA 5JLAA 1N2SA 3S55A 4AJ2A 3IC5A 3KSDO 2E37A 2Y68A 4KUHA 4BQPA 2JJYA 4EUFA 5G0SA 3T7CA 1C3VA 1JDJA 1RPNA 4RVUA 1GQYA 1A9YA 2HLPA 2YQ4A 3QRWA 2DM6A 3BHMA 2VTEA 5EERA 2D8AA 1LI4A 1P1KA 2G17A 3JQAB 3MZ0A 1T4DA 4JJGA 4OXNA 4XQCA 3IDSA 2ZB4A 5ITVA 4K6FA 1YVEI 4LMRA 1ZFNA 4JGBA 4PLZA 5CDYA 4EZBA 4MVJM 4RVHA 4YA6A 3NGLA 4RV9A 3ST7A 2JHFA 5L7WA 1KEPA 4YYZA 1K3TA 4CV1A 3QVOA 4G5HA 3JD1A 3VVCA 2NVBA 4FFRA 5BNFA 3RWBA 4OH1A 2C2YA 5A5FA 5JXWA 3LF2A 4IDCA 1LSJA 5K0ZA 1KVRA 1EMDA 5ER6A 3TWOA 1LXCA 2O3RA 5CHEA 2BF7A 3BZUA 5F1PA 1T25A 2AA3A 3GRPA 1ULUA 1RM5A 2QRJA 4FCCA 2Q1TA 5A05A 4GKBA 4CMIB 1DJNA 1HZJA 4BNFA 2EERA 4WCFC 3FWNA 3A28A 2VWHA 4KDEA 4ALKA 5IDQA 1DC3A 4ZJUA 4RGBA 1H6CA 5I9NA 3G49A 3I6QA 4I5DA 1JKJA 5CEFA 4PLYA 4KQWA 1PZEA 4A03A 3IP1A 2GRAA 3BMCA 4XRRA 4AJIA 3VTFA 3K92A 2AEJA 2I99A 3ADPA 4NBWA 4TRJA 3WNQA 4CM4A 1GPDG 4KWHA 3CE6A 3NT5A 1Y8QB 2Z95A 5JW6A 1YQXA 3QVSA 3VVBA 2HO5A 4UVEA 1GCOA 3TOZA 1ISGA 1H6BA 2AHRA 1OI7A 2I5PO 1EE9A 4P38A 4E32A 4J9UE 1P33A 2PKQP 4NBTA 1X1TA 1LJ8A 4WEQA 3R3SA 4KTTE 3VPHA 3CZRA 4ALLA 4CLOA 1CJCA 3IQDB 3B1KA 2NU6A 1VM6A 4QEDA 4YAJA 4B4OA 5U1PA 3PK0A 3KB6A 3E82A 1P0CA 3AUUA 1EE2A 3NYWA 3WYEA 3K2BA 5GZ6A 3KSUA 1EVIA 5ITWA 5AXDA 1HDRA 1YBVA 2AXQA 3SVTA 4YT8A 1AHIA 3PHIA 4CM4B 3INTA 4Q3AA 1ZK2A 3TNLA 1TVEA 3RI3A 1E5LA 4HXYA 3U09A 3RUHA 1M76A 2ZJ0A 1EVJA 4BMVA 4KUEA 2VUTA 4OHUA 3FF4A 7MDHA 5JAIA 3VH1A 3PP8A 4WGGA 1DAPA 4BIIA 1PJTA 3GN2A 2VHVA 3VZQA 4D3DA 4E13A 4DPLA 1ZK3A 3H5AA 3KTDA 3WFJA 1GEGA 3GQVA 4CLOB 1PX0A 4IQ8A 4DUPA 3U5TA 3CMMA 1I3NA 3ZWYA 1BHSA 1V6AA 5B1YA 1E7SA 4JBHA 1HKUA 2EGHA 3DL2A 1E3JA 1FDTA 3FNGA 5JS6A 2O3JA 4H7PA 1SPXA 4QTZA 4R1UA 5KJEA 1B16A 5CEEA 3RQSA 5I7SA 3VDRA 1CRWG 2IZ1A 4R4JA 1JLLA 4IGEA 3U4HA 3KVOA 1U3UA 3GUCA 2JHGA 1B2LA 3JSAA 5HS6A 1H6DA 4GVLA 1YJ8A 4OQYA 3WIEA 2UDPA 3ZU4A 4L4RA 2F1KA 3U4CA 1ZVMA 4Y67A 3F5SA 1M66A 3OF2A 1X1EA 2NU8A 8LDHA 3GF4A 1PIWA 2AQHA 3DOCA 4DBZA 4E3ZA 1HETA 4J1NA 1IHYA 1B14A 4CR7A 1DSSG 3BAZA 3MEQA 2YW9A 5JDCC 3AFMA 4TROA 1B3RA 3ZNPA 1EZ4A 4Q3DA 1LLQA 1OC2A 1ZK1A 4B7XA 3IKTA 1C0IA 3P2OA 1K2WA 4YJFB 2W2LD 4I9UA 3DFUA 4MVJF 2OXIA 1GD1O 3GH3A 1FMCA 3ZWAA 1HDOA 3JQ7A 5KKAA 3QV1A 1IOLA 2ZIZA 1XELA 2X0IA 3B20A 4FGSA 1O9BA 2OBYA 1UXGA 1H94A 3PQFA 1SEPA 5A1TA 2PNFA 4CLRA 1H9AA 3JQEA 2FPGA 3ZDFA 1F12A 2HK7A 2WE8A 3O8QA 1LDEA 1XG5A 1ZW1A 4PG8A 3QA9A 3L77A 4B79A 2IZZA 3UCFA 2R6JA 4IIUA 1NP3A 4BV9A 1EQ2A 4M54A 5CDSA 2V6FA 1Y6JA 4ZQBA 1H0KA 3WGTA 1MLDA 3RROA 4BNVA 1R4MB 3ZWNA 5COAA 4L8VA 4CUKA 4BO8A 1LU9A 3A06A 2UAGA 4XR4A 2GERA 2DBRA 2PGJA 3JYNA 3ZH2A 3LT1A 2ILTA 1MG5A 1O94A 4CMBA 2NTVA 3OQ6A 3W4IA 2GN9A 1VL8A 4FFNA 4IJUA 3WB9A 3EDMA 4NU6A 3ETDA 3FPLA 3JQ7B 5JCJA 3LF1A 3LVFO 4YJDA 4Z9YA 1A5ZA 3RSHA 2Y1EA 2ZQYA 3NAQA 4RF2A 4J6FA 1EK6A 1ZSVA 3KYCB 2DKNA 2GZ3A 3D5TA 1N7HA 3DMTA 3TDKA 4D0SA 1UP6A 3DC2A 5C7OO 1X0XA 3G79A 3KO8A 3ROKA 1P45A 2WJPA 1SC6A 2TMGA 3WBFA 4D45A 4CR8A 4DPKA 4E2XA 2HSDA 2DTXA 4E2WA 4E5PA 1PS9A 2A94A 4IUYA 2PV7A 4BMNA 3JQAD 4L75A 3H8VA 2EGGA 1DDOA 4O63O 1SO8A 5JBIA 2IXBA 4BO2A 1AHHA 1RKXA 1L7EA 3LQFA 3VC7A 3OQ1A 3WXBA 4KDFA 3VKUA 3VZRA 3NJ4A 2JD1A 1PR9A 2VOEA 4BNYA 4BNXA 3GDFA 4D41A 4BB5A 4GX2A 3EW7A 3P2YA 5KCZA 3EYWA 1HDYA 1YGYA 3GC6A 2ZYGA 2Y1CA 2O48X 3CTMA 1NYTA 1SB9A 4CMAA 4NBRA 3V2UA 2WYWA 5K6AC 1IL0A 5A03A 3GNSA 2X4GA 1VSUA 3OJFA 2P2SA 4Y6SA 2Q50A 1P77A 3CSDA 4XEHA 2X0RA 4D7AA 2XPCA 4XCVA 1G6KA 2ZQZA 5G4LA 4YVFA 2QZZA 1I24A 2DU8A 5I9LA 4PG6A 5A9SB 4EJ0A 4XYGA 1H9BA 3G0OA 3HHPA 3IOYA 3SJUA 2FRDA 4QECA 3Q9NA 1A71A 2AE2A 3RFXA 1MB4A 4ZQFA 1EBUA 1HLDA 4W9NC 2Z1MA 3DHNA 5DOZA 5KVQA 1VKNA 2CVQA 3N74A 4GX1A 1Y7TA 3GG9A 4FFLA 1NHWA 1KC1A 2J5QA 3BMNB 3I52A 4RF5A 2OOSA 1TB4A 1R4NA 1SCUA 4CQLA 1IULA 2DUWA 3MJTA 3JYLA 2C0CA 4Z9XA 2VZ9A 1K0UA 1XEAA 3ZGYA 3CPSA 1OOEA 4PLHA 4RQUA 3E5RA 3AWDA 5FWNA 2P5UA 1N5DA 3L07A 3D1LA 1QP8A 1ADCA 1PZFA 2YV1A 3NTOA 2H1SA 1R0KA 1WAMA 1U7HA 2HMUA 2OP1A 2FWMX 3GG2A 2IODA 5I7FA 4NG5A 4IJWA 5B12A 1MGOA 1LNQA 1DRUA 3Q2KA 4YRAA 3G1UA 4XYEA 4YJGB 5EINA 3O03A 4URFA 1SEVA 4BO0A 4Z0PA 3GDOA 4GPD1 3ZV5A 1NVGA 3GOHA 3JQDA 1KEVA 2EWMA 3PQEA 4K9DA 5FYDA 1NQOA 1P1JA 4MVJE 3H2SA 4NHEA 1JAXA 4BNMA 2RH4A 3WOHA 2AEFA 1M67A 4BNKA 4FN4A 1NHGA 2W4QA 1ZJZA 4GBJA 5GZ3A 4R68A 1DLIA 3DZJA 4M1QA 1E7YA 3DZBA 2Y99A 2D4AA 4BQRA 2P4HX 3PWSA 2IRWA 1U7TA 1PS8A 3ZZNA 4DMLA 3UCEA 4PZCA 3D3WB 1PL7A 1JWBB 2Y1DA 4MKRA 3ONDA 3W4KA 1HYHA 4CM9D 2FY8A 2Y1OA 4ZD6A 2PKRA 1I2ZA 4CMEC 1G1AA 2EW2A 2XAAA 5DP1A 2FN7A 3SC6A 1LRLA 1DJQA 1HE2A 2NU7A 5MGBA 4D42A 1OZAA 4D44A 4DYVA 4XJTA 3T4EA 3LT4A 1E3LA 1JAYA 1K6IA 1E6UA 1DRWA 1TXGA 1J5PA 4Z3DA 5H83A 2RH8A 3NT2A 4TRRA 5U4QA 3D7LA 1LEHA 4L4XA 4UAGA 2EV9A 4BGIA 1HZZA 1EUCA 4D0RA 4TQGA 4M49A 4LRTB 4B4VA 1WW8A 3DOJA 3H3JA 5AXBA 4E2ZA 1MA0A 5TQVA 3RBXA 1IZ9A 4J7CA 4DIOA 5A9TA 5DBIA 1WDLA 3L6OO 3WGYA 4PN3A 4D46A 3A4VA 2WD7B 3GPIA 3KETA 4XB1A 1H2BA 3DBLA 2CF5A 5BT9A 5EMHA 4BVAA 3FNHA 1HE4A 2D2IA 2A35A 4MP3A 5T64A 2VOJA 2NNLD 4WLFA 4BNGA 5F5NA 4II3A 2TMDA 4RPJA 2JCYA 1E3IA 3R1IA 4KP7A 2I9PA 4LISA 4R9RA 1IPFA 3F4LA 1O95A 1S6YA 4DLLA 1VL6A 3PHLA 3FTPA 1GYQA 3HN2A 5THQA 2FHSA 1YB1A 1E7WA 2HK8A 4A10A 2Q49A 3QHAA 1MXHA 4ZQHA 2CVOA 5A3JA 3I4FA 1K6XA 3JV7A 3FBTA 4DC0A 3NT4A 4LCJA 2EJVA 1ADBA 2BGLA 4YT4A 2I3GA 2DUUA 4CMHA 5ER9A 3E9MA 2DT5A 1IZ0A 2Y0DA 2PK3A 1CEQA 1D1SA 2PD3A 1T26A 5HTOA 1DOHA 4FS3A 1JKFA 3HADA 2ZTVA 3DBLB 1YL6A 4QX6A 4RLHA 2OZPA 1M6HA 1UAYA 4QO7A 1P1RA 3LT2A 2C54A 4DQUA 4YQZA 4QT0A 5JDIA 4ALNA 1CYDA 2DBZA 3QY9A 4JQCA 1U2DA 2GO1A 3RASA 1VL0A 4FJ0A 4L0QA 3DTTA 4FQ8A 2C7GA 2OP0A 5JMPA 2X9GA 4CUJA 1KEUA 3MTJA 1T4BA 4QFCA 4BO1A 4XDZA 4U6SA 5G4KA 3FWZA 1C1DB 1NFRA 1E6WA 1QRRA 3AOEC 4W7HA 4PLVA 1DC6A 2QHXA 4XJSA 2R00A 3D3EA 3S1LA 4B3JA 3BIOA 1N9GA 4K1LA 4M8SA 5H81A 5IJZA 4U8GA 1BVRA 4BNTA 1NPTO 4IINA 1WDKA 1KY5A 1T2FA 3DBRA 3OIDA 3UFXA 1Y5RA 4P4LA 3PLNA 4CPDA 4MINA 1P1FA 1DBVO 3O9ZA 4G2NA 1PQPA 3T4XA 4M55A 1NNUA 5JY1A 1YONA 2A9FA 1Y1PA 2P9CA 3E03A 4OXKA 3AUSA 2DVMA 4AJOA 4B8ZA 2O3SA 3LSYA 3WX0A 1BW9A 4I1IA 3WGHA 3TZQA 4DXHA 1TEHA 3JQGB 4LVUA 3Q3CA 1DPGA 2I6TA 4AJHA 2VN8A 3VPSA 1E92A 1P1HA 5I8WA 2ZK7A 4ALJA 2G76A 4GMFA 4ZQGA 4MVJD 4P4NA 4H15A 1LTHR 2IEDA 1N9GB 3JYPA 4CMCA 3CIFA 4ND1A 1VSVA 3WWYA 4IY1A 4AL4A 3HG7A 3AUTA 1XHLA 1QLHA 1LRKA 1ZJYA 3GVCA 1ZBQA 4NNJA 3BTUA 1ZO8A 2O3TA 2Q4BA 3AI3A 3STHA 3QW2A 3BHIA 4YB8A 4DBVO 4WKGA 3BMOB 2JAPA 3E18A 5EQDA 3IMFA 1N1EA 3QQPA 3WYBA 1ZXLA 1VPDA 2HK9A 4XGKA 1DC5A 1NVTA 1DEHA 3DQPA 3DMYA 3GAFA 4L4SA 3W6ZA 3QVWA 1LDMA 4WLNA 2PGDA 3S2EA 3W4JA 3ZW9A 3C1TA 4AFNA 3H5NA 3RD5A 2VZ0A 2X1HA 3ZNQA 3GZNA 5T57A 4GX0A 1I2CA 1T1RA 5J23A 1ZMOA 3U9LA 4B3HA 4A27A 4OKNA 1YDEA 3DONA 4O1MA 1PJQA 3DZKA 3AU8A 3ADOA 1H93A 1A7AA 1DB3A 1A27A 2PH5A 3NX4A 4QQRA 3EGOA 1LC3A 3GMDA 3OA0A 4LSWA 4CM5A 1ZMTA 5A5EA 2VRCD 3PI7A 4R54A 2NU9A 2V6BA 2BRUA 1C14A 4S3MA 3RUFA 1GPJA 4H3VA 4IZIA 1KIFA 2GCGA 3D4PA 3PZBA 5JAMA 1N8KA 3ASUA 3AFNA 4GKVA 4GLLA 3KEQA 4IZHA 3MTGA 4IDGA 4JK3A 5CPFA 3FPCA 3UF0A 5IDYA 3ETEA 2YQ5A 4NFYA 1QSGA 1TT5A 3GZNB 4BGVA 1LX6A 4RPLA 3GZ4A 4J1SA 1A9ZA 3JQBA 3NUGA 1VJ0A 4AJNA 3MJSA 1ULSA 4BL5A 1BSVA 2CNBA 2G1UA 3LYLA 4ZU3A 3TFOA 3AJRA 2WSBA 4GWGA 1MG0A 4J7XA 1EVYA 3RUEA 3OIGA 1PEDA 2NQ8A 4KMSA 1GAEO 4C4OA 4R1SA 2ZB8A 2YHIA 3MOGA 4YWJA 1N7GA 2FZEA 4HV4A 3U0BA 4PRLA 1PWXA 1ZK4A 3NDIA 3KYDA 4CL8A 2Z1NA 3EK2A 3RUDA 1VE9A 4JP3A 4EUEA 1FDVA 2HQ1A 3OECA 4U5QA 2PH3A 2BI8A 4WUVA 3DDNA 3OQBA 4ZRNA 2O2YA 2HDHA 1PZHA 3UXYA 4YJHA 2D1YA 4RLSA 4DIBA 1Y8RA 2BLLA 5G0UA 1NFQA 3ONEA 4R69A 2DTDA 1D1TA 1RJWA 1BVUA 3GVXA 4MVJI 4XRGA 4MVJH 1ISIA 3OJLA 2J3HA 3UAGA 2NLOA 5IN4A 4WOJA 4GMGA 4BKOA 1ONNA 1HE5A 4DVJA 2PLAA 4BNUA 1I3MA 4X54A 4TSKA 2QRKA 4XQGA 1Q0HA 4DQXA 1Z7BA 1CQIA 4YTEA 1FDUA 5DF1A 1MC4A 1T24A 5TX7A 1JA9A 4YEDA 3DFZA 3VHRA 4CM1A 2B0JA 1HEUA 1YS4A 3GNTA 3GAZA 3ANMA 1BG6A 3H9GA 4O6VA 4PLWA 4A26A 4J0FA 3DZGA 4OO3A 1G0NA 4UULA 1V3UA 1ZNQO 3VZPA 2EF1A 2O3QA 1Y9AA 4II2A 4NBUA 3C85A 3DB2A 2H9IA 3X2FA 4W82A 1LDYA 1OBFO 4E6PA 1Y8RB 1X7HA 1M75A 1Y5MA 5TS3A 3NGXA 4YBZA 1EVZA 3I9KA 1MP0A 2FZWA 3W8FA 3MJ4A 4OSPA 3IUSA 4J4HA 2GN8A 4PZDA 3I9NA 4PZEA 4M86A 3D4NA
chains in the Genus database with same CATH superfamily
1RWKA 3FUVA 2D62A 4KQ2A 1JKJB 2XBUA 2Q1UA 1OH6A 3UMCA 5B5SA 3TL2A 4E0BA 5LWHA 3QKRB 4G0PA 1E4EB 1DFHA 2WSIA 3PHGA 2D0OB 5ICSA 2B6HA 4GFDA 4ME6A 4Z7OB 1JNXX 4UVDA 5K3EA 2VTBA 5CDTA 4FIZA 2C2HA 2Y93A 1Y63A 3A04A 3L0BA 1K89A 3M3HA 4LYJA 4OHCA 1Y5NA 2ODTX 4PGAA 4ZFNA 4RDXA 4KPFC 3NTLA 2RBEA 5BN4B 4ZMRA 1GNVA 3SD7A 3UGQA 3KT6A 2ATEA 4AK9A 1XCJA 2C0QA 4KLRA 3EBLA 2CZQA 1KP3A 1J7KA 1I5RA 3EQ7A 1W75A 2H3HA 1SOVA 3A4YA 3DSRA 4LPSA 4OUKX 4EYQA 2WF9A 1FFWA 5GP1A 3ESRA 1FC0A 1WMSA 3CG4A 1QIFA 3QXGA 4TS9A 4RIEA 1S1CA 1TM2A 3I1FA 1BXRB 1GUZA 1UC5B 4NCXA 1CUHA 4PHCA 1QOZA 1QJ4A 2HTEA 1Z2EA 3L7AA 3PGXA 4FYPA 4LHWA 4DC9A 5C8YB 4B3IA 3PS9A 2C5BA 1FLNA 1JECA 1P9LA 3ZHVA 3K6KA 3FI0A 2QT1A 3LYHA 4HGNA 3L8YA 4TZTA 3RIEA 2YXDA 2AW5A 3G5AA 4WASA 2QW0X 4DB4A 2YBEA 1OSNA 4YCSA 3NASA 4YP1A 4G3XA 2QR2A 4MJ7A 3ZY2A 1S96A 1HLGA 1UP4A 2J5KA 3I2GA 3PC7A 2FPSA 4RZ2A 1L7DA 3LNTA 1GUBA 1RQGA 4Y9SA 2HR1A 4V0QA 3JQFC 3LUCA 1PVOA 2CJYA 1EEXB 2SKEA 3RFVA 3ZK7A 5IFKA 1VKOA 4PHTA 2CNWA 3RVKA 3NFRA 2P8SA 5CDUA 2VNHA 4I4NA 3KFLA 1FDWA 3BWBA 2BFAA 2DKOA 3DAFA 4RSHA 5DHUA 4J7AA 1X87A 3N2ZB 5FNVB 3H1FA 5ERYA 2BMAA 1ZM9A 4RKRA 2QLLA 2W8BB 2W2XA 1Z0JA 2FEPA 4MUJA 1J09A 5MDHA 2ATVA 2XUDA 4Q7MB 3B9RA 4LYAA 3LY9A 1RZVA 4U6QA 4ABTA 3E9RA 1IRXA 5TY0A 5BVHA 2PKYX 1X2BA 2I6XA 3D7NA 1GGKA 3KYIB 2L2QA 5C37A 1P1CA 4OQFA 2Y0EA 5HIAA 4ABYA 1E0KA 1N5RA 1QIIA 3JQ8A 4UW9A 4DM4A 4P7JA 1QHNA 4BGUA 2WTBA 1KERA 2R8PA 2O7QA 4MIEA 3U6BA 1E5DA 4F97A 2ZI4A 4OHMA 3NTVA 3VKFA 1Q20A 4KQCA 1M83A 5I7RA 1UR5A 3M4YA 1AKRA 3NPAA 4MHOA 3OWOA 1I0ZA 4MUGA 5T5QA 2V55B 3FCAA 1L6IA 3K72B 4M6WB 1YBFA 4TKZA 3SR4A 4Q48A 2Q8PA 2IE8A 1MX5A 4CM8A 2I22A 4RTNA 1T8PA 1AA9A 4G8DA 4HAOA 4PO8A 2YFQA 5EHQA 2VF8A 1DKRA 1CY2A 2PO7A 4HLDA 1M7GA 4L74A 2B1IA 3H4TA 1IMOA 3KQSA 4OHFA 4MR7B 4Y6GB 3PRJA 4L0DA 3N07A 4EY5A 1QUFA 2PLNA 1HYQA 1ADJA 3C1UA 3UEOA 2C2GA 1SVOA 1FB5A 2VPPA 3ICWA 2Z09A 2VWGA 3CE9A 4HH1A 3QGMA 3QVJA 2OENG 2I87A 2FMUA 5BV7A 2GWHA 5CJJA 3TH5A 2AJLI 3T54A 4XQ9A 3V7FA 3IT2A 2X77A 2OQIA 1QTQA 3VYTB 1QH0A 4NJOA 4H4EA 2IU0A 3GEIA 1BIFA 2GK3A 1NSFA 3OKAA 3PE3A 1C8BA 1DFGA 1IEQA 1EZ1A 2XEXA 4XTCS 1UDAA 1ZUNB 3M5WA 1V5WA 2IX3A 2CXXA 2GTPA 2OL4A 1PI3A 4UJ5A 4DN6A 1USKA 3QOXA 1K06A 3FDJA 4OJYA 2GJSA 4OFWA 3WQQA 4DG9A 3KQKA 5LC1A 4UC0A 2NXJA 1FNCA 4F2HA 1OXBB 1ODSA 4KPEC 2C29D 2I3ZA 4QT4A 1EB9A 1D4FA 2GF2A 2V7XA 4PYRA 5FBRB 1P9RA 2IK8A 1JG7A 3WL5A 3VR4H 4EY4A 4ED9A 2B34A 4CLRB 2XGOA 2P5YA 5TPWB 3S81A 5ELLA 3SBOA 2CDBA 1XQVA 3WGGA 2Z2ZA 4GQAA 2D54A 4DC1A 4J16A 4EHKA 3MGCA 4QFDA 5A5VA 4DIUA 4M0MA 3PGJA 1ZR4A 1CB7A 3E2IA 1U2SA 2QNBA 3F4BA 4AG6A 2OO5A 3PCXA 1YDMA 4XWYA 2F1HA 1NR7A 4AI6A 2FW6A 3OBIA 3TQFA 2I66A 1BZYA 1H5QA 1XD8A 1RLJA 2PZMA 4LRYA 4YASA 1CCWA 5HWSA 2G06A 1MPXA 2APJA 4Z0NA 3SHOA 5CA1B 5J43A 2UUAB 2JDIA 3E9QA 1Y82A 3ROMA 3P9RA 4LJSA 5KVAA 2KB0A 2Y76A 3KXPA 4U2KA 2IIQA 1NBAA 3O2NA 4F3CA 3UJ8A 2I2BA 2XB8A 2Q1WA 3V8BA 2ACWA 5DISB 1A4XA 2ZYWX 2POQX 3UA3A 4RHYA 1ZM3A 4NXNB 4QREA 1B93A 2LE0A 3WZMA 5L4NA 4JZKA 1PCXA 1QR6A 5CM2Z 3TLGB 5JCZA 1PNQA 1EVEA 5CX1A 4K9OA 1TLFA 1JFFA 1SM4A 1PJ4A 2ZYVX 3EVNA 3OJ0A 3P32A 4TTVA 1E3MA 1F4PA 2J3LA 1U0RA 2Y1WA 5B4VA 3K1YA 3G2QA 3HKEB 1IJBA 1ZJWA 1MENA 4LNUA 4NBSA 3HJBA 4D3XA 1UT8A 3KWLA 1U4OA 1L5YA 1W96A 3L7OA 1O4VA 1NF2A 3WAJA 2C7VA 5G0WA 1U3WA 2DLDA 2QPOA 1M2HA 4E1VA 3ZGVA 1SZCA 5JS8A 2D2XA 5CAEA 4G36A 2PWZA 3GB9A 5I5GA 1YZKA 1DO2A 4BFUA 1VHQA 4HEA6 2Z04A 3DEYX 4RHXA 4Y6QA 1QIEA 2X2OA 3NHSA 3RLFA 2H7CA 5B6IA 4P0PB 2FI1A 4ER5A 1X9GA 5C8ZA 4JP8A 1OV4A 1FSGA 2AQKA 2ZI5A 3L84A 4TVBA 4BWYA 2Q0QA 1U28A 3K16A 5K6TA 1CNFA 4KK3A 4U0JA 2V0CA 3GCGA 1OKKD 3SR3A 1FFCA 1Z5OA 3MLBA 1URPA 8GPBA 1R8XA 1ESMA 1NWHA 4GPBA 4TMXA 3UW1A 2QBYA 2JLRA 1P6XA 4YRFA 1M2KA 1CFZA 5HF6A 5CX1B 2OGWA 4W6ZA 4TSFA 3KQVA 1GDHA 1JFFB 2JH9A 4JP1A 3SYMA 1ML3A 3K1ZA 3I45A 5IK2A 5T7BA 3FZQA 3U4IA 3ZE2B 1ZCZA 2FWPA 3PUHA 3UPDA 1GV0A 2G4LA 4V24A 4FFBB 4ZCRA 1AHPA 4FMBB 1OLXA 1J0DA 4L07A 2EJTA 2CHEA 1G38A 2HWKA 1A9TA 1USIA 4YYEA 1TJPB 2JLVA 2UVQA 4XAQA 2QG4A 1F1BA 1DDGA 3PPXA 4FC6A 2VF4X 2ZWVA 2ZYDA 3RDPA 4BS9A 1SH7A 2P11A 3INRA 3KQNA 1ONSA 2ID7A 4DLAA 2N75A 2IEGA 2OCKA 1M1ZA 1ENOA 3KYBA 4FOPA 3THWA 3QELA 4POOA 3NDBB 5IM4F 1V8ZA 1LBSA 1WBBA 4QD3A 2PUEA 4KE7A 2FEAA 2FSVA 2VDOB 2DWCA 2VKQA 1FNDA 2H5LA 3A58B 3GHYA 2X8BA 3E35A 1OXTA 2IITA 3A11A 3JAWB 4LSMA 4Q4AB 4TMKA 7ABPA 4UEOA 4PYQA 2Q8NA 3E48A 1IUOA 4X91A 4MTCA 4BX8A 3R3UA 1QIDA 2XQGA 3EA4A 4NOKA 2CBGA 2ZS8A 5TQ2A 1TEZA 4OK3A 3HYCA 4NMWA 2QOEA 5FUWA 2PA3A 4KWEA 3UWDA 1Q92A 1A04A 1B8VA 1R4NB 4CG1A 4CQLB 4RZIA 3LBIA 1CQPA 3H2BA 1N2HA 1DKNA 1X19A 4MW5A 5M34A 1OB5A 1QRSA 4G1CA 4Y6PA 1A69A 2QVLA 1M2WA 5HE8A 1L7RA 3AI1A 5KPDA 3FVVA 4WKNA 4TGLA 1T4MA 3OE1A 4QDTA 1ZD5A 3KT3A 4YAIA 5KJ6A 2DH5A 3FSGA 3C5EA 4OGKA 1GSOA 5KHLB 1XTPA 1IHOA 3T61A 4IS2A 1XO1A 3QWIA 5CYFA 3BDVA 2H8KA 1MIOA 5IJ0A 2EZ9A 3E3LA 1LTQA 2VRWA 3UW3A 5ALNA 2DUNA 3AESA 3L6EA 2ZUTA 2OT3B 1J8DA 1NXXA 4D6YA 1E99A 4K28A 1DU4A 1RABA 3PUWA 4EY3A 4MSUA 5C53B 2Q9UA 3GZTB 3R5KA 3T6KA 4YCJA 1C80A 4PPQA 1PHRA 3WGZA 4MW6A 3NDRA 3NBUA 3BRSA 5BYKA 3BERA 3F67A 4S1WA 1AIPA 5IHPA 3KBOA 5B6JA 3IEKA 2YICA 1CWUA 1OXMA 1LDGA 3I2YX 3QFSA 3EE6A 3LO8A 1L7OA 3KE9A 4IUBS 4JA2A 3DYBA 4ZXFA 2V7PA 4AROA 1Y4UA 4KITB 3PDUA 3D6TB 4YJ3A 3X1DA 4EDFA 5GJVC 4JP2A 4HQLA 3UTDA 3B5JA 5DBEX 1XVAA 3CPHA 4R1NA 2QJTA 5SY9A 3ZUPA 3UB2A 3B52X 4L3VA 4ZZ2A 5FULA 5T3YA 2P9BA 2YXPX 3ENKA 4Z49A 3AVTA 1VHLA 2F17A 2BW0A 3RT1A 4DHWA 4Q37A 3OZSA 4V39A 1Q0SA 2W58A 1MABB 5AVYA 4JVLA 4CMGA 3QY0A 2C3YA 3MT7A 3LPMA 4J2OA 4MUNA 4BY9E 4OMCA 4O4JA 1XEWX 1VQ1A 2I78A 4QATA 4L0MA 1ND5A 4YP0A 3HCFA 4YR9A 2HNKA 4J8PA 1MIOB 1R6DA 3IMCA 4JJZA 4LDJA 4RTLA 3ECSA 1L5MA 2RBKA 3PC3A 1VJ5A 4B4DA 4L08A 5K03A 2H7VA 2N47A 2I7CA 4MUKA 1V7ZA 4RKFA 1D8AA 2ENUA 2OM2A 3AY7A 3DT6A 5E2IA 1A8UA 4PRKA 3AOEA 1V9LA 2I3AA 4NPCA 1XK7A 3GFGA 4BRWA 4CT0A 4WK6A 5MN6A 4LXGA 1ADFA 4Z54A 3DMPA 4I14A 1F60A 3EPRA 3BX1A 3AUKA 1VECA 2BKLA 2G09A 2KJQA 4QEZA 3VVLA 1QVVA 4DJJA 2OAGA 1KZ6A 4FMDF 4UVGA 4DUYB 5LIPA 4ZC1A 1BE6A 1GKIA 1E5VA 4HNGA 4NENA 2QPAA 4TWBA 5LYJA 2WZDA 2CLMB 2O06A 2PUVA 2X9VA 1EUCB 4H1WA 1IZ7A 1LRJA 3BD9A 1T29A 1E9SA 4MIOA 1FX0B 3MHPA 2W2KA 2EF0A 4OHBA 2X5NA 4E70A 4MS4B 5BMVA 4K3UA 5IZCC 4GLOA 1KF0A 1DKOA 2P65A 2SICE 4CODB 4J0DA 3ZHZA 3UMGA 2R97A 3ZWBA 1ZXBA 2C03A 3LPAA 4B33A 1ODJA 1A2BA 1NXQA 3ZWOA 1ZU4A 2NW6A 3V6LA 1H5UA 1N5LA 2A5YB 4GOND 4JX9A 2P9TA 4QJ5A 1VYVA 5HQTA 1HTWA 3CYFA 2Q99A 3KOWA 4M9UA 1W2WB 2XE6A 3D1VA 2RJOA 5DXJA 4ZVQA 3JZMA 1WZEA 3UJ9A 3CWCA 2FJ0A 3BE4A 3AT1A 2W9XA 3OZBA 3ZOZA 2ZJAA 2ZI6A 5B64A 1U5CA 1Z4OA 2G4CA 2P9ZA 2YUTA 5L95A 4MV1A 1DTWB 3HLKA 4ZVTA 4ZCQA 3U31A 1KKUA 4D3FA 1PTKA 3FWPA 2HWXA 3W6UA 2B7BA 4ZT5A 1G3MA 4KNVA 4XWOA 3X1YA 3Q0IA 3ZBTA 2F59A 1U8EA 2AJ8A 3O1IC 1JPUA 1L4LA 3OLVA 5E6SB 1WVGA 1OTHA 4BWFB 4DBLE 1PU2A 3O3OB 2C9BA 1DNPA 4HMOA 3HDGA 4BNWA 2DFVA 5KC9A 5G02A 4DANA 3PPYA 3AR9A 2HCTA 1V0JA 4WXPA 5JO9A 1P5ZB 5E9AA 2QN8A 1D1PA 5BSVA 4FJ2A 3IAXA 4J0IA 5EXXA 3HUDA 2GUGA 1VIAA 4DNPA 1GKKA 3GHHA 4KFRA 3USZA 3WDKA 1T5IA 3TFWA 4IF4A 2A1UA 5C5IA 3D31A 1YAJA 1SUBA 2Q5FA 2OFPA 3AM4A 3FNBA 3KFVA 3WJAA 3ZC3A 3GXOA 1L9XA 5A02A 7REQA 2IBSA 3GLIE 2GKOA 3QWHA 3F3MA 2YC4C 4M1EA 3WB1A 4YMSA 1FSZA 1TF5A 4F9TA 3MINA 1P2TA 1VKZA 4GLFA 2FUKA 4J0HA 4M88A 4XIFA 5EA2A 4QDOA 4B8WA 4YUXA 1CXZA 1B6TA 1ORTA 3T12A 4EKEA 3P2IA 1KI6A 4DV2B 2A9VA 2R4TA 4I5IA 2O2CA 4REQB 2IYUA 4YLEA 4NCAA 1DTSA 1SVSA 1P2GA 5EEHA 3BULA 3KP1A 5EQFA 1EJ0A 4HWOA 3HWX1 4RZXA 4W1RA 1KI9A 1PR1A 1XYVA 3AG5A 3EEBA 3FMVA 3L8GA 1CPYA 1QG6A 4FSXA 4FYYA 4LHYA 3RJZA 3Q8MA 3FDFA 5AHOA 4XFJA 5F73A 1QLJA 5EZYA 3DL7A 4Q7JB 2OPHA 3UFXB 4BTLA 3H2HA 2WYOA 4EEXA 3Q7EA 4M86A 3RS8A 1YJBA 2OZVA 2AZTA 3C14C 3DOEA 3GEEA 3TLKA 4TV8F 1A9OA 1XQ1A 1GUYA 2XV1A 4MDYA 5JS1A 4MV5A 3JVEA 3QBEA 1WS6A 3AR7A 5IYZB 4WBNF 4DLTA 5P8WA 1BXZA 4YMHA 4HUJA 4Q9HA 4IIDA 4XSGA 3JWEA 3OJOA 5FO1A 4FSDA 1X1RA 5H59A 3DDZX 5TT1A 4BLWA 2JGAA 3KPUA 3FWHA 5E4TA 1KI6B 5CA0B 3F47A 3DAYA 1QV7A 3UTCA 1LBHA 5J59A 4YT2A 5JSUA 2WJYA 4RLFA 2B4RO 1YKFA 4DA9A 1VLQA 2JLWA 1E9EA 1KYZA 1WQ4A 3WLTA 4ZGGA 2XBMA 3BF7A 3WLJA 4BASA 3VMMA 1X7GA 3C7KA 2HBQA 1ZLYA 1USUA 2WFMA 1O1YA 2WR8A 4TMTA 3UHFA 3WI7A 2Q3LA 3HVHA 2JCXA 2LIVA 2QTZA 1VCMA 1F9EA 2HQBA 4J1TA 4LPKA 4OSOA 3T7IA 4C03A 4B84A 2VHYA 3QI2A 5DDIP 3SI7A 4Q4DA 1R0BA 16PKA 2G5PA 2I3DA 4WCFA 2IU4A 2ZP1A 3KAKA 3I04M 4ZVRA 4O59O 3WRVA 2GZSA 2JVIA 2VPYA 2VQ3A 1GG8A 5DVZA 1DRVA 1W5TA 5CFQA 1YIAA 5G0VA 2DLCX 3E7WA 1LI7A 3CEAA 2I33A 2RJNA 4EG7A 1VI2A 3NH6A 3KZKA 4RV5A 3TJRA 1B0PA 3BQNB 3COWA 4E08A 3DG9A 4QJ3A 1FJHA 3HBNA 3DCYA 4FEEA 2O1SA 3DR3A 1CERA 2G80A 3C98A 1UBRS 1XI2A 3KOOA 3GEMA 1MAUA 1KO7A 1V3TA 2I67A 1ZISA 3P52A 1YL7A 4XDHA 3EY9A 1IYZA 9ABPA 1Q0TA 1QGED 4ZI7B 4UZSA 4MKXA 1N5KA 2IYWA 3GBSA 3DLIA 4ZCSA 2WMOB 4Q7KA 2ZUBA 4MV6A 1EHIA 4F3KA 3EXFA 1F2UA 2XX3A 3IMEA 3MNFA 4M1WA 4NI5A 4S1TA 5D84A 4BEJA 2DGDA 2VF7A 5TE9A 3TKLA 5LZ4A 4IGKA 4B3DA 1M5TA 4PAMA 3PEVA 4GPZA 1QRTA 4EHLA 1FL9A 3WKAA 1M1YB 1PZGA 1EJBA 3N6VA 2A9PA 3H99A 1ORDA 3ADKA 3NNDA 3OIUA 2NU9B 3TFQA 4BKRA 4ZK6A 4KL8S 3NO4A 1KK2A 3OIVA 3PTZA 2OO7A 2QLTA 4WCFB 3QTTA 3KUXA 3SC4A 4BGDA 2H4XA 2W6MA 1ZH8A 1O8BA 1NV9A 3HL0A 2C4KA 4EHAA 2WV7A 3IFSA 2RK4A 3ZWWA 4D99A 1RM3A 3VR5H 3OIYA 4RACA 3CXUA 1GSHA 3ZV4A 1PUJA 1JDSA 1TL7C 2OV4A 5FPSA 1EM8A 1DVRA 2JA1A 1CUBA 1TMOA 3ASVA 3GRZA 3M7IA 1RPTA 4Q02A 3EA5A 3R9XB 2HU8A 4PX3A 2ZTMA 3SY8A 1C3OA 5AI6A 3QVMA 3G2MA 1H66A 2YJZA 4JVNA 1P2SA 4FDTA 3HK2A 2AOUB 4KVFA 1U8XX 5EWMA 1YS9A 1KXZA 5H1YA 4RTOA 4FMCF 1V1RA 3A6KA 2HD4A 5SICE 4R71A 4IQ0A 3LAWA 1FDRA 4A1OA 3UKDA 2GESA 4MW4A 1LLCA 2BKAA 3PDCA 2WSLA 4FGUA 1CDDA 4RPHA 3CR3C 3IPXA 4XW2A 4AXBA 3U1VA 1Z28A 1GYRA 4IM7A 4MS1B 2BRUC 1I4WA 2PG3A 3O7WA 1ABBA 4ZDJA 2PX5A 3PUIA 2XKAA 1AO0A 1Z4PX 4JLSA 5EJ4A 4I6GA 2HM7A 1B8PA 1KHTA 5JSZA 2OXTA 3D8NA 2TRSB 1VYUA 2WU3A 2QROA 1U7OA 4LRQA 4R3WA 5BWNA 1RFGE 2KE5A 2J31A 4W63A 5EP3A 3TI7A 2JFHA 3AL3A 4QPNA 3WMXA 3M6WA 2Q2WA 1TVKA 2VJNA 1C8KA 2G0TA 3CY6A 1EM8B 3PX7A 3DZDA 2YDXA 2ZCVA 1CIJA 1FDOA 4PICA 2E4VA 5EMNA 4QUKA 3V1YA 4H0FA 4RMJA 5LQRA 1C3OB 1YIDA 2CK3A 2GASA 3DYIA 3NKVA 2XMBA 4DLNA 1UZMA 4MMXB 5JASA 1EXWA 2P5SA 3IAS6 3JQFA 1P0FA 1CZKA 3GL9A 2UUBB 3S99A 5HJEA 2QI9F 5EWMB 1JPNA 1QTIA 3E5MA 3X2EA 4MP6A 1SQ6A 2JRCA 2C7OA 1KYQA 1YVPA 1V3QE 4RCVA 2IP2A 2VVTA 3MTQA 2PGAA 4IIXA 5FOWA 1WXIA 3ACBA 5E4FA 4YP6A 3WK4A 2ONJA 5I7OA 2GNAA 4FZ5A 3LCRA 3M8KA 1JEYA 3CZPA 3KJNA 1E2NA 3TJZA 4GP7A 3ZCVA 1YQUA 3QMWA 4X66B 1IJKA 5B57C 1TLLA 1V3VA 5SY6A 2VNIA 2GEFA 4JUAA 3OEYA 2IZ5A 2CHGA 3ID6C 1U1IA 3TSWA 2ROQA 1ZQ1A 1Y33E 3T7TA 3EXAA 1GQSA 2ZRJA 1BDMA 2J85A 4RXUA 4TXJA 1TVKB 3I58A 3NHPA 3VDNB 1JI3A 2J5RA 2VTDA 2NO9A 3DH0A 3VX4A 4DLUA 5JATA 4P0QB 3CZAA 3JVUA 3BT7A 1ZIDA 1YDHA 1U02A 1XAIA 1YR8A 4GGPA 4EB3A 3Q8LA 2F8LA 3GRRA 1E6EA 4ZT7A 1OASA 2ZWOA 2AN9A 4HQFA 1VC2A 4NBVA 1E8MA 2AK2A 2B4TO 3KTAA 4RFSB 5ALLA 1ETHA 3T3DA 4CT4B 1Z0SA 1WMFA 1KQ3A 3HJCA 3CVYA 2LKDA 3LC1O 2GZMA 4FJ1A 4MWGA 3N75A 3W5IA 1ZCJA 3C5VA 4ILKA 1FMJA 1M2OA 4XM2A 4DWWA 4X60A 4HDKA 1L5HB 1C9MA 1NI4A 1UJ5A 4MR8B 1NQAO 4DNQA 3WA7A 1JG4A 3MD0A 3C43A 4BLQA 1T5TA 4D4MA 1YBHA 2JFFA 2LUOA 1JTVA 4B80A 2R86A 1KNXA 2O05A 3I23A 3C3XA 1JMKC 2K7ZA 5EP2A 2VUUA 3ZWCA 4B6JA 1ZD2P 3CX6A 4XLZA 1DQPA 1YVUA 4PE5B 4WFQA 1D2HA 3LQQA 1NE7A 1XDBA 2JFXA 5MN5A 3UJHA 2WI8A 4YWHA 1RQ2A 1WOYA 1CF2O 4YO8A 4UFNA 4K26A 5FBQB 1FZQA 2DPHA 3VOBA 3SXUA 2I6GA 1P62B 4A7PA 5I47A 2BT4A 4LX0A 1HEIA 3U13A 2HWUA 2OBMA 2QT9A 1CT9A 3IA7A 4EUNA 2YY6A 3MSCA 4IDHA 4AF8A 2BHTA 2IXGA 4DDVA 1HYEA 1K7XB 7ADHA 2BFCA 2QZ4A 3F49S 4GL2A 1Y1KE 1IM2A 1JDVA 2HA7A 2PA0A 3A7EA 1R8YA 3F8WA 4G84A 4AICA 4C0AC 4UHJA 1P60A 4O2AA 2O7RA 3ZIUA 4EAAA 2GD0A 2X7XA 3AKDA 5BSGA 3Q0EA 2WHQA 4JDUA 1DXYA 4HS4A 1ULBA 1TW3A 3U56A 2DHRA 1KRWA 2EBHX 3IODA 5GJBA 2PKXA 3PGMA 5TLSA 4HFRA 3ONVA 1M2OB 1EWYA 1T5OA 4X90A 4Y2QA 5DNVA 3R7BA 2P78A 4C6HA 2PAAA 4JJAA 1H05A 1VLMA 1KJYA 1E0DA 1TEVA 2WIGA 1HSOA 4KXWA 4LZPA 4O1IA 2EBFX 2YV2A 1PR4A 4KAAA 4ZOLA 3ZR4B 4D3SA 4ACBA 1CVLA 3PQDA 2SCUA 2OXRA 2E85A 4QPPA 1HOTA 2IL1A 4AECA 5DTRA 4ZTBA 7GPBA 1BQ3A 3L7MA 5EAIA 3CLHA 4KGZA 3M3DA 3HKCB 2EX4A 1E3QA 3IJRA 1PSWA 4KN8A 4RVOA 5FUYA 4CM6A 5COQA 4IDAA 4ND5A 2C77A 3A4MA 1S01A 1L5ZA 1PZMA 3DUWA 4O4IB 1U90A 4C7JA 3F6SA 3KWFA 4CWAA 4US1R 1K7YA 4R8SA 4I8XA 5LQCA 1I6KA 1XT6A 3S40A 2I65A 4JUIA 4JQSA 5AHXA 4BMCA 5P21A 3TXAA 2BEKA 2YH2A 4RK1A 5CP8A 3U4GA 2OE2A 5HZMA 4BMDA 3MBKA 3V7NA 1JWAB 1U7ZA 5HRCA 3IA2A 1UANA 4Z1MD 2WW8A 3VAAA 1R3UA 2M6SA 2OXCA 4Q82A 3QBTA 3GUYA 3WL7A 3R3XA 2VG8A 4B3BA 5KYTA 4GBMA 1T3GA 4HGZA 1R0YA 5K6AA 3JYQA 1YD7A 5DNAA 4ZOLB 5HDQA 1CUGA 3WLFA 5HE9A 2JD2A 2PX0A 3H65A 4TUYB 3UXMA 4YDSA 3AUXA 3EBOA 4EJSA 4UKDA 3NUZA 2QMUA 1M1XB 1STOA 1ULAA 4YXFA 1C3XA 1WUJS 1YRWA 2CDCA 2QL6A 3HB4X 1C7EA 3HMKA 4TYMA 2IGTA 5AOAA 1G7RA 5MHTA 1AKTA 4B87A 4J29A 5CLQA 1XHFA 5G3YA 4N18A 2XTZA 4EX6A 2YV4A 4PTYA 4C4SA 2F00A 2NGRA 4P2GA 2I91A 1H2WA 3PNLA 3R5SA 5AICA 2FQ1A 1GQ2A 1T6NA 3L1VA 4MUIA 3QPCA 4NK5A 4OJKA 4D56A 5BQFA 1C0PA 4HK4A 5ICMA 2R7KA 2NT3A 4C6TB 5IF3A 3RV4A 1A9XA 3VJMA 2P2GA 3OQIB 1E1QA 4UCWA 5AP9A 5K4HA 1PGPA 2KLHA 4YS6A 1VG9B 5IKOA 5TEVA 3S2FA 1L4KA 5KNLA 4MVJA 1HG1A 4BLPA 3VR1A 5KQGA 1JG6A 1E8DA 1HF3A 1NURA 3ELBA 4R31A 2VFAA 1KTIA 3E9NA 3ZLJA 4C2TA 1J00A 1GZUA 2A0YA 3OKCA 1E2IA 4XX0B 4A4DA 3WGOA 1XAGA 3AZPA 3WWCA 4Q05A 2V7EA 4QM7A 3MYYA 4PINA 4JJIA 1ESDA 3STUA 3I4LA 4CEHA 1C3LA 2ZAYA 3I64A 1XRRA 3G2LA 4ZYUA 5ALFA 1VPWA 2Z6VA 4A8JA 1EFRD 3QFHA 5F7ZA 3NU1A 4F4FA 3LCUA 1IATA 4F5WA 3PWZA 2EFHB 3WO0A 3LFHA 5AUNB 3ETNA 2BGNA 1YZLA 1MVLA 2QUKA 2DPYA 3ESZA 3RAFC 3AVXA 5EIBC 2I7XA 4QOJA 3TN7A 1Y0BA 2AJBA 3R3VA 3SEQA 4J4BA 1P80A 1DAKA 2F43A 2GNPA 3WK8A 3G17A 3Q5EA 4MUEA 4F45A 1XKQA 4ID3A 4W8HA 3TRDA 1KO4A 3KR2A 3GCZA 4QXPA 5HK9A 3I3SR 3LWBA 4F2WA 1SPBS 3L7JA 3H97A 4AVYA 2AV6A 2WJGA 3BYZA 5JXHA 5AM0A 1M8PA 4BGEA 1WXXA 3ZLTA 4LOJA 1XLUA 1R00A 2FSIA 1NDHA 4Q1VA 1JDNA 3OPYA 5A04A 4ZHQB 1J0XO 1OGJA 2GEVA 4PTZA 4L9WA 1YRBA 1O94C 3QF4A 1HLPA 4ZDWA 5NULA 3L1HA 2XWSA 2AG1A 1GL6A 3ZGXA 2QLMA 1M10A 4PPFA 3RCBA 4LN1A 5FBZA 1CJBA 2Y0BA 3LFTA 2DHCA 3CXRA 1K5GA 2R25B 3EIEA 3KAPA 3ON5A 3TYXA 1KMHB 2PY6A 3OE5A 2Q4DA 4ZAZA 2D7JA 4B43A 5K0TA 3O0DA 1NZFA 3ZY4A 4MVWA 1YL5A 4MROA 3GN1A 2HF9A 1GHTA 4ROTA 1GU7A 2F43B 3ESDA 3ICCA 3EUWA 1FUYB 5A3QA 1ICEA 2JZNA 2AH5A 3W79A 4XQ0A 5KTYA 2BD0A 1JLKA 1W5BA 2E6UX 3HSKA 3SJ7A 1HDXA 1Z0KA 1RYDA 2OORC 4MH0R 1Z8NA 2Z58A 3A1DA 3EZ2A 4XZ3A 5LXTB 1EYZA 4Z4GA 1CZHA 3T52A 2HN9A 3GEGA 3B51X 4KU4A 5DGDA 3D6MA 1MRZA 4JNKA 5BVGA 2AG6A 2B9VA 5ESDA 2D5LA 2JKVA 3C3YA 3K6SB 1YOBA 5IFLA 5CPBA 4I6JA 3PRKE 2I4NA 2JKZA 1CY1A 4OG2A 5HZHA 3RT9A 1TTHA 1QH8A 4G4JA 2XYPA 3GR6A 1H2AS 1M34B 1TF2A 1Y1QA 2GKGA 3L6CA 2FFHA 3PV0A 2PWBA 4YJ3F 3AF1A 3ZXSA 1R6VA 3QWFA 5FR1A 3LKZA 2BGGA 4W4TA 2D59A 3D7MA 4H17A 5ESWA 1U1FA 3ZQJA 4ZHSA 3HH8A 4JFRA 5JH7A 3M6MD 3P94A 2P6MA 4G0YA 3CGGA 4ZRDA 2WDZA 4WJKB 5FKJA 1OAAA 4GSYA 2NNWB 2D1SA 4AUEA 1YOVB 4XLLA 3PDIA 5DRYA 4EOGA 1KVUA 3WDMA 3IEMA 3H9UA 4HPXB 4U2FA 5IWAB 4KR6A 1F2TA 3LI2A 3UQZA 3FN4A 2SBTA 3HBLA 4A6PA 4C88A 2VJCA 4S04A 3VHXA 4O4JF 10MHA 4ZO7A 3RVQA 2I80A 1UDCA 3KCNA 4NBLA 3VR2A 2FP4A 5IAKA 1TPYA 2Q28A 3SQLA 5AYVA 2YV5A 1GNPA 3S8EA 3UUWA 4ARSA 2V45A 1BU5A 1OBHA 2QJWA 4HYEA 4XJXA 3ZWMA 5IXSA 2GYWA 1K2VN 4F6RB 2ERCA 4JBNA 1GNRA 4RTRA 1PJBA 4OLHA 4ZT4A 2WKPA 1N6RA 1JVSA 3P4XA 1R0XA 2FKAA 3M1AA 3LUPA 3OMLA 2GN1A 4KOAA 4EUKA 4ARCA 3UN1A 4C76A 3V9PA 4YRLA 1JSZA 4QOIA 3T7KA 1WEKA 3AR6A 1M2VB 2EP7A 5KSYA 1F4LA 4N5DA 4YI5A 4TXNA 1VA4A 3LU1A 2C5EA 1SG9A 3CH5A 4DZRA 3L1IA 2WD7A 5KVVA 1UQUA 4WOBA 5IZCA 2ZUFA 2GFQA 2PUFA 1UEJA 1A4RA 5LYJF 1QB8A 1SHTX 2GARA 2VPXA 3ZW7A 2VAMA 3E6AA 4LMPA 4B47A 1MDFA 1DWUA 3DXXA 1HXHA 1XLWA 3L4KA 3AMVA 1HL3A 1KETA 1WDTA 3PA8A 4BVGA 2MOKA 3VDMA 1XJWA 3MUEA 5BMVF 4HDNB 4RDIA 3RG8A 3VZSA 4R51A 3OZUA 3OHSX 5BR4A 3GUUA 3D5QA 1UBLS 4ZJPA 2XB2A 4ZT6A 1BFKA 1UMKA 1Z4NA 2GLXA 3BF8A 1I2DA 4L85A 4MV8A 3MCZA 5BSHA 4L7QA 3M1YA 3HI4A 2H92A 1G3UA 3RYFB 4YJ2B 3AXTA 3DL0A 4B4WA 1DKMA 2VSXA 3B6EA 1N0VC 5BRJA 5C3UA 3ICEA 3H9JA 1EK2A 3KIPA 4MO9A 1B4DA 2OAEA 4Z8XA 5FUBA 5JFOA 2B6NA 1Q21A 1X1SA 2PGLA 2XUFA 3B9BA 3NHWA 1YCGA 3FR8A 4L6CA 3MWJA 4YDRA 2H16A 1HDIA 3U9TA 4OOFA 3EGVA 1ZAYA 3E8SA 3PGKA 3EIUA 4H6XA 2CDNA 3NHKA 1RP7A 3DFFA 1E61A 3PHCA 1SKYB 3H11A 4JBIA 4ENRA 2WFLA 3GUHA 2BELA 3FNRA 4UXJA 3O3NB 3N7TA 4DYDA 4WL0A 4FD2A 3AKZA 2PTGA 3VR4A 5E7MA 1G7CA 2FEWB 2AGVA 2XDQA 4L2IA 1W25A 1VGRA 3E7FA 3A4LA 3PXBA 1IEVA 4KC0A 3SJCA 3ZCSA 2QM7A 3BL6A 4BLSA 3EPKA 3CH6A 1MV5A 1ZUWA 5FUQA 2ZJ6A 1QH1A 2VTKA 4BHTA 1QIGA 3EARA 4BKUA 3FDXA 1L1FA 3PQ8A 1F14A 1WKVA 2CLCX 2YJ3A 1Z36A 3B53X 5KYKA 1ADGA 3PIDA 1Y37A 3NM5A 2HUPA 2NSHA 4F5EA 2VXBA 3K09A 4ILEA 5J4HA 5LMCA 1ZEMA 2EU8A 4D9NA 3ESXA 1OT5A 2FEKA 3OCYA 1KBQA 1UADA 4GOLD 1V37A 4PCAA 4UPDA 3L0DA 2W4MA 3ZU3A 4BVHA 3AHDA 3GRYA 721PA 4N0PA 4N5MA 4COKA 2WPDA 3MK31 1EFCA 2VK2A 2IS6A 4HDSA 3K05A 2O8FB 4QOGA 3SQDA 3DAPA 2WLSA 3H2IA 4YV0A 4RF3A 3ZJYA 2BTQB 4H77A 2QXTA 2ECPA 3MB8A 3VNQA 4RTKA 2XUGA 5TNXA 1Q2XA 3TM5A 1W2HA 1JHXA 1INLA 1CULC 4B6RA 3GD5A 3UCXA 4H2DA 4WZBE 3BXHA 3IS3A 3VSDA 4OXIA 1N8TA 2W2OA 3PQ5A 1ZN7A 4MVJP 1KYWA 1A76A 1ARZA 1BWRA 1OFUA 2AEMA 4GZ3A 5EZYF 3WFZA 4DMCA 3QW4B 2XYVA 4M53A 2IYSA 3REQB 2EX1A 3D2BA 4KO4S 1WXDA 2PLRA 4AUMA 1GKYA 4H27A 4AWXA 1WHTB 1EB8A 3PUVA 1JMYA 1HORA 4TX1A 1SBYA 2VDUE 4KOEC 4F7DA 1UUFA 3GJZA 3PGA1 3NRBA 4PZPA 3UXEA 4FEAA 1R0LA 2VJLA 2PX4A 4GX5A 4NZ9A 4OBXA 4LZJA 2VJKA 4FYKA 1I4OA 5J9FA 3QVXA 5KX5A 4OA5A 3TAUA 4KLAA 5EWLB 1IXSB 4UD6A 3RF6A 1XAJA 5K0FA 3QIAA 3RJ5A 4UNNA 2PX2A 3OCVA 3IMGA 3QKTA 1CY4A 3SBEA 1PWEA 1MAVA 1SZPA 1ZNYA 2VYVD 2WUFA 1LVUA 4LMBA 1MQSA 3PGVA 4PCVA 4RD1A 3E7XA 4KQKA 5CD9A 1QC5B 2GXQA 2ID4A 2EARA 1E2FA 2IPNA 4NS4A 3HABA 1WMBA 1U8AA 4QRIA 4X1KB 4F12A 2JLZA 3HO1A 2NTJA 1G8HA 1RWWA 2Z5LA 1NY5A 3ILHA 5CVUA 1PV2A 1TM4E 1YU6A 2BEVB 4OREX 1M8JA 4EJFA 2O1WA 1WVIA 5JXIA 2Q4EA 3U7HB 1GKLA 2C95A 1KY3A 2FWJA 1NRIA 2RHWA 4X1OA 2FMXA 1N2OA 3ZHXA 2GHIA 4IICA 3K0BA 5F23A 4ITUA 3GDGA 3HKDA 3QE2A 3U3OA 4EUSA 2EQBA 3NQ41 1RAFA 2A67A 1JDZA 1KFCB 5EMLA 3I1YA 1Q0ZA 3EN0A 1I7NA 1D2CA 1JDBC 1LK0A 1CJVC 3A14A 4TLAA 1VE6A 2EKPA 2QE7A 1KAMA 4EGFA 4WIAA 1LA2A 4WTOA 2XB6A 4YO7A 5EJ2A 3OZVA 4AYTA 2HLHA 4CCAA 1YFKA 5KTSA 4B3RB 4F2PA 2O0HA 4B3SB 1WUTA 4N54A 4WKCA 1O2DA 2E3JA 2B82A 5E8RA 3KPJA 3WHKA 1ZGBA 3MRVA 2RGXA 3KUDA 4NATA 4I5EA 4BFTA 5JS2A 4RTQA 2C8VA 2ZUCA 3BIFA 4G5SA 3QNMA 4TKLA 2BY4A 2ZSDA 3ICVA 3PC4A 1RU3A 1B26A 5BSMA 4F4IA 2HI0A 6YASA 2WG2A 3AF0A 2DTEA 2JI4A 2A33A 2PKWA 4P7GA 1Q17A 1U1DA 1Q0UA 2ZDQA 3O7MA 1FY2A 4O4LB 4LEIA 4DCUA 3D3QA 1DWOA 3MWEB 4QYIA 1VKJA 2RMKA 3RBZA 1G21B 2R3SA 4RZQA 4F91B 4GDFA 1OYVA 3H4VA 2HADA 3FHOA 3MGAA 3RJ9A 1BE1A 1ID1A 3W1VA 3HHEA 1WJGA 1P4RA 3NTQA 5JPCA 5IT0A 1KAQA 5L7YA 2QQEA 3LCJA 3L82B 2Z30A 1GNTA 2A9JA 3DWGA 5DI3A 3SYRA 3HKDB 4EG0A 5DX8A 3GRVA 2C88A 3C7CB 3W6NA 3DD5A 4MWOA 3UMYA 1KC3A 5KYUA 4HEHA 1LV8A 5IAGA 3O8LA 3LDFA 2PX3A 5D3QA 4Y1EA 2D7DA 4JJEA 4F8YA 3Q4GA 2WU0A 2R1VA 3PJGA 3IX7A 4CV2A 4NK4A 4RSMA 4X6UA 2LCIA 2ZR7A 1KGSA 1QCYA 4D6PA 4BMOB 1XCBA 2ODAA 4FU0A 5FJIA 4OQQA 4JLPA 4MV7A 5A0VA 3EEIA 2R6DA 3JSXA 4IRMA 4PCLA 1ZUIA 3DL4A 5H80A 5T6MA 3T0FA