2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
3VZSA 2W98A 4W7HA 4IMPA 3D4NA 3QE3A 4CL3A 4PG6A 2P5YA 4YR9A 3OQ6A 5BT9A 1C14A 3WIDA 3ROPA 1EUDA 2B69A 3VH1A 1JDJA 3RBXA 4YAIA 1CJCA 1KVQA 1VSVA 1MGOA 3PWKA 3ABIA 4FBGA 1S7CA 4MVJG 1FDWA 1I0ZA 1T1SA 4YPOA 2C54A 1PQPA 3AY3A 4BNXA 4PN3A 4MJLA 2ZJ1A 4Y6PA 1U5CA 1LDNA 4QUKA 1DC3A 3DBHA 2V65A 4D3FA 3OH8A 1H9BA 4DC0A 3TZQA 5L4SA 1CQJA 3M2PA 2GD1O 4B7XA 4EJMA 3V2UA 3OICA 2HMVA 1P3DA 3GFGA 1I24A 3IP1A 2JCVA 4E5YA 1NR1A 2ZTVA 2NNLD 1Z75A 1YL5A 5JAZA 3L6EA 1NBOA 1PZFA 2FZEA 1L7DA 3PFFA 4WE3A 2FR1A 4RVDA 3VTZA 3MTGA 3GOHA 2OBYA 1V35A 5KWEA 3HB5X 3PJEA 2VHYA 4AJKA 3DC2A 5G0WA 3TZKA 1Z7BA 2Q99A 3K5PA 3NKLA 5LDHA 5JCXA 2NTVA 3JSAA 1LU9A 3SLGA 2GCGA 4NBRA 2IE0A 2X6TA 4BNNA 4QO7A 1T2DA 1V9LA 3CZRA 4NBWA 4CLXA 2YY7A 1JVSA 1NM5A 3ETGA 1JLLA 3LT1A 4XYEA 5DBFA 3HDJA 5TT0A 1AXEA 1O6ZA 2WM3A 3B1FA 2W8ZA 1F8GA 3SXPA 2FWMX 4BV9A 4LRTB 5IDWA 3GRKA 2JJYA 4BMNA 1ZNQO 1KC3A 3OP4A 2PH5A 1FJHA 5DP1A 2RH8A 3V2HA 3VPGA 4PLYA 3NGLA 5LCXA 3STHA 4CR8A 2XXBA 1PIWA 4RLSA 3H6KA 4IS3A 1QV6A 2B5WA 2IEBA 1EVJA 4YQZA 3E9MA 3Q6IA 2G0TA 4DQUA 2WJPA 4J91A 1GUFA 1X13A 3M6IA 5JMWA 4CMEA 3U9LA 4PGFA 3BMCA 5C7LO 4RVFA 1WP4A 1GZ3A 1LDBA 5KNLA 1ORRA 5EMHA 3A06A 2YDYA 2X9NA 1ZEMA 1T1RA 4NBVA 3IS3A 1DLJA 1SMKA 3I6QA 3A9WA 3UH1A 4JN6B 3GF4A 5JSFA 2Q1WA 4FS3A 3WOHA 8ADHA 4PLTA 5TIIA 4EJ6A 1X15A 2YYYA 1LSSA 1H9AA 3QA9A 5IAAA 1LSOA 3RUDA 4RPHA 1R4MA 2FN7A 2RCYA 3AK4A 3LQFA 1U3TA 1WMAA 1MXHA 4IDAA 1L7EA 3G1TA 2G76A 5I7SA 4IZIA 2ZB8A 3PLRA 4HXYA 2FHSA 1XHLA 3PFWO 1BDBA 1EFLA 1YS4A 2JD1A 3C7DB 4M86A 1VJ0A 3O38A 4O63O 1WAMA 3RASA 1CQIA 4ZU3A 2PWZA 3D0OA 1QG6A 3I1JA 1N2SA 5A3VA 1I8TA 4BO7A 3B6ZA 1V8BA 5FI3A 1PGQA 4RPGA 4OH1A 3WIEA 5JC1A 4LMPA 1ENYA 3JYQA 1ZK0A 1TXGA 3CIFA 3PHJA 4WCDA 1BTOA 1UP6A 5DDIP 4XA8A 3VH3A 3ZZNA 3PJDA 4FD3A 1K3TA 2CUKA 2JL1A 2ZKLA 3IJRA 1ZKMA 1M2WA 3DWFA 1I5RA 2AW5A 3OA0A 1PWZA 3WNVA 2FOIA 1HKUA 3FN4A 4D45A 3WGOA 5FEUA 4N54A 1QP8A 4WNCA 3ANMA 1PS0A 2HAEA 3AOEC 3H5RA 4HX5A 2UV8A 4I5FA 3ZV5A 3FPCA 4LN1A 3N58A 1DFIA 2NUAA 2IXBA 4LRSB 3ZNNA 3HHPA 3AI1A 5T64A 4ZQGA 1K89A 1NNUA 4ALNA 2AA3A 3SBOA 2NTJA 3V5NA 2VZ0A 2VRCD 3IDSA 1DXYA 4ND1A 4I9NA 4O6VA 1PS9A 3F47A 3K2BA 4BNJA 3QVXA 1P74A 4KDEA 3BMQB 1PZGA 4B8ZA 5A1TA 4Z0TA 1RM3A 3H2SA 3TNLA 4E2YA 4HFNA 4ROSA 4BMVA 5A06A 4OQYA 4S3MA 4RVUA 3Q9NA 3KYDB 2J8ZA 4KWHA 2B0JA 1HDOA 2JCYA 1X1TA 3RWBA 1CIVA 4JXKA 2VYVA 3PXXA 3ZWYA 1WPQA 4BL5A 1NQ5A 4WLNA 3GNQA 1FDUA 2HJSA 5I9MA 3I9MA 3Q2KA 4R68A 4A73A 3EUWA 2VYND 2YDXA 2VUSA 1EK5A 4G65A 2JFGA 4MIOA 1E1MA 1OC2A 1K2WA 1XQ6A 4ZQEA 4BNWA 1YKFA 5I9NA 4JLWA 3C7AA 1JWAB 4UULA 4CMIB 4RO0A 2O3TA 4CLOB 5T57A 5BSEA 1RYEA 5FWNA 1WXDA 1D1TA 4CM1A 1DFGA 1GFSA 4LCJA 2GZ2A 4R3WA 2J3IA 4U6QA 5A5FA 4XYMA 1V3VA 1XIVA 1GEGA 3SX2A 3H7AA 3RROA 2VWPA 3GZ4A 4FDAA 4NBTA 3PDJA 1PWXA 3V1UA 3JQGB 5C3MA 1MC4A 3ZWWA 5KJ1A 1AXGA 4PZDA 1GV1A 2AQ8A 5T5QA 1DIHA 2VUUA 1J4AA 4IBOA 3ONEA 1DDOA 3IQDB 3UXYA 1VL6A 3TL3A 3RUCA 2C0CA 2IXAA 4IIUA 1W73A 2O7QA 3VDRA 1KEUA 3ZWAA 2I6TA 3HG7A 1BG6A 3Q3CA 1KVTA 3Q0EA 1HXHA 2PTGA 2ET6A 3FF4A 3JCZA 4BB5A 2V7PA 2B37A 1HDRA 2V6BA 2Z95A 1M67A 3RUAA 3ORFA 3VOSA 4AJOA 4MOWA 3A1NA 1BRMA 3I9LA 1JKIA 1IPFA 4N5NA 4WKGA 3GZNA 3ROKA 1PJCA 3S1LA 1UR5A 5JDIC 4J4HA 1O89A 1C3VA 5A9SB 1H2BA 2C07A 1VPDA 3BMQA 5COBA 1LA2A 2FP4A 4RDIA 1DSSG 4WOKA 4E6PA 2P9GA 4BNZA 3ZNOA 1AHIA 3K6JA 1AN9A 2O3JA 1LRKA 3GVIA 1XG5A 2NTNA 3LF2A 2HCTA 3G17A 4GX1A 3A28A 4G81A 1NQTA 1HE4A 5ITVA 1J49A 2AG5A 2Q45A 1XEAA 2GNAA 4M8SA 4KDFA 5C7OO 4DBZA 4RPLA 3TPCA 1GUZA 1E7QA 5G0UA 3NEPX 5COQA 4Z0PA 2NQTA 3L77A 3K73O 4TSKA 1LSJA 4NHEA 5G4LA 4BKRA 3AUAA 3RUHA 4ZHSA 1DOHA 4BKPA 5JAIA 2OBNA 3BHIA 1C1DB 3ZWCA 1NHGA 3K31A 2EHDA 1GZ6A 3ETDA 2OOSA 3RJ9A 2Y1OA 3D4PA 3LC2O 3OMLA 2CF6A 3PZRA 5CAEA 3BMNA 2PGLA 4CLRA 4H7PA 3PIDA 1WDKA 2PFGA 3KSDO 1KC1A 5IZ4A 1E3JA 4DIBA 2W2LA 4MVJH 3GNSA 4FW8A 4UEOA 2RAFA 5ENVA 5JY6A 3SVTA 3MJCA 1EVZA 5IZCA 1B16A 3WBBA 5KCZA 3GQVA 1A7AA 1Z82A 2O50A 4NH4A 5BSFA 5L45A 5JY1A 2I66A 5MDHA 2AQKA 3DBLA 1ARZA 4WCFA 5BR7A 1O94A 1QORA 4ALKA 4OSPA 4HUJA 3IP3A 3GHYA 3OFSA 5KIAA 3V2GA 1DIAA 2X0NA 2JFFA 1XU7A 4KTTE 3E8XA 4LVUA 5L4LA 3DONA 4WNIA 3ADPA 1U3UA 2HSDA 4IDCA 1H5QA 2J5QA 2VT3A 3WSVA 1CEQA 3DTTA 3VZRA 1ADCA 3ONDA 4L74A 4ZGWA 1YB4A 1NX6A 2C29D 4PG8A 1MG0A 4PRKA 3PQEA 1UZMA 1J5PA 1DAOA 2I3GA 3ICPA 4PLZA 3IJPA 4D43A 2RH4A 5KVSA 4RJTA 4CMCA 1WVGA 3DXFA 3FBGA 1PSDA 4MVJD 4ZVVA 5IDXA 1RWBA 1EK6A 1HE5A 4FOSA 2X22A 2WE8A 2AMFA 1PEDA 4MVJA 4W9NA 1VKOA 1EZ4A 4II2A 3K2EA 5JMPA 3QJ5A 3U49A 2HMWA 3VKUA 3ZHYA 5IF3A 4OGWA 1SZJG 2R6JA 1GZ4A 2J6IA 2PK3A 3E18A 4PG5A 3I3OA 3LLVA 3NV9A 2VN8A 4A5OA 1HZZA 1X7GA 3U4CA 4W4TA 1U8XX 4M87A 1OAAA 1LSUA 3C7CB 1KETA 3TRIA 2CSUA 2LDBA 2IZ0A 4HBGA 4RDHA 2FPIA 2DAPA 4MINA 5FI5A 5A9SA 4B79A 2BLLA 2YV1A 3KTDA 3WGTA 4GSLA 2W90A 1EUZA 3A4VA 3X2EA 5CEEA 1IZ0A 4B7UA 3COSA 3FR8A 5A3JA 3RCBA 1GD1O 3QY9A 4BNKA 4DLBA 4TVOA 4RZHA 1JW9B 1UXIA 4OM8A 2Q1TA 1R4MB 4XEHA 1N9GB 2FPGA 3OJEA 4DMMA 4FFOA 3ZWBA 3WMXA 4CQMA 5C37A 1LI4A 3GA0A 4I9HA 5ILGA 3ZH2A 2OUIA 3CSDA 4DTIA 1YDEA 2TMGA 4E5MA 1SOWA 4IJUA 4B3HA 4B3IA 5KJCA 4W9NC 1KY4A 3BYZA 3ZHXA 4NU6A 2G5CA 2PLAA 4K6CA 4R5MA 4ALJA 4B4VA 5THQA 3QQPA 3U09A 1H6AA 4UUNA 4WLEA 1E6UA 1IYZA 1ML3A 3LSYA 4AJ4A 3KVOA 4WLOA 3VTFA 2OL4A 3PZBA 5EL0A 1P45A 4FIZA 4GLLA 5IDYA 4OL9A 3IMFA 4IZHA 2DLDA 2D59A 4AICA 1U3WA 2V6MA 3WXBA 4BS9A 1ZK3A 4B4UA 5L51A 3BTUA 4KWIA 2A9FA 5F1KA 1WZEA 3P2YA 4MP3A 1P1FA 5TT1A 1ISMA 3JYOA 4A03A 4RVSA 1PJSA 4EEZA 3ANLA 1ZW1A 4LISA 1HL3A 4OQZA 4X54A 1ZBQA 2C5AA 4I9UA 4DBVO 1RM4A 1WZIA 1VE9A 1I32A 3R6DA 4UEKA 3S2EA 3ZU3A 4KUGA 2QRKA 4GWKA 4CJXA 4WEQA 2ZJ0A 3VH4A 3R3JA 5DBIA 4TZKA 3FRJA 3P19A 2VHWA 3QWIA 5IZCC 2D5CA 1BXKA 1CETA 4EUEA 2AEMA 1SBYA 4CV2A 1NHWA 1GUYA 2HU2A 2WE7A 3KEOA 1Y9AA 4TVBA 2OHXA 3GC6A 4AJ1A 3H9JA 4UVEA 4E31A 4W99A 1C0LA 4BNHA 2A4KA 4KUEA 3EK2A 4JK3A 4PZEA 1B0AA 1F14A 1PJBA 4YJGB 4OXKA 1Y5RA 1QLJA 4CM3A 4MKRA 1ISGA 1QYDA 1UAYA 3DOJA 1VC2A 2POQX 4BNIA 3FPLA 1P77A 5EIOA 3MJSA 2Y67A 2YHIA 3I9JA 5DOVA 4YB8A 1NPTO 4XQEA 4GVLA 3TOZA 2Y68A 1WDLA 3QWFA 3OSUA 1E1NA 1HEUA 1O8CA 1K6JA 5I9LA 2EXXA 3EY4A 4AVYA 3NT2A 1L1FA 3NRCA 4NJMA 1I3KA 5JS6A 4Z3KA 4DPLA 4QECA 3OM9A 4FPXA 5JW6A 2PD6A 4U5QA 3JQ7B 4MVJM 3QW2A 3VVBA 1HSOA 1AUPA 1JQBA 3OJFA 3FWZA 3IKTA 1ISIA 1BXZA 4OOFA 2Z5LA 5G0VA 4KQXA 4D42A 1R4NA 1Q0LA 2ZQYA 1R0KA 1B3BA 4AJHA 3GRPA 1B14A 2HQ1A 3ICCA 2PZLA 4BO9A 5DF1A 4CM6A 2BELA 3W6ZA 1GPDG 5MGBA 4TRJA 2X5OA 2WWRA 4B7CA 3GUYA 4Q3CA 2O2SA 2QIOA 1DFHA 1EVYA 3DDNA 3JQ6A 2D4AA 3K9QO 4M54A 4NQZA 4YT4A 4Z9FA 1R4NB 1Y6JA 2C5EA 1MXFA 4IQ8A 1YGYA 2PV7A 4J16A 4ID9A 2GO1A 4YRBA 1NYTA 3AY7A 1F8FA 3UF0A 1NWHA 1SNYA 3JQCA 4D3SA 3FR7A 4LSWA 4RF3A 4AJPA 1NAHA 4AJNA 3I4FA 4DGSA 3SC4A 1NFQA 1DRWA 1GR0A 5B4TA 1SEVA 1D1SA 3TDKA 1PGOA 3ZU2A 4CUKA 2BH9A 4BO3A 1HETA 3PRJA 3AU8A 4F45A 3GG9A 3KV3O 3F1LA 4CQMB 3WB9A 4E5NA 3KLPX 5DP2A 4L73A 4BO8A 2RBEA 2WYWA 3F5SA 4PLWA 5CDUA 1KEPA 1P1KA 4MVJP 2DBZA 3BMNB 4JJGA 4D41A 2VOEA 3B20A 3JQ9C 4OOEA 1DJNA 4Y8VA 1E7MA 5K6AC 1PZHA 2BF7A 2OO5A 4PLFA 3KBOA 4FSHA 5T8KC 3W8DA 1IUKA 2OORA 2WD7A 2A94A 2DFDA 2GR9A 5BNIA 3RC7A 3L4SO 4CV3A 3SLKA 3IIEA 1UUFA 1QKIA 4XWYA 3AJRA 3PPIA 1NPDA 4FGSA 5EJ2A 1U8FO 4Y9DA 5AXDA 1ZIDA 1QYVA 3K30A 1OFGA 2R00A 3F9IA 3GHHA 1YBAA 2BFPA 2PH3A 4NFHA 1DBVO 4NMHA 4RQTA 4HNGA 2VOJA 1N8KA 1ZXBA 2IYOA 4ZICA 5C5IA 4B3JA 4P22A 1ZJYA 1Y5MA 1T24A 4NBUA 4DUPA 3KZVA 1YOVB 1K6IA 3H8VA 4IS2A 1BW9A 1UZLA 3ZNPA 3CH6A 3OF2A 2Q1UA 3Q11A 4U7WA 3L4BA 1Q7CA 4J43A 5JO9A 2UUPA 2NSDA 4PCVA 1DPGA 3TJRA 5A05A 3HB4X 5B4VA 5GZ3A 3HE3A 1KYQA 1O0SA 2TMDA 3PHHA 4LVCA 4PRLA 4MDHA 4OHUA 3TWOA 2EF1A 1NVGA 1UAGA 4DWVA 3IUPA 4AJEA 1JN0A 3GVCA 4R54A 4N5MA 4S1VA 4P8RA 2PKQP 4RF2A 4WCFB 2HRBA 3QWAA 4EW6A 1BDMA 2P9CA 2EW2A 1YL6A 2YW9A 4GI2A 1HE3A 3AOGA 3QRWA 2HJRA 4R16A 3UCFA 4YRAA 3D7LA 4MIEA 1P44A 3ENNA 4QSMA 1ZXLA 3VAZA 3EVTA 4BNYA 4MVJI 4U8GA 3K8ZA 1Y8QB 1ISJA 2NLOA 3FHLA 4IY1A 4XX0A 4FJ2A 4DPKA 4Q3EA 5B1YA 5CG1A 4GWGA 3ITDA 2C82A 2HK9A 2I3AA 1QYXA 4CPDA 2B36A 1LLDA 4XIYA 1UP7A 5AOVA 2Y1CA 3WMWA 3PGXA 4MVJE 1HZJA 2O48X 3OHSX 2ZK7A 1X7HA 4ZN6A 5U4QA 1T25A 4CMAA 5CDYA 4XYLA 3GMDA 5BNTA 2PKRA 2AE1A 3DHYA 4GGOA 5F3RA 4WJZA 4L4RA 3RUEA 3PJFA 4L9RA 4Y6RA 4ND5A 5KJ6A 1ENZA 1HSZA 1ID1A 1YJ8A 1YVEI 4HKTA 4EYEA 1GCOA 4GMFA 3UCXA 3WR5A 4JJFA 1LTHR 3LLSA 4K26A 4Q39A 5HS6A 5THKA 4XZ3A 2EV9A 4ALIA 4EBFA 3MJ4A 4YAGA 3GK3A 4RCVA 3DHEA 4RL6A 3PYMA 4J9VA 3JQDA 2NM0A 4GGPA 1Y8RB 4PLGA 3ZI0A 4PVCA 5DULA 2QZZA 4M89A 5K0ZA 3BTOA 3BXXA 3RQSA 1IHXA 1N92A 3AI2A 3HN2A 4II3A 4AG3A 4Z9XA 4BNUA 4ITUA 1NFRA 3INTA 3DO5A 4TRMA 2Q1SA 2YZ7A 3FNGA 4F3YA 3RFTA 3INGA 4ESOA 2AQHA 2WTBA 3B1KA 1QV7A 3F4LA 2XOXA 5DBGA 4EI2A 3X2FA 3C85A 4YYZA 1Q0QA 2FR0A 5CPBA 1Y1PA 3INRA 3QVOA 5DNAA 4BMSA 4NU5A 3R3SA 3DBRB 2CDBA 3G0OA 3F46A 2O3RA 1QXSA 3ZW9A 3KETA 4B4WA 3GGPA 1ADBA 1IZ9A 1PU2A 4R69A 5AYVA 4JGBA 1GAEO 3ZGYA 1YXMA 4WPGA 3SC6A 1DIGA 5DOZA 1B26A 1DJQA 1LRLA 1E3WA 1IHYA 4L76A 4MVJF 3WWYA 3WICA 4Z0HO 5FFFA 3L9WA 1MUUA 3UHAA 3JD3A 4FJ1A 1NQAO 3VKVA 4XDYA 1E7YA 3RU7A 4BQRA 3DOOA 2VQ3A 3EZYA 3B1JA 3UAGA 4AJLA 1TLTA 5IDQA 3RKRA 5DCYA 1LEHA 3PQDA 4AL4A 2IODA 4BKUA 1NXQA 3TFOA 1HLDA 1UJMA 4GLOA 2GLXA 1DO8A 5HRUA 4YVFA 3UICA 3WTCA 2C59A 2PZJA 4I5EA 3KO8A 3O4RA 4FGWA 2NU9A 4CMIA 1MG5A 1T2FA 3QP9A 3I9NA 4O5OA 1N5DA 2Q2QA 1DAPA 1I2CA 1NP3A 5DCWA 2UDPA 3WLFA 4J0FA 5F21A 4XR4A 5G4KB 1LRJA 2OP0A 4LGVA 4J1SA 1NVTA 2UAGA 2Y05A 4FFPA 5AXCA 3ZCXA 6ADHA 5KKCA 1JU9A 3LC7O 3ZN2A 2RHCA 5KVQA 5F5LA 4JP3A 2FSVA 1DLIA 2Y1GA 4IDFA 2F1KA 3VPFA 2W2KB 1CRWG 4IDBA 4DLLA 1Z73A 1EBFA 4E12A 1R66A 2O2YA 1N9GA 2GF2A 3E6AA 4GBJA 4OO3A 4ZRMA 1E0DA 3RFXA 4D79A 5B12A 4IXWA 2P68A 4ND3A 4RZIA 1GV0A 4AJ2A 3PIIA 1MC5A 2VWGA 3JQBC 2P9EA 1UXKA 2P4HX 1BXGB 3DBRA 3ZWVA 4H15A 3ZWXA 3ONFA 4YBZA 2OXIA 4YJFB 4PFJA 2ZYDA 2RHRA 4GAEA 5HBRA 3ZV4A 5TJHA 4E2WA 3FBTA 3GN1A 2ZIZA 3M1LA 4RORA 3CPSA 3GVPA 4CR7A 4FJ0A 5KVVA 2BI8A 5JCJA 2HMUA 4BKOA 2B5VA 1ADGA 3W1VA 4Z6KA 1R12A 1ZCJA 1RYDA 1KY5A 4XGNA 1ZEJA 1ZSYA 5JAMA 3O8QA 1RJWA 5U1PA 4GSKA 5IJZA 3I4CA 3IKVA 1T4BA 1OZAA 3DFUA 4OKNA 5GMOA 3JQ8A 1VI2A 4A0SA 4W7IA 1EEHA 3PVZA 5A4DA 1YDWA 1P0CA 3LVFO 1PZEA 4BHTA 1C0IA 1ENOA 1YRLA 4NK4A 5FF9A 1Q2XA 4J7XA 2Q49A 3ZU5A 1XSEA 1D8AA 2ZB3A 4N5LA 1XGKA 3F6YA 4Y67A 1VRWA 2H63A 3AFNA 4CM9A 3NDIA 4R9SA 3WQSB 3QSGA 4XGKA 1I10A 1E3EA 3WFJA 2X5JO 3DAFA 4HY3A 5JLAA 4NPCA 4UVHA 5BSGA 1M76A 5ER9A 3T4XA 3U4DA 4WOJA 3MJVA 3WGHA 4CM4A 1ISFA 1PJTA 4EUFA 3H2ZA 1SPXA 4TWRA 2FZWA 1ZJZA 4J9UE 4FCCA 1ZK2A 3KSZO 2I76A 3RUIA 2BHLA 3KYDA 3DMTC 5ILOA 2X5KO 3S2IA 2ZATA 4BVAA 1FK8A 3G49A 3MWDB 2GRAA 4YJHB 3ASVA 2GYYA 1TA4A 4GL4A 4KMSA 1ZO8A 2HK7A 1MFZA 1DHTA 4JIGA 5EQFA 4RQUA 4R5HA 2C20A 2EKQA 2Z1NA 2DT5A 1J6UA 4CR6A 4YJDA 1O5IA 5C7IO 3MTJA 1BVUA 3CKYA 4JBIA 4DQVA 1VL0A 4J7CA 1Y9EA 3WGGA 2ZTLA 4P4LA 2DQ4A 3FSRA 5H81A 5G2OA 2EERA 3ZWNA 3BTVA 2G17A 1H94A 1NR7A 3JQBA 3I9KA 4J2HA 1UDCA 2DBRA 3O03A 1UDBA 1U1IA 1KS9A 3L07A 3TFQA 1TT5A 2BI7A 2WYUA 4YCAA 2FRDA 2NVWA 4QXMA 1EDZA 4NNJA 1KEVA 2PKQO 4UEJA 4YA6A 1U28A 3L4BC 1CF2O 2XF8A 4CMBA 1ZFNA 4ALLA 1GQ2A 5KTKA 2NVUA 3FD8A 4RVHA 3C1TA 4FOOA 2DPHA 3JD1A 2GPTA 4DRYA 1E1KA 2GUGA 5EN4A 2GN9A 2IEDA 3OECA 4C7JA 3HWRA 1D3AA 1T2AA 4E30A 4CQLB 4CL8A 1P1HA 4PG4A 3W8EA 4H16A 1N1EA 1NWCA 4BQPA 2R00C 3PYXA 1LC3A 3HDYA 1LDMA 4NFSA 3LT4A 3IC5A 4JNKA 1FDSA 4LK3A 1VJTA 1XA0A 2PD3A 3E5MA 2D2IA 1JWBB 3LU1A 2EEZA 3P2OA 4WECA 2BGKA 4TZTA 5B37A 1EUCA 2HUNA 4BNVA 3TF5A 1X1EA 3WFIA 1KVSA 4CQLA 5A9TA 2J5KA 4QEDA 3ULKA 5GZ1A 3IAHA 4IM7A 4MKXA 2YV3A 3ZHZA 3DL2A 5CHEA 5K6AA 7MDHA 4HP8A 3OA2A 4RVGA 3BIOA 1BMDA 1GCUA 4PLVA 5DN9A 2ZCVA 4IUYA 2AG8A 1GU7A 3FCOA 2C7GA 5L53A 2X58A 4I08A 2YHUA 1BVRA 4XQCA 3I83A 1JKJA 1W6UA 3KOUA 4R41A 4BIIA 1HDYA 1G0NA 1HDGO 1MX3A 3NAQA 3ZHBA 3OBBA 3D3EA 4PG7A 4DVJA 4ND4A 8LDHA 2A92A 1V3UA 4J4BA 1LLQA 5KVCA 2NU8A 2WD7B 3D3WA 1LDGA 1UZNA 3E9QA 4L4SA 2VNAA 1B2LA 1F0YA 3AUTA 4J0EA 5CDGA 2I99A 1FMCA 4QT0A 2PZKA 5G0SA 1FDTA 3QVWA 3FNEA 2VCYA 4LCEA 3AI3A 5ITWA 2O3QA 4YXFA 1NQOA 4K1LA 2O4UX 9LDTA 4A7PA 4CLOA 4J6FA 2DU8A 5CDTA 1IPEA 1NFFA 2YFHA 1PX0A 1YB1A 2DC1A 1SAYA 1H6DA 2Y0DA 4BV8A 3ZWMA 5HS4A 4RPKA 3HSKA 2VUTA 3QV1A 3D64A 4HFJA 3IL2A 2PGDA 3RC2A 1H6CA 2VNSA 1VKNA 4K28A 1K5HA 1E77A 2UYYA 3W4KA 3HFGA 4YEDA 2OP1A 4NG5A 4HNHA 3R1IA 2JAPA 4IDGA 3GH3A 4CQMD 3BHMA 1ISHA 3JD4A 3D1LA 6LDHA 3HN7A 1R37A 4IXTA 4MPDA 4GVXA 5CFZA 1M66A 2GDZA 1SO8A 2YUTA 4I1IA 4KOAA 5H83A 4R1NA 2X8LA 3T4EA 2FY8A 4IGEA 1UP4A 2NV6A 3CTMA 3DAGA 4E33A 3H5NA 5CEJA 2HO5A 3U4HA 3GVHA 4YAKA 1R16A 2NU6A 4BUCA 1HYGA 1M6HA 2QRJA 2ZB7A 1C1DA 5A5EA 2IDZA 2PGJA 5CPFA 1S6YA 4XB1A 3GUCA 5L9AA 4BO4A 4WEOA 4D7AA 3OIDA 3UKOA 3WLEA 4XRGA 1HT0A 3QLJA 3HZZA 4BO1A 2PNFA 3NGXA 3DBVO 3AUSA 1ZSNA 1WMBA 1W4ZA 4WLFA 5GZ6A 3T7EA 3AUUA 1CDOA 2ZB4A 3KM0A 1YQXA 3EW7A 4ZD6A 4XD2A 3WGIA 1U7HA 4J1QA 5JO0A 3K96A 1XDWA 1VM6A 4JBHA 4HFMA 3HNPA 4DPMA 1PGPA 3WS7A 4L0QA 1Y8QA 4XKJA 4YDRA 1P1IA 3OJOA 1E3LA 4E2ZA 1KVRA 4IQ0A 5JE8A 3RC9A 2AXQA 2CNBA 4ALMA 4CV1A 3DZGA 1ULUA 1VSUA 2X7HA 1GQQA 3AY6A 4Z9YA 5A04A 1LJ8A 3TZCA 2WSBA 2AEFA 2JD2A 3PK0A 1B3RA 1R6DA 1LLUA 2Q4EA 5TJ9A 3CEAA 1P0FA 1PJ2A 4BKQA 3TQHA 2I65A 4D46A 4J3FA 2NADA 2Y1DA 2QW8A 3DBHB 3GAZA 5IFLA 1I30A 4NIMA 1B8PA 3JQGA 3OETA 5I7FA 3EAGA 1Z45A 2VZ8A 4XCVA 4E2XA 1LC0A 3GVXA 1GPJA 5I8ZA 4BO2A 2Y1FA 3W4JA 2E4AA 2W2LD 1Y8RA 5I8WA 3BMOA 5JPIA 2EJVA 5T8KA 4BGVA 1YQDA 3MZ0A 3TN7A 3W6UA 1YL7A 3EVNA 3RUFA 1GDHA 2GERA 2J3HA 3JQ9A 1B8UA 3DZIA 1EE9A 1I01A 2Y99A 4IIVA 3OEYA 1HDZA 3C24A 3B70A 1GTMA 2B4RO 1JA9A 1MA0A 4YJHA 2HDHA 3RFVA 3AM3A 4E5PA 4ZA2A 3PWZA 3K92A 2XAAA 3S8MA 5GY7A 1YONA 1LUAA 4NJMB 4EGFA 4FQ8A 2PZMA 3LZ6A 4EDFA 3TOXA 3WYEA 1LXCA 2IYPA 1LDEA 5KJEA 3Q9UA 5K9ZA 1E5QA 1E92A 3QWBA 4FFLA 3CMCO 4P38A 1TB4A 3GEDA 1I2ZA 4OAQA 4W6ZA 5HWSA 4YJGA 2B83A 3LYLA 1W8DA 2JHGA 1EBUA 4JP2A 2Q2VA 3DOCA 3RBVA 3I52A 4ILKA 1MP0A 1P33A 1XWFA 3AU9A 4E13A 3WGQA 1T2CA 5A03A 4D0RA 3TZ6A 3UGKA 3DZHA 1QLHA 3AFMA 4IPTA 1ONOA 1I2BA 4R1UA 3EHEA 1UXGA 1E7RA 1XQ1A 3GDFA 5G0TA 2Y1EA 5LC1A 1DRUA 4GMGA 4Q3NA 4WUVA 1B15A 1UH5A 5TX7A 2NACA 5CDSA 1E3SA 5ADHA 4QFCA 5HTOA 1F12A 4EZBA 1R15A 4DL9A 3C8MA 1VJ1A 4CUZA 1M6WA 1PTJA 3VPHA 1GL3A 4JJIA 2PD4A 2NVBA 3KRTA 3A14A 2DTDA 3PWSA 3T7CA 1A4IA 1Y7TA 3UFXA 1LX6A 3O8QB 4E32A 3FI9A 3RU9A 3BMOB 1VLLA 3G3EA 2IZZA 3FNHA 3O26A 5AQ1A 3GLQA 5JYDA 1GY8A 3D5QA 3RBZA 5BQFA 5HM8A 3DHNA 4EITA 4WLUA 1AE1A 3F1KA 1BSVA 5B4UA 1YO6A 3DB2A 4TRRA 4GH5A 2PR2A 1YB5A 3PHLA 5I7VA 4CLEA 5CG2A 4R4JA 4BO5A 3WJAA 1P1RA 1OC4A 2VYNA 2Y0CA 3GGOA 3NYWA 5TNXA 4UVIA 3H9UA 4D0SA 4Q3AA 5IXYA 3I9OA 2EKPA 3GMSA 3S2GA 1J0XO 2CMDA 4E0BA 3PQFA 1PL7A 4R01A 4FFNA 1ZH8A 4BGEA 4LSMA 1PQUA 1I3MA 4U0JA 3SEFA 3HFSA 2EW8A 4XR9A 4F6LA 2AQIA 3DZBA 2GN8A 4BNTA 2BGMA 1I36A 1N7GA 2LDXA 4ONEA 5AXAA 5TF4A 3WX0A 3ZV3A 1ZMOA 4BO6A 4IJWA 2H5LA 5AXBA 1HLPA 1C1XA 4RF5A 4CLRB 4PLPA 2W2KA 2CDAA 2EGGA 3V1YA 1PQWA 2HMSA 3H9GA 3NTQA 4J1TA 3GPIA 2OMEA 3L6DA 5F1OA 2DKNA 4KTVE 3ENKA 3I5MA 4YAEA 1UXJA 1OBFO 2ZCUA 1YJQA 2CF5A 2QRLA 1T26A 3DFZA 3H9QA 5ES3A 4BNLA 1KIFA 1NTOA 5JDIA 2G1UA 4I5GA 4YACA 2FSSA 4GPD1 3GDGA 5BSHA 5JDCA 2VWHA 2X86A 1BHSA 3PP8A 5TLSA 3UUWA 5KKAA 1P31A 1RM0A 5HA5A 3GR6A 4A26A 1KVUA 2HRZA 5T6BA 3I6IA 2NQ8A 3L6OO 3L9XA 5ENDA 1JAYA 4XQ9A 1T4DA 2OGUA 3RI3A 3P7MA 2BGLA 3AM5A 1PL8A 1PJ4A 4JROA 4B8WA 3JD0A 1XELA 4YWJA 4P4GA 2P91A 3P5SA 4MO2A 3NDRA 4IQGA 4OIMA 3S2FA 1Z7EA 3VZPA 2CFCA 2CVOA 3PHGA 1O95A 2YJZA 4GQAA 4DIOA 2ZQZA 2ZYGA 4OXYA 1KEWA 1NPYA 4U0KA 4K9DA 1SB9A 2DUWA 1LDYA 1N1GA 3NJ4A 2E48A 3JQAA 4FR5A 3CUKA 1U3VA 2HKIA 2XPCA 4XQGA 3NJ8A 4I8XA 4DIFA 4J4TA 1HDXA 1K0UA 4ZQFA 2B4TO 4YJFA 3TZHA 4DYDA 3ZWOA 1RKXA 3VH2A 2NU7A 2VYVD 5TC4A 4NDNE 2CVQA 3AWDA 4CMJA 1OMOA 4E21A 2E6UX 3WQQA 4Q9NA 4CM4B 1JKFA 1AHHA 1WWKA 3DR3A 4DLAA 5A9RA 2QX7A 1ZVMA 2VT2A 3WGZA 3DBLB 3S55A 3Q1LA 5JCJD 4JCOA 3NTRA 3Q2IA 1PGNA 4O0LA 1KOLA 4CUJA 1PS8A 3PEFA 5JDCC 5CEFA 5JBIA 5TS3A 4A2CA 4XIJA 1FXSA 3R0IA 4ZJUA 3L0DA 4PLCA 3M1AA 3U0BA 3WJ7A 2WYVA 2DPGA 5ICMA 4YQYA 3BHJA 3HDQA 1QR6A 2BFAA 3F5QA 1C0PA 1ZZEA 1E7SA 3JYLA 3PDUA 3RJ5A 4EUHA 3ZU4A 1Y81A 4TMFA 4BO0A 1Q7BA 3NDJA 4YTEA 3WYBA 2QZ9A 5ICSA 1C0KA 1I3NA 2FMUA 3KUXA 1ULSA 4C7KA 4RF4A 4WCFC 3U4IA 1ZUD1 4K6FA 4PZCA 4ND2A 3LK7A 2QHXA 2E37A 2J3KA 3AOEA 4KP7A 4HV4A 2VZ9A 1SOVA 2FR8A 1YBMA 2D0IA 2Y93A 2XXJA 2DUUA 4DMLA 4Y6SA 3GPDG 1KERA 1G0OA 2CZCA 2PA3A 3ITKA 4TRNA 3MCVA 2Q3EA 3LDHA 1HE2A 1LNQA 3OIGA 2YHIB 3H5AA 5EERA 3KLMX 3FWNA 1Q0HA 3V8BA 1GEEA 2Q4BA 4IJKA 3GZNB 2SCUA 4YT5A 5I7EA 2P2SA 3E5RA 1YWGO 3ZW8A 2O23A 4CM8A 3TSCA 4IGFA 2QQ5A 4DXHA 3BZUA 4AJJA 1RPNA 1AGNA 1GYRA 4CMKA 1VL8A 4M1QA 2EKLA 2RIRA 2QYSA 1KBZA 1RM5A 2WDZA 3JQ8B 3V1TC 2NWQA 4CV0A 2V6GA 1TI7A 3H9EO 4DREA 3GG2A 1A7KA 4GKBA 1MB4A 4DA9A 5J23A 1V3TA 1A9YA 1CERA 1DC6A 1TT5B 2YV2A 2I5PO 3NT5A 4MP6A 2EWMA 3RIHA 1IB6A 4H3VA 4RV9A 1XKQA 4KUHA 1ZMTA 1GYPA 2VHVA 2BFMA 1BGVA 4J49A 2VHXA 1A5ZA 3ROQA 2A35A 3VPSA 1SCUA 4WGGA 4AJIA 2DM6A 4F6CA 1IULA 2O7SA 3NTOA 1PJLA 3VVCA 4XJSA 3CMMA 4EEXA 4KQWA 1F17A 1MFPA 1OOEA 4JQCA 1WDMA 3C1AA 3EMKA 1H2HA 4J2OA 1EDOA 3GY0A 1E7WA 2AEJA 5JFOA 4ZRNA 1Z6ZA 4CMEC 4A10A 4E5KA 4B4OA 3I23A 1Z74A 3WSWA 3NUGA 2D3TA 2HK8A 1EMDA 1I3LA 2HLPA 1E3IA 3UCEA 3UW3A 4M49A 4WK6A 4TKLA 1PJ3A 5A02A 1O9BA 2WEKA 5L4NA 2R2GA 5F5NA 4L4XA 4XGIA 2JFHA 5H82A 4BGUA 2WD8A 1WLYA 2QYTA 1LQUA 3U3XA 4UUMA 3MOIA 5JYEA 3UVEA 2D1YA 1F06A 2UVDA 3WGYA 2X0RA 3SJUA 5G4KA 3D5TA 4XRRA 1ADFA 1PL6A 1B7GO 4NJOA 3DZFA 1XYGA 4BNGA 4D3DA 4Q3BA 3ZV6A 1U5AA 5IN5A 1HRDA 3JD2A 2Y0EA 3BTSA 1K6XA 4NK5A 2DVMA 4W82A 1BW9B 3JQEA 1D4FA 3BAZA 2CY0A 1LQTA 3HQ4O 4GX2A 4LMRA 3U5TA 3HJAA 1PGJA 1DEHA 1FDVA 3GT0A 1H6BA 4BOYA 1JTVA 4ZQHA 1EQ2A 1NASA 3WQRA 3UN1A 2Q46A 1YBVA 4PLHA 4HWKA 4M55A 4IINA 1NAIA 5EINA 3WTBA 1LBEA 3KXDA 1P9LA 2CDCA 1NVMB 3LC1O 3ZDFA 3U62A 3DQPA 2J5RA 3KB6A 1DC4A 3N7UA 4QQRA 3M2TA 1ZK4A 1X14A 3VC7A 1IY8A 1JVBA 2BD0A 3MWEB 1IL0A 2CD9A 2I9PA 4MP8A 2X23A 4NI5A 1DHRA 5COAA 5TRTA 2DTXA 1N7HA 4NZ9A 1EE2A 5TGDA 2GGSA 1A9ZA 2H9IA 4E4YA 4XDZA 3ST7A 1ONPA 1GYQA 2WMDA 3EDMA 2AHRA 3OIFA 3FTPA 2PY6A 4CMGA 1HYHA 4QTZA 3KSUA 2OFPA 1D7OA 2H1SA 1LLCA 1T2EA 2VRBA 1A4UA 2G82A 3RD5A 1XU9A 1TT7A 1XLTA 3PLNA 1E1LA 2VRCA 3OQBA 1XR3A 1E3WB 2JHFA 4G5HA 4GKVA 4N18A 5JXWA 1EVIA 3QIVA 1V0JA 3GEGA 2GN6A 3JQAB 2GZ3A 1OI7A 2HMTA 4CLDA 3NT4A 5JAQA 1U7TA 3GDOA 3NX4A 1HWYA 2UUOA 4YRDA 3HADA 2AE2A 3GGGA 3FTNA 3RC1A 1DRVA 1U2GA 5FYDA 1ENPA 4O1MA 4YT8A 4NFYA 2BRUA 3C3XA 2GASA 4WLVA 3DAPA 4DYVA 2Q50A 3WG9A 1PR3A 2EP5A 1A27A 2DBVO 4OYRA 2X1HA 1SEPA 2JD0A 2C7VA 4UUPA 3JYNA 1DIRA 5EQDA 3IOYA 2VTDA 4Z3DA 3RAJA 4PIVA 1X0XA 2BMAA 3PYLA 2E49A 5L7TA 4C4OA 5KJFA 3WYCA 4OSOA 2JAHA 2X0IA 3ASUA 1CYDA 2GSDA 2P4QA 3WWZA 1DB3A 3MJTA 3OJ0A 3OEWA 4YAJA 1TEHA 3MEQA 3CZMA 3IUSA 2O3UA 3DEYX 1SC6A 1E6EA 3FNFA 5JC8A 4OJNA 1A71A 1HDCA 3C1OA 1G1AA 3UOGA 1WNTA 3VDQA 5DZSA 1YE3A 3KEQA 5BNFA 2B35A 1QYCA 4BB6A 4UVGA 4BNFA 4IDDA 3ROMA 4FC6A 2EIHA 4TKMA 1U4OA 4LW8A 4IDEA 5CP8A 3PGJA 1MLDA 3JQ7A 5EPOA 3WBFA 4L8VA 3CE6A 1H0KA 2VWQA 5AVOA 1YQGA 1QRRA 3E82A 2FPPA 4OXNA 3MJEA 3N74A 1U2DA 3EC7A 4F46A 4QX6A 1DIBA 3BA1A 3G1UA 2EGHA 2ZTUA 3G79A 3JTMA 3LT0A 2QG4A 1FF9A 1CWUA 4J7UA 3AM4A 5IN4A 3MOGA 1A72A 2EP7A 3QHAA 3BMCB 3PHIA 2NVUB 2BKAA 3ON5A 4CM9D 4I5DA 4CODB 3JYPA 4J1NA 3RSHA 3D3WB 4GX0A 4E3ZA 5L7WA 1IOLA 1HF3A 1U9JA 3W4IA 3EGOA 4CM7A 3VPXA 1UDAA 2BFOA 4FFMA 2D5AA 2J3JA 4OMUA 4HFRA 4UREA 4UVDA 4OKIA 3JQAD 3WDSA 4D44A 2Z1MA 4TQGA 2X4GA 3JV7A 4QFDA 1JAXA 5KOIA 1EFKA 4RLHA 5LDGA 4CLHA 3GN2A 3EZLA 2GN4A 5ER6A 3H65A 5T67A 4RGBA 3TL2A 4UAGA 4FB5A 2IZ1A 3ADOA 2JCXA 3DZKA 4N7RA 4AFNA 1U4SA 4WASA 7ADHA 2P5UA 2ZTMA 3WNQA 2O3SA 1V6AA 3VZQA 4CM5A 1HTBA 3H3FA 5EESA 3QVSA 1R0SA 5L95A 4TROA 2VTEA 1BWSA 4R3NA 3PTZA 3HUDA 5L7YA 2VHZA 1BXGA 1ZK1A 2OZPA 5L3ZA 1X7DA 1H93A 4EJ0A 3D4OA 4HADA 3W8FA 2X0JA 4IMRA 1PJQA 2C2YA 4RPJA 1Q7GA 3RVDA 1PR9A 5DCUA 3SJ7A 1QYWA 2JKVA 1YH3A 1M75A 1IE3A 4URFA 3CXRA 4GX5A 2YQ4A 4BNMA 5JNLA 2Y66A 3LF1A 4QO8A 4MKZA 2H6EA 4R51A 4G2NA 4JX8A 2B4QA 5L40A 1QSGA 1UXHA 2W4QA 1YOVA 3DTYA 1P1JA 5IXSA 5U9CA 3PJGA 4CMHA 4MIYA 3H3JA 2EG9A 4XYBA 3CINA 1DC5A 4YT2A 4XYGA 4JBGA 1HYEA 2CVZA 3ANNA 4XJTA 5TQVA 2EJWA 3DMYA 1EQUA 3GFBA 1GQYA 3GNTA 1WW8A 3JQFC 5TSDA 4A27A 3LT2A 1E5LA 3H4VA 2O4CA 1SB8A 1XCBA 4J90A 4BGIA 9LDBA 1I33A 3DMTA 4ZQBA 3DZJA 4O59O 3QWHA 3GAFA 3EYWA 2DBQA 4INAA 2DTEA 4L75A 4IJVA 2IRWA 5F1PA 4DQXA 3E9NA 1Q1NA 1E6WA 1W0CA 3ETEA 3VHRA 4R9RA 3HDHA 3E48A 3O9ZA 3RKUA 2D8AA 3KHUA 4Y98A 4R1SA 4DC1A 3KYCB 4FC7A 5DT9A 3AW9A 1GADO 4PVDA 3PI7A 1C1XB 4FN4A 4Q3DA 4U6SA 4UUOA 1R0LA 2X9GA 4XB2A 2ZYAA 3E1KA 3E03A 4KZPA 4P4NA 3F4BA 3KYBA 1MV8A 2C2XA 3QVTA 2F00A 4CM8B 2Q2WA 3GEMA 2E82A 2GZ1A 4NR0A 4R1TA 3ZNQA 3KYCA 2V6FA 1ONNA 1G6KA 2ILTA 2DFVA 5IG2A 1TVEA 1ZSVA 3JQFA 3OJLA 2YQ5A 3F3SA 4FFRA 2YFQA 2I67A 1QMGA 1X0VA 3ZWPA 1B8VA 3OQ1A 2X9VA
chains in the Genus database with same CATH superfamily
5D3KA 3VZSA 3RV3A 4HDCA 1EWVA 1MAAA 2AG1A 3MS7A 4KXWA 1XVIA 4QVKA 4UHCA 4IH1A 3FMVA 1S2NA 4N0MA 5ESRA 3D4NA 3ZHSA 1S9HA 4PG6A 2P5YA 4MEBA 1D5CA 3VYVA 4UARA 2WHQA 3G5MA 1W2HA 3QYJA 2R97A 2FDRA 1EUDA 3O31A 3VH1A 3TOCA 4FYJA 3RBXA 1JDUA 1KVQA 2IELA 5FLXA 3FFAA 5IEJA 3FCSB 1O0CA 3R23A 1TUBA 3AFOA 4FBGA 1YIDA 3RVMA 3QK7A 4DCNA 1T1SA 4YPOA 2D2EA 3ZEIA 1MRZA 2C54A 3I8SA 3LP8A 3O73A 4MA0A 3SJZA 4TLCA 1TIKA 1NQUA 5JXJA 4U3JB 1KMIY 5LP1A 4Q9IA 3TIXB 4FWBA 3LQ4A 2JB9A 3VOAA 2FWRA 2HIHA 3ZY5A 1LDNA 1RYNA 2CLLB 3G68A 4BP1A 5LKRA 4C07A 3EPHA 2V65A 3OH8A 3RBAA 1T5IA 4DC0A 5L4SA 3M5WA 1M6VA 3BFJA 4DLUA 1J0BA 4KQMA 5DX8A 3IBGA 3T5DA 4KPYA 2QLJA 1Z2EA 4ARVA 4OHBA 3ZLJA 1G1MA 3EZNA 4I9FA 1WB4A 1RAIA 1HT2E 2BMDA 1C7ZA 1F2TA 1JHRA 4KXNA 4P0TA 1S02A 3BD7A 3TTXA 4YP0A 4DKXA 3MWDA 2V9PA 2LRHA 5FYQA 3MIZA 5JAZA 1NBOA 5C1BA 3P1JA 1IWOA 3Q9SA 2FZEA 4IIDA 1AC5A 2JBWA 2XWBF 4WE3A 1AKWA 3AT1A 3AHDA 3GA5A 5FWYA 4NARA 3F71A 5JZBA 1I94B 4QOJA 5CB4F 5FV7A 4H0CA 2W6ID 5I8PA 1V35A 4LRWA 3ENWA 1B76A 1R6UA 2WVGA 3FH0A 3CVUA 5UKDA 1U7DA 4C3UA 3E9EA 3DC2A 3TZKA 4JAVC 3RYHB 4D8XA 4M37A 3K5PA 4LRQA 5D5QA 3RS7A 1Y3HA 3PXGA 1KK3A 2ZE6A 4FNOA 2IE0A 2X6TA 3WRVA 3CX6A 5A1JA 3DPIA 4MUFA 4A15A 1KK2A 1V9LA 3CWZA 3JSXA 1SCIA 1GTG1 1KJ9A 3RQIA 4CLXA 3ORRA 1NM5A 1I1HA 5DBFA 2VSOA 1IXZA 2JLQA 4MVWA 1IZZA 4LJ5A 1Q50A 4EVIA 3EEQA 2ZRQA 1PJRA 5F12A 2V5VA 3R5XA 5TV2A 5BOSA 4BV9A 3RYIB 4YDHB 5IDWA 5KO2A 2JDID 2YQZA 1EGAA 4IV0A 2RAUA 4TV8B 5LIRA 2PH5A 1FJHA 1I4DD 3KKMA 3PDHA 4C88A 1XDGA 5F9FA 2XCTB 2YMLA 5ALIA 4MA4A 1NOJA 1Z88A 3X1XA 4R98A 2IDMA 3JASB 4K05A 2OE2A 4KWTA 4G24A 2IEBA 4JLUA 1HLFA 4D82A 1XK6A 2HNBA 4NOMA 1VMKA 2WFAA 2H7YA 4ZCLA 4TWZA 5A71A 4DQUA 5EXTA 3TLJA 1WDWB 3G9XA 3IHKA 4ZFNA 4IP0A 2FFHA 1KFJB 2DKFA 5FFMA 3NXSA 4U00A 1POWA 3U9LA 1NQXA 2OKCA 3BMCA 4J03A 2OD2A 1CUSA 4RVFA 1KO4A 4HZIA 3REQA 1LDBA 4D9IA 1D4AA 3A06A 4JXJA 1EFUA 2YDYA 2YTZA 5IH3A 5ALMA 4LBYA 2XCUA 1FU7A 2BUBA 3IS3A 3OAAA 2MSLA 2XXAA 4BRWA 4PZAA 3DKIA 3GF4A 1PNRA 4UAUA 3H5LA 2Q1WA 4LOJA 2ATXA 4MR8B 3EFBA 3WOHA 2PLFA 4ZVOA 5JNWA 4PLTA 1X1QA 3ZY4A 2VDLB 1CUUA 2F55A 4QUBA 1NBMD 2EX1A 4RLQA 1UMCB 3I05A 1FUUA 1KQFA 5DN6A 1Z29A 4LSZA 3RUDA 5AOBA 3OPMA 4NZMA 1R4MA 2RCYA 3E9RA 3OZTA 3PFIA 3LQFA 1U3TA 2LTAA 1MXHA 1T13A 1TMKA 1CUGA 3BIFA 5FLKA 1K6MA 3HI6A 2G76A 4REOA 1KI3A 4Z3OA 1P81A 4NVRA 4KHZA 2GJSA 1XHLA 1E8DA 4BGDA 2ORIA 3QUBA 3EZ2A 1PQ4A 1U9CA 1WAMA 1CQIA 3FPFA 1TM7E 3D0OA 4NOKA 2WWVD 2L82A 5AVZA 1M34E 5FHQA 1R1DA 2AV6A 4BO7A 1RCFA 2BJVA 2XA1A 3FGOA 5C34B 2VPXA 1KE1A 5FI3A 3WIEA 1E1QA 1HPLA 1IIRA 4G84A 1KE2A 1QX3A 2O2IA 1RTTA 5KNBA 3U56A 3JYQA 1DBPA 1G21B 1KDTA 1ZK0A 2D2FA 3CIFA 4WCDA 1UP6A 3VH3A 4XA8A 2IIQA 3HR8A 3LLUA 2C2HA 3PJDA 4CFSA 1KDZA 4RJLA 2BRUC 2JLRA 1UDWA 1M2WA 1ZKMA 1RBZA 2A5DA 2QVCA 1PSWA 2ZKLA 3DWFA 1OLOA 3BT7A 4O2AB 2AW5A 3BL5A 2IUUA 3OA0A 3BD6A 4NV0A 3EHDA 3DLTA 4P32A 2FOIA 4PSVA 3TTVA 1N3IA 4G8DA 3SNHA 3FN4A 5F2EA 1AA9A 5EEHA 1DAEA 4WNCA 4DJJA 1PS0A 2HAEA 3BH0A 3H5RA 2XT0A 2GA8A 4HQLA 3ZV5A 2FXIA 3FPCA 1TYEB 4I9GA 4REQA 1DFIA 1ICIA 2I2CA 4LRSB 1JS1X 2Z5GA 3OE7D 4JITA 4JYZA 3HHPA 5DGCA 3HM9A 1L5FA 3AI1A 5T64A 2V4ZA 3CKMA 4N49A 4ZQGA 4ALNA 2QD2A 3FOZA 2YBEA 3SBOA 1TYCA 2IYRA 2BEKA 2VRCD 2QMEA 4IHJA 2APJA 3F47A 4ABTA 2IH4A 2V7UA 1FMLA 3T15A 4KRFA 2YMPA 4LBZA 4R84A 1BMFA 4U2GA 3QPAA 1PZGA 3NWEA 4HAUA 1PYDA 1RM3A 3H2SA 4XLTA 4XX0B 4H1UA 2H5IA 4TYQA 1X1SA 4QQNA 1KMNA 1NBHA 2EJBA 5C51B 3Q9NA 2J8ZA 1HT3A 1JYEA 1MBZA 5JZSA 4UNSA 1KYIA 1VI5A 1I6LA 4ZVMA 2R8XA 1RWKA 1G3QA 3BIXA 4P3KA 2J32A 3AZPA 1Z8HA 3N2LA 1QGUA 1GCAA 1DKMA 1KEEB 3EW9A 1YZTA 1TZBA 2QP4A 1I14A 3I9V6 4WLNA 2GJ9A 2HJSA 2X4DA 4GYKA 4DR2B 1XCOA 3GUHA 4A73A 1NRWA 2VYND 2YDXA 2PS9A 1SXIA 4MSUA 4ZO4A 3IV7A 2W0MA 4RELA 3WYAA 1CUIA 4G65A 3BK7A 2VAVA 4MIOA 3QE9Y 2IS4A 1K2WA 1VMEA 4I7EA 3UXHA 1YKFA 3VX4A 4DANA 6PFKA 4RO0A 1ADYA 1RYEA 3BC1A 3NJRA 1NZDA 4ZEVA 3DO8A 3TD2A 4IDNA 2D5IA 3B52X 4LCJA 3FI0A 1K5DA 4P58A 3DTVB 4ZC8A 3GX1A 3OCCA 2ASVA 4RK5A 3W2GA 3LIPA 1OYVA 3A31A 4M3NA 1V3VA 1YKGA 1LPBB 4ZI2A 2CZQA 1GSIA 3SX2A 3BRSA 2ESRA 2EW1A 2OECA 3OF3A 2VWPA 1PV2A 1R8XA 4FDAA 3G8AA 4HNQA 3V1UA 3ROGA 5HIKA 1U0EA 5KJ1A 4CETA 3A0RB 4PZDA 2P11A 1P7ZA 2ZSFA 4I36A 1NTRA 3EA5A 3PC8A 1XO1A 2VUUA 4KGVA 4JI6B 1DDOA 3IQDB 2Q0XA 4RHUA 4X60A 4XVCA 3UXYA 1XPRA 1OH8A 3GGSA 3TL3A 2UU9B 4G1UC 1WU7A 3OY7A 3EGWA 4P5DA 1JBKA 3NPMA 4JENA 3OD1A 5TEWA 2O7QA 3SI7A 5EZYA 3EMVA 3QSYA 2MJLA 3HCCA 4Y1FA 1WOYA 2QD5A 4HHEA 1FYFA 4JB3A 2IP2A 3FF4A 4PIPA 1G2OA 4BB5A 1ESMA 1SG0A 4DUGA 4OI0A 1HDRA 3JZIA 2ZYRA 2D6FA 1U11A 1SRRA 1Z13A 4K6GA 3RUAA 4ENVA 1FCJA 1UJCA 2EFHB 1XTBA 4WZAB 3G0DA 1JKIA 1GTJ1 1BX3A 4EBBA 3MQ2A 3KWJA 1DUVG 1SC4A 4HWTA 3WK7A 1UR5A 1IY9A 3C3MA 1SC9A 1JPJA 4GOMD 4YRQA 5B57C 5JBNA 1QG0A 5A9SB 2HYIC 1UOEA 2OCDA 2QTBA 4TLMB 1LA2A 1W47A 4WOKA 4PHCA 1OKKA 2O59A 4E6PA 5E2BA 1JYSA 4BNZA 4WESA 2AF4C 1AHIA 1A8HA 1UWKA 2JRLA 3K6JA 1LRKA 2GEJA 1GZHB 4PR0A 4KI0A 1I0LA 1Q19A 3G17A 2VZEA 2OZKA 2WHEA 3BX1A 4UM9B 4ZYWA 4LC9A 2GD6A 2XRMA 4NBKA 1NQTA 3D8BA 3DL4A 2Q8NA 5ITVA 4RHCA 2FSGA 2ISSD 4REQB 4IOLA 5JSKA 3CCFA 2GNAA 3IIKA 1Q3TA 3P0JA 5CXXA 2I91A 4B3FX 3OLCX 4RPLA 1RCTE 3B89A 5DI3B 3VYUB 5KTYA 5G0UA 2R1VB 5HGXA 4QUDA 4AM8A 1UC9A 1LSJA 5CA0A 2BT4A 3RTAA 2EQAA 4C87A 1DV2A 4OQXA 3PGA1 3C45A 5BN3B 4GOND 1C1DB 1YJBA 1NHGA 3O4IA 2JHAA 2BEJA 1GZ6A 2Y1XA 3RJ9A 3LBNA 1SY7A 4UAVA 1ZJ5A 5EQTA 5CAEA 2HMYB 1UPBA 4CLRA 3JY6A 2W6QA 2ZROA 2OYSA 4BLSA 2CNWD 4UCWA 3LOQA 2QTVA 2RDMA 1GZDA 2EP8A 3M1IA 4IFIA 4DIBA 3AVYA 3GNSA 1ZC4A 2J5BA 4Q21A 1APBA 1E9FA 5EHXA 1J9EA 5ENVA 4ISCA 3SVTA 3MJCA 2IEGA 3CNEA 4K3VA 3CLRC 1G20B 4M9SA 1JAHA 4K1XA 3KQHA 3PGKA 3LL7A 3Q7PA 5KCZA 3GQVA 1A7AA 1Z62A 2O50A 2C9YA 2CFRA 4F5EA 3B78A 1ULBA 1OWNA 4IGIA 2QAIA 5MDHA 2QM8A 4TSFA 2QU8A 3VA7A 3D4BA 3GJZA 3KZOA 1O94A 4ZI3A 1V4BA 5FOSA 4MRAA 4UZFA 2IV3A 2ONKA 4TSFD 3RSGA 4BE9A 5JIBA 4Z4CA 1NN0A 4K9PA 3FZEA 4EX6A 2VJMA 3E8XA 3PQ5A 3HZRA 3U7IA 1PAUA 1UBJS 4B74A 4F5WA 2IBSA 3KHTA 4KZKA 3T3PB 3W6PA 4RGVA 4P5EA 2VT3A 2WSMA 3SKVA 4DNQA 2H00A 4D4LA 1UPAA 4Z4EA 1BROA 1A9TA 2C57A 1ADCA 1E9CA 4LGCA 5EPUA 4EH1A 1G5TA 4FT4A 4E1BA 3W2IA 3T35A 4L28A 2C29D 4KSBA 2EQBA 4PG8A 3LYUA 3QXJA 2CJPA 2VK1A 1UZMA 2I3GA 1DAOA 2JZCA 3GBSA 4D43A 1T15A 2RH4A 5AHXA 3EXEB 4CMCA 3IQEA 4Y0NA 2A4MA 1WVGA 1PSDA 1L8OA 4MVJD 4OP3A 5ELXA 1XJQA 1ZD5A 2Q3MA 5AM4A 5B64A 4FEYA 4IKEA 3N0TA 4IIJB 5IBQA 1C9NA 1PEDA 2AGVA 2VHQA 4MVJA 4W9NA 3VJLA 4AP5A 4BLUA 3NOQA 3U16A 1XTUA 3K2EA 2CLDX 1ZYUA 3QYFA 4IILA 1KYTA 5LZ7A 4M0PA 3TSYA 5EMNA 3UA4A 1CNFA 2ABWA 2F4VB 1J99A 2VN8A 4H0NA 2QE6A 2OD9A 2NGRA 5MF6A 2IEYA 3O3MB 2A5LA 3ZLVA 3T5AA 1Y89A 4WWHA 4M87A 3RRFA 1OAAA 2ZBVA 1S2IA 3LECA 1T36A 2JFQA 4QLAA 1CUHA 1PDVA 4PC2A 2LDBA 2VBFA 1J0CA 4MINA 1UT6A 2DAPA 3N2KA 5IJAA 5A9SA 4JBYA 2JI7A 4DDUA 3WGTA 3RT7A 5AIAA 2GYWA 2PQMA 2Z2YA 1KP3A 1MNQA 1IZ0A 4KAFA 1G9XA 3PX3A 3ZJ4A 3L82B 1TECE 1GSAA 3RCBA 1KMQA 4DMCA 3QY9A 4E03A 1TTPB 3UB3A 1JW9B 4WJKB 3WAKA 4ER0A 4D9HA 2FPGA 1RE1A 1T9KA 3WMXA 5CW2A 4RC9A 4ZXPA 1LI4A 4CQMA 2IS6A 1T8YA 3TSZA 3CGGA 4QTTB 3CSDA 3RF7A 1G8AA 1SOWA 2Q5EA 4IX9A 3IAAA 3ZGOA 1POXA 1MMFB 3EA0A 3PFNA 4LJYA 3BYZA 2R86A 3DS8A 4B4VA 2NMVA 5THQA 3QQPA 3UNXA 3WV4A 1H6AA 3F5FA 4UUNA 1U8TA 4I3HA 4WLEA 5SZJA 3W9UA 2GD0A 4J0IA 3RK1A 1DBQA 3W5DA 2ZUVA 3PRKE 4F2GA 1FIUA 1QGZA 3T1NA 2XI4A 4MWEA 4WLOA 4ZVPA 1OT5A 4F9EA 4OXXA 5EL0A 1GPMA 1UBSB 5K3OA 2OWDA 4RLFA 4DRXB 3EC1A 1H3EA 2I78A 4FMCF 2D59A 3A6EA 2BFFA 1U3WA 1QCDA 3WA6A 5EHQA 3K0AB 2Q8QA 3WXBA 4MS3A 2YMQA 1QGDA 1ZK3A 2HJGA 5L51A 3I76A 2ONCA 4EB8A 2ISCA 4HEQA 2P5TB 2A9FA 3P2YA 3KJIA 4AZ0B 4AY4A 3J80A 4QKQA 3P8ZA 3DFFA 4A03A 4HAYA 1NY6A 4QOFA 3AV0B 2G9NA 1JECA 4EEZA 1ZW1A 2MINA 4LISA 1HMPA 2FSUA 1ZH2A 2BOVA 1LV7A 3SYTA 4BVLA 1U9IA 3KLNA 4D26A 2FGJA 3BCUA 1FY2A 4MGEA 5LD2C 1ULAA 4YCLA 3H5TA 1JLLB 1I32A 3WJ2A 3OCYA 3R6DA 1D1QA 3GLIA 3ZU3A 4KUGA 2R6ZA 5C8YB 4D4KA 4BECA 2G9QA 3UUEA 4JP5A 4ZAZA 3THRA 1VL5A 4PV7A 3PICA 3M82A 1Q1EA 4TL6A 1RAAA 1BXKA 1PT7A 4BIMA 1GO2A 1SCJA 3S1AA 1CETA 3ABOB 1G9TA 4O4JA 4W5JA 4G5SA 4CG1A 1J5EB 3U4QA 4D5GA 2J3QA 1QK4A 1J06A 1FDRA 3WK9A 5BRJA 2D0DA 3KEOA 4J43A 1Y9AA 2Q3BA 2OHXA 4AJ1A 1E3DA 3H9JA 4Y9SA 2EBFX 4UOZA 1ZAKA 4HQ0A 4JODA 1KP9A 2H11A 5TPWA 1RCUA 3D3JA 3DE3X 4KUEA 1M1XB 1VHDA 4UNIA 3U3KA 5CXQA 5HM6A 1AXRA 3A4LA 2P41A 1ISGA 4MPPA 1UAYA 1ZUNB 3SHOA 4DA4A 2RGUA 4EO9A 5LM3A 2K7FA 4BNIA 2YYAA 2RK6A 2V7TA 3IP5A 3GYBA 4FP9A 5EIOA 1DT5A 3MJSA 3WGUA 2M6SA 1FUKA 1YS1X 4KE8A 3U3RA 3Q98A 3VR3D 3NHMA 2NV0A 4BFZA 4GR5A 4R9VA 4GVLA 3I2GA 2REOA 4WZZA 3EJWA 1FNBA 2ZWVA 3OSUA 1E1NA 1Z0AA 5FB3A 5IAKA 1NW9B 3EY4A 1QLWA 3NT2A 4JVOA 4AVYA 3FVQA 1I3KA 1Y34E 1SQSA 2QNIA 2UZIR 3KZMA 5JS6A 5F52A 3UV7A 1JQ5A 4FPXA 4JSYA 5ICGA 1SXJB 2F9LA 2A33A 3EDQA 4OHWA 3JAMA 3SK0A 2R68A 4M8KA 1YI8A 1Z22A 2JFVA 2O8NA 2WJ6A 2JEOA 1S4QA 1X7XB 3MAJA 1ISIA 1BXZA 1IY0A 1ORIA 1QO0A 3B1YA 2AUTA 2OSVA 4NHOA 3M9LA 1GNPA 5GV8A 3UT0A 1VB3A 1R4NA 1Q0LA 3RFFA 1SCKA 1Z4OA 1F1JA 4JHXA 1U8UA 1J56A 1Q2UA 4G1FA 4WT7A 1W2GA 3QX8A 5K0EA 1CEEA 1IN4A 3P9SA 4YRMA 5JHHB 2F67A 2WA1A 3BGOS 3KPVA 4GMKA 3JXEA 3R5TA 3P9RA 3NHFA 2BELA 2KLHA 4A16A 4BRUA 2O0LA 2CKMA 4TRJA 3S7ZA 4ZYLA 1I13A 1Z25A 1ZWKA 4NULA 2W6CX 3TL6A 4Q3CA 2OVFA 3OQVA 1ULHA 3E2MA 4OKSA 1L4GA 3KJFA 4Y1RB 1RYMA 1XI2A 3DDNA 4XARA 4M54A 4U2CA 1V7QA 3G6KA 3DOHA 3IXLA 1QPGA 2I4TA 4NP6A 4U02A 5DGXA 2EAUA 4C6RA 5FTJA 5I48A 1W35A 1X39A 4EG3A 5BWCA 5C8DA 4FDTA 1TTQB 3R0VA 1PJ8A 1NYTA 2C1ZA 1DTWA 3UF0A 3D7RA 2BTOA 3CW8X 2TECE 2CJYA 1GPBA 2D2XA 2G09A 3P9KA 1A5SB 4X1KA 3EC2A 3SC4A 3L4JA 1NFQA 2IKQA 2JASA 3SWWA 3G6WA 1DRWA 1OPXA 4EL5A 4O2LA 1NU8A 2A7QA 2GRUA 3B3AA 3QBTA 3J7TA 2EX4A 5GPBA 4F91B 4BO3A 5ECWA 2ZI3A 2ZWOA 4CQMB 5FEMA 4YMUA 4EYSA 3OKPA 4PCAA 4GVPA 4R2WA 3NETA 4L73A 4BO8A 3HXOA 1NBAA 1RRPA 5CDUA 1UM9B 5AK0A 1NM5C 4PAWA 1U80A 3E9CA 4CTOA 1KORA 3F7TA 3OMWA 4HNAB 2HF9A 4B8YA 4JJGA 1FFEA 3B20A 2BP7B 4KJXA 4OOEA 3FUUA 3N2IA 3FDZB 4Y8VA 3X3HA 1IUOA 3O94A 1PZHA 3DYBA 4PLFA 4FSHA 2NO5A 1WV1A 3SDZA 2OORA 5DHQA 4DLYA 2BTEA 2XLCA 3H1AA 2GR9A 5EP4A 1TTTA 3RC7A 3L4SO 3X43A 4BAZA 1AIPA 1AJEA 1NSTA 5CLLA 2CVHA 3GNLA 4R31A 2LKCA 3COYA 3PPIA 2JLYA 2H2AA 4HQFA 1DL5A 4DMRA 4DDVA 3MCTA 3PT5A 5KX5A 3MWEA 3OU6A 3F3MA 4WBNB 5EKDA 1Z7YA 1D2CA 3L0OA 1BNCA 4B4DA 2ACKA 5D2CA 4ZDWA 1XT6A 4M1OA 3F9IA 4N0DA 2HQBA 4GO1A 3CR7A 1LJLA 4QHTA 1T8UA 3COJA 2BMVA 4HR7A 1KRWA 4OJKA 3GRVA 4HNGA 3MMXA 3T7AA 2RI6A 4XSHA 3P2KA 2BGTA 1NVKA 3ZHCA 4P22A 2IY8A 2QQ0A 3ONWA 4JB8A 2IHJA 3KOWA 2X6RA 4ZCSA 1P60A 3KZVA 1YOVB 4DUPA 4QQKA 2QJRA 3PD7A 4MW2A 5C4GB 3ZNPA 1LNZA 4U7WA 2C7BA 2JLBA 1AGXA 3A9UA 3BORA 2UUPA 2NSDA 3L4BA 4GBGA 3MRXA 3OUZA 4PC1A 5IAEA 5EAIA 3TJRA 5B4VA 5GZ3A 2KYRA 4RZUA 4YO7A 5BNZA 1EI9A 3GCWA 3A11A 4MDHA 3GWZA 1E0AA 4L2IB 4J29A 4MRMA 4DWVA 3TLXA 4MUGA 4URHA 3GXOA 1VLZA 3IUPA 4GP6A 3GVCA 4G56A 4S1VA 4ZAVA 5DYWA 2EX0A 3E1GA 1U0HC 2HRBA 2CKDA 3QWAA 1BDMA 1MA3A 3RRNA 1O6BA 2H1IA 2HCFA 4EW6A 1HE3A 1C30A 3AOGA 1U4NA 3MCAA 2HJRA 3MHPA 4Q7JB 1W4BA 3U7GA 2IYQA 3TFWA 4YRAA 5B6PA 5CB6A 5JBQA 3CUTA 4AAYA 2C96A 5JFGA 3AEUA 1ZXLA 5BR4A 2OHFA 3EG5A 3M6LA 1WR8A 1JG3A 3IMKA 2XNDA 4EG5A 1CJVC 4G25A 4UNQA 4AUMA 3FHLA 4DPKA 4FJ2A 2NZWA 1DWPA 1JQEA 2CCGA 4GWGA 4UE6A 1JUDA 2BEUB 4DUYB 2O57A 4URWR 1Z68A 1OIXA 2X0KA 4OI4A 1QNLA 5A0TA 2OAP1 2R3SA 2WWFA 3PGXA 4F86A 1W30A 1HZJA 1DP4A 1A2KC 1GRCA 2RK3A 3OHSX 4GE0A 4WFJA 4XCQA 4F4HA 1X86B 1X7HA 1SQGA 4ZN6A 2W2OA 1T25A 4CMAA 5CT8A 4DR3B 3B48A 5LB4A 1OGIA 3KB1A 2PKRA 3SXUA 4ED9A 1ZM2A 1VHQA 4JOSA 3NPAA 4L4RA 5KJ6A 2K5UA 3A7DA 1S2MA 1ID1A 1YVEI 4PO8A 4C4TA 4M0EA 3ZS8A 4G89A 4NZZA 3AETB 3T7TA 5K0TA 1GCOA 3WR5A 2GWHA 2JDIA 3R7SA 3ZXUB 3K5WA 4A2QA 3FLAA 1CUWA 5HS6A 4AZ0A 1MENA 4MLDA 4G97A 2C61A 1BX0A 2EV9A 4FQ5A 4Q39A 3I5XA 5F73A 1DXOA 3OU7A 4PZ0A 4ALIA 3RB8A 4B0OA 2NP6A 4D02A 1GQFA 3B3JA 3BWYA 3JQDA 1YVRA 3ZI0A 1NNSA 4IGAA 4NESA 5SZKB 1V11A 3CPJB 3FHOA 4GDFA 4L9SA 4LYEA 2QZZA 4OHYA 5K0ZA 2FK7A 1DAHA 4AG3A 2MWMA 2I55A 4F9FA 1RR6A 5A3JA 4F8JA 1UT8A 2H52A 1Q1AA 4F3YA 2XHZA 2QN6A 4KVFA 4X3OA 1RACA 2LPMA 2Q1XA 2WTBA 3HJBA 1QV7A 2QMZA 4GC5A 2DB3A 4B3GA 4CKWB 2PL9A 3UTCA 2MMGA 3CLSD 1HNNA 3T7IA 1GRRA 1Q0QA 2B9VA 1QH8B 1QE5A 2FR0A 3INRA 3QVOA 5DNAA 4HRVA 4J0CA 1E9VA 3G0OA 1NRIA 4P3OA 3F46A 2VFAA 2AT1A 5MN5A 1QMPA 3S0JA 1DMRA 2ZU6A 3QNUA 5IVIA 5CDHA 3KETA 4HAIA 4OJYA 2PZ8A 1HKHA 1DG1G 1O9HA 4JGBA 5DASA 1TKAA 1GKKA 4QU9A 1JX6A 4WPGA 4F4FA 2BM0A 3SC6A 2Q3CA 1EUQA 1IHYA 3BXEA 4RTOA 5C8YF 1ZESA 3WICA 2X4LA 4HWPA 4Z0HO 4LXHA 5FFFA 1ZCBA 1GTVA 5PNTA 4YAOA 1RRFA 3JD3A 5BUCA 5B2ZA 1UQUA 4J75A 3V4OA 4I3FA 5I7WA 2EHJA 1YFLA 1KZ7B 1FXWF 1XMJA 3GJTA 4LZPA 2O20A 3KAPA 2YKGA 1QVZA 5HILA 2BMJA 4H4DA 3ZI7A 3A27A 3FMIA 4UZEA 4AJLA 4Z9AA 5JAPA 4UE2A 3RKRA 5CFRA 4HTFB 1OVGA 1YI1A 2QTLA 4NONA 4X9XA 4YYEA 4QPNA 3QY0A 4Y6OA 5AJXA 5CJPA 2J31A 1NXQA 2WSYB 3B7GA 4W5WA 4X97A 1WS6A 4DADA 2V6IA 4AKEA 2QL6A 1ZMBA 3FFTA 2YOGA 4QE3A 3KQNA 3HKDB 3NVAA 2RHMA 4I5EA 2JAWA 1RI2A 4X94A 3SG0A 3HSSA 3LJKA 4ENRA 3TGPA 2YL2A 1MG5A 1T2FA 1MO6A 4C89A 4O5OA 2Z1DA 2ZIGA 1N5DA 3IP7A 3TKLA 2VHUA 4KMRA 1DAPA 1I2CA 1NP3A 2RJNA 3A2NA 1ZUIA 1KJYA 2DFTA 5G4KB 1FX0A 1LRJA 1XD9A 4KL8S 1TE2A 4RA6B 1LNSA 2BE7A 3HNOA 5E7IA 4OF4A 1KJ8A 1CQPA 3A6ZA 4YREA 1J00A 4RMJA 2QUAA 4UBMA 3GJ7A 2FOLA 5GIOE 3OPYB 4KACA 4KR3A 1OLXB 3AGPA 4K8OA 3GJXC 5KTPA 3HLTA 1AS0A 3H19A 5F5LA 4JP3A 4HX9A 2FSVA 4LZZA 4DGQA 4IDFA 5FOQA 1SCBA 3P2IA 4C7OB 1KFEB 5ALUA 3OZ7A 2W2KB 1CRWG 2H57A 2GKOA 1EBFA 3HI4A 5CEFA 1N9GA 1G98A 5D86A 1E0DA 2VDJA 1NBMA 3G2NA 2PXCA 2YJ4A 3DZDA 2EL9A 1PLJA 4HATA 5JWOA 2P68A 1FRNA 4ND3A 4LRUA 3ILXA 4UC0A 2DF8A 2PJUA 1LBQA 4V0SA 3EF0A 4R2XA 3DBRA 5HFJA 1VZ3A 3AJ9A 3MILA 4H15A 4QGGA 4QT4A 4YBZA 1JZTA 2Q27A 4OD0A 4OQNA 4TMXA 4QDUA 3VU3A 3FOFC 3CWCA 2NUAB 5J5CA 1S3FA 3PUYA 4QUGA 3ZIUA 5JVDF 5TJHA 2DUMA 4E2WA 5EY5B 2QBYA 1V5WA 1XLWA 2ZIZA 3M1LA 1I51A 2OG2A 4C0XA 1U2DC 1MW9X 2ST1A 1IQUA 3QF7A 3VDMA 4AMVA 2YWXA 5CW1A 4EFMA 2FEKA 4K9RA 3OQHA 4NCIA 5HF8A 4ZK2A 2B5VA 3IKMB 4DWWA 1GLNA 2WYHA 3W1VA 3K16A 1RYDA 1KY5A 1ZINA 4ND7A 3H0CA 1YZLA 3NBMA 4UFNA 1RU3A 4QC2A 4H1WA 5JAMA 3LQ2A 3M6MD 1Z8DA 2J41A 3I4CA 1T4BA 2F17A 4JDUA 1Z0FA 1E2EA 4A0SA 5AVVA 1TA0A 4W7IA 1XXHB 4LXGA 4FWTA 1FC0A 1E58A 2AS0A 2JIBA 4JA0A 3O82A 5M29A 2HZ7A 3DOEA 4MGIR 1IEQA 2A1UB 3DC7A 3ICVA 4BBZA 1ENOA 2ERYA 3C7KA 1Z0UA 3VAYA 1XNGA 1F2UA 1Q2XA 1YK1A 2ZUTA 2Q49A 5KYGA 4DG8A 5A3SA 4I99A 1QH1A 5A5GA 4CM9A 1AKNA 4EARA 4OCZA 3PA8A 1BH6A 4QZVA 3MAAC 3WFJA 3DAFA 2H1LA 4KMMA 4HB0A 4MKFA 4NRDA 5JLAA 4BQNA 4UVHA 4HWOA 2XUIA 3GLGB 3U4DA 1OBVA 3FWKA 4WOJA 1DCTA 2JIOA 3DCIA 1PJTA 4EUFA 3L0SA 3KT8A 4KV7A 4TWRA 2FZWA 1D4OA 3VSEA 5IUJC 2AJLI 1ZK2A 3B85A 2BSQA 1PG5A 4TT3D 3RNLA 3RUIA 3KYDA 1WXEA 5C7YA 1E59A 3R3ZA 3MINB 4IZOA 5ILOA 4GHWA 2V59A 4F3NA 1MOZA 4W63A 1J7KA 1FK8A 2B7CA 1H2FA 2QMOA 4MWDA 3G9TA 2FSHA 3FCCA 3L1UA 4N8SA 4OAPA 5CB4A 3DNMA 1JDTA 3PNLA 4KMSA 4QBIA 1ZO8A 2X2OA 5IAGA 2HK7A 1DHTA 4LY9A 3GDWA 3DQZA 4R5HA 4RQUA 1N78A 2OK8A 2Z1NA 4DQDA 2DT5A 1JLSA 3KG2A 1SUIA 1FFDA 1UPXA 3GROA 5GGYA 1MT0A 4BTEA 3KELA 2J4DA 4R83A 4CR6A 1P2GA 3GEPA 1AQYA 5CA0F 1Q0ZA 3ZD6A 1RS0A 2C98A 2X0DA 1G5QA 3VBEA 1BVUA 1W87A 1Z0SA 2QTWB 4JBIA 5IUKC 1DEXA 1FFXB 4DQVA 1V5IA 3CHYA 5IU6A 2GEBA 4PF1A 4EG7A 3ENQA 4P4LA 2H3HA 1E2HA 1OAKA 2DQ4A 2FZGA 1S8OA 2Q0SA 3BXOA 5HP4A 4B73A 2HXGA 3WRWA 2C84A 5HK9A 3T3NA 2BGNA 5EIBC 3I9KA 1BWRA 3PENA 4YR7A 1MVOA 4JB2A 4D96A 2AFIE 1G55A 4YFYA 1KS9A 3N8IA 4NS1A 3TFQA 1TT5A 2BI7A 1OU0A 4RBNA 1EDZA 1PW5A 2XMPA 3KZXA 1FX1A 4N3CA 5JNUA 4YA6A 1FFXA 1P4HA 1U28A 2AMLA 1C9DB 3M81A 1CF2O 3ZPXA 4LXIA 1DQRA 1ZFNA 2H4XA 3LCVB 2B99A 3RRZA 4HWRA 4MEAA 1W34A 3C1TA 1LF0A 3LI2A 3T6KA 3K0FB 3JD1A 1RLUA 1H42A 5J4LA 5FPKA 3HHEA 3SYLA 3VUFA 2GUGA 2BGRA 2GN9A 3C5CA 4I3GA 4PQGA 3U9TA 1BA2A 3AEKB 2E6KA 4RZSA 5J1TB 1ABBA 3QKRB 4PG4A 4H16A 1NWCA 5CIQA 4R1MA 2R00C 4QYIB 1Z15A 2GI4A 3NUQA 1LC3A 5ALNA 1GSHA 3HDYA 4HUQA 4JNKA 2GDJA 2C95A 3E5MA 3I5AA 1JWBB 4B4KA 2BGKA 3TLGB 1I80A 2Q9CA 3G88A 4LXXA 4P7BA 3UQYS 4KMOA 1FMTA 4PX5A 1G8KA 1RJ9B 5EWMB 3Q9LA 3TW4A 4A0FA 4KVAA 4AKTA 1P0QA 2J45A 3AFIA 3IAHA 3PEUA 2ZJYA 1QDUA 2Q5IA 3GB9A 2G88A 3SEQA 4N3BA 5K6AA 4MMXB 2XMZA 3NS7A 3N86A 4HP8A 1U63A 3OA2A 3L6UA 2FJPA 1R5NA 2CHGA 4DFDA 1ZD3A 3GBVA 3LA8A 4ARIA 2GF0A 3M0EA 5BV0A 4WADA 5IYZF 2ZCVA 4HQ6A 4K87A 1PT5A 4IF4A 4E7OA 5L53A 3F6RA 3HUTA 2X58A 4ARSA 3UQZA 1QOZA 4LQCA 4NDAA 2Z8YM 1V37A 2VT7A 3K9FC 1BXRA 1Y1QA 5K0FA 1D6JA 3WWDA 3SQWA 1W6UA 3AETA 2IP1A 2IUTA 2B21A 2KE5A 1QJ4A 2RC6A 2XVYA 4R41A 3WGJA 4XLLA 2HF8A 2GCNA 3NHYA 3EBLA 3MT9A 2D3WA 3BICA 3D3EA 4PG7A 5LP6C 3HL4A 2A92A 4JFRA 4NBSA 5AFSA 3RG8A 1EIZA 4X64B 5KVCA 3GQBA 1I9GA 3E9QA 4L4SA 1UCFA 2VNAA 4GE3A 4MUMA 1F0YA 4A6XA 2A0XA 2HJWA 3AUTA 4BE4A 3I30X 5F1YA 4OTZA 5B3JA 1QKJA 1FMCA 3N87A 3WKEA 1FDTA 1QQ6A 4R6XA 4RHTA 5FBHA 2RI0A 4KB5A 4BUZA 4IW3B 1NQOA 1IATA 4OLFA 1CJUC 3CSSA 1YRHA 5M5BA 2WC1A 1GQOA 1V16A 1XDDA 4K1LA 5AI8A 3VI4B 4A7PA 4A8HA 9LDTA 3IUNA 3VR2D 3NHZA 3HLKA 4PYQA 1NFFA 3JWHA 3IE1A 2YFHA 4M0KA 3F2VA 4AF7A 2Y0DA 3ZWMA 1NZJA 4LEIA 1JA0A 2B8NA 1EWQA 4UHBA 3ORQA 2H2IA 4ZT7A 1WV0A 2HDNB 3D64A 4F3KA 1VLQA 3LE8A 3DGFC 3IDFA 2R2AA 4WN9A 4RUKA 1CZRA 1RFGE 3MW8A 4FGLA 5TE9A 3LT5A 1VKNA 1H8HA 2XDQB 3K4HA 5I9TA 2HGZA 2V54A 3W4KA 1RI4A 1KZ6A 4JI8B 1Y5LA 1S7GA 4NCKA 2XCSB 3HUFA 3OZIA 1GL7A 2IPMA 2JAPA 2REXB 1HQDA 1IHDA 2O8FB 3WE7A 3GH3A 3WLKX 2Y27A 4QLOA 3BHMA 3KSRA 3FJOA 4QOGA 1Q3HA 3JD4A 5HIJA 2PAFA 1RMYA 1F9EA 2P9FA 5TQ0A 6LDHA 2A86A 1JFTA 1R37A 4Z4QA 2IEAA 4MPDA 3BXPA 2R7NA 2F1JA 1IRXA 1Q1QA 5H83A 3THYB 4R1NA 4CF3A 4GD3Q 4ZOLA 1YE5A 3GLTA 4IGEA 2R6HA 4E33A 3H5NA 2YCLA 3H1GA 1IG0A 1G2QA 1QHFA 4YAKA 2WTXA 1R16A 4MW0A 1FDIA 1CUJA 2NU6A 2SICE 2QPAA 2QN2A 4DLKA 5B1EA 5K3FB 4AQ7A 4BUCA 1ZCAA 1NIPA 2GD2A 4HT3B 2J3DA 2EJUA 3P0FA 5DNDA 2IDZA 3C3EA 3SSNA 1V26A 2QUHA 3HJGA 5A5EA 4XB1A 3SYMA 1QP4A 3GUCA 4WEOA 1ZM3A 4D7AA 3AVTA 1W4CA 3C41J 2IYAA 4IXMA 4IVRA 1KZ9A 3I6MA 1HT0A 2DFPA 1XVAA 1QIMA 4XWKA 1RSZA 2PNFA 2PWBA 3F5DA 1T2VA 3NGXA 3VC3A 1HLGA 1AK2A 2HHJA 4WCVA 2E3JA 1W4ZA 2RK4A 2X8JA 1MEEA 3A1SA 1N5LA 1QHGA 2VK2A 1NKTA 2FN3A 1NW6A 1YQXA 2ZB4A 5ITZB 4XD2A 3WGIA 1T5OA 3TE7A 3W2HA 3TUZC 5BPHA 1ECBA 4JJKA 3EXHC 4D0LB 3VDXA 4YAWA 1G21A 2FPSA 2P2GA 2QENA 4XKJA 3W6OA 1H4QA 1OU4A 2OY0A 1M1NB 1YFKA 4L6AA 5A7GA 1OREA 4GFDA 4INJA 1ORDA 1I6KA 3M4NA 4MI9A 2PEZA 4PZ9A 3JR7A 4ALMA 4CV1A 3DZGA 1RXUA 4ZREA 1WA5A 1ULUA 1VSUA 4P4UA 4Q1FA 5HCUA 1GQQA 4GI7A 4Z9YA 2L42A 4NCHA 4WZBE 5FNZA 2H54A 1II8A 1E62A 4DEYA 1YJCA 3D7KA 4TKZA 4TMYA 1ABEA 3HBLA 1R6DA 3L8CA 5HZKA 1A9OA 1LLUA 1RADA 2Q4EA 3CEAA 3HM2A 3ME5A 5ALGA 5F35A 5TJ9A 3D8SA 3QEBZ 3EFEA 4IEFB 1DQZA 2NOAA 5DM1A 2J0EA 5HHTA 5EHIA 4S0XA 2NADA 3RS0A 1X77A 3DBHB 2XKKA 3GAZA 2HEIA 2PRYA 1J20A 5KYTA 2DERA 1YD7A 2P9TA 1B8PA 3S2ZA 3IOMA 3OETA 5JJ5A 5I7FA 4QJ4A 1YS6A 1Z45A 4LZOA 1E9EA 1N2IA 1JNXX 4G1BA 1LC0A 5KSOA 3FVWA 1GXSA 3UJHA 4XOIA 5I8ZA 2O2JA 4JHLA 2GBLC 2R8RA 3W4JA 2O8BA 5AKGA 3GJ8A 1U0SY 1LH0A 3MWGA 4PR3A 2OYCA 4DARA 3BMOA 1M2KA 3PSHA 1A9SA 3RW9A 1P7YA 4FOLA 3MOSA 1FLAA 1CW2B 4PBTA 3W6UA 4ZDIA 3CW2A 1GDHA 3RUFA 4BU0A 2J3HA 2YY5A 3JQ9A 5FBKA 5EEGA 2PBRA 3VYTB 1KDVA 3ZG6A 4IIVA 1FFAA 1HDZA 3OEYA 4V0ME 4DR6B 5CURA 2YYZA 2H4FA 3HKDA 1BJKA 4FE3A 3DHWC 3LDUA 4A1FA 1O9GA