2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
2X23A 1U28A 4OO3A 4NBUA 1QG6A 3L9XA 4PLWA 1WW8A 4R1TA 4IS3A 4BO0A 3LVFO 1FK8A 3HQ4O 4BNMA 2Y67A 2FSSA 4TVOA 2ZK7A 3AOGA 3BXXA 4EJMA 3U3XA 4NHEA 2PD6A 4Y8VA 4UVGA 4IQ0A 2XXBA 4K1LA 1B16A 3H6KA 4DVJA 3A4VA 3R0IA 4G5HA 4NBTA 5KWEA 5T5QA 2XXJA 2X7HA 1E5LA 2VZ0A 1B7GO 3TQHA 5IZCA 4U8GA 4XYEA 4MOWA 5DBGA 4JGBA 4LW8A 3NT5A 3ICCA 1E7YA 4XYLA 3GG9A 5HRUA 1KY4A 1UDBA 2BF7A 3VKVA 4WECA 3PIDA 2W8ZA 1T26A 1DIAA 3TDKA 3WXBA 1GD1O 1KEUA 1HKUA 2RBEA 3IC5A 2B0JA 4TVBA 1H6AA 1JKJA 1P31A 1HE2A 1D8AA 1U9JA 3FD8A 5JW6A 2C7VA 4MP6A 1H2BA 2X86A 1LLQA 1A71A 3HUDA 1HDOA 2V6FA 5B37A 3O8QB 3GUCA 1EFKA 2QX7A 1YB5A 2I5PO 1BG6A 1A27A 3N58A 2G76A 3GPIA 3JD0A 3KEQA 4K9DA 3TL2A 3WYEA 5H81A 4O0LA 3AM3A 2YV1A 2BI8A 3O38A 5JYDA 1M67A 1XG5A 5IN4A 2EG9A 4PLPA 4M54A 1Y1PA 4J4BA 3S2EA 1Q0HA 2C54A 4KUEA 4EEZA 4O1MA 4E2ZA 4YR9A 4RL6A 3SX2A 4YPOA 1Y9AA 3GHHA 4E5PA 1RM0A 4DPLA 4BO5A 1QV7A 4II2A 4M87A 2BMAA 1SC6A 3C8MA 4R1UA 1EK6A 3TL3A 4YJDA 4UUMA 5T8KA 2JCYA 4CV0A 2RH4A 5L95A 1IPEA 1IHYA 1BXGB 4LCJA 1DAPA 3F46A 2JFGA 3U4HA 3VC7A 3WJ7A 4YAIA 1E6UA 1FF9A 1EUZA 1H6BA 4H15A 1BWSA 3KSDO 3QHAA 2DBRA 3GZ4A 1SOWA 4YWJA 2DBQA 1I2CA 2ZCVA 4PZEA 3FNFA 3D64A 1YQGA 2FSVA 2J5QA 2C20A 1KETA 1P1RA 1GV1A 3QV1A 1DRVA 2P2SA 3DBHB 3DONA 4IMPA 1YO6A 4FOSA 3DOJA 4GSKA 5G0WA 2AE1A 3ZWPA 1GU7A 1E3LA 4GPD1 5T8KC 2Y1OA 3H2ZA 5CAEA 3OH8A 2WDZA 3O9ZA 3JTMA 3FPCA 3NDRA 1C1XB 2BI7A 1W4ZA 1U3VA 2O4UX 1JVSA 3W6UA 2Q1UA 3TPCA 5A5FA 5LDHA 2QZZA 3O26A 2GO1A 1PJBA 3NTOA 3ADPA 1YL7A 2C59A 4JQCA 4UVDA 4L75A 5DT9A 1LA2A 4PLZA 4BO6A 5EJ2A 1PZHA 4I5GA 3IP1A 1PZFA 4A10A 2GD1O 2P68A 4TMFA 5G0TA 1XA0A 1Z73A 2W2LD 1I8TA 4WKGA 4A27A 5JLAA 3O8QA 1YS4A 5G0UA 4PLHA 4A73A 3TOXA 4R3NA 4B3JA 4E5MA 5B4TA 2IODA 4HFRA 4BMVA 1HYGA 3WSVA 2O4CA 3OA0A 4Y67A 4YCAA 3UFXA 5L7WA 3KYCB 4WLNA 1BDBA 4EBFA 4CJXA 4JBGA 3H9EO 3T4EA 1ULUA 3VVBA 1YH3A 3ZH2A 1MLDA 2H63A 5TQVA 3BMOA 2RCYA 1C14A 3AY7A 1GFSA 1PX0A 4DBVO 6ADHA 2Q49A 3WGTA 3DBVO 4IPTA 3R3SA 1JLLA 1M76A 4JBHA 5BSGA 5DOZA 1T2DA 4MO2A 1JU9A 4YT8A 4WJZA 1LDMA 4MKXA 4J2OA 4KDEA 3L77A 2BLLA 3ICPA 3VH1A 3MJSA 4AFNA 1ULSA 2IEBA 1ZSYA 2WYUA 3UCFA 4P4LA 3WGZA 5EIOA 5AOVA 4D46A 3CTMA 1G1AA 1CDOA 1O8CA 3KB6A 3P5SA 4BMNA 3M1AA 3W8EA 4J6FA 1NWCA 3WB9A 3BA1A 1EE9A 4CR7A 3AM4A 1DFIA 1H93A 1ADFA 4KQWA 1AN9A 2B83A 2IXBA 1O9BA 5C5IA 4CUZA 1YWGO 4OGWA 3WWYA 3UN1A 1XHLA 3B20A 4CQMA 2DAPA 4YJHA 3WICA 1P1HA 3TZKA 5ITWA 1LBEA 1MX3A 2QYTA 4Z0PA 4BKRA 1D1TA 1ZK4A 3ZGYA 1XCBA 4DBZA 5JY6A 3IJRA 4IGFA 4I1IA 3VZSA 4BO7A 1H9AA 1O0SA 2NUAA 2GGSA 1K89A 4L74A 1CQJA 5EERA 4BNTA 1ZCJA 3EVNA 3FR8A 3ZU3A 3PIIA 3WFJA 5K6AC 5JAZA 1ENOA 3GVCA 1GL3A 2W2KB 4NBRA 4JX8A 3KO8A 2V6GA 1ZZEA 2YY7A 4E2WA 3JQFA 4CM4B 2A94A 4Q3BA 2BRUA 2WYVA 3FRJA 1TT5B 1R6DA 1T2FA 3OICA 2OHXA 4K6CA 2NVBA 3RSHA 3UCXA 4CODB 2HLPA 4OXNA 2CUKA 2EP7A 3JQBA 2P4HX 1E7WA 1ISFA 4I5EA 1ISIA 1ML3A 3PYXA 4NIMA 2VYVD 1R16A 2YJZA 1EFLA 1BXKA 4F46A 5CPFA 4BNKA 4BNGA 5ES3A 3RUAA 3UKOA 1I33A 3H8VA 4ITUA 5JE8A 4AJJA 4DC1A 3CE6A 5CDSA 4GMFA 1QKIA 2RH8A 4XKJA 4IDAA 1C1DA 2O3TA 3DAGA 4GVXA 3GVIA 3FI9A 1HE4A 4Y6RA 3MOIA 3NUGA 4BB5A 4UUPA 3RBXA 1L1FA 2QYSA 3DB2A 4Q9NA 4AJPA 3DDNA 1PSDA 4R68A 4TRRA 5AXCA 4MVJM 4I5FA 3DMTA 3HDYA 3DWFA 4JN6B 4DIFA 2P5UA 2ZTVA 1LRJA 2R00A 4J4TA 3KM0A 4LK3A 2CDAA 2I3GA 2HCTA 3G79A 4GX0A 1OC4A 5TT0A 1I3LA 1GEEA 2G5CA 3WGIA 4E4YA 3RWBA 2EGHA 1HDXA 1QXSA 1ADBA 2B35A 4NBWA 4CMEA 4WNCA 1GYPA 4RPHA 2I67A 5G0SA 4R4JA 3AM5A 1F14A 2J3KA 3ONDA 3VPGA 2CDCA 4OH1A 1LXCA 3RUEA 1I2ZA 1TB4A 1PJ4A 1VC2A 4PZCA 1LUAA 1U5CA 2D1YA 4GBJA 1UZMA 2Q2QA 3GN1A 2AQ8A 1MXFA 1X7DA 3ADOA 1JAYA 4FFOA 3OMLA 1C1XA 5COBA 3KBOA 3GEMA 3SXPA 1UXHA 3LT0A 1YQXA 1A9YA 4EYEA 1H2HA 2JAHA 1PJCA 1T2EA 4CL3A 1IZ9A 1DIBA 3DHYA 2NU7A 4GQAA 3U62A 1E5QA 4E31A 4AG3A 4R01A 4HP8A 1R4NA 3QLJA 4FJ0A 2HSDA 1ZO8A 5K0ZA 3H9GA 3CUKA 1TVEA 6LDHA 1AUPA 2GN6A 4RZHA 4FFMA 3E5MA 5L51A 4U0JA 3FPLA 2PZMA 1DC4A 3ZDFA 2JL1A 4ALJA 3NX4A 1JVBA 1P45A 1ZUD1 2G0TA 2YZ7A 4GX2A 4CL8A 1R0KA 1OAAA 4ILKA 2E48A 4OHUA 4J1NA 3HB5X 4IDDA 2WMDA 2ZB4A 3RD5A 3ZU2A 2JHGA 5GMOA 1N5DA 5TX7A 1NP3A 4CMCA 1B3RA 2HMWA 2HO5A 3KYDB 5JY1A 4ZQFA 2P5YA 1UP4A 4IDBA 5A9RA 1LEHA 5BSHA 2GF2A 3V5NA 5EINA 1F17A 2UVDA 4BOYA 1HWYA 1NQAO 3RUCA 5BNTA 4NFYA 1Q7BA 3PZRA 4XB2A 2WD7A 4YJFA 5JDCA 1U3TA 2NVWA 4XX0A 5KVQA 3D7LA 1DSSG 3GF4A 3VH2A 1UR5A 1Z45A 2Z1MA 1MP0A 1Q1NA 2VWPA 1MG5A 4IINA 2RHCA 3UH1A 1XGKA 2P9GA 5A9SA 1QP8A 2ET6A 5IZCC 3QVOA 2VYND 4YAEA 3FTPA 5ER6A 4A26A 1EDZA 4YJFB 1DDOA 1U1IA 1YB1A 4JBIA 4E12A 4IM7A 4ZA2A 4NJMB 5TS3A 3PP8A 4D79A 2CZCA 2QG4A 3WGHA 2OP1A 1Z75A 1EMDA 4BHTA 3V2HA 4CMJA 4E5KA 3BMCB 4E13A 3AUTA 3AU8A 4WGGA 1UDAA 5T6BA 2FRDA 4J9VA 3IDSA 2HJRA 2WE8A 4FR5A 5KNLA 4R69A 1LSUA 2X22A 4TRJA 2CFCA 3GOHA 4J1TA 2P9CA 1WZEA 1Y6JA 3HADA 4YT5A 1V6AA 4NDNE 1IPFA 3H5AA 4NK5A 3EDMA 4J91A 4ZJUA 4RORA 1UXIA 3RJ5A 1QYWA 3ZV3A 3D0OA 1DC3A 3UVEA 3NEPX 4HNGA 3PQDA 1GYRA 3GDFA 2PGLA 3PLRA 1DIHA 4Z3KA 1P1IA 3JQEA 1NX6A 1NPTO 3PFFA 2Z95A 4D3FA 5DULA 1TT7A 3MTJA 4ND2A 4NJOA 4PG6A 4Y9DA 1CWUA 2EKQA 3L4BA 2IZ0A 5KKAA 2Y1GA 3KTDA 3EY4A 4UEOA 3WX0A 4D41A 5CP8A 4CLOA 1FDWA 1KEPA 3FWNA 3JV7A 4QFDA 3ABIA 5GY7A 2PZJA 3D4NA 1GTMA 1P0CA 2YUTA 3DMTC 3JQDA 4EUEA 3WOHA 2D4AA 2ZB8A 1C0KA 2VUSA 4WE3A 1ONPA 3GUYA 1M6WA 2HQ1A 1QR6A 1W8DA 5JAQA 1KEVA 4AICA 4RVGA 4ALIA 2W2KA 1WMBA 4YAJA 1VL6A 4ALKA 4BGEA 1VLLA 5F5LA 4XGKA 3UF0A 2C29D 5I8WA 4HUJA 3X2FA 4CM1A 1VJ0A 5L4SA 5A1TA 1V8BA 2OL4A 2JHFA 3WNQA 2BGKA 3ZU5A 5AVOA 1ID1A 4OSOA 4FFPA 1N7GA 2C5AA 4L76A 1BDMA 3ZV5A 5C3MA 3OIGA 3IS3A 1I36A 3C1OA 2HMSA 3DBRA 4L4SA 4PVCA 3TWOA 1YOVB 4GSLA 3AOEA 3H9JA 4EUHA 2Q4EA 2NLOA 1HYEA 1HDGO 3RC1A 5G4LA 1XEAA 2J3JA 4OM8A 3WBFA 3IKTA 3DHEA 3I83A 4GLLA 4WPGA 3PJGA 1Q0QA 3DBRB 2D2IA 3JQCA 3VTFA 3JQ8B 4QUKA 3EAGA 1UXKA 3P2YA 2F00A 2WD7B 1XIVA 2NQTA 3MWDB 3PXXA 3BMCA 3ZWWA 3IKVA 2GZ3A 1GPDG 3O4RA 5DCUA 4CM5A 4J16A 1X13A 4NJMA 3RU7A 3WGQA 3DBHA 4WEOA 3IP3A 2PLAA 1EEHA 3GZNA 3F1LA 3ZWMA 5KTKA 2DTXA 4G2NA 3MWEB 4IDEA 3W1VA 1KVSA 3H65A 3FTNA 4XB1A 1DIRA 3OECA 1LQUA 5L4NA 3KETA 2Q2VA 1NYTA 3C7AA 3EYWA 1SB8A 4DA9A 4AJNA 1W6UA 1U4SA 1R4NB 3GGGA 3KXDA 3TRIA 3JYOA 1PGPA 2Y99A 4WLOA 4I9NA 3GA0A 1K0UA 3D1LA 9LDTA 5IAAA 1XR3A 4BIIA 1R66A 2OUIA 2VZ8A 3OEYA 3ANLA 4RPLA 2BFPA 4UEJA 2ZTUA 3W4IA 4JXKA 3M6IA 3ZNQA 4NQZA 3ZI0A 4Z9YA 2GZ1A 3TSCA 4J7CA 2C2YA 3U4DA 3WGYA 5KVCA 3DZBA 4NFHA 1YDWA 4HNHA 1PS8A 3PGXA 4GKVA 3AI3A 3GDGA 3D3WB 4LGVA 3K2EA 3LSYA 1JKFA 2FR0A 1YXMA 2I9PA 4UUOA 2E82A 1K6IA 3I9NA 2XOXA 3VTZA 2VHVA 1HSOA 1R12A 4RJTA 5LC1A 4Q3AA 4U5QA 4BS9A 4J1QA 2DTEA 3F4BA 3H9UA 5F1KA 4C4OA 1E7MA 1C0IA 2VRBA 3B6ZA 3JYPA 1PJ2A 3DEYX 3PWZA 4WLUA 2WTBA 2FPIA 2PGDA 3KRTA 1XKQA 1B14A 5KOIA 1A7AA 1HDZA 2GLXA 1RYEA 4F6CA 4Z9XA 1N1EA 1LLCA 1RWBA 3GNQA 4QECA 4CM8A 1E3WA 3GK3A 1P0FA 3PHJA 4ND5A 4TROA 4A2CA 5IDWA 5KCZA 1OBFO 2JFHA 4WLEA 4YXFA 3NGLA 4LRTB 1I10A 3WSWA 4AJ1A 1IY8A 1XSEA 3AUUA 4B3HA 8LDHA 2XAAA 3GNTA 1O6ZA 4GH5A 3ETEA 5DBFA 5IXSA 5EL0A 2O2YA 1HDRA 2QW8A 4J9UE 3TZHA 3H9QA 1AXEA 4D3DA 4YA6A 4N18A 2C82A 2Y1DA 3MJVA 3ZWOA 2VUTA 1XYGA 4IMRA 1JTVA 1JWAB 4BO3A 2VYNA 3ANMA 2IDZA 2QRJA 4Z0HO 2VWQA 4DWVA 2AEMA 1NQOA 1ZXLA 5JBIA 3C7CB 2BFAA 3IUSA 1QYDA 3L07A 4JROA 4R5MA 3CEAA 3CPSA 2PR2A 2O3UA 1WDKA 4JP2A 1YKFA 3RUIA 1ADCA 2RAFA 3FWZA 3GMSA 2EV9A 3DZIA 2PD4A 1L7EA 3IMFA 1DJNA 3L6DA 3WIEA 2ZJ1A 3F3SA 4EGFA 3AFMA 4NU6A 4BNFA 2X1HA 3AOEC 3FSRA 1NNUA 4I5DA 4N7RA 4PG8A 2G1UA 4GKBA 3ENNA 1BGVA 1IL0A 4FC6A 4OIMA 4NFSA 1ZW1A 5GZ3A 4H7PA 5BQFA 1EDOA 2O23A 1ISMA 3RFXA 4FD3A 1WLYA 4AJIA 1YBAA 3X2EA 5JDIA 2Q50A 4G65A 2NNLD 3QE3A 4ND1A 3RCBA 3DZHA 3VAZA 4WCFC 1XQ1A 3E5RA 3KSZO 5TJ9A 3GAZA 2ZQYA 3WR5A 4LISA 3NT2A 4C7JA 1F12A 1U3UA 3MTGA 1Y5RA 1PS0A 1TT5A 2OO5A 2PK3A 3BMOB 4GAEA 1P1KA 2DPHA 3DQPA 1MG0A 4OOFA 3V1TC 3TFOA 1MB4A 3N74A 1YL6A 3ONEA 3EGOA 4UEKA 3K5PA 3OQBA 2DQ4A 2PWZA 4AJHA 2HJSA 1X1TA 1GADO 1LDGA 1MXHA 1PJQA 2C5EA 5ILOA 4RV9A 1WAMA 4TKLA 1PJ3A 2P4QA 3EZYA 4DPMA 1T24A 5HBRA 2VUUA 4LN1A 4D45A 3BTUA 4YEDA 3FNGA 5ICMA 1IOLA 2YQ4A 2YHIB 2CVOA 4TZTA 3ZNNA 4WEQA 5CFZA 1UDCA 2X8LA 2DT5A 3NV9A 4NI5A 1LLUA 2VOJA 4IQGA 3KOUA 1ZK3A 3K6JA 4GMGA 2BH9A 4PLTA 3RAJA 4BNJA 3PJFA 4R1NA 5CDYA 5L7YA 5JYEA 3UAGA 4INAA 1PTJA 2CVQA 3KSUA 2CF5A 5JSFA 5JAIA 1OZAA 1YRLA 3KEOA 3JSAA 4FCCA 3WIDA 4WOKA 3UUWA 5F3RA 2D59A 1ENZA 2J3HA 2UV8A 4BNNA 3C1AA 3PJDA 1P1FA 1DOHA 2X4GA 1IZ0A 2QIOA 1A4IA 2GERA 4OQZA 3TN7A 1I3NA 4TZKA 5BNIA 5CPBA 5DCWA 4J49A 4IXWA 4WUVA 3GEDA 3C1TA 3QVTA 3GVHA 3GY0A 4CQMB 2NV6A 1EBFA 4KTVE 2OXIA 5A06A 1B8PA 4MVJI 1LDNA 1PGOA 1XLTA 2Y0CA 2VZ9A 4ZRNA 1DHTA 2EXXA 5A4DA 1O89A 2X5JO 3IOYA 4P22A 4CLDA 4E5YA 1UAYA 3OQ6A 1PL6A 4D0RA 4E30A 4MVJD 3PWSA 4I9UA 1X1EA 3ZWBA 3AFNA 4XRRA 4BNYA 4Z9FA 3VPHA 2OFPA 2OGUA 1J4AA 1ZBQA 3KV3O 4YB8A 3GR6A 3E03A 3GH3A 3UICA 2X0JA 4J7UA 3GQVA 4M1QA 1FMCA 3ETDA 3U9LA 1HL3A 3Q6IA 3E1KA 4IY1A 3JQ8A 1PEDA 5EQDA 4KUHA 3BHMA 2YDYA 2ZJ0A 2PZKA 3QSGA 3ZHBA 4FS3A 1YDEA 1T4BA 4GWGA 4HWKA 1EQ2A 4WCFB 4CM9A 4IJUA 4OJNA 4HXYA 2GRAA 4PG4A 3U09A 3UOGA 1RM5A 1KY5A 1SB9A 1I01A 5JMPA 3TZCA 1UAGA 1B15A 1PJSA 3GMDA 4IZIA 1JN0A 2Q3EA 3LZ6A 4QX6A 1EQUA 4RCVA 3GNSA 3KVOA 1J0XO 1PQUA 4XQCA 3WS7A 3Q2IA 1FJHA 1D3AA 4N5NA 3STHA 3NTQA 2R6JA 3HNPA 5JCJA 4PLYA 3INTA 4YT4A 3QA9A 2Z5LA 2J8ZA 4ZQGA 3I3OA 1M6HA 1LC0A 1B8UA 2WWRA 4J1SA 1GUZA 4RF5A 1I30A 5I7VA 2HDHA 4HFNA 4OAQA 4Q39A 1RJWA 3VPXA 4J43A 4YRDA 3W4KA 4ZICA 1V3VA 5BSFA 3L6OO 1SEVA 4F45A 3OEWA 1PQPA 1V35A 2ZIZA 3JCZA 3D4PA 1XU9A 3KZVA 3JQGB 3INRA 3HHPA 4H3VA 3T7EA 3U4CA 1QRRA 1T2CA 1DO8A 5G4KB 3WYBA 4HY3A 4ZQBA 1JDJA 2VNSA 4EW6A 4BNZA 4R1SA 4B8ZA 5TGDA 1QLHA 1LTHR 4DQXA 3H4VA 1HDCA 5DCYA 3CZRA 3WGOA 4TRNA 3FN4A 4JP3A 2BD0A 5JC1A 3WJAA 4XWYA 2GCGA 3W8FA 3ZW9A 5CDUA 4XR9A 3T7CA 4B3IA 2PNFA 1NFFA 2Y0DA 2ZQZA 4CQLA 3DFZA 2OP0A 4HFJA 3I23A 4PCVA 5AQ1A 1SBYA 1BXGA 2HMVA 2QRLA 4GX1A 4YAGA 1B0AA 1GV0A 1NAIA 3AJRA 1HYHA 3HDJA 4RVDA 3HSKA 2IE0A 3LT2A 4BVAA 5IF3A 4X54A 5DP2A 3ZHYA 5HA5A 1MC4A 5TSDA 3FNHA 3MJCA 1KIFA 1BW9B 1KEWA 2PKRA 3QIVA 4RF3A 5TF4A 3GPDG 4ONEA 3JYQA 3PVZA 4CM7A 3OQ1A 4ID9A 1C3VA 4L4XA 3RKUA 3DOCA 4FFLA 3K96A 2HKIA 4MVJF 4JIGA 4DQUA 4EJ6A 5B1YA 2GDZA 1HLDA 4K6FA 2EJVA 3OHSX 1ISHA 1H9BA 4Q3EA 3V1UA 3JYLA 3I52A 1HLPA 3PDJA 5A9SB 3PHHA 4J2HA 5L9AA 1DIGA 3CZMA 5L40A 5ICSA 2YV2A 4GGPA 5L4LA 1NTOA 1GDHA 1E6WA 2VTEA 2Y1CA 1NQTA 5I9MA 1HSZA 5CEJA 1JWBB 1K3TA 5H82A 4W9NC 2FN7A 1NVTA 4HV4A 1ZJYA 2UAGA 1KERA 4RPJA 5A3JA 4R9RA 3NYWA 3ASUA 1X14A 2GN4A 1SAYA 3KYDA 1J6UA 2Y1EA 4CM9D 1KC1A 3RROA 4YTEA 2VT3A 2Q45A 3GN2A 4EDFA 4J0EA 3S8MA 1IHXA 1ZSNA 2HK9A 2I76A 2VT2A 3EMKA 5A02A 2ZATA 5GZ1A 3DAPA 3NDIA 3BIOA 3BMQB 5JAMA 1NAHA 3LC1O 1HZJA 2SCUA 4B7UA 2X5OA 4XZ3A 5FF9A 1Y8RA 4GGOA 5F1OA 2VNAA 2Q46A 1HXHA 1MA0A 1ZJZA 3OETA 4DIOA 4UAGA 4CQMD 1U2GA 3T4XA 4TWRA 3GHYA 5FI5A 1LSJA 1N92A 5FFFA 4IIVA 2VWHA 1CERA 4MDHA 4KMSA 4PIVA 4KQXA 1Z7BA 4Y6SA 3GVXA 1E3EA 5U1PA 4PRLA 2IYOA 5T67A 1NHWA 3ZW8A 3AWDA 4J4HA 4WOJA 4KUGA 5DN9A 5CDGA 1PJLA 3DFUA 1NVMB 4CLEA 5TNXA 2B4QA 1X7GA 4OKNA 1GPJA 5THKA 2VHZA 4URFA 3LF2A 1Y81A 1YBMA 3KLMX 3TZQA 3DTTA 3Q3CA 1WXDA 1N9GB 3SJ7A 4E0BA 5THQA 4E3ZA 1I24A 3U0BA 4IDFA 1ISJA 2X6TA 1RKXA 3MJEA 1K6XA 4D42A 1IB6A 1ZKMA 4FN4A 3WTBA 2NVUA 4XRGA 4JCOA 4IBOA 5C7OO 3QW2A 2DBZA 2AQHA 2NSDA 1KVRA 3ZNPA 3ROQA 3WLFA 1RM3A 2OZPA 1PL8A 5G2OA 4Q3CA 1ENPA 4QO7A 2C2XA 4E32A 4K26A 3BTVA 4IJVA 2O3QA 3VOSA 2EERA 4AJ4A 3ZWNA 1NFRA 1LDYA 1DC5A 4DPKA 4WCFA 3ANNA 4IS2A 3RUHA 1EVJA 4IZHA 4XIYA 4F3YA 4NZ9A 3ENKA 4RZIA 4I9HA 4K28A 4DUPA 4LMPA 5B12A 5EESA 2EIHA 1UZNA 3JQAA 3WQQA 4CR6A 3PLNA 1EVIA 1RYDA 4RDHA 2FR1A 2I3AA 2P91A 4O5OA 4XDYA 4U7WA 2X5KO 4BKUA 4XYMA 1CIVA 2WSBA 1LJ8A 1YBVA 1BW9A 2DC1A 3MZ0A 3OBBA 2DFVA 2UUPA 1UXGA 3A9WA 4MINA 1H6CA 5BSEA 2BGLA 3NJ4A 4IQ8A 1A9ZA 3V8BA 3QQPA 1SEPA 3HZZA 2V65A 1Q0LA 4OKIA 3FF4A 3I9LA 4KP7A 1DPGA 1NR1A 3L6EA 3QVXA 4KWHA 5F21A 5ER9A 3ITDA 4MP8A 5LDGA 3OA2A 1DC6A 3SLGA 4RVSA 5JO0A 1EVZA 1GY8A 2Q4BA 3D3EA 3WNVA 2HK7A 3B1KA 3ZCXA 1WP4A 3RUDA 3F1KA 4OXKA 5AXAA 3ROMA 4XGIA 3F6YA 3M1LA 4QSMA 2B4RO 3UGKA 1BXZA 1WWKA 3VZQA 1LSOA 5L53A 4JK3A 1GZ3A 1B3BA 1E7SA 1K2WA 5DP1A 1A72A 4RPKA 4W7IA 5G4KA 1AE1A 4B7CA 1PL7A 4CV3A 4GLOA 2D8AA 1ZMTA 3AU9A 3QP9A 5HS4A 1KC3A 4YJHB 1UP6A 2RHRA 4D3SA 2QRKA 1N1GA 4BV8A 1GYQA 2VRCA 2FR8A 2FP4A 2NM0A 3DZJA 5DF1A 3VVCA 3OJOA 4QQRA 2EWMA 1WVGA 1NWHA 4MVJH 4ND3A 1I2BA 4PRKA 3NAQA 5U9CA 1HT0A 1Y8QA 1EBUA 1E92A 1V3UA 2W4QA 4MVJA 1F06A 1WPQA 4AJ2A 1BVUA 5MDHA 5EQFA 3CMCO 3RI3A 4EUFA 1PGJA 2NQ8A 2CVZA 1PQWA 5MGBA 2AMFA 3OJ0A 5F5NA 4LSMA 2OMEA 3LT4A 3VDRA 3CKYA 3PZBA 4HBGA 4A03A 4CM3A 5JS6A 3B1FA 4RQTA 3DMYA 2EKLA 3TOZA 2A35A 1EVYA 2ZKLA 1LU9A 4C7KA 3E8XA 1NBOA 5KJ6A 3DR3A 4IJKA 1E1MA 2DLDA 1HZZA 2BELA 3RJ9A 3W8DA 1LNQA 3WMXA 1LRLA 1XDWA 2O2SA 2Q1TA 3EZLA 2E49A 1QV6A 2W90A 3ZNOA 1NASA 3GG2A 1J5PA 5FI3A 3RIHA 1KS9A 4B79A 4BO2A 3TF5A 2EF1A 2GR9A 4PZDA 4OL9A 5KVSA 4ALNA 3TJRA 5COAA 5JDIC 4QFCA 1VSVA 3RBZA 4XD2A 1ZSVA 2VYVA 4FW8A 1DLIA 4RPGA 2O3RA 1H0KA 4WASA 4DC0A 3G0OA 4Z6KA 2WE7A 3WFIA 1PGQA 2WJPA 4KZPA 3DO5A 1LLDA 2JJYA 8ADHA 3GFBA 1LI4A 1OOEA 3HWRA 1BTOA 3RC2A 4A7PA 1YONA 4YQZA 3S55A 3PRJA 1VE9A 2CDBA 2JAPA 2IEDA 4NMHA 5I9LA 1SPXA 5IDXA 3BHIA 2VCYA 2FOIA 1T1RA 3MJ4A 2J5KA 4BNLA 4BO4A 5IDYA 2YYYA 1ARZA 1XWFA 4YVFA 3LT1A 1A4UA 1ZK2A 4BGUA 4ROSA 2H5LA 1LSSA 3QVSA 5A3VA 4BMSA 4EITA 4MPDA 5B4VA 1QORA 1VJ1A 2WD8A 3LLVA 2GYYA 3E82A 2EW2A 4M8SA 3RFVA 5JNLA 2E4AA 5I7SA 3KYBA 1ZK1A 3B70A 4GWKA 5ILGA 1MC5A 2BKAA 1WDMA 4FFNA 3PYLA 2PTGA 3ZWYA 3JD1A 1VM6A 3BZUA 3SBOA 1P9LA 2PY6A 1D1SA 1O95A 4ND4A 2F1KA 1OI7A 2ZB3A 4JJIA 4BNVA 3O03A 1VL0A 3WGGA 4F6LA 1YVEI 3A28A 1EUDA 2H6EA 2B69A 3GEGA 1AGNA 1RM4A 2FZEA 5A9TA 1IYZA 2X9VA 3OIDA 2JD0A 2IZ1A 5KJCA 3GRKA 2HU2A 1KVTA 3HB4X 4BKQA 2CMDA 2B5VA 2J3IA 3OIFA 4U0KA 2PH3A 4CLHA 1XU7A 3I4FA 3COSA 1I3KA 1GAEO 5EN4A 2FZWA 5T64A 1JKIA 4S1VA 4RF4A 5T57A 4FB5A 3V2UA 4GX5A 1Y9EA 2B4TO 4II3A 3FCOA 1HRDA 4RLSA 1R4MA 1VKNA 1U7TA 4DIBA 4XJTA 3G3EA 1R15A 1P74A 5JXWA 3AI2A 3I9KA 5JPIA 1D4FA 2WEKA 2ZTLA 1U8XX 3GGOA 1Z74A 2ILTA 2X9GA 1LQTA 2O7QA 5CHEA 3CIFA 5I7EA 4PLCA 4ZRMA 2PH5A 3F9IA 2BHLA 2GASA 3DZKA 5GZ6A 4R41A 7ADHA 1NQ5A 1KYQA 3GC6A 4B4UA 4Y6PA 2E37A 2NADA 4S3MA 1O5IA 3GT0A 4RVUA 3PPIA 3Q1LA 2GSDA 3H3FA 4PN3A 3Q2KA 5DOVA 1VRWA 2FY8A 1ZEMA 3BTSA 5DDIP 4Z0TA 1FDSA 4GL4A 4N5LA 1YOVA 2HUNA 4M49A 4W4TA 5G0VA 3RU9A 2G17A 3WBBA 4R9SA 5JMWA 4P38A 3UCEA 1Q7CA 5A5EA 1JW9B 4CMAA 2Y05A 4J7XA 4W6ZA 3ASVA 4XCVA 1NR7A 3JQ9A 1DRUA 3QY9A 4CMGA 5TT1A 1QMGA 1CJCA 4CMIB 2BFOA 3K30A 3GGPA 5I8ZA 3H2SA 2D5CA 3ROPA 2O3SA 1TA4A 1R37A 3EUWA 2X0RA 3ZV4A 4TRMA 1QYXA 1ZMOA 3NRCA 5KVVA 1E6EA 1SCUA 3JQFC 4DQVA 4IDCA 3W4JA 1CETA 1HETA 4B4WA 4D7AA 2FHSA 4BKOA 3BMQA 4OOEA 1HDYA 1GUYA 3GLQA 4E6PA 5J23A 3PJEA 2EEZA 4IJWA 1M75A 4AJOA 1DXYA 3BYZA 5AYVA 4RF2A 4NNJA 5CEEA 1A7KA 1CF2O 4CLOB 2V6BA 3BMNA 1VI2A 4O59O 3RVDA 1UJMA 4QT0A 2B36A 4A0SA 3ON5A 5IXYA 4AVYA 4D44A 4FGWA 1EUCA 4LVUA 3G49A 2AW5A 1BSVA 2AG8A 3FBGA 3QJ5A 1V9LA 3LC7O 4L8VA 3MCVA 1X0XA 3C24A 4A5OA 1BMDA 4NH4A 3BAZA 1LDBA 2YHUA 4MVJG 1C0LA 4IGEA 3JD3A 5CEFA 2NTNA 4LVCA 4KOAA 3K9QO 4PLVA 4M89A 2HK8A 5ENVA 1G0OA 3U49A 2HMUA 4FOOA 3JQ9C 1DRWA 3LU1A 1DFHA 4BQRA 1PR9A 4BB6A 3UW3A 3VZPA 1DAOA 1V0JA 4ALLA 4N54A 3IUPA 5AXDA 1GUFA 2PFGA 4LCEA 3ZN2A 3GFGA 3TZ6A 3ZZNA 4B4VA 4DYVA 2YV3A 1E1LA 4ZHSA 1AXGA 4Q3NA 4MP3A 3M2PA 3NJ8A 1N2SA 1S6YA 4BUCA 1TLTA 1N9GA 1TXGA 2AEJA 3LQFA 1FXSA 4MIYA 3HN2A 2O3JA 1HE3A 4RDIA 3GVPA 2W98A 3ZU4A 1F0YA 4MVJP 4CLRA 4PLFA 4P4NA 2QZ9A 2ZCUA 5TIIA 4CLXA 4EJ0A 1X7HA 5JFOA 1LRKA 5DNAA 3DL2A 3IIEA 1GCOA 1W0CA 2JFFA 2Z1NA 4CMHA 3WG9A 2EP5A 2ZYGA 3KYCA 4W7HA 3OJLA 3H3JA 2H9IA 1BVRA 5L7TA 5JCXA 2YDXA 4YAKA 3QWIA 4XA8A 3V1YA 1E3JA 3HDQA 1P3DA 3K2BA 1B8VA 3BTOA 2YFQA 2PKQP 2ZTMA 2DU8A 2PD3A 5L3ZA 1CYDA 3VH3A 4P4GA 1DLJA 1IUKA 3LC2O 5A04A 3AI1A 4FIZA 3S2IA 4R54A 2LDXA 4PLGA 2JKVA 1A5ZA 1EE2A 3CINA 3FNEA 2VTDA 1YQDA 3ZHZA 2H1SA 4YJGB 2PKQO 5LCXA 4YACA 4M86A 3SVTA 1ONOA 1WDLA 3AUSA 3RBVA 5HWSA 2YFHA 3AK4A 4CLRB 1E1NA 2CY0A 4BQPA 1E77A 1KBZA 2Y1FA 3ZWVA 1E7QA 4MKZA 4MVJE 2R00C 3SLKA 1KVQA 1J49A 1WMAA 5I7FA 1DEHA 2CF6A 4E2YA 3AUAA 4KWIA 1N7HA 2A92A 1QYVA 4D43A 5COQA 1Z82A 2A9FA 4UUNA 3RASA 2DVMA 3QWHA 3PQFA 1FDTA 1JQBA 2O48X 2JD1A 4BNXA 4J0FA 4KDFA 3R1IA 1Q7GA 1PU2A 5A03A 4FPXA 2X0NA 3GAFA 3JD4A 4OSPA 4OYRA 4FFRA 4EZBA 4N5MA 4MKRA 4UVEA 1P44A 3A14A 2OORA 4BNHA 3FR7A 4XGNA 3HJAA 3MEQA 4DL9A 3RFTA 2DFDA 5C37A 3QWAA 1NXQA 1NPDA 3PI7A 3VPFA 3GRPA 4PFJA 3C85A 4DXHA 5IZ4A 3HE3A 5U4QA 3VZRA 1T25A 5IJZA 3JQBC 1U2DA 2I65A 1ZIDA 1YE3A 4W99A 1ORRA 3P19A 1RPNA 3HFGA 4L0QA 1R0SA 2VRCD 2J5RA 2BGMA 4HKTA 4OQYA 4DRYA 3PHGA 3OF2A 4DTIA 9LDBA 2Y0EA 5EPOA 2VWGA 4YJGA 4AJKA 4H16A 4LSWA 2GUGA 3OSUA 5FEUA 4KTTE 1PWXA 5HTOA 4XYGA 1UZLA 1V3TA 4O63O 4YRBA 3JQ7A 3E9NA 3EHEA 3S2GA 4HADA 4ZGWA 3JYNA 3P7MA 2CSUA 3I9MA 5IFLA 1M2WA 3UHAA 2C0CA 2C07A 3CSDA 1IE3A 4XQ9A 3JQGA 4RVFA 2VHWA 1OC2A 3OM9A 1LDEA 5C7IO 5B4UA 3LK7A 3ROKA 1UP7A 1ZNQO 3PFWO 2J6IA 1K6JA 4UVIA 3RKRA 4GVLA 1HEUA 2AE2A 4PG7A 1KOLA 1CQIA 2AA3A 3PK0A 2Q1WA 3P2OA 3Q0EA 3WTCA 4B8WA 2C7GA 3OFSA 1PS9A 1B2LA 2JCVA 4BO8A 4CMIA 4YT2A 1EK5A 4BV9A 4CMEC 3DC2A 3JQAD 4FJ1A 5I9NA 3SC4A 4WNIA 1G0NA 1VJTA 3M2TA 3F47A 3DAFA 1I3MA 5BT9A 2XF8A 2ZYDA 4QXMA 1Q2XA 2UDPA 2HRZA 1ENYA 2VHXA 5FYDA 1LC3A 4FBGA 1UH5A 2D3TA 3WQRA 4HX5A 4DREA 2DTDA 3ZHXA 1GZ6A 3SEFA 5JC8A 3RQSA 2BFMA 2EHDA 1QLJA 3E9MA 1NFQA 1D7OA 3EW7A 1GQYA 1LX6A 5HS6A 3MJTA 2IYPA 4CPDA 1W73A 1R4MB 4RLHA 3F5SA 1MFPA 3PHLA 4R5HA 3UXYA 3GZNB 1MGOA 1EZ4A 2R2GA 3SJUA 4DMMA 7MDHA 3K73O 3HDHA 4OXYA 2X9NA 5C7LO 3DBLB 3N7UA 4Y98A 4CV2A 1P77A 2GN8A 4G81A 1PWZA 4TKMA 1YJ8A 2NWQA 3U5TA 2E6UX 1DJQA 3KLPX 3B1JA 2W2LA 5ITVA 1XQ6A 4ZVVA 2Q1SA 3CXRA 3NDJA 4ZN6A 3JQAB 4DLLA 1GQQA 1IULA 3L4SO 3D4OA 3IAHA 4CUKA 4NBVA 3HN7A 5TLSA 2Y68A 4DLBA 3WWZA 1Y8RB 4CQLB 2GPTA 5KKCA 5KJ1A 3PEFA 1ADGA 2AQIA 3OJEA 1PJTA 3PQEA 4L73A 4YDRA 3F5QA 1YJQA 4E5NA 5CG1A 1ZXBA 2Y93A 3FHLA 4NU5A 5K6AA 1JA9A 1YGYA 1ZH8A 3VPSA 3IJPA 5BR7A 3ONFA 5IG2A 4B7XA 4PGFA 3NT4A 4BL5A 2V6MA 1PR3A 5DBIA 1NVGA 3CH6A 4AJLA 1G6KA 3PGJA 2O7SA 1ONNA 5H83A 3G1TA 3S2FA 1NPYA 1Z7EA 3D5QA 2FWMX 3QRWA 4RGBA 5F1PA 4RO0A 1ZFNA 2AQKA 3AY6A 1SZJG 1Y8QB 2O50A 3D5TA 3JQ6A 4CMBA 1T1SA 2CD9A 4R51A 4BNUA 3MOGA 4NG5A 4FGSA 1E0DA 3F4LA 3DHNA 2IXAA 4CV1A 2VQ3A 5KJEA 3GDOA 2YHIA 3RC7A 4IIUA 3KHUA 4GI2A 4XEHA 1I0ZA 4ZQEA 2WYWA 3LF1A 4IDGA 1Y5MA 1CEQA 1SO8A 2OOSA 3H5RA 4FC7A 1GZ4A 3NTRA 4MJLA 2Y66A 3HFSA 1GR0A 4B4OA 2FPPA 4I08A 3Q11A 3RC9A 3PDUA 4D0SA 2D5AA 1SNYA 2QQ5A 3WYCA 3L0DA 1OMOA 5KJFA 2IZZA 3E18A 2PGJA 1FDVA 3I1JA 1MFZA 1TI7A 4XJSA 1O94A 4WK6A 4ZU3A 1T2AA 3IL2A 2P9EA 3VKUA 3WQSB 4BGVA 1U7HA 5TC4A 4FDAA 1H94A 2TMDA 3QVWA 4BKPA 2OBYA 2ZB7A 4XQEA 4MIOA 1C1DB 1VSUA 2VN8A 3IQDB 4L4RA 4YBZA 4PG5A 4LMRA 4UVHA 2CNBA 3PYMA 1ISGA 4CR8A 4L9RA 4WLFA 3LYLA 3ZV6A 4YRAA 3Q9UA 1E3IA 4R3WA 2GZ2A 5JDCC 5HM8A 1H5QA 1S7CA 1P1JA 1M66A 4NK4A 2DPGA 2I66A 2NACA 4LRSB 4CM6A 2GNAA 3DZGA 1F8GA 1DBVO 1ZEJA 3CMMA 2RIRA 3C7DB 4Z3DA 4PVDA 4E33A 3QWFA 2ZYAA 3NGXA 4FJ2A 3HG7A 3DXFA 1X15A 4TSKA 5ENDA 3SC6A 2FMUA 1CRWG 4ZD6A 4W82A 3VDQA 3H5NA 2EKPA 4J90A 4XYBA 4EI2A 4IUYA 4BO9A 1DFGA 2DBVO 1Z6ZA 1VKOA 3ORFA 4NR0A 2UYYA 2G82A 4I8XA 3E6AA 4CUJA 1GQ2A 3K8ZA 1T4DA 5CDTA 1BRMA 2POQX 1I32A 1N8KA 4RVHA 4UULA 4TQGA 1E3SA 4W9NA 2PV7A 1BHSA 2DKNA 5DZSA 3ST7A 4WLVA 1MV8A 2LDBA 2DM6A 5AXBA 3LDHA 2NVUB 1YB4A 1NM5A 3LLSA 3QWBA 3FBTA 1GCUA 4DLAA 4YYZA 4IXTA 4NPCA 2YQ5A 4FQ8A 2I6TA 5BNFA 3TNLA 3K92A 4ALMA 1HE5A 5JO9A 3R3JA 4WCDA 1B26A 1DB3A 3V2GA 5FWNA 1PGNA 2JCXA 2B5WA 3ETGA 4HFMA 4QTZA 1Y7TA 4M55A 3WDSA 1XELA 3G1UA 3JD2A 3VH4A 2EW8A 2HRBA 2PZLA 4O6VA 4XDZA 2Q99A 1UUFA 3Q9NA 2NU8A 4BO1A 2EGGA 2I99A 1PZEA 3U4IA 5A05A 3I9OA 1ZK0A 5L45A 2PA3A 4EEXA 4XQGA 4UREA 5JCJD 1E3WB 1R0LA 1FDUA 4RQUA 1DHRA 4CM8B 2Q2WA 3AW9A 3RUFA 1U3WA 1I5RA 3BHJA 3BMNB 2B37A 3NKLA 3S1LA 3DBLA 2A4KA 2QHXA 1SOVA 4DGSA 2GN9A 2X58A 1WZIA 3ZWCA 3DOOA 2AEFA 1C0PA 1U8FO 2JD2A 3WMWA 1VL8A 2HAEA 4CM4A 5CG2A 1U5AA 3C3XA 3INGA 5EMHA 1L7DA 1PIWA 1AHIA 1ZVMA 3PHIA 4QEDA 2AXQA 2X0IA 4XIJA 4J3FA 3ITKA 1UXJA 1QYCA 2NTJA 3A06A 3VHRA 1AHHA 1JAXA 3OP4A 3PWKA 3WLEA 4DMLA 1TEHA 4YQYA 4MIEA 3E48A 3L4BC 1YL5A 3D3WA 1X0VA 3H7AA 4BNWA 1SMKA 1NHGA 2FPGA 3I9JA 3TFQA 5IDQA 2AHRA 2VOEA 2NTVA 5KIAA 2NU9A 4AJEA 3E9QA 5TRTA 3PTZA 2HMTA 2TMGA 3ULKA 1PZGA 3I6IA 4JLWA 3ZWAA 3KUXA 1E7RA 3EK2A 3EVTA 3I5MA 3ZWXA 3EC7A 2YW9A 4P8RA 4ZQHA 2WM3A 3DTYA 3W6ZA 2DUWA 1WNTA 1E1KA 2D0IA 1HTBA 4Q3DA 4CMKA 4E2XA 5ADHA 2NU6A 5TJHA 2VHYA 2IRWA 1OFGA 2OBNA 1P33A 4XR4A 4E21A 4JNKA 1H6DA 3I4CA 1GEGA 4JJFA 4R16A 5K9ZA 4BGIA 4FSHA 5IN5A 1U4OA 4JJGA 3K31A 4BNIA 3A1NA 4AL4A 2XPCA 1MUUA 1HF3A 3AY3A 3R6DA 4U6QA 2V7PA 3OJFA 4U6SA 4QO8A 1VPDA 4DYDA 2DUUA 1QSGA 4OMUA 3G17A 3DZFA 3L9WA 3I6QA 2EJWA 3JQ7B 1F8FA 2UUOA 1KVUA 1K5HA 2AG5A 4ESOA
chains in the Genus database with same CATH superfamily
2X23A 4MVXA 2HQOA 2V59A 4NBUA 3L9XA 1P1CA 3FGZA 3IAAA 4H77A 4HQOA 1XMPA 4PLWA 4U7JA 5ELMA 4BBJA 2ISCA 5EJ4A 5FUVA 4NZYA 2DKOA 1ZRNA 1ZGGA 2FRVA 3I8XA 1RXIA 1UMDB 2ZK7A 2QI9C 5IMBA 1FSPA 4EJMA 4LC0A 2D13A 4NHEA 2PD6A 3EG5A 2WFZA 4A36A 3ILSA 4K1LA 4EGCB 3NP9A 5KYUB 4PPQA 4MR7B 3N8KA 2AGVA 3I0ZA 3CZQA 3LO8A 1ZICA 1DVRA 4DYHA 2H8GA 2OYRA 4GXNA 2VZ0A 3KHSA 5AUPB 3F49S 3TQHA 4U8GA 4JGBA 4LMAA 1BRTA 3ICCA 1E7YA 1GPUA 3DWGA 2ATIA 1KY4A 4DUGA 3A3YA 3PIDA 4WFKA 3S5JA 4OXXA 2OLKA 2R0QC 1DIAA 4GG1A 2E18A 1GDDA 3TDKA 5EJ8A 1HKUA 2PVPA 1FU7A 3IC5A 2X0KA 4S1OA 5JI2E 4TVBA 1D07A 5CT5A 3BDVA 4J03A 2FQXA 5M04A 3V1MA 3FD8A 3WBJA 2VBFA 1MB0A 2VK2A 2C7VA 3H4IA 4JAVC 4KFTA 1H2BA 2WAXA 4D9MA 1YB7A 2EZ4A 3HUDA 4IKEA 4ND6A 1HDOA 3PKIA 1JT9A 5GOTA 5LQUA 2J0QA 2V6FA 3G7SA 5TEVA 4CDMA 4NY1A 1BMFD 2G72A 2WM9B 4UZEA 4C22A 4RTNA 4GR4A 5C8VA 2BT4A 3HMKA 1BG6A 2XYRA 2WWHA 2ZE6A 2ZIXB 3L7MA 3QVJA 5EJAA 3TCNA 3VR3D 4DXDA 3AHHA 1X70A 1SUEA 1U9IA 3JD0A 1S96A 3MT9A 3WYEA 4BFCA 3COWA 3HVIA 3MYRA 3PUXA 4GL2A 4O0LA 3AM3A 4C0AC 2BI8A 1VPEA 2J08A 2BHSA 2J3EA 4FCVA 3WRYA 4COOA 5JYDA 1M67A 4ZARA 4C14A 4B17A 2DFLA 1PR2A 4FHDA 4UNPA 4M6WA 2ZSHA 3U17A 3IT3A 4V0QA 5G40A 1Z2AA 1X92A 4XB6B 1U63A 1NRWA 4XLZA 3F78A 4M54A 5H16A 1D9ZA 1Y1PA 2I54A 1MJGM 4IWXA 2C54A 1FE8A 3PX3A 3R41A 4KUEA 3TG8A 4X84A 1RRPA 2DPYA 1TO6A 4AD8A 2ARKA 3FOAA 4LXHA 1XJ5A 2RIPA 3UMFA 4E2ZA 2GFHA 4ZO8A 3CJTA 1CVIA 4YPOA 1NDHA 2Y8EA 1Y9AA 4Z4CA 5TQ2A 4DPLA 4M87A 4Y1EA 2ZUDA 3TZLA 1XLVA 3KIPA 3HLTA 3O91A 4R1UA 4D8XA 1XEFA 1WOYA 5J4LA 3PQ7A 1VG0B 4FI3F 5EGNA 1QHGA 3REQA 1XLWA 1IHYA 4PBSA 5E4TA 1A8SA 2HWKA 1DAPA 2XRMA 3VC7A 4UTOA 3TSWA 1OBHA 4YAIA 5KQMA 3FZQA 5LIPA 3PPWA 5K3BA 1U7ZA 5LXTA 3BWXA 5F3WB 3AILA 1CQPA 1TUGA 2F90A 3HBJA 1I2CA 3LQYA 2R1TB 1F2TA 3FNFA 3D64A 5DYWA 3ETJA 1DRKA 1MCZA 5JWHA 4EDHA 2J5XA 3DOHA 5SYAA 3QI2A 1GV1A 2XMRA 4X1IA 2C9YA 3RSOA 1KP9A 1ULZA 3DE7X 5G0WA 3BGWA 2AE1A 3CCCA 3ZWPA 1DL5A 1L5HA 4WESA 3UJ6A 3ZBUA 4GPD1 1C7FA 4TLCA 5AM2A 2OILA 2WDZA 1SUIA 1NIPA 2PZFA 5HX7A 2F43B 3RHZA 1US8A 5AI6A 4U3JA 1U3VA 2O5VA 1EEXB 4UFPA 2A9VA 3AGPA 5LQMA 4RA9B 4M3NA 3O84A 3TPCA 2QZZA 2YWFA 5A5FA 3O26A 2XTMA 3C3JA 3HXPA 5LNK1 1QWSA 3KFLA 3ADPA 2W8BB 3D81A 3HU1A 1Q3TA 2C59A 3OM8A 4JQCA 4L75A 4M6WB 1LA2A 3IJ5A 4UVDA 1KI6B 1FS6A 2OC4A 3KHKA 1AM4D 4NWIA 3UK2A 3U19A 4Z4QA 3DE1X 2MYPA 5MGNA 1IWBB 1L5WA 3HBNA 3TQIA 2PO5A 2DY0A 2VH5R 3D8BA 3MXTA 5HZGA 2P68A 4TMFA 3RJZA 2P4EA 1XA0A 4QYIA 4KR7A 1CLUA 1THGA 1Z73A 2W2LD 1UBFA 2IF2A 1JALA 1JUDA 2FLKA 5CRIA 4EYQA 4A27A 2WR8A 2O5EA 5JLAA 3SEQA 1YNSA 3S70A 3CZ9A 1ILWA 2IODA 1HYGA 1ZITA 2O4CA 3OA0A 1CDDA 1R8XA 3N39C 4HNSA 4LC9A 2F62A 4Y67A 5IBPA 5B6JA 4WN9B 2VDPB 4V0MA 1B23P 3OTGA 5L7WA 4BX8A 4D4GA 3SZMA 4Z5XA 3KYCB 3T4UA 4XVUA 3GBSA 2BUAA 4KFRA 4PAQA 1CR0A 3H9EO 2ZUBA 4LIPD 3FDXA 4QUJA 1QH0A 3RJMA 2IHZA 2ODAA 4N0MA 3RKSA 1M2KA 1TCAA 4DBVO 4JEHA 1PR6A 2OZKA 1U0FA 1EESA 4JBHA 4FNOA 1MVLA 1W9MA 4KHPB 3EXHA 1RHRA 2YR0A 4MO2A 4WJZA 3KR2A 3EPLA 2ZIXA 3AYZB 2FEWB 4MRPA 5BQOA 2AC7A 1EUCB 1MPXA 4IIFA 4KDEA 1C4XA 3VH1A 5JMOA 3HGTA 2PSDA 1KSHA 3UKDA 3RAFC 2X14A 1ULSA 4TTIA 4GKJB 4XTCS 1HDEA 5I9TA 2PRYA 5EIOA 2I91A 3CUWA 4QBIA 4BB9A 2EBFX 1D04A 3IGFA 4H3HB 3CTMA 4FCTA 4X8MA 1GT91 3QEOA 4FOLA 1FTGA 3SZGA 2HREA 2Z8YA 3HUTA 5TMDA 3WMEA 4O4JB 3HSSA 4DV1B 1G9XA 4MQ6A 4OREX 1V1RA 1QYRA 2GO7A 1PVVA 1ZH4A 3BA1A 1EE9A 2ZT6A 1F3LA 1QFYA 3AM4A 3D8HA 3GT4A 3HLKA 4CR7A 5LP6B 1WS6A 4NS1A 4IDHA 3LP5A 4UU8A 3EXG1 3R5KA 2B83A 2IXBA 4KQWA 3A4MA 2OM6A 2QRVB 4OGWA 3OP1A 4URYR 1V25A 1Z08A 5FJIA 3SU8A 3WWYA 3AF0A 3B20A 1HO3A 1TAHA 2FCRA 2LKCA 3LCMA 2P3SA 2W0SA 4OFXA 5TPZD 3WICA 3VISA 1P1HA 2PJUA 3L8FA 4RSGA 3ZH9B 1V9CA 4UASA 5ITWA 3RS7A 3I28A 3NVAA 1IONA 1RMYA 4E5SA 4NESA 2VDOB 4Z0PA 1YNOA 4BKRA 1X7ZB 4QDXA 4CKXA 1XCBA 3N53A 2X7JA 1ML4A 1CULC 2JIBA 4IGFA 3VZSA 1DU4A 4G9BA 4KO4S 3H7IA 1O0SA 5LQJA 3QZUA 1ZNYA 2GGSA 2IHVA 2NUAA 2BGNA 2DWPA 3VC3A 2CK3A 4UBOA 5IJXA 1FDOA 3OC6A 2OV4A 3PIIA 5HKKD 1NYQA 3U13A 5K6AC 4DV0B 4M60A 1SVOA 1GL3A 2O7VA 2W2KB 3G8AA 4QXRA 4JX8A 4XWTA 3KO8A 4S1PA 3WYGA 2IITA 3OIUA 3AP1A 1X77A 3L7JA 3B3QA 4QM6A 5GQSA 1GSIA 1T2FA 2ECFA 1ODKA 1CK4A 4O4JA 1JJAA 2J3MA 4K6CA 3FLAA 2I4TA 1DXOA 3G8DA 4WNYA 3UCXA 3ER8A 2ZR0A 1BHQ1 4CODB 1MMFB 4OXNA 1QB8A 1UT5A 3KWLA 5HFJA 4EATA 2GCIA 1QGED 4EHHA 1Z28A 3V8EA 1ISIA 1NOKA 1N0VC 4NIMA 5JQGA 4KYUA 2VYVD 2CSXA 1EFLA 1SOUA 4F46A 4GT1A 2AOWA 1ZD5A 2LIPA 4BNKA 2IYVA 3DH0A 3GUZA 2AEEA 3QPVA 5AVTA 2BC9A 1I33A 3H8VA 4ITUA 2HMYB 3UKOA 1DNPA 3CE6A 3JY6A 4YRGA 5CDSA 4R71A 4GMFA 5EHIA 2RH8A 4XKJA 4ARZA 2ORVA 4ZI7A 2FSVC 4G0QA 1CF9A 1D2NA 1L1EA 2CKMA 2W6ID 3FYTA 1MDFA 1OPXA 3O8CA 5AHOA 4V39A 4IRMA 3QUBA 5HZKA 3LX8A 5C5CA 4Y6RA 2M32A 4LHWA 4BB5A 2B3DA 3QOXA 3GRUA 1KPHA 2BAGA 4NMLA 2CVPA 5K99A 2PFSA 1MJFA 2XW6A 3OBIA 4Q9NA 5GPBA 1NP6A 5IEJA 3EVFA 4G8CA 3IOEA 3MCWA 3UFXB 3ZHVA 1UQRA 2NP6A 3DMTA 1IM8A 3ZDDA 4A92A 1WLSA 4U5XA 3V8NA 2XNDD 1CB0A 3JPWA 4X61A 3A37A 3EXG2 3JZIA 1IUNA 4WFJA 3HVUA 2I3GA 2R8YA 4AXXA 3T7KA 4GX0A 4COKA 1X19A 2E4WA 3HA2A 4IFTA 1MIOB 3WGIA 4DUYB 1V8PA 4WACA 1JH8A 1P72A 3EH1A 2MYNA 1QXSA 3EQZA 3IPAA 2B35A 3AHDA 4WHMA 4GGMX 2VQ6A 2QTFA 2KWIA 4RPHA 1QOPB 2XEXA 2I67A 4ARUA 2VEDA 2B2CA 1F14A 4QPJC 3UEOA 2XZDA 3ONDA 4ZVKA 4IVRA 1YDFA 2PL5A 4GO1A 3URMA 3ZE8A 1LXCA 2C5HA 1O4WA 3BCRA 1I2ZA 1S4MA 4W9MC 1XZAA 1MB3A 1KNXA 3IAS6 1UZMA 4JVLA 4RIHA 2AQ8A 3EODA 1O97C 2FP4B 3FZEA 2EZ8A 2PKEA 3GCDA 3KDPA 1E4EA 1N0UA 4FFOA 4U3JB 2IDJA 3C4QA 3DUFA 3KBOA 3PXUA 2RHMA 4RXUA 1QRSA 2GSWA 3I2IA 2JGLA 1J0CA 1YQXA 3EWSA 5DKFA 4EYEA 5GIOE 2PBZA 2WI8A 2PG3A 4S1TA 3HCOA 1DIBA 5IYZA 3DHYA 1QVWA 2NU7A 1W9HA 3K05A 1XRMA 3IT0A 1EM6A 5DVZA 4RPIA 4AG3A 2E2WA 3VSBA 1R4NA 2OWDA 2NO7A 4DLUA 3ICOA 3IQEA 1C7ZA 5ICCA 1U0EA 1V4VA 1PFQA 2OCAA 6LDHA 2AZTA 2BEUB 2GN6A 3TLKA 2O52A 2PBRA 2FX3A 1JE1A 3K9WA 3EZ6A 1FFDA 4IRXA 3CX7A 3KU1A 4UNQA 4ALJA 3PJRA 2AV6A 2HIGA 4Y2UA 5G41A 2G0TA 1CHNA 3O4GA 5BN5A 1IWPB 2VP0A 4EFNA 1OI2A 1JZSA 2WMDA 2ZB4A 1A50B 4OGFA 3ZU2A 1P5RA 2JHGA 5GMOA 5TX7A 2QI9F 2ZS9A 5CVCA 1XTJA 2IPOA 4Q1DA 1I4DD 2HO5A 4RDCA 4DHWA 3PA6A 5E38A 1IWOA 1UP4A 4IDBA 2QTGA 4FMDB 5A9RA 3HKCA 3EBLA 4OXRA 2X2FA 5EINA 1YAJA 1P4JA 3B9QA 1SK9A 3RUCA 1GJRA 4NFYA 2JFVA 3HEBA 5AKKA 4G0ZA 4YJFA 4M9SA 2NVWA 1U5BA 4XX0A 5KVQA 4EG6A 3BXEA 3GF4A 3DKVA 4H1UA 5ALYA 1TU0A 2Z1MA 4IINA 1MG5A 1YR7A 4H35A 2RHCA 1PFKA 1XGKA 4JASB 4M7RA 4Y2SA 3UK1A 3ND6A 3LE8A 1GNQA 1X6VA 2ET6A 4WDQA 5DHSA 2JIPA 5BR8B 1E2EA 4M0KA 4YMSA 4C6SA 4B2IA 1NNEA 3CZPA 2BMEA 2FJUA 1VLMA 4WK0B 3UB3A 3PT9A 3KBBA 4JBIA 5KYTA 1EP3B 3PUKA 4YS6A 5BPHA 1E18A 4ZA2A 1MW8X 3VOBA 4NKRA 4R2JA 5TS3A 3T0GA 4KDRA 2CZCA 4JYAB 2QG4A 1E3MA 2AC4A 1EFPB 3O3MB 4UTRA 3MRTA 2ZRFA 1K98A 3KNZA 4ZIRA 3MGBA 4EABA 4E13A 1A95A 4CWAA 1FW6A 3QF7A 4FX5A 1UOEA 3B6IA 3AU8A 3BF8A 3BH0A 3CH4B 3HKBB 4RETA 2P40A 4GPEA 1CU1A 1TW2A 4Q4AA 4C3VA 3LPDA 3GLFA 4Q4JB 4TKVA 2WE8A 4FR5A 4ON9A 1RI5A 1NVDA 1PZXA 2RDMA 2X22A 3KAQA 4XE5A 4F2GA 5AFSA 2R3SA 3GOHA 1OASA 2FSGA 3L0IB 4HR7A 4C7VA 1NSYA 2HMAA 1TUIA 4K88A 4NG4A 5LUBA 4NDNE 3VHXB 1EFUA 4NK5A 2H92A 2J4FA 3EDMA 4J91A 5GAJA 2WV9A 4YR7A 3ZV3A 2QYHA 4U9IS 3D0OA 1DC3A 3UVEA 3VYSB 3NEPX 2NUTB 1FFXA 3WRXC 4DCSA 4RIFA 4ALIA 2FWIA 3PQDA 1GYRA 4FZ3A 2WJWA 1NX6A 4GZLA 2PUWA 1T1EA 1KDPA 3NZEA 2FN8A 4B3RB 3FAZA 4MCAA 2R6R1 2WUGA 1EG2A 4B6SA 5DULA 3L0PA 4PG6A 4F6RA 5FBKA 1CWUA 2O8DA 1DKNA 3L79A 3EY4A 4D41A 4H3KB 2Q6VA 3LHFA 2JLCA 5IMSA 3GT7A 4JBLA 4QFDA 2RH9B 1TPYA 3AR3A 3D4NA 2ZPUA 1P0CA 4IMIB 4ZVSA 3JQDA 1DZ3A 4IH9A 3LIIA 4LHXA 1OILA 2B7LA 3OT1B 4BX0A 3WOHA 3ZVKA 2AWNA 1LBQA 1C0KA 3ZHTA 2CLHB 1RLUA 1ONPA 4HN2A 3UMVA 1M6WA 1QRAA 1FYFA 1Z2OX 3C3EA 5JZ9A 1BDIA 1UBGA 2ZDGA 2YTZA 4FZRA 5ERXA 1G7TA 3K0CA 2O9JA 4TS4A 1IN6A 3KQSA 1KEVA 1SBTA 4GXRA 1D2RA 4IMJB 4KKXB 4RVGA 1VL6A 2ZXEA 3BRQA 1KE1A 4BGEA 1KI8A 5ICMA 1KGSA 2C29D 2BDUA 2NNWB 3E35A 3TBFA 1TZBA 2R5FA 1D0SA 5BOVA 5A1TA 1Z0KA 2OL4A 4AZWA 4HG2A 4A6DA 4M7OA 3N2GA 5T3UA 1ZDMA 5AVOA 4OLAA 1GL6A 1LI7A 1N2BA 1WKBA 2HQRA 2FWJA 1RWWA 1QJ4A 2C5AA 2YBEA 3BFJA 3H86A 2H4JA 3QXJA 1Z4KA 1KYXA 5BOSA 1Q92A 2OD2A 3IBFA 1C4OA 3DBRA 1E2MA 1E89A 1QVAA 2GZDA 3N2NA 4PVCA 2F3TA 2XZLA 3AOEA 2O8CA 2R1ZA 3AQIA 3TQRA 1RKUA 4HLUA 4PIMA 3GI1A 1AT1A 1I80A 4AUEA 3X1KA 1XTPA 4M0PA 4E1AA 1XEAA 3AB7A 3ODGA 4AAYA 4YUZA 5C53B 4OM8A 4HI0E 3AKZA 3WBFA 5DV9A 3DNMA 4GLLA 4B3DA 5G1OA 1S2IA 4WVFA 4Z54A 2W2NA 1UC4B 3N87A 3PX7A 1IJKA 4DZRA 1T13A 4MUYA 3VTFA 4R0NA 2JLZA 5KSYA 3MTAA 2RGEA 3TSAA 4EKYA 1UXKA 1K7FB 2YHAA 4LE0A 4G4IA 3IVRA 3MWDB 4FR0A 1V2GA 3EC1A 1VPVA 2QRPA 3P2IA 3PXXA 4QG7A 2QJTA 5SYMA 1X7WA 3LLMA 4XVHA 2YN0A 3PR1A 3ZWWA 1XDUA 3O4RA 1GPDG 4X93A 4KR9A 2ZM5A 3AEQA 4OG2A 2H51A 5JSUA 3KQPA 3OOYA 3RSLA 2EKDA 2G7MC 3G13A 4IO0A 1N33B 2ZS8A 3PD1A 1OH5A 4Q3OA 1QTQA 3ZWMA 5KTKA 2XXAA 5F52A 1B93A 1EGAA 1KGDA 3M8KA 1Y4DE 3MWEB 4U7PB 4IDEA 4EMSA 4CL0A 1JYSA 1WSAA 1QNLA 3WRWA 4D57A 3NBAA 2IV7A 4TT3D 3ILHA 1LQUA 1QNFA 3L2OB 4N9WA 5ALKA 3VBCA 3LDGA 4RHYA 4BFZA 1HZZC 1ZH2A 1DBRA 3DZDA 3N75A 2DZDA 3W90A 3PIRA 4DA9A 2WHPA 3TQOA 4NENA 4V03A 2EBUA 2YIMA 2GK3A 2GD6A 3CB2A 1BGXT 4TWZA 2CYAA 5DRTA 4C03A 5CB4A 4DJ5X 2F4VB 1O2DA 1G6Q1 1RLMA 2Y99A 3O0DA 2R8EA 1K0UA 4NYJR 4YP1A 2PS0A 4BFXA 5AKIA 1TPZA 5ED4A 1XR3A 4BIIA 1XKXA 2A58A 4M98A 2WHQA 3CWCA 3BL8A 2VZ8A 1YR2A 3L0CA 5AVXA 3MLEA 2FEMA 1U02A 4JXKA 2XUJA 3QEMA 5K0NA 3ZNQA 2BRUC 4K86A 1ZUHA 3ZI0A 4CLOA 1TD1A 2GZ1A 5LD2B 3VJKA 4DW8A 1V1JA 3LWBA 1BH2A 1W2HA 2XUFA 3RRXA 5A0TA 1NKVA 3QYPA 3IIMA 4L5AA 2C2YA 5TQ0B 2AK2A 1XVVA 2CKDA 1QBKC 3CE9A 4HRYA 2HA5A 3QTLA 2OM2A 1Z47A 5ALSA 4EARA 2QXYA 4JH0A 5BW8A 4ESVA 5JU6A 5J2UA 3OCYA 2AI3A 1DP4A 1C30A 4HNHA 2AX3A 1ETHA 1GGHA 3UJCA 2O14A 3OD5A 1SZDA 2VJYA 3GDGA 3D3WB 2Z56A 1B73A 2N46A 3K2EA 1E4YA 3LSYA 1SA0A 4JELA 3UJ7A 5HYVA 1SPBS 1HYQA 1R6BX 1K6IA 1YK0A 1U2DC 4OU4A 3VTZA 2VHVA 3OY2A 1O6BA 4IDOA 5HK9A 4EPWA 1SRRA 4MUJA 2A0KA 4BLSA 1PCXA 3G82C 4O2AA 1WF6A 3H9UA 1SZPA 4G36A 3K1TA 2PSEA 2FE1A 3JYPA 3WK4A 4GPZA 1PJ2A 3AI7A 1G60A 4RH1A 3W3AD 1E0JA 2ADMA 2GAFA 3KDAA 1N36B 2GN2A 2PYZA 5KOIA 2WPDA 1RYEA 1EJBA 5HRCA 2C98A 3NBQA 4QKQA 2FPXA 1N1EA 1MAAA 5FL7D 2JFQA 4PC3A 5FV7A 2QN3A 2XTJA 4O0MA 5CFQA 3COJA 5IDWA 2J7PA 4TROA 4A2CA 1V96A 1PZMA 1JJVA 4ND8B 4O4JF 3QBJA 5C1PA 5KCZA 4BVLA 5CVUA 3NANA 3JASA 1NMYA 2F9MA 4LRTB 4AJ1A 3RS3A 3AW8A 4RM3A 5LWQA 4JC5A 1FBTA 3GBVA 2EWVA 1U28C 4DJAA 1C7QA 3GXOA 1Z4QA 1ANKA 5IXSA 1JJFA 2O2YA 3NC0C 2ZZMA 1HDRA 1SG6A 2BE9A 2FHPA 2WZBA 1VLHA 3HL4A 1PX2A 2PT9A 3H9QA 3TZHA 1N2CB 4R40A 4D3DA 3M6MD 1GXSA 3E23A 3SS8A 2JCBA 2JFOA 2ODPA 3NV7A 3C5HA 1Z4OA 1O96B 3V4VB 1KP3A 4NCAA 1YI8A 5C51B 3QNUA 4MI3A 3RIXA 2ONZA 3ZWOA 2PM8A 1XYGA 4MUNA 4IMRA 4JI3B 1JTVA 2JVJA 2VYNA 4Z0HO 2IDZA 2WUEA 1JBKA 1X8XA 1K9VF 4UMFA 3S1AA 1RKBA 2QPLA 1PWHA 3TLMA 1VJCA 5BRJA 4H7EA 2MSDB 1EXNA 3IXMA 5H9VA 3P9XA 3HZOA 1XMXA 1QYDA 3EEBA 1QKJA 4MAFA 1IN5A 4HF7A 4NV1A 3SYMA 4KR2A 3SJCA 5IKPA 2PR2A 1HUQA 4G26A 2J32A 1ADCA 3FWZA 4G37A 3GMSA 1PHRA 1O7JA 4WKBA 3UWKA 3TUZC 3N2EA 3P9SA 1DJNA 3TVTA 2IIQA 2ZPAA 5ECDA 1JDTA 1KBOA 1VHJA 2AKYA 3F3SA 3W8NA 3AFMA 2X1HA 1L5QA 2QUBA 1C7EA 3AOEC 4MRMB 3FSRA 1NNUA 3RVKA 1F6BA 1SQFA 4TWAA 4HGQA 3DPSA 1VI6A 3O47A 1H4SA 1H0SA 1E9RA 5DBOA 5LA6F 4H7PA 2YIDA 3ZJVA 2A9KA 1ISMA 3OFND 3ISJA 2AFHE 4YBRA 3RFXA 1LVHA 3X2EA 1P7CA 2Q5HA 3UA3A 4MQFB 3HDTA 1KK0A 4CKBB 1XZMA 4ND1A 2VDUE 2WHPB 3IBGA 3IAS1 5CCXA 1JR4A 3VAZA 1R0ZA 1A5TA 1WABA 1XD2A 2DQYA 3EVEA 3GAZA 5CA0F 5K5EA 4MB0A 5HJ7A 3DBIA 5CH3A 3I76A 1KO1A 1WCYA 1H05A 2XKJE 3Q1KA 4C7JA 1F12A 1U3UA 1Z16A 2BIFA 4PO1A 4E6EA 2PK3A 4M0UA 2CL7X 1ITZA 2OENG 4OOFA 2QUZA 4TN5A 3A1TA 3TFOA 4UEKA 3TQQA 5BN4A 3A4NA 3UPDA 3AFHA 1JHYA 1XZIA 2PWZA 1PT5A 3KZXA 3SF8A 4CEJA 2Q4DA 5KI6A 1X1TA 3VPDA 2C4HA 1GADO 1F2UA 1NVFA 5AHWA 2QTHA 3P9CA 1QDLB 4OFBA 4EKIA 5BN3B 1QU2A 4TKLA 3EZYA 4EX6A 4DPMA 2YYAA 1T24A 2JF0A 3P4YA 2VG8A 2Z6AA 4DCTA 3K09A 4D45A 4WY8A 2EAUA 1H1DA 3UY4A 3OLQA 1BA2A 2NW6A 2FMFA 1NONA 2YRWA 4A0QA 3QV2A 1L7VC 2QMEA 2P1RA 2HNKA 4HZIA 3OE7D 4ENUA 3IDOA 3FKSA 4P3NA 1EFRD 1C2TA 2BISA 2LRHA 3L1UA 3NV9A 1LLUA 2WWIA 4J07A 2OLJA 1ZK3A 3K6JA 4GMGA 3RAJA 4BNJA 1FFBA 2W43A 4OQXA 4R1NA 4XVCA 1TYAE 1QHXA 3KXIA 3FCAA 3ENWA 5JYEA 5KX5F 5FWXA 3UXMA 3KSUA 2ZUUA 1KAEA 2NTEA 2A3RA 3A6EA 3PUZA 3UPTA 1Z0IA 1LPNA 3V8RA 3GLIB 1YRLA 4RHUA 3JSAA 4MHSA 4UBNA 4WOKA 5K3CA 2A8YA 4WMLA 3UJ9A 1KTVA 1E6MA 3UXEA 1GA6A 2UV8A 1B8OA 2R6AA 2R97A 3I4LA 3C1AA 4PICA 4QHSA 1P1FA 3EQ9A 4MKIA 1K3FA 3GWZA 1ZD4A 2PZBA 1NUQA 2JAOA 1IZ0A 2WG1A 1FDRA 2XSZA 1G20A 2Q3MA 2Y9MB 1YQTA 4HPXB 4PYRA 4OQZA 1M2OA 1DG9A 3GJZA 4TZKA 1J7KA 4F4CA 5CPBA 2VAMA 2P9QA 5KWSA 2PXXA 3C1TA 4EG7A 5ALFA 2VPZA 4Q6BA 3JWEA 2BZSA 2CLCX 4QYIB 4X95A 2OXIA 1SCKA 2XKAA 3DTVD 5D3ZA 5ANRB 2W6CX 3BH7A 2C03A 3KQVA 4XX1A 4EL0A 2VZ9A 5B7QA 5KEIA 4AKIA 1XLUA 1DHTA 1T3LA 1LK7A 2QZJA 1J0EA 3EC2A 4LDQA 4BAZA 3FNIA 1MO5A 1VE3A 4E5YA 2I6GA 5KWEA 3OQ6A 1JHUA 1PL6A 2FDXA 3DW1X 2JK1A 3F98A 4YNBA 4MKGA 3IP8A 3ZWBA 5E0KB 4N47A 4BNNA 4BNYA 4EHIA 5HBGA 4MEJA 4JBNA 2JFXA 2QDKA 3HKEB 2YN4A 2ADFA 1J4AA 1ZBQA 3H2BA 3LBYA 4JKOA 1KJYA 1ZXXA 4YB8A 1JFVA 4J8PA 1H0HA 2W6ZA 3E03A 3L84A 2HO4A 1L7MA 1G9SA 4NEHB 3E3AA 3EG9A 2XE8A 3E22B 1HL3A 2Q3LA 2ZYVX 3NLLA 2R4QA 2QTVA 4IY1A 1RAEA 5IC6A 3VI4B 5H4GA 3PVCA 4NSNA 5A1JA 3C41J 2PUHA 2PZKA 3TG2A 3PKZA 3WK7A 5EIXA 4LFAB 4E14A 1NJFA 1FW8A 1GNVA 1T4BA 2O5CA 4ZAFA 1J7JA 4QUHA 4DWJA 3NKVA 1QLWA 2GZMA 1IVNA 3HJFA 4I4NA 3C7KA 1P4RA 3QKRB 5EIBC 1O3YA 2GRAA 4TXLA 2A5DA 1MQ8B 1SB9A 1I01A 3ZVMA 3FMOB 3KPYA 1EGMB 2XCOA 1WKCA 4RTLA 1JTFA 1ORIA 2RGNA 3BJZA 4YHBA 2YQZA 4R2KA 1B15A 3EVBA 3QFHA 1IJFA 1MO6A 1PJSA 3EDYA 3FFXA 3JZMA 1EVKA 3K5HA 3GMDA 1RZVA 3SNKA 2Q3EA 3SSMA 4QX6A 4AM8A 2IV3A 1EQUA 4FP9A 3SHQA 5CDHA 2VQSA 2C97A 2WFLA 3KVOA 4G0OA 2C2HA 5KNDD 2HOQA 2SKEA 3GIDA 4TXNA 4YDHB 1DADA 2CFTA 3HVKA 3CWZA 1ZL2A 4KQFA 2IS4A 4FGUA 3EIHA 1XZFA 1FJHA 1D3AA 2IZ7A 4LYYA 5JCJA 2R6JA 3ODPA 4C7MA 4ZVQA 3T0FA 5EWLA 3GJYA 4MJ3A 4ZQGA 1WR8A 2P79A 1M6HA 3AF1A 3FPEA 4F6RB 4X85A 4HB3A 3U5ZB 5DLEA 3G89A 1IVSA 2C95A 2IEYA 4UDOA 3FHJA 1UFKA 4K9SA 4BFWA 2HDHA 4OAQA 5EXTA 1RJWA 3VPXA 2OECA 4F5YA 1OXVA 2ZRNA 4HNRA 4JD5A 4ZICA 1MABB 2EX1A 3OI7A 3VYWA 4JYPA 4YCCA 1YS6A 5BSFA 3L6OO 3NATA 1NNLA 1SEVA 1CUDA 3WNDA 4YMHA 2CV1A 3OEWA 4G1CA 4KAJA 5IKEA 8OHMA 2ZIZA 1FVXA 3D4PA 4BJ5A 4P3YA 5AVSA 2ZRMA 4H3VA 1H4QA 3HHEA 1AS2A 1TK9A 4FS8A 3U4CA 1QRRA 1T2CA 4NCIA 4HY3A 1QPBA 3T7RA 5DGXA 2VNSA 4A0FA 4BNZA 4R1SA 5GV7A 2YWDA 4QOEA 1E1RD 5CK5A 3VR4H 1G8HA 4B8ZA 3PX2A 3FPHA 4F9EA 4DQXA 1GAXA 2E89A 3CZRA 3WGOA 4MI1A 3AV3A 4LDJA 1EUYA 4TTJA 3DE3X 4HLQB 1EK1A 1ODSA 3WJAA 5FUXA 4EENA 3JS5A 4XWYA 3TMKA 3IHKA 3HJUA 1E1RA 1MJNA 5FPSA 3FB1A 3IOBA 4JWKA 4IZ6A 4LGYA 2A78A 2H4YA 4DV2B 3KDSE 4N8EA 1SBYA 1ID8A 1BXGA 2C3PA 1LF5A 2HMVA 1QK3A 4GX1A 4LRUA 1DARA 3K1AA 4FXPA 2H2FA 1EFCA 4XFDA 5HIIA 1Z5GA 1KBQA 2QOEA 4BVAA 2VSXA 2LXNA 3EUFA 3GW8A 5FO0A 3GUHA 2AZMA 1T1GA 4WGFA 1EWTA 5C8YF 1V7PC 4NAVA 1YR8A 2BONA 4MRVA 3MJCA 2VCEA 1UK6A 2QPTA 2VHJA 3BORA 3HGQA 3GPDG 1CJUC 1LPMA 3TR0A 3H84A 3JYQA 3O90A 3ZBQA 1U8TA 4ID9A 2PLNA 4L4XA 3ZLBA 5KBYA 3RKUA 3G88A 2HA3A 3GFTA 3JZAA 3BB4A 3IR7A 3KJFA 2W2PA 4MVJF 5FJJA 4ZYWA 3TNDA 1IQRA 4RZ2A 4EL5A 5CT8A 1HLDA 4FHEA 5B1YA 4Q3EA 3W7VA 3SZOA 4EEKA 3JYLA 2RHWA 4KGVA 5GVSA 1G3RA 1NT2A 3LVBA 4J2HA 2PL1A 5L9AA 4M9ZA 4GXTA 3CZMA 2H59A 3LYAA 5LU8A 2W2MA 1E6WA 2VTEA 4HK4A 5EWJB 3D6MA 3M6WA 2HPAA 3U2QA 1DOAA 4MJXA 3BG5A 2HCFA 3VTKA 1WUIS 5H82A 4GLBA 2D7DA 1E2KA 3CC8A 4HV4A 3OX1A 2HGZA 2ERCA 5EZ5A 3NYWA 4EELA 1GDTA 2DCUA 2GN4A 4ZKDA 1E4OA 2NXWA 2VT3A 3B6EA 4EDFA 4J0EA 1YRWA 2HK9A 2GM3A 1JTEA 1BD4A 1B4DA 3DAPA 1GGJA 4PZLA 1GNTA 5A4FS 3NDIA 5I4BA 1SD1A 2CMHA 4PY2A 5FV4A 5JAMA 2AD1A 1OAKA 2PWPA 2O2EA 3NRBA 4I3HA 2VBCA 3ADDA 2X5OA 3F7MA 3NHSA 3EIWA 4BMPB 3THXA 1YBFA 1QK4A 2ZDQA 1NXXA 5F1OA 1X8KA 2VJQA 3GLHE 4HS4A 1YDGA 2DECA 2OYCA 3WKCA 1FX1A 4TLMB 1ZJZA 4DIOA 1XCMA 3AJ8A 2PPLA 7YASA 1NJ2A 1W4LA 3AVOA 4RKRA 3NIDB 1VJDA 2AN3A 3H75A 4FLEA 4ODIA 4Y9UA 3THSA 1NV9A 4P83A 4TWRA 2HSWA 4K05A 4LHEA 4QOJA 3EGDB 1N92A 1Q12A 3LPCA 5CMLA 2XUOA 3GEEA 2HWUA 1CERA 4MDHA 5EKXA 3IODA 4AMZA 1I2AA 1QIMA 5IK2D 1E3EA 1KH3A 4AY4A 5U1PA 4QODA 2F4NA 3D02A 5T67A 1NHWA 3ZW8A 1MAVA 3AWDA 4UBJA 4WOJA 4KUGA 2WU3A 4FQ7A 3P9KA 5DN9A 3PNBA 1MABA 3TIVA 5CDGA 4GC9A 2H2AA 1JLLB 1NMSA 2B2XA 5TY0A 3HB1A 2WF8A 6REQB 4YONB 2X2EA 5DW0A 5TNXA 3K8OE 3DMHA 3W34A 4JL6A 2RH5A 3A6KA 1ZLXA 3LF2A 1I1OA 4JOBA 4U2BA 3TEJA 2QRNA 4AKTA 4E0BA 4ZP1A 4I1VA 2OK8A 4OX9Y 2J3LA 1VCNA 1T2UA 3U0BA 4K6MA 4IDFA 1ISJA 4YC7A 2OA0A 1RKXA 3EZ2A 3MJEA 1K6XA 3PRKE 221PA 5B1DA 1NBWB 3AJDA 3VU3A 2D3WA 3ZD8A 2KLHA 4XRGA 1KEEA 1JR6A 2I6XA 2LW7A 5CLGA 2NSDA 1RWPA 2AQHA 4Q82A 1NLZA 1CPYA 2Z8YM 3DPIA 4YO8A 3ZNPA 1RBZA 1WUTA 4DV7B 1BH6A 2OZPA 1VL2A 3CNQS 4ZDWA 3ZLVA 2YN2A 4F71A 5G2OA 4BRUA 1B0ZA 4QO7A 4RBNA 4E32A 2VNKA 5CD1A 1DEXA 1P6QA 4C3OB 1ECBA 4IJVA 1IZYA 3AESB 2HYDA 2FF5A 4PO9A 5EKDA 5KHAA 2LCQA 3UWDA 1JSCA 4G0VA 3VOSA 4CTKA 4PGHA 2OO7A 4ZVTA 4AJ4A 3GPLA 4IS2A 2MR6A 3N86A 3QVGA 4IZHA 4X71A 4L5CA 1TD9A 1CV2A 1TCBA 1XMJA 4NZ9A 2X9QA 5E2BA 3RF7A 4B2PA 4DUPA 2O8CB 1RJFA 3CX6A 3MGKA 5JNRA 5ALLA 5LIRA 1ECJA 2UYHA 4FLMA 2XUDA 2I3AA 2P91A 5IVDA 4Q15A 1Z0DA 1XEXB 3HRKA 1T4CB 4MRNA 4XDYA 3W2IA 4INZA 2VXCA 4M38A 2H9YA 4KI0A 3I5YA 1LJ8A 1YBVA 2ILVA 3WOVA 4MINA 3B85A 3OBBA 3IVGA 2XIJA 4O4HA 2PIDA 3SE0A 3L8DA 3WGVA 1A9ZA 1NN0A 1PR5A 4EQZA 3RLIA 1SEPA 3HZZA 3M6VA 1Z8DA 4UJ3A 2V65A 2IP2A 2VRNA 1DPGA 1T5LA 3QVXA 4KWHA 4N3NA 3ZLUA 3GIWA 3LLCA 3LBNA 1ZISA 3W6NA 4BV2A 3Q98A 4EY5A 2CXHA 4I4TB 4GF5A 2V1UA 4ZHQF 2QTBA 4H59A 4LX8A 4J0CA 4RVSA 4UD2A 2Q4BA 3KKMA 4UNNA 3DOIA 2H65A 2PKXA 1KMHB 1QFZA 3RYHB 3B1KA 3ZCRA 1IUPA 3RUDA 2HWWA 3LH5A 3TLBA 4YX9A 2CZQA 5CD9A 1ES9A 1U0OC 1C3OA 3WZLA 4WH0A 3D2AA 3M1LA 1PEKE 1AUXA 3AUXA 3UGKA 1BXZA 4GI7A 4FYIA 4GZMA 3ZZ0A 2IHNA 1NVVQ 1LSOA 4FT2A 4ZTZB 4XWKA 5L53A 5K03A 1GZ3A 1UKVY 1MVNA 5DP1A 3JALB 3ELUA 4YP0A 3NORA 1H8ED 1QOZA 4CV3A 4GLOA 3EFHA 2Z09A 2MYTA 3QP9A 2WWTA 5GV8A 2QA5A 2IOFA 3R09A 2V96A 5LJLA 2BMVA 1NG9A 2RJNA 4BV8A 5FBLB 2VRCA 3AGQA 2FR8A 1ZAYA 3JR7A 3DZJA 2YCBA 1QTRA 2JFNA 2FKAA 3DXYA 2EWMA 2FPOA 1XKTA 4WZBE 2IUTA 4MVJH 4MWBA 5IH7A 4ND3A 1CEYA 3E7PA 3TCKA 4L57A 4L0CA 1JEEA 1P8JA 4B46A 5U9CA 1HT0A 1QP7A 2G5GX 4CG3A 5EJ9A 1MAWA 2JLAA 1Y8QA 2B6HA 2CJWB 3N2YA 1E92A 3IE1A 3TMAA 1ZQ9A 3VR5H 3IOCA 1BVUA 1TJ5A 4XEUA 2GLTA 2D62A 1COZA 4EUFA 3AVTA 3C6BA 4DKJA 4FGKA 1GUAA 1ZN8A 1FRVA 4F06A 2C04A 1ZL0A 1L8AA 2AMFA 2XVXA 4Q7LA 4M0FA 1CUFA 1T2NA 3OJ0A 4HAIA 1EK2A 3VI3B 5J4KA 3VDRA 3CKYA 1KI9A 3MTIA 4G07A 1P0MA 5DSTA 4A03A 5K0JA 3DMYA 1TYEB 2EKLA 3TOZA 3DDZX 3VU9B 3ANTA 1LU9A 3FDIA 1PT6A 1KKMA 4G0MA 4WADA 5AKGA 5EIBD 1T4GA 4G1UC 2NPIA 1E1MA 4I46A 4LDNA 2BELA 1SXJB 1LNQA 3VSAA 4J1TC 4C89A 4JR2A 4ISCA 4S12A 3K0FB 1SM4A 3FYUA 4CIWA 2F3QA 3LUGA 4QYWA 4CETA 3N0VA 1GQFA 3CBGA 3ZHCA 1YGPA 4EGSA 1VJ5A 1NASA 1QAQA 5CFMA 1FUYB 1U7WA 1QTIA 4BO7A 4BZPA 2ZOSA 3E2IA 4IH1A 3TF5A 1BE1A 2EF1A 3H5WA 3DLAA 4GXQA 4PZDA 4UDXX 3PFIA 4UARA 1J22A 1DDIA 1UWLA 5COAA 3ZE9A 4JSYA 2PIAA 4I36A 4RZQA 5JEDA 1ZSVA 5E6SB 1YZUA 1OUMA 1QDUA 1DLIA 2A1UB 3OCWA 1V4NA 5LQSA 5ALQA 2FFRA 1OB2A 4IIEA 2GCNA 1Q20A 4RC9A 3G0OA 5LU9A 3DUWA 5DH9A 1CNEA 2I71A 1DAGA 2GNPA 3T1NA 4HAXA 5AUOB 1U0BB