2C7VA

Structure of trypanosoma brucei pteridine reductase (ptr1) in ternary complex with cofactor and the antifolate methotrexate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGSSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title Structure and Reactivity of Trypanosoma Brucei Pteridine Reductase: Inhibition by the Archetypal Antifolate Methotrexate
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 90
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c7vA00
3MJEA 1JVBA 3VZPA 1NHGA 2O2YA 1R4MB 2X9VA 5EN4A 3OJLA 2ZTLA 3GVCA 2QZZA 5LC1A 3RQSA 3U4IA 2GNAA 2VOJA 3JD1A 1OC4A 1D8AA 1U2GA 1B2LA 3EVTA 5I8ZA 1NQOA 4EGFA 4Q3BA 2G76A 4MJLA 2C5AA 2JFFA 3E1KA 1NP3A 2VT2A 4JJIA 1MV8A 4IIVA 3AM4A 4ZQEA 3G3EA 3JV7A 5JO9A 1T2DA 1L1FA 1UP4A 2J3IA 3RBZA 3TZHA 3WOHA 1KETA 4YJHB 4YT2A 4IDDA 5A9RA 2JD1A 3S1LA 1DLJA 3OEYA 4RF5A 3LT1A 5A06A 3SJ7A 1ENPA 4XQEA 2BGLA 3IMFA 2VWQA 3LU1A 3M1AA 1DJNA 2IZ0A 3ASVA 1EUCA 3LZ6A 3OHSX 4NJOA 4PLGA 1LLCA 4RPKA 3TNLA 3AJRA 3GK3A 3IS3A 3G79A 2C0CA 2Y05A 1HKUA 3TL2A 1E6WA 3RUDA 4TVBA 3QVOA 1GPJA 1OI7A 4UVGA 1SMKA 5DCUA 4YPOA 1LXCA 1TLTA 2I99A 1XSEA 3H7AA 4MP3A 1XQ6A 1D7OA 2BRUA 4B4UA 5B4VA 3PRJA 1PJLA 3OECA 1ISFA 4RCVA 4R9SA 2PH5A 2A94A 4Z9XA 3GZNA 3MJCA 3ZV4A 3CUKA 4IJUA 4R16A 3VPGA 4J7UA 1Y9AA 4OXKA 3RUAA 1YKFA 3C1OA 1M6WA 5GMOA 1VE9A 3PFWO 1NAHA 2YW9A 3UF0A 2XF8A 4E4YA 4GX0A 1VLLA 1CWUA 1M2WA 1LLUA 4NJMB 4CV3A 1H5QA 3BMCB 1FMCA 1FDUA 1ADFA 3DHNA 5IN4A 3QP9A 5J23A 3RC1A 5JMWA 4A7PA 4IQ0A 2V6GA 2W2KB 2ZTUA 3D1LA 3IP3A 5AOVA 3RROA 2ZJ1A 5IDXA 4A10A 4R41A 4L4XA 4XGIA 3GVXA 3CMMA 4AG3A 5JAZA 2C54A 1D3AA 4N7RA 5G0WA 3TSCA 2TMDA 4DVJA 2EGHA 2IYPA 5B37A 1XG5A 1H0KA 2VRCA 1EEHA 3FNGA 4JJGA 4E12A 2E82A 1MFPA 5HTOA 3C1AA 5JS6A 1Z73A 2VRBA 4E30A 3RJ9A 3EVNA 2NUAA 1DOHA 1DSSG 1Z45A 2JFGA 5KTKA 4LSWA 1IOLA 1YL6A 4ALNA 5HM8A 3IDSA 2YV2A 4J4BA 5ES3A 1HLDA 1LU9A 2EKLA 2E48A 1HWYA 3BTOA 1AUPA 3MWEB 1UP7A 5KVVA 1PU2A 2HSDA 1LLDA 1YQXA 2C82A 2ET6A 2PA3A 4R1SA 1ML3A 5ER9A 1RM4A 2O4CA 1N2SA 4RVFA 4RV9A 2WWRA 3UW3A 4RORA 3VC7A 1ADGA 1SB9A 2P9GA 2ZK7A 2IEDA 5JCJA 2OGUA 3UAGA 1A9YA 1P1HA 3OFSA 3E8XA 4BNHA 3KOUA 1WP4A 3I83A 1BMDA 1XGKA 1XDWA 5K9ZA 1QORA 3RCBA 4GAEA 2OBNA 3FWNA 1P74A 4Z9YA 4CM3A 3GUCA 3TQHA 2SCUA 1DIGA 1VL8A 1Q0HA 1XKQA 1XEAA 1HZZA 4L75A 4RPJA 1RM0A 3TFQA 1YWGO 4D3SA 1EBFA 3NTQA 3GEGA 3BMQA 2DQ4A 4ZA2A 3PYLA 4FBGA 3ON5A 3VH3A 1A7KA 4CMAA 5TRTA 1P1IA 3E9MA 4ND2A 4K9DA 4MO2A 5IXSA 4JJFA 4R3NA 3LQFA 4WLEA 5HS6A 3RBVA 5JAMA 1JAYA 1VSVA 2G1UA 4ITUA 3C8MA 3GVHA 4RVHA 4Q3CA 5DCYA 3WMWA 3PEFA 3ZW9A 1VJ1A 5BNIA 1ZXLA 4NG5A 1PQPA 4BKPA 1K89A 1LDGA 3T7CA 1UUFA 2Q45A 4Y6PA 3PPIA 3U49A 5B12A 1ISHA 1MG0A 3RC9A 1LUAA 2DTXA 1I3MA 1WDLA 3O03A 3RC2A 3WYEA 4Y6RA 3R1IA 4E31A 1HSOA 4CMIA 2ZQZA 1N8KA 2DBZA 1E3LA 1E7SA 4YA6A 1HDRA 1NHWA 4XDZA 1X7DA 4DIFA 1P1JA 2GN6A 4OH1A 4LN1A 3JD3A 4UVEA 1YONA 4BGVA 3WGGA 1V3VA 3VPXA 2B5VA 4D0RA 3OIFA 3GN1A 2AQKA 1XU7A 4BQRA 1AXGA 4U6SA 2DUUA 1CYDA 1Z75A 4YVFA 5CPBA 5IN5A 3WR5A 1NR1A 2Q1SA 1EVZA 4FR5A 4FGWA 3KUXA 3OQ1A 4MKZA 4DC0A 1B16A 1LI4A 1Y5RA 1Q0LA 5JDIA 2TMGA 3GFBA 3KETA 3M6IA 4B7CA 1JN0A 3HE3A 4MVJF 2B0JA 4OGWA 5JDIC 3OA2A 1B15A 4BNLA 1IULA 5T5QA 4DMLA 3BXXA 3UHAA 5T6BA 5DBIA 3WGOA 3PI7A 3KRTA 3DTYA 5IJZA 1OAAA 3JQ9A 4AJLA 2YZ7A 1UAYA 2PZMA 3PVZA 4UREA 4IDEA 4CL3A 3AFNA 4IDBA 4BL5A 2WTBA 5KKAA 4ZD6A 4ND5A 3RFXA 2BHLA 3P19A 2GERA 4MDHA 3LC2O 1XA0A 3GDFA 5T67A 4OQZA 1JLLA 1HXHA 3MOGA 4I9NA 2NVUB 1ZNQO 3HZZA 3TPCA 3ETEA 2GASA 5DDIP 3IC5A 1SEVA 1GQQA 4EZBA 3F4LA 4YACA 3O4RA 1YBAA 2VHWA 1BG6A 4KZPA 3BMOA 1UXIA 3WIDA 4QO7A 4EEZA 5IZCA 3FWZA 4CLRA 3AM5A 4XJSA 4TRRA 1PJQA 4AJOA 3DEYX 4OSOA 4PFJA 1CQJA 4IM7A 1T2EA 4C4OA 2BKAA 3R3JA 2PNFA 1PQWA 4YJGA 1BWSA 1U9JA 2DTEA 4GSLA 4OM8A 1P1KA 4J49A 1HLPA 3OICA 3OSUA 1P45A 3QY9A 4EITA 2WD8A 4XYBA 3H4VA 4EJMA 4H16A 1I2BA 2W98A 3W6ZA 1R37A 2IXAA 1ID1A 3KV3O 4UAGA 4GVXA 2DT5A 5CG1A 1HDZA 5GZ6A 3ZWVA 1ONNA 4NH4A 2I67A 2Q2QA 4IXWA 4MVJI 2NVWA 4XGNA 4L74A 4Z0TA 3ZV5A 1ZK0A 1A9ZA 4FFOA 4OQYA 5IAAA 2PH3A 3FBGA 3QVXA 4DGSA 4DQVA 2DPHA 3PDUA 2CY0A 3CKYA 3CPSA 2OXIA 3H5AA 2BD0A 1ENYA 4D7AA 2E37A 2NV6A 2O3JA 1VL6A 2JD2A 4CMCA 3A9WA 1FJHA 1YL7A 4TRNA 3BHIA 3OEWA 4ALIA 2EJVA 3QVTA 1E3EA 3D3WA 2RIRA 2AE2A 1KVUA 3OJ0A 3EGOA 4CUZA 3NT5A 3W8FA 4DPKA 5KJCA 4Y8VA 4ALJA 1U8FO 3HQ4O 2H63A 3ONEA 1LNQA 1MB4A 3WMXA 2ZTVA 2EGGA 1C1DA 3WJAA 4IDGA 1R0LA 4IJWA 4ND4A 4B7UA 3OETA 4OOEA 2B37A 2GD1O 3CSDA 1DIAA 3GEMA 5DOVA 4ROSA 3I52A 4WPGA 4Z3DA 4IY1A 3FSRA 3LYLA 2DKNA 2P5YA 3B1FA 3VOSA 1CDOA 3DXFA 1XYGA 4U7WA 5G0SA 3HG7A 4CMGA 1PL6A 3CH6A 3GQVA 1EQ2A 2Q2WA 4DA9A 1M6HA 1PJSA 1ISJA 2FPPA 4CM8B 4XWYA 4L0QA 1LLQA 4UVDA 4MVJD 5U4QA 2ILTA 1GFSA 1H2BA 2C29D 1Z7EA 1E5QA 2V6FA 3EDMA 3OBBA 1YBVA 2UUOA 1R0SA 2EW2A 1GYRA 4NK4A 5KVSA 2FZEA 1HYGA 4P4GA 5C3MA 4S3MA 3TZKA 1YJQA 5G0VA 4XYEA 1HDGO 3QVWA 3ZNQA 3ANMA 3WGHA 2X5OA 2GDZA 2D0IA 4BKQA 1MG5A 4DXHA 1ENOA 2Q3EA 4R3WA 2BFPA 2VNSA 1C0IA 1ZJZA 2Y66A 3GG9A 3KLPX 3JQEA 2D2IA 3Q3CA 5JAQA 2NU8A 1I24A 4Z9FA 1RKXA 3U4HA 3RKUA 2Z5LA 3AY3A 3PIIA 1E7RA 3ZU3A 1NWCA 3ZV3A 1WMAA 1B14A 1XR3A 3G17A 1MP0A 4A0SA 4AL4A 4HFJA 4NBTA 4CQLA 2CD9A 4YTEA 2GUGA 2BFAA 1SZJG 5TJ9A 1NQ5A 4IDAA 4J7XA 3KYBA 1W6UA 4IGFA 4TKLA 2Z95A 3K31A 4D42A 4YJFA 5CHEA 2HK9A 3KXDA 3Q9UA 1ADCA 4LCEA 4OYRA 3JQAA 3H8VA 3NRCA 5JDCC 1PS0A 2AEJA 4A5OA 1PL7A 1CETA 3DZGA 3GZNB 2B4RO 4KUGA 4XX0A 2VHZA 1O94A 4HP8A 5GY7A 4ESOA 3H6KA 4RPLA 3DZFA 5I7VA 3RASA 1F06A 4R68A 4OJNA 3E82A 4ZVVA 4P22A 4N5LA 2CVQA 1LA2A 4GQAA 2OHXA 2FWMX 4GLOA 1C14A 2YV3A 1XELA 4DRYA 4PVCA 1R4NA 4MOWA 4M1QA 3HDQA 1ARZA 4BUCA 1DAPA 5TSDA 4GGOA 4XQCA 3AY6A 2JD0A 1IL0A 1HYEA 4MVJH 4RGBA 5L4LA 1I2ZA 4HX5A 4D44A 2PKQO 1WPQA 1V3UA 2V6MA 2NQTA 2W8ZA 3W4KA 3VZQA 3WICA 1N7GA 3AFMA 2W90A 3GVIA 1WNTA 3VZRA 5AXDA 3GRPA 5JNLA 4GVLA 1LDMA 4QSMA 5KJFA 3HUDA 1MC5A 5K0ZA 1KVSA 1KVTA 2DLDA 2ZB4A 4NBVA 4WCFA 2B4TO 3PFFA 4RVDA 1PZGA 1Y8QA 3TFOA 4CMEA 4ZN6A 2D5AA 2D4AA 2IRWA 2B83A 4RLSA 2QRKA 3WQSB 5CG2A 1IUKA 1UDBA 1GAEO 5I9MA 4RDHA 1B3RA 5TT0A 4AJJA 4CMEC 3UFXA 1I36A 4DIOA 4ZICA 3ADPA 4NDNE 5F1KA 2HMUA 3PIDA 3QW2A 3ZU5A 4AJPA 4BO6A 2JL1A 1I3KA 3UCXA 3DZBA 3A14A 4O63O 2VYVD 3RUHA 3AI3A 3BTSA 2O50A 3QSGA 5KOIA 1NR7A 1GCUA 1KEWA 3IUSA 1E0DA 3FCOA 1U4SA 5BSEA 1YB1A 2EIHA 3B6ZA 4R1TA 1X1EA 5KCZA 1PWZA 3ZWCA 1NAIA 4R5MA 2EP5A 1ORRA 3O8QB 5L40A 4CV2A 1LDEA 2EW8A 3VH1A 4BKRA 1E7MA 2CF6A 4YB8A 4Q39A 1RWBA 5G4LA 5HS4A 3FNEA 4ID9A 3BMQB 5G2OA 4B4OA 2PV7A 4HNGA 5C37A 1HDXA 1GYPA 2PWZA 2R2GA 4A73A 2AQHA 4J90A 4BQPA 5KWEA 4LW8A 5DP2A 4MINA 3GRKA 4PZEA 1P3DA 4IMPA 4JQCA 1U7HA 1ONOA 1M76A 1P31A 3KSDO 4IMRA 3F47A 3K92A 5EIOA 5TLSA 3L6OO 2DPGA 1YVEI 3SX2A 1J4AA 3PJEA 1T2AA 3G49A 4OIMA 1JDJA 3NKLA 3RWBA 4YAKA 2GR9A 3KYCA 3OP4A 3VKVA 1QXSA 5TGDA 1MUUA 4XR4A 4AICA 2EP7A 3MZ0A 4RVSA 4Y67A 1UXHA 3GNTA 4PG4A 1E92A 2Y1EA 4CMIB 2UYYA 3RFVA 3VZSA 5U9CA 2VHYA 2BMAA 2O48X 3IQDB 2X58A 3F4BA 2JJYA 4OXNA 4CM6A 4CMBA 4J0FA 5COBA 2PY6A 1VRWA 1SBYA 4O59O 2WE7A 5GZ1A 4YBZA 2CSUA 1U3TA 3PTZA 5KNLA 3E5MA 4AJEA 3BZUA 5TIIA 1LC0A 4HNHA 3EZYA 1EK5A 4H3VA 4PZCA 1EQUA 3I4FA 5CPFA 1U4OA 3FTNA 3V2UA 3Q2IA 3WTBA 5I9NA 1I2CA 4XA8A 1MLDA 2QW8A 3DBLA 9LDTA 2Y1GA 1P33A 4CL8A 2WJPA 1PJ3A 4G2NA 1ONPA 4QQRA 4INAA 2NSDA 4J9VA 4D43A 1ZK4A 3JQDA 3X2FA 2DC1A 1LRKA 1ZW1A 1VI2A 3QRWA 4L8VA 4ZU3A 4DREA 3TZ6A 2HU2A 5F3RA 3K30A 4JBIA 1G6KA 1GTMA 2O23A 2XXBA 3PHGA 4DLBA 4GH5A 4PG7A 4IINA 2HO5A 2VT3A 1YRLA 2IEBA 4DYVA 2D5CA 4GMFA 2VTDA 4W6ZA 3RUCA 3PYMA 3V5NA 4NU6A 1KEVA 3BMOB 1RM5A 2EXXA 3OJEA 4Q3NA 2Z1MA 2GYYA 1UR5A 4RPHA 4B7XA 3JD4A 4NQZA 3WGTA 1UXGA 3DHEA 4CLRB 2DBQA 4FGSA 3ZDFA 5KKCA 3AUTA 3MOIA 4I5DA 3WS7A 1I33A 3A4VA 3IOYA 4CLHA 5CDUA 1E6UA 3ULKA 2JCXA 4CPDA 2GLXA 3DQPA 2FHSA 2A4KA 4KQXA 1CF2O 3W4IA 3I4CA 4NK5A 3ZWWA 1XU9A 4LCJA 4I1IA 2FPGA 1HE5A 1GEGA 1BHSA 3H9GA 8LDHA 1U3VA 3VPFA 5AXAA 3U4DA 1ZCJA 4Z3KA 4QFCA 5GZ3A 1Y6JA 1QKIA 8ADHA 1N7HA 5FF9A 4FD3A 1PGJA 1AE1A 2FOIA 5A02A 4EJ6A 5EINA 4AJ4A 5JBIA 5F21A 2GSDA 3Q0EA 3DBRA 2I65A 4GX5A 4E13A 4WEOA 1YB5A 1LX6A 3ZWXA 1O8CA 4ONEA 4JNKA 1EDZA 4IDCA 1DRWA 2Q4BA 4MVJE 3KO8A 1E1LA 3HWRA 1R0KA 4AJHA 2FN7A 4BIIA 4I9HA 4UUPA 1E3JA 5EL0A 5AXBA 3D3WB 5BR7A 2HMWA 1EE2A 1SAYA 3F1KA 4BNNA 1H2HA 2XAAA 4RF3A 2QIOA 1N1GA 1K6IA 3QVSA 5I8WA 3HDYA 2P9CA 4CV1A 2JAPA 3B1KA 1C1DB 1Q7CA 4C7JA 4YXFA 4FFPA 4ZQBA 1X1TA 3H2ZA 1MFZA 3UICA 1R12A 4W7IA 2EHDA 3C7AA 2BFMA 3MTJA 2Q49A 3JD0A 2HMTA 1GCOA 1ZK2A 3WWYA 2VWGA 3DDNA 1LBEA 5AXCA 3WG9A 4GLLA 2HRBA 2UDPA 2YDXA 4RO0A 3GMSA 4WASA 2OZPA 3U09A 3DBHA 4B4WA 3KEQA 1QYVA 2C59A 3WYCA 1A71A 3T7EA 3SXPA 3SVTA 2BGKA 4GWKA 4BMSA 1I10A 1BVUA 2BF7A 5ADHA 3DMYA 2V6BA 3VH4A 3DOCA 2AHRA 3TZQA 2WSBA 3ANLA 4RZHA 3JQFA 4GI2A 2AE1A 4FC6A 5L4SA 3E18A 1X14A 4PGFA 1H9AA 5TX7A 3FD8A 3GY0A 1SO8A 3OJOA 3T4EA 3U62A 1UDCA 1KC1A 2O4UX 1BGVA 1PS8A 1PZHA 3FBTA 2ZTMA 3JQFC 4BS9A 2I9PA 1NVGA 3E9NA 1O89A 2QZ9A 5F1PA 4BO5A 3QWFA 2E6UX 2OFPA 3NJ8A 4FIZA 3CINA 1ZUD1 2AXQA 4XB1A 4W9NA 1LC3A 2AA3A 3AI1A 4MIYA 4B3JA 1F12A 2VHVA 4B8WA 4KP7A 4EUFA 2CVZA 4M86A 1G0OA 2OO5A 4KTTE 3L07A 1ZO8A 4W9NC 1HSZA 3NTRA 4RL6A 4BO4A 1PEDA 5DBGA 3RIHA 4D79A 1ZFNA 4JROA 1ZEJA 2W2LA 1MC4A 4WNIA 4KDEA 3MJVA 3GR6A 4WEQA 1G1AA 4CV0A 4KQWA 1DAOA 2PLAA 1ZSVA 3C3XA 3PP8A 4R5HA 4M49A 3O26A 4GBJA 3ZNPA 1YQGA 4WLOA 4NBUA 3ONDA 4CQLB 3KLMX 3ROQA 4GX1A 5JE8A 1X0XA 4ALMA 4MKRA 4PLTA 1KY5A 2P91A 4NPCA 4JP2A 1DXYA 5BNFA 1GQ2A 3U3XA 2P2SA 4YJFB 4PG8A 4XGKA 1T2FA 2E4AA 3D4OA 3GNQA 3JQAB 2DBVO 2EG9A 1ADBA 4J2OA 5AQ1A 1B8UA 4WE3A 1PZFA 4ILKA 3I9LA 1TXGA 4Q3AA 4DQUA 1S6YA 4JLWA 3RSHA 3JQBA 4GKVA 3WSWA 3FHLA 1M66A 4PG5A 1HETA 1JWAB 3AU9A 3FF4A 5U1PA 1HZJA 1VC2A 1XQ1A 1ZH8A 3LT4A 4DYDA 3OJFA 3L9XA 3JQ6A 3JQBC 2I5PO 1KEPA 3G1UA 4Q3EA 4EEXA 3I9JA 1F0YA 1D1TA 1UZLA 3PHHA 3HDJA 2GN4A 2CFCA 3BTVA 1IHYA 2WYWA 4FB5A 5FWNA 1R4NB 3QQPA 1GADO 1ZVMA 2G5CA 3A1NA 2X0NA 3L77A 2Q1TA 1E1MA 4WK6A 2O3TA 1X13A 1I8TA 3E03A 4YT5A 1YBMA 3UGKA 4WLVA 1PL8A 2PR2A 4BNWA 1OZAA 3ONFA 3I6IA 2GO1A 3BHJA 4CLEA 2CVOA 3STHA 4IQ8A 3GN2A 2D59A 1NPDA 3PLRA 5JFOA 1DIHA 4MIOA 2D3TA 4LGVA 1NNUA 4CQMA 4U5QA 4WECA 4F3YA 5T8KA 5L53A 1Y8QB 6LDHA 3WSVA 1CRWG 4I08A 1AXEA 1HDOA 4OHUA 5C7LO 3IJRA 3UN1A 3NX4A 1EVJA 1MGOA 1PTJA 1EUDA 3HADA 3JQ9C 3BMNA 4UUMA 2EJWA 3ZWYA 3NDIA 3KM0A 3VKUA 3NTOA 4PLWA 3SLGA 3WB9A 2VOEA 4G65A 4D0SA 2VZ9A 1QLJA 4XR9A 1FDSA 3ZV6A 3AUSA 1GU7A 4CMKA 3VAZA 1KC3A 1MXFA 5A3VA 4XRRA 3V2GA 5BQFA 4LK3A 4EUEA 2HMSA 3GFGA 4WOJA 4TZKA 3S8MA 2FRDA 1U2DA 3GGGA 1GQYA 2LDXA 1B26A 5JPIA 4BO9A 1Y8RA 5DZSA 1I0ZA 3JYLA 1RYDA 5TT1A 2GGSA 2IODA 4GX2A 2ZATA 4XJTA 3ZHYA 4YAGA 5IZCC 5BT9A 1QYWA 4UEKA 1WZEA 2PKQP 4E5YA 4PN3A 5MDHA 4FJ1A 4FN4A 4E0BA 2C20A 3DAFA 1P44A 2C07A 3UUWA 1H6DA 3DR3A 4AJKA 3N74A 1PSDA 3K8ZA 4JIGA 1DC5A 4UUNA 1EUZA 1HDCA 5JLAA 4CM9A 4HADA 1YJ8A 2EERA 2G82A 5C7OO 4R54A 2WDZA 1QG6A 2Q99A 1BXGA 4WGGA 1NTOA 4FSHA 4WLNA 1DRVA 1X7GA 2BFOA 4NFSA 3VDRA 1OFGA 3B20A 2YY7A 2ZIZA 3KYCB 1KY4A 2BI7A 5B4TA 5IXYA 1CERA 4RF4A 1PJCA 4YCAA 1NXQA 3MJSA 3TOXA 4BGUA 3ZGYA 1FXSA 5KJ1A 4ZRNA 4J4HA 1ENZA 5B1YA 3D7LA 3HJAA 2ZB8A 4XQ9A 2A92A 2X0IA 1ZZEA 1KVQA 2CDBA 1PR9A 3LSYA 1W73A 1I3NA 2HAEA 3VHRA 3BYZA 3JQAD 3G1TA 2GCGA 4AFNA 3S2GA 4URFA 1PJ2A 3RU9A 2XOXA 3I9NA 1ZJYA 4BOYA 2D8AA 3LVFO 3GGPA 5TJHA 4PZDA 3Q1LA 3FN4A 3LLVA 2ZQYA 5HRUA 4ZRMA 3H2SA 4CJXA 4J4TA 4F45A 1H94A 2EKQA 3EHEA 3JQCA 1CQIA 2Q1WA 5CEFA 1QYXA 1A4UA 1ZEMA 1U7TA 1PS9A 3OQ6A 4FFMA 4XEHA 5A4DA 1DPGA 3FI9A 2OL4A 2UAGA 1GEEA 3RVDA 4TSKA 2ZCUA 4HY3A 1YGYA 4HKTA 4BMNA 1ZSYA 3DBLB 1W0CA 3WYBA 2X86A 1C1XA 4C7KA 4IIUA 5A04A 1PGPA 3UKOA 4A27A 5EESA 3SEFA 3ROMA 1DC4A 2NM0A 3ZWBA 3GVPA 4AJ1A 1LEHA 4J9UE 1DFGA 4JXKA 3GG2A 2O2SA 3GPIA 4TROA 4ZQGA 3IKTA 3WDSA 1DO8A 3QA9A 1M75A 3IUPA 2P5UA 3RAJA 3EW7A 1DC3A 3RJ5A 1SEPA 3C85A 1Y5MA 4MVJG 2QYTA 3PJGA 4BNGA 5CDYA 4PCVA 1N1EA 3PLNA 4OL9A 1HYHA 4J1TA 3WFJA 3ROPA 3LF2A 3GHYA 1N92A 4UULA 4EBFA 3B70A 4Z0HO 4M54A 4N18A 2UVDA 3NT4A 5FYDA 4BNXA 1R16A 4QO8A 5KIAA 3BAZA 3AUAA 5JY1A 1EK6A 1Q2XA 3WGYA 4BO0A 4U8GA 3S2FA 1QLHA 2PZJA 4QT0A 1LSUA 2HK8A 3AM3A 5CP8A 4RPGA 2X0RA 2NACA 5H83A 4CUJA 3KBOA 3DZIA 5ICSA 4FDAA 4YRBA 1VSUA 2IDZA 1PX0A 5AYVA 1U8XX 2ZYAA 3F6YA 3O38A 4J0EA 4TMFA 4CODB 5JAIA 3UVEA 3UH1A 3ZHZA 4GKBA 1A5ZA 4Q3DA 5CDSA 3PWKA 4BNZA 4JCOA 1HDYA 1BXZA 2HLPA 3JYPA 4QEDA 5CAEA 2WD7A 3RU7A 4DQXA 1ZMTA 1P0CA 2QYSA 3HB4X 5JW6A 1E1KA 4IXTA 3DBRB 3KB6A 1V9LA 3GT0A 2C7VA 1ZXBA 4K28A 4YQZA 3NGXA 1ISGA 4S1VA 5T57A 4PIVA 1YL5A 3BHMA 3LC7O 4RVUA 2X4GA 4XYMA 1HEUA 3WIEA 5DOZA 3FNFA 1UJMA 2AG8A 3LLSA 2VQ3A 3GUYA 4YAEA 4E5KA 5C7IO 3W8EA 1R66A 3NGLA 3MEQA 3H5NA 3HFGA 3GC6A 3H9QA 1UXJA 1ZIDA 1P77A 1ZMOA 4QX6A 3AW9A 4L4RA 5DF1A 1E7QA 3FPCA 5L45A 2FP4A 2YFHA 3EC7A 4FS3A 3R3SA 1C0PA 2Y99A 3WXBA 4J1NA 2H9IA 1U5CA 3AWDA 1IZ9A 1I3LA 4J6FA 1P1FA 2P4HX 3WFIA 1CIVA 2YHIA 2LDBA 4CR8A 1EMDA 2QRLA 1SPXA 2Y68A 3JYOA 1JVSA 3GAFA 3I9MA 4PLYA 5EQFA 5A5EA 5JC1A 3ADOA 3EUWA 4W7HA 1GZ4A 1LSOA 1UDAA 2PGDA 2AEFA 2VUUA 3H9UA 4AJNA 4YT4A 2CDAA 4WCFC 3K73O 3DL2A 5KVCA 4PLCA 1Y9EA 3GAZA 2NTJA 1JWBB 4W99A 5IF3A 2CF5A 4NFHA 3NUGA 5CEEA 5I7EA 4E2XA 4RVGA 1QYCA 1YO6A 3RD5A 2VCYA 2GN9A 4FFNA 4HFNA 2GZ2A 4LMRA 4CLOA 1BW9A 4JBGA 1NYTA 1O5IA 1T1SA 3GHHA 4R51A 2Y93A 4BV8A 2J5QA 1H9BA 3I3OA 1GPDG 3UOGA 2AQIA 3P5SA 1K6XA 4YRAA 4TKMA 4MP6A 4TRJA 5F5NA 4M55A 2BLLA 2J6IA 2PGLA 4O0LA 3DFUA 3JQGA 3H9JA 4EJ0A 1V35A 4K26A 5BSFA 2IXBA 5JSFA 1KVRA 1ZK3A 2C5EA 1K2WA 1B3BA 3EMKA 4GPD1 3SBOA 3GMDA 5TNXA 4CMJA 3AU8A 1FK8A 2EWMA 1V6AA 5KJ6A 3JYQA 2FMUA 4HFRA 1U3UA 4IUYA 4FPXA 2CZCA 3I23A 1HF3A 2G0TA 3H3JA 4FCCA 2H1SA 3ZI0A 4M87A 1ZBQA 2RAFA 3K9QO 3ZW8A 4UEJA 1IE3A 3VVCA 2DFDA 3AOEA 2VZ0A 3W6UA 2PZLA 4DUPA 1YS4A 5B4UA 2OUIA 2NU6A 2ZJ0A 3QWAA 4PLVA 2FPIA 2QHXA 3AOEC 5CFZA 4CM4A 1RYEA 3WLFA 2OOSA 3QIVA 1QMGA 1EVYA 2FR8A 2W4QA 1XLTA 4XYLA 1NVTA 5A5FA 3U5TA 3VVBA 2PKRA 3VPHA 3U0BA 1KEUA 2QQ5A 3KTDA 5CDTA 2B69A 4F6CA 2CDCA 2Y1FA 1WLYA 2PFGA 1LDNA 4GL4A 4M89A 5L51A 3FRJA 3F1LA 4WUVA 5ITWA 3E48A 4Z0PA 1UZNA 4MPDA 1F17A 4LRSB 1XIVA 1X0VA 1A72A 3UCEA 5F5LA 4F6LA 3K96A 2OORA 3DMTA 4CQMB 3HN7A 2EV9A 3A28A 2VYNA 1NQAO 3R0IA 4TRMA 4E6PA 1C0LA 3OIDA 4L9RA 4TZTA 3DO5A 1VM6A 4EI2A 3DMTC 1UP6A 2NADA 5A9TA 1GY8A 4BNIA 3WQQA 1B0AA 2PK3A 3BMNB 1T4BA 2VRCD 3JYNA 4RJTA 1LQTA 3QV1A 1OC2A 3I9OA 1RJWA 1SOVA 2YUTA 1JA9A 4WOKA 3SJUA 4BV9A 4RF2A 4R69A 1JKIA 3H3FA 1N9GA 3LT2A 5G4KA 1UZMA 3QJ5A 4ZQHA 4AJ2A 5DP1A 1DIBA 3K2BA 4DL9A 4CMHA 1F14A 3NDRA 1H93A 3L0DA 1E3SA 1Y8RB 4PLPA 3EYWA 2IE0A 2PZKA 1SC6A 3C24A 3QWHA 4FW8A 1Z6ZA 1O0SA 3TZCA 4CM8A 3WGQA 3D3EA 4R4JA 3LT0A 5JCJD 5THKA 1TVEA 3O9ZA 4L4SA 4YJGB 3JCZA 4A03A 3ZU2A 3D5QA 4JGBA 3BA1A 1PIWA 3KSUA 3D5TA 2I6TA 4LSMA 3WTCA 5K6AA 3L6DA 3FR7A 4XDYA 4E5PA 4B3HA 4HBGA 3VTZA 1U28A 2ZCVA 2VZ8A 1PQUA 4TQGA 3PZBA 3HHPA 3PWSA 5FEUA 1KERA 1P1RA 4M8SA 4PRLA 1T1RA 5K6AC 3RFTA 5DN9A 4BHTA 4E2WA 1DBVO 3V2HA 1KBZA 1R6DA 1Y81A 2W2LD 2AG5A 5FI3A 4BNKA 1BXGB 3WGIA 4D45A 1E3WA 3ZNOA 1DC6A 1KYQA 3D4PA 1HE3A 3QHAA 2CMDA 1GUYA 4DPMA 4Y9DA 4BB6A 3Q2KA 2WMDA 2AQ8A 3PHJA 4KDFA 1XHLA 1E7WA 3K5PA 4I9UA 5LCXA 4BNUA 2A35A 3DONA 1MA0A 2I66A 5A1TA 1BXKA 5JMPA 1T25A 3P2YA 1DEHA 1U5AA 4FFLA 1QV6A 2VHXA 4UEOA 4XIJA 1I32A 5EPOA 4JP3A 4WJZA 4E5NA 2Q50A 1JKFA 1Z82A 2VTEA 3QLJA 4ZHSA 1K3TA 1HRDA 1YDWA 1EZ4A 4Y98A 4O5OA 2EEZA 2Y0DA 1PWXA 1WMBA 2B35A 2J5KA 5IZ4A 1BRMA 4GWGA 1GD1O 4L73A 3VTFA 1Q7BA 3H9EO 2X1HA 2UV8A 4J91A 4I5FA 1H6BA 1C1XB 5H82A 2C2YA 3OQBA 4OXYA 4IPTA 2X22A 4Y6SA 3S2EA 1PGQA 2I3GA 3ZH2A 4DTIA 7ADHA 1LSJA 1TEHA 2VWHA 1DRUA 3GLQA 1ZSNA 4N54A 3ANNA 2V65A 4CQMD 3N7UA 2FZWA 1E1NA 4D3FA 1GV0A 3C7CB 5G0UA 5ILOA 1LTHR 1U1IA 5JY6A 3OMLA 3ZU4A 2NLOA 1J6UA 3CZRA 4NZ9A 2IYOA 1PGOA 4CLDA 1D4FA 4PVDA 3Q6IA 4XCVA 1LSSA 3BIOA 3ZHBA 4HUJA 4NIMA 3G0OA 4EDFA 5CEJA 1FDVA 4BNTA 5BSGA 5COQA 4PG6A 3FTPA 1GZ3A 4DC1A 3WNQA 4J1SA 1A27A 1HE4A 1TT7A 1K6JA 4U0JA 5BNTA 3DOJA 4WKGA 4NMHA 4BKOA 2NVBA 3C7DB 4J2HA 3GEDA 4BO1A 5FI5A 5L4NA 1ULUA 3NEPX 3GZ4A 4CR7A 5TF4A 2X6TA 3OM9A 2PD4A 4MIEA 4E2ZA 3KHUA 5C5IA 4JBHA 1QV7A 2WD7B 2HKIA 1YOVA 1LRJA 3O8QA 5HWSA 4ND1A 5IDWA 1DLIA 3DOOA 2POQX 4QECA 3DAGA 2A9FA 3HB5X 4BGEA 1EVIA 4O1MA 5TQVA 4HWKA 4P4NA 1A7AA 4IQGA 3L4BA 3PYXA 1K5HA 3K6JA 4CM9D 3TJRA 4FC7A 1ISIA 5HA5A 4EUHA 4ZGWA 2Q2VA 4BMVA 3Q11A 4BNFA 2HJSA 2JHGA 3GOHA 4CLXA 3P7MA 3L4BC 3KYDA 1FDWA 3I5MA 2O3UA 2XXJA 4YT8A 2GZ1A 3GH3A 1B8VA 4IZIA 1FDTA 4A2CA 1NX6A 3GPDG 1AHIA 4FJ2A 2PD3A 3F5QA 4U0KA 5G0TA 5DCWA 3V1TC 5A9SA 1TB4A 3GNSA 4XD2A 4K6CA 1IB6A 1S7CA 2NQ8A 3ZWPA 5DNAA 3JQ7A 5I9LA 2OP1A 1IYZA 4OKIA 5DULA 1E7YA 4LVCA 3RUEA 3LC1O 4J1QA 1E77A 1T26A 1VKNA 1N5DA 1D1SA 4YJDA 2UUPA 3FPLA 4O6VA 2FSSA 2YHIB 1YE3A 3DZKA 1DHRA 3IP1A 5ICMA 3TL3A 4WCFB 1SNYA 1Q0QA 1Z7BA 1CEQA 2O3QA 1DB3A 3PQEA 3ZWNA 4P4LA 2YQ4A 4II2A 4BO2A 5L95A 4KOAA 3E5RA 3INRA 5ILGA 5T8KC 1LRLA 4X54A 2P68A 5ER6A 3NJ4A 4MVJM 1TT5A 3MWDB 4IGEA 4RLHA 1FF9A 4RQUA 5CDGA 4QXMA 4PLFA 1A4IA 3MJ4A 4FOOA 4BB5A 2DU8A 2QG4A 3COSA 1YB4A 3L9WA 3M2PA 3MTGA 3JQ8A 3W1VA 3BTUA 3CEAA 1BVRA 1EBUA 3MCVA 1BW9B 4OMUA 1JQBA 4CLOB 1DFHA 2HCTA 4JX8A 4XIYA 4DPLA 4EYEA 1JTVA 1P0FA 1WW8A 3KEOA 3W4JA 1BSVA 3EY4A 1KOLA 1BTOA 2PTGA 4J3FA 4XRGA 4MP8A 4CR6A 1WDMA 1O6ZA 1R4MA 1OMOA 2ZKLA 4NI5A 1J5PA 1ZK1A 2RCYA 4BO8A 1HL3A 5AVOA 3L4SO 3DBVO 1NFQA 3CZMA 3JQGB 3U4CA 4BO3A 3GA0A 1LJ8A 2O7QA 4KUHA 1O9BA 4IBOA 2X23A 4LRTB 1TA4A 4KWIA 3ICPA 1NPYA 2IZ1A 2B36A 3VH2A 4NR0A 4BNJA 1HE2A 4MVJP 5THQA 1W8DA 4I5GA 3UXYA 5JYEA 4YYZA 4YJHA 2ZYDA 3NAQA 5MGBA 4ZQFA 3DTTA 2VUTA 3PGXA 5TS3A 1IPEA 1IPFA 1JW9B 3AUUA 1BDMA 2O3SA 2OMEA 3F5SA 3HDHA 3JSAA 5ENDA 5L9AA 5I7FA 4WLFA 2ZYGA 1IHXA 4B8ZA 1DDOA 2JHFA 3CE6A 5JC8A 2HK7A 1X15A 4CM4B 4YAJA 1EFLA 1NFFA 2F00A 2YFQA 3HFSA 3V1YA 1GDHA 5JCXA 3E9QA 2I3AA 2RH4A 1H6CA 1Y7TA 1WAMA 1JKJA 2WYUA 2YDYA 3NDJA 3UCFA 1WDKA 1PJBA 1V0JA 4Q9NA 3AK4A 4J16A 5T64A 1NM5A 4IJKA 3JTMA 2J5RA 1RM3A 4IJVA 4YWJA 3F3SA 3ABIA 2H6EA 5I7SA 1ISMA 5JYDA 1B7GO 5L3ZA 3EAGA 1TI7A 2J3JA 4R9RA 3ZWOA 5JO0A 2X0JA 3IJPA 1IY8A 3OA0A 1DJQA 4NJMA 4OAQA 3BMCA 3NYWA 1B8PA 1L7DA 1ZKMA 3JD2A 2YYYA 1AGNA 1LDYA 2GZ3A 3ROKA 2W2KA 3PDJA 3TDKA 1F8FA 1NFRA 2AMFA 1I01A 3WNVA 3VPSA 3FR8A 3Q9NA 3ICCA 4FOSA 4BVAA 3PHIA 1NVMB 1GUFA 1GR0A 4BKUA 3PK0A 2B4QA 3ETDA 2GN8A 2V7PA 3DHYA 1Q1NA 2NWQA 1HT0A 4PLHA 1E6EA 5EJ2A 1VPDA 1Y1PA 3QE3A 2YQ5A 3P2OA 3HSKA 1N9GB 1QR6A 4P8RA 3LK7A 3WBBA 4JN6B 3PXXA 3QWBA 2GF2A 5G4KB 2Q1UA 5JXWA 2X9NA 3HN2A 2JKVA 2O7SA 4N5NA 2DBRA 3WJ7A 1AN9A 3X2EA 5COAA 1KIFA 2DFVA 3WX0A 3RUFA 4NBRA 4UVHA 2WEKA 1NASA 2F1KA 2FY8A 3L6EA 4XYGA 4HXYA 4I8XA 1V8BA 2RH8A 2C2XA 1J0XO 3IL2A 3WBFA 2WYVA 4PLZA 2I76A 1UXKA 1M67A 1VL0A 3K2EA 3W8DA 4IS3A 1WWKA 1C3VA 4DWVA 1SCUA 4UVIA 3DWFA 9LDBA 3ZWAA 1DHTA 4HFMA 2HRZA 1EDOA 4BO7A 3RKRA 3TOZA 4BNVA 2ZB7A 1W4ZA 4G81A 1P9LA 3HNPA 3EZLA 2AW5A 3INTA 5F1OA 1E3WB 2YV1A 2P4QA 1Q7GA 2X8LA 4LVUA 3VDQA 4WCDA 1K0UA 5L7TA 2JFHA 3GDGA 4OO3A 6ADHA 2CNBA 2X9GA 1NQTA 3U9LA 4GSKA 1J49A 3INGA 5ENVA 3KZVA 3C1TA 1O95A 3DC2A 3EK2A 2D1YA 3ENKA 5HBRA 2BI8A 3N58A 3A06A 5DBFA 3KSZO 5KVQA 3D4NA 4DBVO 1EFKA 5JDCA 4BNMA 2NTVA 4II3A 3OIGA 2HMVA 4G5HA 5IFLA 1NWHA 4YDRA 3TRIA 1YH3A 2O3RA 3ITKA 3PJFA 3ZNNA 3ZZNA 1E3IA 3S2IA 2X5KO 1BDBA 4GMGA 4OOFA 3M1LA 3ZN2A 4E2YA 5IG2A 5L7WA 1T24A 4W82A 1DFIA 1UAGA 2VUSA 2NU9A 1NPTO 3AY7A 1GZ6A 1E5LA 4QFDA 2P9EA 2DUWA 1VJ0A 4ALKA 3H5RA 5IDQA 2BELA 4K1LA 4U6QA 3TWOA 4UUOA 4B79A 3KVOA 3TN7A 4YAIA 1U3WA 2HQ1A 2R6JA 4J7CA 1UH5A 4W4TA 1PR3A 4FFRA 4R1UA 3DBHB 3SLKA 4NU5A 4D3DA 4E5MA 3R6DA 3RC7A 2DTDA 2Q46A 2Y1CA 2Y0EA 1WZIA 4HV4A 4XZ3A 3IKVA 4NBWA 4EW6A 1WXDA 2E49A 7MDHA 2VN8A 4BGIA 2X7HA 2YJZA 2FR0A 3CTMA 4AJIA 3IAHA 3B1JA 1SB8A 2JCYA 1JAXA 3ENNA 2DM6A 1R15A 2G17A 1QYDA 1AHHA 5LDHA 4K6FA 2NU7A 3IIEA 4CM7A 3D64A 4P38A 2HJRA 2AEMA 3PQFA 2VYND 4MVJA 2Z1NA 5A05A 2HDHA 1NBOA 1QP8A 3ZCXA 1T2CA 3F9IA 4KWHA 1PJ4A 2C7GA 4I5EA 1Z74A 2Y67A 2WM3A 3T4XA 2FSVA 4Z6KA 3F46A 1RPNA 3RI3A 4QTZA 1MX3A 3ST7A 2NNLD 3PQDA 4LISA 4DLLA 2BH9A 3PZRA 3CIFA 4R1NA 4DIBA 1H6AA 3ETGA 1T4DA 4FQ8A 4E33A 2NVUA 4XQGA 3WWZA 3ZWMA 1HTBA 3LF1A 4DLAA 2RBEA 2VWPA 1I5RA 4A26A 2X5JO 4QUKA 1PJTA 1X7HA 1MXHA 1PGNA 1VJTA 3MJTA 4MKXA 4ZJUA 4RDIA 5EQDA 2XPCA 3DB2A 4CUKA 2HUNA 3PHLA 4ND3A 2PGJA 2PD6A 3GF4A 3V1UA 4IDFA 4FJ0A 3OH8A 4XKJA 1YOVB 4GGPA 3E6AA 3DFZA 1LQUA 1C0KA 3ASUA 4N5MA 3TF5A 2EF1A 3GDOA 3WGZA 1YQDA 3ITDA 4NHEA 1ULSA 2OBYA 2OP0A 3DAPA 1WVGA 4LMPA 4E21A 1OBFO 4OSPA 1PZEA 4F46A 3I9KA 1CJCA 4BNYA 3KYDB 3GGOA 3DZHA 3H65A 2WE8A 3RBXA 2Y1OA 4YR9A 5A03A 5ITVA 3NV9A 5BSHA 3PWZA 5A3JA 1YDEA 2DAPA 2IZZA 3I6QA 1EE9A 2Y1DA 4KTVE 4H7PA 5H81A 4IZHA 4ALLA 4D41A 4KUEA 3WQRA 5A9SB 3OF2A 4NFYA 2B5WA 2DVMA 1QRRA 3JQ7B 1SOWA 2FR1A 1JU9A 4WLUA 1OOEA 2Y0CA 2QX7A 2GRAA 2NTNA 1G0NA 4J43A 3LDHA 3FNHA 5L7YA 2JCVA 4DMMA 3PJDA 5IDYA 5TC4A 4RZIA 3I1JA 3NT2A 1XWFA 2VNAA 4PRKA 4B3IA 4JK3A 3SC4A 3ORFA 2GPTA 4L76A 2RHRA 2ZB3A 5FFFA 4TVOA 2JAHA 4IS2A 3DZJA 4CM1A 4E3ZA 2J8ZA 3AI2A 1F8GA 4DBZA 2Q4EA 2R00A 2J3HA 1GL3A 1KS9A 1QSGA 1GYQA 2H5LA 1TT5B 4KMSA 2YHUA 3V8BA 4AVYA 4NNJA 1XCBA 4TWRA 5EERA 3CXRA 4XB2A 2R00C 3PGJA 3RUIA 4H15A 3D0OA 5DT9A 5LDGA 3M2TA 3AOGA 4E32A 2CUKA 3JQ8B 4RQTA 1GUZA 1YXMA 2QRJA 3CMCO 4WNCA 3WLEA 4R01A 3QWIA 1LDBA 1GV1A 2RHCA 4YRDA 3ZHXA 4YEDA 1L7EA 2VYVA 1DIRA 3SC6A 4B4VA 5KJEA 1V3TA 1I30A 4CM5A 5EMHA 2BGMA 4OKNA 4D46A 2EKPA 1IZ0A 3S55A 1VKOA 4YQYA 2J3KA
chains in the Genus database with same CATH superfamily
1JVBA 4KIUA 3VZPA 2CNWA 4LYGA 3QI2A 3GJ3A 3KB1A 3M82A 3OJLA 5D86A 3F2VA 5HGXA 2QZZA 5LC1A 5TEVA 2DPLA 1XL0A 2GNAA 3ZZNA 1D8AA 1U2GA 1W88A 2XECA 2RGRA 2O19A 1DAEA 4YBRA 3ZQ4A 3D4LA 4EGFA 1KMQA 1CU1A 2FVXA 1IMOA 2G76A 2G9ZA 2C5AA 3COWA 4MJLA 2W00A 4LMAA 1L5NA 3EVBA 1P5FA 1NP3A 1IOZA 2VHEA 2VT2A 1MV8A 2Z2IA 5LXTF 1RJ9B 4K6OA 3AM4A 1Q21A 3N2EA 1ZP6A 1FTYA 3VR3A 1Y3IA 2I4NA 4YJHB 5CA1A 4CCYB 2IDJA 2CYCA 3F7MA 1IOWA 2JD1A 3S1LA 4CNQA 1SUSA 2JW5A 4RF5A 4EF4A 3LT1A 3BIXA 4BX8A 1TJ5A 5A06A 3CT4A 1IPHA 4M4SA 5KAPA 1ENPA 2XHEA 2LIPA 4G5SA 1U8EA 2JFBA 4PNZA 4XQEA 4AN4A 3UH0A 2XTJA 3R4CA 3ID6C 2IHYA 3EGVA 3LOQA 1DWOA 2EIXA 3LU1A 5JQGF 1T9KA 3CLVA 2Z4TA 1EUCA 4NJOA 4PLGA 4QYSA 5EIXA 4RPKA 1GQRA 1SUEA 1K7SN 1NIPA 5HEKA 4LF7B 3HNRA 3B1ZA 3RUDA 1DUIA 5GJBA 3PE3A 2I2WA 3HA5A 4LHEA 3EVZA 4NE2A 4YPOA 4MP3A 3I5UA 2JGIA 4XUGB 3BGDA 3VR4H 4PWYA 2G9UA 3UQZA 1PJLA 4G8DA 2ZRBA 1ISFA 2PH5A 1TO2E 2A94A 3EODA 3MJCA 3L1IA 3STVA 3ABQB 4QPCA 4X7MA 3CUKA 1VB3A 5EPEA 1JDBC 1G7TA 3GA7A 4EKGA 4JEHA 1YKFA 4Z2YA 5J3JA 4P35A 3IUEA 4HEJA 1QH9A 1VE9A 2YJ6A 5FBWB 1NAHA 3FJOA 5BN5A 4ZRDA 2XF8A 4E4YA 4JUIA 1VLLA 3BF7A 1VSTA 1Z56C 1I7QB 4QT4A 1P5ZB 1R8QA 2W8BB 4ND6A 4YDSA 1H5QA 1I51A 5DFAA 3FMOB 4MQEA 1ADFA 2CVPA 1L9XA 2QG6A 2FRXA 3QP9A 4DC9A 4KFTA 3H75A 5J23A 5JZOA 2QORA 4IQ0A 2WTUA 5DSTA 4L8YA 3I05A 3BWYA 3O2QB 1UINA 2FG5A 3D1LA 3IP3A 5D3MA 2IV3A 3G8AA 4HF7A 3RROA 2ZJ1A 5FKJA 1BKYA 3U7EB 4AO6A 4ZYXA 1QO9A 4R41A 3MS2A 1TDJA 4JLMA 4AG3A 4F3KA 1RYMA 2GK6A 2W2XA 4IIYA 5JAZA 2C54A 3WGNA 4AP5A 3T15A 3CVWA 4QUAA 3TSCA 2TMDA 3T54A 1PG0A 3RTAA 3VR6A 2A9VA 3S0JA 5B37A 3NHYA 4OGGA 1L1RA 3ZJYA 3FNGA 3KAQA 4JJGA 4MWBA 4PV7A 4F5DA 1FTNA 5HTOA 2ODQA 2Q7OE 3FTQA 2OXTA 3OIWA 2VRBA 3QLUC 1L5FA 2ERYA 3AC0A 3MUOA 3HH8A 1M54A 2PWPA 1EX6A 3VC2A 2B61A 1U90A 5GM1A 5KTKA 2QV7A 3A2LA 2H2IA 1J2RA 1ZD9A 3G7UA 5HM8A 1Z39A 2XYHA 3SSNA 4J4BA 2G40A 4MW0A 3K1TA 5JYCA 4YRTA 1NW7A 3AV3A 4I9GA 1E9FA 2E48A 2JH9A 3BTOA 3DF9A 2FVYA 4BFXA 5FR1A 2B0CA 1LLDA 1YQXA 2VR1A 2AG6A 3LT5A 3JAMA 1UAAA 2LP4Y 5JRDS 2F3QA 3VC7A 3KB2A 1JAIA 2ZK7A 1QCYA 4LS3A 4UEQA 5HR5A 2HW8A 4JYBA 1G6OA 1IAQA 3HA3A 4I4TF 5JJBA 3Q3VA 3FOZA 1WHSB 3I83A 5EP1A 4NCKA 4OQEA 1JYEA 1G7RA 2CLCX 3IYLW 1QORA 1K3UB 4NBLA 3SNHA 1VHWA 4GAEA 4RACA 4MRNA 1VLJA 3WV4A 1P74A 4WKBA 1PBTA 3M5PA 3W90A 4CM3A 2Z5GA 4Y6GB 5LOVF 3FMIA 2SCUA 1JDTA 1KK1A 4Q48A 2XZLA 2VNJA 3E35A 1HZZA 2PSHA 1UEIA 4L9AA 4ZEXA 2QMUA 2XDYA 1BVYF 1KSFX 1QP0A 2H7YA 2BDEA 3DVQX 5H3CA 1DXOA 1VL2A 2BEVA 1DCTA 2OGTA 4QM7A 3HP1A 4HS4A 3FPHA 2EYUA 3TDNA 3T3MB 1VPEA 2I9KA 5TVKA 1GPYA 2P9YA 4CEJA 5REQB 2Z1DA 4JJFA 4R3NA 5H59A 2AFHE 3CN9A 2BVNA 4UDOA 1JAYA 1LS6A 4Q4CA 4XLLA 4V2UA 1PYDA 1U94A 2ODPA 3NM5A 1TEVA 1HL7A 3WGVA 3LLUA 3ZW9A 1ECGA 1ZN2A 1VJ1A 3DMDA 4JLDA 1PQPA 2E0IA 1K89A 3OT1B 1UUFA 4YCDA 3ZQJA 3M6UA 1H8EA 2AN3A 2GBGA 1NVAA 4LZNA 1MG0A 2IS1A 5DWQA 3E23A 1GVHA 3TI7A 2DTXA 1XK6A 1WDLA 5IC6A 2QDXA 1UOOA 4B33A 3BREA 3VDXA 2ANCA 2P1DA 3QPWA 3QFSA 4P5PA 2QSUA 1NZFA 2NT4A 1N8KA 5A4KA 1HDRA 5EWJA 3G68A 2IOYA 4CXMA 1OD6A 3FPKA 2HA5A 1U2PA 3GMTA 2C9YA 2GN6A 4OH1A 1NP6A 3AT1A 4LN1A 4WAUA 2OZVA 5T4BA 2W7TA 1GZSA 4UVEA 3U4QA 4D5EA 3WGGA 2WU1A 3X2SA 1LD3A 3OIFA 3GN1A 3PL5A 4YMUA 3ZPXA 1TYDE 5AK3A 3KLNA 3THRA 3VXKA 2GD0A 1JEJA 1I4WA 5FFNA 1QFMA 3LKBA 2HO4A 4K88A 4KO8A 4DC0A 3G2OA 2HV8A 1P2BA 4UNSA 2BMVA 1CNEA 2GNOA 1USIA 3CF4A 1D5CA 3T7JA 1JN0A 3HE3A 3R76A 4DMCA 1KMNA 1ORIA 2I7CA 4W9RA 1P9WA 5JDIC 1H3EA 3INYA 3OA2A 1B15A 3DNPA 1XTVA 5T5QA 4BNLA 4DMLA 1ZAYA 1I7LA 2GHQA 1I2AA 3RARA 3RADC 5DBIA 3WGOA 3PI7A 4L4ZA 3VPCA 3WK8A 3C4VA 1U7ZA 3SKVA 2ZVDA 1OAAA 1YNOA 2K4MA 1WVIA 2PZMA 3JQ9A 3PVZA 4UREA 4BUZA 5AW4A 1GUAA 4ZDJA 3VJKA 3P9ZA 1HG0A 1EE1A 3NBAA 3N2KA 1EJ0A 1EK1A 1KQFA 2I1VB 4DGQA 5A5DA 4NABA 2HMAA 4LGCA 2FEXA 2WSIA 1Y1QA 2WA1A 2C4MA 3RAPR 3HTXA 1G8MA 1Q1ZA 1TPZA 2QW1A 4HTFB 1FP1D 2D7DA 2UUCB 1ZNQO 3V42A 5KOYA 4JB2A 4O4HF 5LIPA 1XMQB 1E9BA 1Z25A 1TEZA 1VBNA 5JXJA 3OCXA 5ALDA 3DP7A 1SEVA 1GL9B 4EZBA 5B7NA 1M1YA 3MLEA 3PKZA 3F4LA 4QC2A 4R2IA 5BORA 5JFTA 1F8XA 1ZG3A 1QZXA 5IYZF 1UXIA 2A1UB 1YS7A 3WIDA 2XJ4A 1XZHA 4QO7A 2HSEA 2QD3A 5IZCA 5HCUA 4GGMX 3FKJA 3HCRA 4A36A 2ZSUA 5AR1A 3RABA 1BXRB 2GT1A 4UCWA 4AJOA 3EOAI 2FV8A 3DEYX 4FOLA 3WVNA 5JAUA 5BV7A 1D6JA 3RWOA 5HDQA 1NMEA 4L51A 4KW7A 2ZJ7A 2XUKA 2J41A 1PLKA 3FMVA 4AD8A 4TOIA 4B35A 1BWSA 1FFDA 1NQXA 3QE9Y 3PC7A 3F6EX 1EU1A 1JTEA 1ZC3A 4RHEA 5CCBA 3WP0A 1RYFA 1P45A 1CF9A 1ZCZA 4KK4A 1I14A 2IIVA 1HT2E 2WQ7A 2GPWA 5CW1A 1UZUA 4UTZA 3QX8A 1NXTA 4QDTA 3D8TA 3DB1A 4LHZA 4M9SA 3DUFA 2IXAA 1ID1A 1N3LA 2IP4A 4RCYA 3AVWA 1QE5A 4AI6A 1HDZA 1NJSA 4MZXA 2WFLB 5C81A 3CH7A 4WZBE 3JWGA 1XNQB 3IKJA 5I51A 5CYFA 2EZUA 4OQYA 2PH3A 3AP2A 3FFBA 3HC7A 2W70A 3IR7A 5DLQC 3VX3A 4J6EA 2BD0A 4TQ9A 3DKVA 3T3IA 1O9GA 1VL6A 3Q9LA 4FZVA 3QKIA 4YJ2F 1THMA 5GOZA 4AECA 4J16C 5I5GA 3U3JA 2IS6A 4WK0B 4ALIA 3LS2A 2YY6A 1N75A 1GRNA 4CL2A 4ZVPA 4DJAA 1KZYC 2B1GA 2E4UA 1M72A 2OV1A 3ZVNA 4C03A 3EGOA 3FGZA 3C74A 4ASUA 4DPKA 1VCNA 3AHJA 5KJCA 3K20A 4CT0A 1JIIA 1U8FO 2V4MA 2H63A 4FE7A 1KJWA 3DVAA 4G36A 3C5HA 1M2KA 4MYSA 2EGGA 3SIPA 3TXAA 2B9VA 2VP0A 3T12A 2PMCA 4IDGA 3I1FA 1R0LA 4RFVA 4ND4A 4WI1A 1T5LA 4OOEA 4JI1B 4S2UA 3LQRA 4OIFA 3T3HA 3WC4A 4I2VA 1M1XB 2EVWX 2WJVA 2INGX 3IQFA 2D1TA 1VIDA 3M33A 2AV6A 1X77A 3P97A 1IN8A 2PBLA 4DNQA 1QOPB 4AWBA 2ETXA 3BWXA 4WPGA 4Y1EA 4Z3DA 5FX2A 3TZEA 1J8FA 1WSBA 3MC1A 2NUPB 4FOTA 5ETJA 2DKNA 3U7RA 2EJCA 1ADJA 5G1OA 2P5YA 4OHFA 3RRFA 1F0KA 1C5KA 4C0JA 3DXFA 4MMYB 1YS1X 1RYZA 2GZDA 3NIDB 4B3RB 4R84A 1C4WA 3JX9A 3RK0A 4AUEA 2GD6A 3HG7A 2GPBA 1CY4A 4Y18A 1AZWA 1ISSA 1TQ4A 3OLQA 1PL6A 4MV6A 4OP1A 5FL3A 3ANSA 2ATXA 1GPKA 4O4LF 2LPMA 3O91A 2RH5A 4CM8B 5KU1A 2HCFA 4LXGA 4XWYA 2IKQA 4UVDA 1EHIA 5U4QA 3MWKA 4AZ0B 2C29D 3CY6A 3W5SA 3D7KA 4N3CA 2F43B 1YFJA 4WH0A 2V6FA 3OBBA 1SVKA 1O5TA 2JCGA 2OBLA 2UUOA 1K4MA 3V34A 1BQEA 4NK4A 4YI5A 5K03A 1IIRA 4Y2TA 3G89A 1CIJA 1J1ZA 2Q5OA 3W9SA 4X64B 4AS3A 2B21A 1HYGA 1VG8A 2RKOA 3ZHOA 2J9ZB 5A3QA 4G24A 2EX4A 2IL1A 2MR5A 3QVWA 5EYPA 4QRHA 4JC4A 4U9UA 2WWYA 1QG2A 3HEMA 4UBIA 2E7ZA 1RQNA 2D0IA 4BKQA 3T5AA 3DA8A 3HK2A 1EIWA 2VYQA 4NPHA 4WW0A 1KEKA 3C87A 1E61A 3D8BA 3QYPA 1S1CA 4OCZA 2Q3EA 4R3WA 2FF5A 3GG9A 1C0IA 1ZJZA 2G83A 3R9XB 5JAQA 3A6JA 1SUFA 2C88A 5FBVB 2VNIA 1C9MA 3AKEA 3RS7A 4QXRA 2PSSA 3RKUA 2D0OB 1O4VA 1JHRA 2QRNA 5I47A 1W49A 5CIYA 5J2UB 1VE3A 2RHOA 3ZU3A 4RJJA 4QGSA 4A0SA 4AL4A 4BAZA 2ZWVA 5KYXB 4YQEA 4CKBA 3QVJA 1WPRA 3DDZX 3I6YA 2BFAA 3HKDA 4F84A 4DJFC 4DSAA 1NQ5A 4J7XA 1JXMA 1FNMA 4IGFA 4F3CA 2Z95A 2F1RA 4DV4B 4KGZA 5IABA 5CHEA 2XADA 1L5VA 3O7WA 4BRSA 1NW9B 2HDNB 5HXAA 3Q9UA 3SIRA 3H8VA 4CQJA 4BFWA 1PS0A 4UTVA 3K0HA 1JKXA 4C05A 2ID4A 4NS4A 1SFRA 2O2ZA 1WL8A 3O31A 1REQA 3GZNB 4KUGA 1QJCA 4ESOA 2GAFA 4DWOA 1AMOA 3TIGA 4A8TA 3VYSB 1T2UA 4EHBA 1K7EB 4HGYA 1ZGZA 3PHCA 3ZH9B 1ZJWA 3I5AA 4R68A 1S4MA 2P3OA 1TU4A 5SYMA 4RTOA 4Q3OA 2CVQA 4R6WA 2VPPA 3HUTA 4U9HS 5DM0A 3IDFA 4U2DA 1C14A 2YV3A 5AOCA 4RNDB 3OFKA 4P53A 5ELLA 4W1RA 4I1PA 3LKDA 3ZIAD 4M1QA 3FAKA 3HDQA 4NMXB 4BUCA 2Q4DA 3B3AA 2H65A 3IAM1 4DCTA 3KQKA 1K88A 1LH0A 2B25A 3AY6A 4XQCA 1QB8A 2WNHA 4RGBA 2JVIA 4OUDB 4RGVA 1TLLA 2JC3A 4IJ5A 1WPQA 1LBHA 1AH2A 2W8ZA 2YASA 3VZQA 1ECJA 3WICA 1X1AA 5IKOA 4Q7QA 5DM2A 2WMOB 1A9XB 1PFYA 5E38A 3VYRB 1AB6A 2J9GA 3BDVA 3ASYA 3T5MA 4JDUA 1WVMA 3OJCA 2RJOA 2WHEA 1VL5A 4NBVA 2JS7A 1KAMA 1Y8QA 3TFOA 5B3JA 4XASA 5HPYB 4N7JA 3VYUB 3PNMA 2CMGA 4ZN6A 1XXHB 2YVQA 3IHLA 2PGXA 3ZQUA 4X8HA 3UAVA 2OE2A 4RLSA 2QRKA 2ZRGA 4ZPXA 4TL7A 3WQSB 5CG2A 5CLHA 1JPUA 5I9MA 5E4FA 5BW6B 4AJJA 3QE4A 1SXJC 3UFXA 1L4EA 2XKKA 1V11B 3QHPA 2R7LA 1JMKC 4GE3A 4NDNE 3B3QA 3PQCA 5F1KA 4JI7B 4IH9A 2A4MA 4BO6A 1E8DA 1JXAA 1DAGA 5CH5A 5KSZA 2QUJA 4LUCA 1C8KA 3PXDA 1XHFA 2HC9A 3A14A 3L7BA 4GSYA 4AQDA 3RUHA 2O50A 2PX5A 5ICEA 3QSGA 5A6SB 1NR7A 3A7DA 3L8YA 3N2ZB 3QVUA 1RKVA 5HF8A 4E88A 1O96B 3QIAA 4NG4A 4R1TA 4FNMA 3R7DA 1PWZA 4Y30A 5B55A 1GAJA 1G9SA 2EP5A 5I4BA 4NMMA 3BBPA 1SN7A 4X93A 1HT3A 4CV2A 3RSSA 4PN7A 3VH1A 4Q01A 4BKRA 2CF6A 1JFLA 2NZ2A 4FFSA 2WY2D 4BQOA 4DM3A 4PXAA 3W2GA 5AIBA 3FNEA 3T1TA 4YRRA 3BMQB 4R2JA 5GVRA 5EZYF 1GQSA 1MB9A 3J81A 3EPLA 5HCIA 5C37A 4BWYA 2HNBA 1UBLS 5AO9A 1T4CB 1TGYA 3U40A 2F9MA 2L69A 2ZWMA 4WFJA 2OT3B 5DP2A 3I0NA 1MOSA 1P3DA 5EQJB 2V7GA 1ULTA 1V4VA 3CLSD 1KE2A 2WD9A 1NP7A 2ATCA 4LKRA 5DBOA 3RTEA 2G8LA 2OV3A 2VJNA 3KSDO 1J2UA 5EIOA 3EGXA 3L82B 2I2BA 4XDGA 1RJEA 4DCSA 1DAMA 3DDCA 3TB4A 3CVYA 1D0IA 1W9HA 2QE7A 3AG5A 3D81A 2VPWA 1SIWA 3E7DA 3I4LA 1J4AA 1T2AA 3ISJA 1JDJA 3NKLA 3OP4A 3VKVA 1QLWA 1G4UR 1QXSA 2XMBA 2P6PA 1ZR2A 7REQA 4FB4A 4LDZA 1JSLA 2B2NA 2H4FA 1QRSA 4AICA 1KXZA 1Q95A 1QRDA 5EA2A 3MZ0A 4F4FA 1H0HA 1KFEB 5LZ7A 2FX3A 3QPAA 3MUEA 4LNUA 4P08A 1E92A 2JDID 2Y1EA 3A05A 3LW7A 4QYIB 3GLRA 5EIWA 2UYYA 4CMIB 3AF6A 1QGZA 5U9CA 4I3HA 2ZRFA 3IQDB 4KIGA 1ST3A 2XB2A 4MQLA 3PXUA 4TLDA 5AVSA 2V4UA 5COBA 1Z5GA 1VRWA 2GZAA 2VRWA 3IGFA 5AK5A 5LMUB 3T7IA 4YBZA 3OE7D 2JFPA 5D8DA 5LN1A 1U3TA 4PNEA 1EUQA 2QRGA 2PZFA 3E5MA 4H3HB 1CFZA 2HHCA 2IYAA 2HSWA 3DPSA 2ZQ5A 1QGUA 4RQBA 5IC4A 4YJ3B 2F17A 3EZYA 1UDRA 1AD2A 1VJGA 3GV0A 3MRVA 1QE0A 4TV9B 2GF9A 2HHAA 2AC7A 1YBFA 2XB6A 3HN6A 4R1PA 4C5AA 1GAWA 2XZTA 4D6YA 1BO6A 2VJCA 4XA8A 5AKHA 1KK2A 1MLDA 4K9SA 4A5SA 4BMOB 4BB9A 9LDTA 3CWQA 2BBWA 2BFCB 1FW6A 4CL8A 3MF4A 3QU9A 4UDNA 1PJ3A 4AQYB 2OCAA 1C8LA 5THXA 3UK2A 2FQWA 3KKZA 2W2TA 1P4JA 2OAGA 3A9VA 4FLFA 2XOEA 4QQRA 1XMXA 3PT9A 1WULS 1LBTA 4B6RA 1KP3A 2PJZA 1ZW1A 3QRWA 4QUGA 2GLTA 4L8VA 1GUDA 4K9LA 2HU2A 4HSEA 2A1TS 4GR5A 5F3RA 3GLKA 3ZJ5A 4E5UA 3EPKA 1MTZA 3I2FA 1JLLB 2PHZA 4EBBA 3RIGA 1JI3A 4HLUA 4LX0A 1NUPA 4UTXA 4REMA 3AVUA 5ELXA 4GH5A 1GNTA 1A04A 4FZ5A 2BFEB 2VT3A 2IEBA 4HPJB 2IXEA 4IRXA 3LLMA 1ZH6A 4MGHA 4HDSA 1A8PA 4X65B 4L8WB 1RLJA 3PYMA 2ZUUA 4RSGA 5LYYA 5DX1A 3BMOB 2XJ9A 1SGWA 2EXXA 2F59A 1ODJA 3LBAA 3DLAA 3S99A 1MAVA 4PHFA 1FSSA 4CLRB 3CGGA 6CHYA 1UXGA 3DHEA 2DBQA 2B8TA 5IDVA 1W4BA 3ZY2A 5IAJA 1A3CA 3IXLA 3MOIA 4G5OA 3RT7A 1CQJB 1J0CA 2QMYA 1M83A 2A14A 4GFDA 5CDUA 4QBIA 2G1KA 3FNRA 1P3JA 3O1JC 4CPDA 3EVAA 3IQXA 4LSGA 3U44A 1OFUA 3L4JA 2VK8A 3AYZB 3UMYA 2WP8J 5AVXA 3I4CA 4OQDA 4EPVA 4MRVA 4OA8A 4FMBB 5C18A 3PUYA 2I8CA 3ZWWA 3QZUA 1E9EA 5BUCA 3UA3A 3FCYA 3L84A 3RDPA 2BKXA 1BHSA 3LGXA 3Q7TA 1U3VA 4QDUA 3VPFA 1JBQA 5AXAA 4Z3KA 3FOBA 4LZAA 4QFCA 5H3HA 2XI4A 5HIKA 4NE7A 2HRRA 5FF9A 2FOIA 1IK6A 1JU4A 5KQMA 1VMKA 2C7QA 1XCGB 2WTNA 5EINA 1XNGA 2B7LA 3KUCA 5FP0A 3C3BA 5JBIA 2XDQA 4NV1A 5D51S 5EUCA 2I65A 4EECA 1JYSA 2IZ6A 1RHKA 3FOAA 4GMDA 4I1UA 2FYTA 1BOFA 1YB5A 5KU7A 2OGSA 2IOFA 1II0A 3X1XA 3ZWXA 4CIYA 4N41A 4ONEA 1V16B 4ZMSA 4UMEA 1EDZA 3FIUA 1R1DA 2Q4BA 1RE1A 4DR5B 3LNTA 3SVZA 5JALA 1R0KA 2PX4A 4CTNA 1Z8DA 3LK6A 4BX0A 1E3JA 2H31A 5AKJA 5AXBA 4U7FA 3L1JA 2HMWA 2ZIFA 5IJ0B 4FYXA 2ACVA 2GVDC 2B3TA 1MDBA 1SAYA 3F1KA 4BNNA 4MPJA 1H8ED 2Z4SA 1TC1A 4EUSA 4OB6A 1N1GA 2PMKA 1K6IA 1JA1A 5DHAA 3ESBA 5FL7A 4DQLA 1F6WA 1AGXA 2WINI 1UOEA 5DXJA 4FFPA 1M6NA 4OQFA 1X1TA 1J33A 1MFZA 3DE6X 1MN6A 3TK1A 4LF9B 1L7MA 3FYUB 3T1NA 3NANA 3PR2B 2WZQA 3C7AA 3O90A 4JQZA 3MTJA 4AW9A 4D9HA 4YLGA 3RK4A 3UZUA 2PFKA 4BN5A 5E1OA 3RSLA 1FQJA 2RHDA 3OM1A 1ZK2A 3RAFC 1DBSA 2CJWB 3HXQA 2HLDA 1P7YA 1S2OA 5AXCA 2ROQA 2HRBA 2UDPA 3F97A 3GMSA 2OZPA 3I58A 4X1KB 3U09A 3DBHA 1VI6A 3QU4A 1LV7A 2FWPA 1KDOA 4DLUA 2J0QA 3SXPA 1K1EA 3SVTA 1GKIA 1KMMA 3KPUA 3PXCX 4FP9A 3ROXA 3B1XA 2J08A 4F56A 1G18A 4BMSA 3FVVA 1AQLA 3QKRB 4V0SA 4RMHA 3IEMA 3HBFA 1JU3A 4G9EA 3HJFA 3ANLA 1RBZA 2DQYA 2RG1A 2RHTA 4FDVA 5LA6B 4LQDA 4FC6A 5KS2A 1B1CA 1GZHB 1KJ9A 1H9AA 2BF4A 3IJ5A 2OV2A 5TX7A 3Q8LA 1MJHA 2WTMA 3GY0A 3GD5A 3OCWA 1SO8A 3DTVA 2KE5A 2QD1A 4GI5A 4PZAA 1U63A 2UUBB 1F9EA 3VNVA 1Q0ZA 2O4UX 1PZHA 3D5EA 3MIIA 3OEED 2UVPB 2XLBA 1ORVA 3ND7A 2I9PA 4LX8A 4A0RA 2XT6A 2C83A 3RV4A 4EWLA 1HK7A 5F1PA 4X3PA 4FIZA 2V74B 1Q0UA 2AXQA 3IHWA 4NOMA 4XB1A 5AJTA 1QRAA 4CU2A 3IALA 4B3JA 4MB6A 3T7DA 2HBRA 5LM3A 2VHVA 2H1RA 4AF6A 2GNPA 4EUFA 5GTDA 2OV8A 3M81A 5K3AA 5KWJA 1G0OA 2ZGVA 5K45A 3SICE 4D3ZA 3ER6A 1KQNA 3LFUA 4FHEA 1Y5IA 4B0PA 3RIHA 3OKPA 4QJIA 4D79A 1ZFNA 3D0QA 1OKKA 1KYWA 2J0UA 4LPSA 4NEHB 1ZEJA 1BWRA 2ZDQA 1XAIA 4KDEA 1TM3E 3NWOA 3GR6A 1CUSA 4CLHA 4IUBS 2C84A 3WA7A 1HZZC 1YZUA 4IHJB 4CV0A 5JS8A 4UATA 3AVVA 1L5QA 3GUVA 3PP8A 1NBHA 1WCIB 2G67A 2JGNA 1DU4A 2COKA 2Q5IA 2VAPA 4Y3UA 5ENZA 3HCDA 4GBJA 1ZH2A 2CWDA 1AQYA 3OQPA 2Z58A 2WICA 1G42A 1POXA 1R4AA 1NXXA 1SCKA 3ONDA 1SU8A 3MINB 4G1FA 4GECA 4JELA 821PA 5JI2E 2ZYHA 5F9MA 1SC9A 2VTBA 3EIFA 3KTFA 3UMJA 4BVLA 3VQTA 4ALMA 5C4MA 3V4RA 3TW6A 2MTBA 5C32A 1DTEA 4GOLD 2XXAA 1FLAA 1LPNA 2Z04A 4JP2A 2XEDA 3G0DA 1G20B 2AKAB 5JT1A 4YJFB 3WLOA 2AOTB 2OXRA 2JIOA 3CR8A 3JQAB 5BUQA 3K4PA 2DBVO 4FS8A 1ADBA 1K66A 1XAHA 4WE3A 5EJ6A 3F8TA 4NZMA 4Q3AA 5AOAA 1B6TA 2ATEA 1J25A 2XCLA 3GLFE 4KPGA 1S6YA 3O3OB 1SBCA 5HE8A 2XAUA 1Y5NA 1Q0RA 1R6UA 3FHLA 3JQBA 1B93A 2ZT7A 1JWAB 3AU9A 4YCLA 1L7XA 5U1PA 5IT9A 3KU4A 4DYDA 1L3IA 4C7OA 2KS6A 3LG2A 1H85A 2I5PO 1TTQB 1DKQA 4EEXA 5KSWB 5K09A 1KKUA 2B8EA 4RTJA 1YIDA 4B75A 5DE3A 5EC8A 2PSFA 1YSCA 2WYWA 4UE6A 4FB5A 3QQPA 1GADO 4Z8XA 3A1NA 3MJRA 3K5HA 4GMHA 4LGYA 2CXPA 3UJHA 2O3TA 1X13A 3M5WA 1I8TA 5FCDA 4AMBA 2ZWIA 2FFJA 1UJBA 2GZHA 3D7NA 1D07A 3EXFB 1DX6A 4HAWA 2XGJA 4IYRA 5KAMA 5KOJA 3TRDA 4Q5IA 4BNWA 1YCHA 1OZAA 2LWIA 1DTSA 3AONB 2YWDA 4C43A 5LD2C 2G9QA 1LWNA 1MNAA 2GO1A 4FZJA 4ASUD 3KV1A 1WG8A 5AVZA 4HNVA 1XTPA 2DHQA 3K7EA 3PLRA 3DZCA 4GZ6A 4DUZB 2D3TA 2X0KA 3AZQA 2OKCA 1L4MA 3R40A 2VAWA 4LGVA 4U5QA 4NXNB 5T8KA 4MUBA 1C29B 1GNSA 5HJ7A 3R6GA 1P0QA 4PCAA 4QG7A 4JSYA 1VE1A 5CK5A 1HDOA 4PZYA 4R7TA 3IJRA 4ZAVA 4JUCA 3NX4A 3DL0A 4J03A 2EOAA 3HNOA 4KYIB 5A6VA 3PXGA 3C15C 1WR8A 3JQ9C 2OLJA 4TTTS 3ZY4A 2HLHA 2BBSA 2XUIA 2EJWA 3IBYA 1H1DA 1L7NA 3ILHA 5ALJA 5KX5A 4WKOA 3VKUA 3U37A 4IEEA 4PLWA 4DA4A 4H3KB 2VOEA 4G65A 3WB9A 3IUJA 1UK9A 1QLJA 1XZEA 1FDSA 3EE6A 2VUIB 4QYTA 1V5WA 4XR9A 5DM1A 4WOBA 1T0PA 5KYUB 4NCNA 2I22A 3F78A 5A3VA 2G5GX 2WJWA 3C8DA 3G6KA 4LVOA 2GCOA 2OCGA 4OAOA 5D3KA 5KOJB 1E3QA 5A4MS 3GFGA 4TZKA 1RIIA 3TTVA 3CUSA 1OBHA 3EF1A 3KAJA 1T43A 4LBYA 4BU1A 3AI7A 4MQMA 4UDXX 2BJWA 4AP9A 1Z68A 3T1OA 2FDCA 1FU8A 1SK9A 5F2EA 3JYLA 2DUMA 5K4HA 2FRDC 3Q10A 2W11A 2GGSA 3ND5A 5I9TA 3WHLA 4YCCA 3QEAZ 2YFKA 1ZHOA 4XJTA 4YAGA 5IZCC 2QDKA 1G5QA 1PQYA 4JLPA 4ZCIA 5IC5A 1DINA 3GT7A 4N3BA 3RHZA 1WZEA 3D6TB 4E5YA 2ACKA 4YRLA 4EYQA 5KC8A 4O0MA 2ZXUA 3HABA 1CZHA 1RI1A 3B6JA 3DAFA 2GBLA 1P44A 5EXSA 3UUWA 2WIJA 1U6IA 1NLFA 3K8ZA 5DTQA 2VXBA 4WXRA 3G2KA 4YGXB 5BT8A 2W0MA 2QD5A 1HDCA 5JLAA 1PFVA 1UBJS 1XF9A 3FLBA 4MS4B 1CHNA 2RHBA 5FI1B 1ND6A 2PEZA 1BX3A 1YFKA 1S7GA 2BJHA 3H2HA 3N39C 4IDPA 2OG1A 2P1ZA 2VDMB 2XQKA 4JNCA 1N2CE 1XVUA 4C30A 3REQA 4F60A 5HJ2A 2GK7A 1HO3A 2NTYC 5HOQA 3Q3GE 1NTOA 1S3IA 5ALGA 5ULLA 4EPYA 4M22A 1ECCA 3OTHA 2RFLA 5JZBA 5H02A 2M6LA 1N6LA 1NDQA 2RG7A 2H1FA 3KYCB 2O0JA 1L5ZA 1QZUA 3O6VA 1O95D 2QZPA 4I1RA 2WLSA 4JJKA 4M99A 4RF4A 1R74A 3MJSA 1TUBA 3WGJA 1ZS9A 4LSZA 2YJ5A 1FYVA 3IVCA 5EIHA 5KJ1A 1TKRA 3BL8A 2ZYUX 1AM4D 2PYDA 1XZIA 1X7XB 5JPDA 2R68A 1DQSA 3WIVA 4UJ3A 1P73A 3DVRX 4ICIA 3EMDA 1KVQA 4AZTA 4YCNA 1PT8A 1H0SA 2G07A 1EVKA 4ZV7A 3RIEA 3BYZA 6REQB 5FO0A 1YJXA 4H1HA 1V3QE 4OK3A 3RU9A 3GP5A 3F90A 5LZ2A 4BOYA 2D8AA 3VU9B 2CV2A 2A3RA 3FWKA 1L7BA 3GGPA 5CVEA 3Q3JB 1RAIA 5TJHA 5MGNA 3NVDA 4QU9A 4QGFA 4ZRMA 3EZNA 2WBLC 1AS2A 3EHEA 1VIMA 3FYTA 4OFXA 3JQCA 3TNDA 5AI8A 4Y9SA 2CBZA 1SCJA 3NHRA 2KMLA 1N5OX 2F1JA 3GLIB 4DIDA 1A4UA 2JF0A 2WIGA 3NTVA 3CPJB 4P32A 4Y1RA 3SZUA 5A4DA 4WK2B 2VDUE 2VS1A 2OL4A 1L5HA 1KI3A 3MM4A 4XD7A 3GJXC 4PX2A 1J8QA 1WQ3A 4HKTA 1ZSYA 3DBLB 1W0CA 3EVGA 3GYGA 4IKPA 4X7PA 3T3EA 1XVIA 1C1XA 3FM9A 4ZANA 2GFQA 4JBNA 1UJ5A 3ROMA 1DC4A 2F3SA 3HB7A 3GVPA 1CUXA 3I28A 1LEHA 2VBIA 1EX9A 1SZDA 3DD5A 3GG2A 3IKTA 1V48A 5IUKC 2ZTSA 1BH2A 4MKGA 4UUBA 3B6EA 4R2HA 1MIOB 5ES4B 3CB4A 1M75A 2X1VA 2X3UA 3IUPA 1N2HA 1XX6A 2G88A 2WT8A 3BILA 3EW7A 2WMNB 3ML1A 1DC3A 4G5FA 1KSGA 4LXQA 2P5TB 3U9SA 1SEPA 3C85A 3CSSA 2YS7A 3DLCA 4MVJG 3SDSA 1XFDA 3OTQA 4BNGA 1NVVR 4PCVA 5J9FA 5WRFA 3P2KA 4YV0A 2O5EA 2QAIA 5I5EA 1UK7A 4GD3Q 3B70A 1OASA 4Q9DA 1W94A 4BNXA 1FUIA 3H8WA 1AV6A 1USUA 3JARA 4QO8A 3JYHA 2MYNA 4GYYA 4TL6A 1Z2AA 1U0HC 3VVLA 1NNI1 3NIWA 4HQLA 1C50A 2HK8A 4M1OA 2C9MA 2HI0A 5GWXA 4ARAA 4QVGA 4RPGA 2X0RA 1RLIA 1CRQA 2VXYA 3PGA1 2QRUA 4K9MA 3TSAA 5ICSA 1QIJA 1VSUA 4MS3A 1KZ9A 3D1JA 4BJHB 2F3PA 4JEUA 1X1DA 4EHJA 5KUTA 3PFHA 2A86A 1XTRA 2F1OA 3F6YA 1SQSA 5FBRB 5AYVA 2ZIAA 4J0EA 1FNCA 3QGMA 4TMFA 1VCOA 2ZE8A 4B17A 3UH1A 5JAIA 2O8DA 4GKBA 4TKVB 2DETA 4MMZB 3WLRA 1NW8A 2ZSEA 4ID3A 4OFWA 3ZE1B 1FDIA 4JCOA 5A5VA 2YXDA 3FWYA 1B41A 5CAEA 2WD7A 3Q7EA 2G08A 1ZMTA 4O2BB 2QYSA 4K6MA 2P40A 4ZXFA 1C8BA 1NYLA 2GJ8A 3OZXA 3E7WA 5IWCA 4JJZA 2ZBUA 5KB3A 5ISMA 1OX6A 2GFIA 3ENZA 3UHPA 2QM3A 3CA8A 1I9GA 1SKYB 4PC7A 3Q3EA 4YMGA 2R3SA 2ZTHA 2VLIA 5AJWA 1ISGA 5E7IA 3LRPA 1YL5A 2KLBA 3EJ6A 3QUQA 2H8GA 4XYMA 4F9EA 1R5OA 3PNBA 4ZCSA 4L5BA 1DKPA 1PKXA 5M3BA 5REQA 2FUKA 5F9HA 2VQ3A 4YFYA 1V47A 1MZVA 3GUYA 4YAEA 5EJ8A 3K0AA 1HG1A 1ZM9A 3J81k 3C3JA 3N5KA 2PSDA 4DSZA 3K09A 5LLSA 1SHUX 4EHDA 2A9OA 4MDFA 1R66A 2QE7D 3NGLA 1BQ3A 4XSHA 3I53A 4MHOA 3HFGA 4G1MB 1EM6A 1W35A 4ZHQF 1DOAA 5HIMA 3N75A 1D2RA 4FFBB 1WCYA 4EA7A 4WNAA 2JRLA 3S1SA 1NKSA 3LX5A 2VQFB 1V8OA 2E4ZA 2QJTA 3B9RA 5EJMA 1T0JB 5DF1A 1OW3B 5L45A 1TYCA 1OF1A 3BWBA 2HIGA 4HDKB 4Q1DA 3RRNA 3T4PA 3D6HA 4MLCA 2VHCA 3QUBA 5HM6A 2JLCA 4M0LA 3SDZA 1I3LA 1VGRA 4FK8A 2Y1LA 1GLGA 1RPZA 5ALVA 2P4HX 3WFIA 1CIVA 2ZW9A 3K1YA 3H8JA 4BU0A 4PYRA 2FPMA 2XTAA 3GL9A 2Y77A 3JYOA 5A7HA 3I9MA 4PLYA 3AJ9A 2E6KA 4LHVA 4YXWD 3TLYA 1DBRA 2H00A 2ZFUA 3EUWA 4IJQA 2FDXA 4OGKA 2P8SA 4M76B 4RK6A 2FNAA 2NUAB 3WRYA 4LJRA 1WDTA 1CB7A 4QWWA 5C4GB 3HZRA 4YT4A 2CDAA 1AKUA 2B4YA 4MWGA 3DL2A 5FBKA 5I9BA 2GH1A 4R8SA 2GPSA 4BN0A 2NPFA 1FS5A 1YA4A 2VF7A 1TO6A 3A6EA 2AOUA 3JATB 4NFHA 1XPJA 4E2XA 3HV2A 2WUWE 3FSEA 3LCMA 1CUYA 3RW9A 2FSIA 1AKWA 2GN9A 2VCYA 2DQSA 2L42A 2VDKB 3FETA 3GUZA 4HFNA 4R7ZA 4ZYLA 5A4AA 1BW9A 2ZSJA 1N6IA 3WHPA 3K1AA 3RTCA 1GWNA 2VDWA 5HBGA 3O8OB 5E6UA 1H9BA 2W42A 5AMXA 3IMEA 2OCLA 3I3OA 1GPDG 4RTSA 4UAVA 2RHMA 3P5SA 3SYTA 3W2EA 1WW2A 3RJMA 1TL7C 4OB7A 1YFZA 4F4CA 2YY5A 2G1PA 1B23P 3L7DA 4KXMA 4TKMA 4YRAA 4C2TA 1US8A 2H1IA 3LY7A 2C7BA 4PZ0A 4TRJA 3V46A 5F5NA 1JIQA 1ZM2A 2J6IA 2P90A 4G56A 1NT2A 3A2MA 1FOEB 1QTQA 3DOUA 1GUBA 2NSHA 2YMQA 4LOKA 2J0SA 1DKRA 3HCBA 5JNTA 1G7SA 3CLUC 3WV5A 2IXBA 4HLNA 5B3KA 1XRSB 1XRLA 1GG8A 2A5DA 1ZK3A 2C5EA 4O1HA 5FOSA 5GV8A 1ICEA 4H0FA 4H7KA 3WHIA 5TNXA 3WWCA 4CMJA 1G38A 3H4IA 1CZOA 2IUSA 3AU8A 3JASA 5DRYA 3CZCA 3H9CA 4ABYA 1C7RA 1OAOA 1YR6A 2RI1A 3AETA 3EWIA 1XCJA 3P9PA 2DUNA 2FMUA 5JD6A 1IBMB 2RARA 1GZ5A 1L3CA 3D4BA 4MQFA 3UMGA 1J42A 1KY3A 4HB4A 5HQ3A 1ZD8A 2H1SA 3ZR4B 1ND5A 2V54A 1I0LA 3CZ9A 1E5VA 3EH2A 4UEJA 4YRIA 4GP9A 1IE3A 1P18A 1RWXA 2MU1A 2NPIA 3KKLA 3BGOS 1XPOA 4HH0A 4DUPA 4OF4A 1E2EA 1RMTA 2NU6A 2ZJ0A 5ILQA 1WDWB 4MW2A 4PLVA 1WBBA 2FPIA 3AOEC 1WKVA 2YIMA 2BR5A 4PGGA 1O03A 1RYEA 4I9FA 4RVNA 3DV0B 4CM4A 5TQJA 1X7ZB 1XQYA 2BSAA 3FDIA 2YNMA 4KAAA 3PL1A 3NVMB 1EVYA 4WXYB 3IB6A 1RJFA 4XSGA 1S8FA 1WM1A 3VPHA 3U0BA 1NSFA 4MZDA 1YR1A 3B3FA 4GL4A 3F1LA 5ITWA 5MN5A 5T41A 2LVBA 4GKAA 2ZRKA 4IO1A 1OX4B 2A5LA 2JFUA 3Q7IA 4W5TA 1D6SA 2KM1A