2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2IHKA 4R84A 2IIBA 2IIQA 4V39A 4R83A 4V2UA 2Z4TA 4V3BA 2EX0A 2ILVA 2EX1A 4V38A 2II6A 2IHJA 2IHZA 4R9VA 2IY8A 4V3CA 2ZWIA 2C84A 2C83A 2IY7A 3S44A
chains in the Genus database with same CATH superfamily
2XTJA 3HL0A 4TRJA 3ZH2A 2IVZA 2XKAA 1S9DA 2JEYA 1TK9A 4NZOA 2JGDA 4ZCLA 1LBEA 3LK7A 4ANFA 4DXHA 3BMQA 1ZBDA 2ZYSA 4A6XA 1KZGB 5B4UA 1J1UA 4DANA 3D4IA 5I6DA 2HBRA 1I3NA 1NFQA 3WL5A 1D3AA 4Q3LA 4C3UA 1H2EA 2X4GA 3DW3X 5HBGA 1RRGA 4DDVA 5LCXA 4UU7A 1J7KA 4BJ1A 1AHIA 3LS2A 4M1QA 5CVTA 1NYRA 5JFTA 4RKYA 1CHDA 1I4LD 4ZHQB 1FJXA 1E58A 3DF9A 3D3EA 3CVXA 1VJGA 4A1OA 4ZHQA 3AM3A 3LIIA 4QDTA 4W99A 3VU9A 3NHYA 4F4FA 1NP3A 1L5OA 4M22A 1ICEA 4LOIA 3IKTA 1DINA 4LYJA 1FFGA 1KI1A 3R1IA 3M9XA 4YXWA 4U7DA 1Q91A 1JR3E 3LCCA 2JJ2D 1RQ2A 1YZKA 1VIVA 2PSSA 5AOCA 4DSZA 5CLFA 5MGNA 2JL1A 3EXIB 4V1CB 1MVNA 2KBEA 2RHMA 3OEWA 1VPWA 4L8FA 2ZZMA 4BWVA 1G3IA 5AKHA 2YX1A 2OBYA 4BLWA 1E9DA 4FLMA 2CFSA 1TADA 5BNZA 1HTBA 5JAUA 1I1OA 1E2IA 3DE0X 1UF9A 1T0JB 3R3XA 5E9WA 4C1BA 5CDSA 1WW8A 4I3GA 1VYVA 4QHTA 1ESMA 3ZHOA 3ZDDA 1Y5LA 4G2TA 5GPBA 2OGZA 2OXEA 1EUQA 1ENPA 2ECPA 3IDSA 4K9DA 3QIVA 5EJIA 3ZCUA 4NOLA 3UT5B 4L9SA 1ZEMA 1GUBA 1Q11A 2C1EA 4UOQA 3K4QA 5HCIA 1DO2A 3RHZA 1WRBA 1GNTA 3PEWA 4OBEA 1DDIA 2D5IA 3DDUA 4M7RA 2B4YA 2L0XA 4RF4A 1UJBA 2R8EA 4W8GA 2H6EA 3KLBA 2CDAA 3Q9LA 4URFA 1E8MA 1VPEA 1WG8A 2XUJA 4JUAA 1CY1A 2Y1XA 4FYIA 3IVMA 3BTSA 1N2OA 1BXRB 1T1EA 4F93B 4JLAA 1K27A 2P68A 4XX1A 3MSCA 4IZIA 4EFLA 5AP9A 1PS9A 4L57A 1NUPA 1OAOA 2FETA 2PKQP 5BW4A 5AICA 5DN6D 3Q87B 2GBCA 1VG0B 3B1JA 3RODA 3WLJA 1R5JA 4WZBA 3M89A 1D2RA 2Z2ZA 2ZYRA 4A10A 4E5SA 5A9SB 5BV7A 2Q5LA 1KORA 3GJ7A 3JALA 2PIAA 3JWGA 2C2WA 2J7PD 1ISFA 1EGVB 2O50A 4ZDJA 1YJBA 4DPMA 3QVUA 1C81A 1L8AA 2DFVA 4D9EA 4NPHA 5HKLA 2QP9X 3MGBA 1E3QA 4X1KB 5AIBA 5J4LA 1VIMA 1YD7A 5K0SA 1VI6A 1C8KA 1H69A 3OHMA 1QC5B 4Z3OA 1XALA 4YDHB 3C6QA 1FX0B 3HBFA 4PAOA 3SXUB 1D4FA 1L8LA 4HGQA 3CEAA 2BJWA 4EYEA 1XCOA 2EHJA 2PT7A 4MVJM 1SRQA 3D0KA 3ZJVA 1G20A 4QATA 1U0BB 3J80A 2BC9A 5JXIA 4JSYA 1VYTA 1Z56C 4Y98A 5EQFA 4HNAA 4R2KA 4QUAA 1GR0A 1UMDB 5JSQA 2O0HA 4U7HA 4B4DA 3GFTA 4HY3A 1IONA 1JG1A 1H6DA 1U4NA 4JJ8A 4EKIA 3OIFA 2XXAB 1HZZA 2NVUA 1XGKA 2QVGA 2X14A 3G2KA 1G4AE 1LNQA 2X2EA 2YJGA 1N57A 2WD8A 4K6HA 2FUEA 4JVOA 5H3HA 2F3TA 5KTSA 2D1QA 1IBSA 3IGFA 521PA 3NMUF 4BLQA 2G77B 4CKWB 5TPZA 2E4YA 4FFMA 3ZCTA 3K6SA 3VPAA 3OIYA 2C7QA 1YL7A 2FJ0A 3O2QB 4FBGA 3REQB 1SBQA 3ABZA 3TKLA 3THOA 2AUNA 5B53A 2PBRA 3EMDA 3N0TA 5BN5B 4ZAYA 4EHLA 3WGQA 4DAEA 1DU4A 3ZWBA 1TPYA 5CHEA 3LC1O 2E4AA 3IJRA 3NIDB 1NUSA 1HPLA 1AQ6A 1F7UA 3RTDA 2VJKA 3TJRA 4GP7A 2BW0A 3RG8A 2YBEA 2GTHA 1EFVA 1LBHA 3OU7A 4JKOA 5F78A 3BA6A 4RLHA 4Z0PA 3TLBA 1NQUA 3F9RA 3Q5DA 1LI4A 2VJPA 1DEAA 4PG6A 1R6BX 3S2UA 3W8FA 4WBNF 2PS0A 3FETA 1L1FA 3MWDA 5TV2A 4BMXA 2QRJA 2VDQB 1N33B 4IW3B 4QFCA 4B4KA 1N4AA 1DAFA 3PE3A 3LY8A 5H02A 2DQSA 3NLLA 2AF3C 2GTPA 2R5WA 3JZAA 3RIGA 3T7RA 1A5SB 3QPAA 3WMXA 1V1JA 5A6SA 3H8SA 2VQSA 4RTKA 3VU9B 4JS0A 4R7TA 1H93A 5B7PA 3R0IA 3EZXA 4G4SO 3DVRX 4DE5A 4RAOA 5FB3A 3SP1A 2XE6A 2C98A 1VMDA 4RTSA 1OH6A 4ICIA 3N2EA 1BX0A 1CUUA 4GP6A 3TZBA 2ZIGA 1UEIA 4XB6B 4XFKA 5HMLA 4ES6A 3KSUA 5IUJC 4WFJA 4IZHA 4BMZA 3HKCA 4N5LA 1I4TD 2ARKA 1ZHFA 1WB4A 4HKTA 1PFUA 1R0ZA 1Z37A 3ROXA 3HKDA 2PGXA 2QMQA 2GLUA 3C3BA 4PZ0A 5JD6A 2VDOB 1G5RA 2HRCA 2VNSA 3PCTA 4DT1A 3LX6A 1RXWA 1YK0A 3DAGA 1Q3KA 2RH8A 2CK3A 2ZRHA 3NTXA 4D3XA 2XRFA 3HBNA 4NBNA 4ZOCA 3H6KA 3HR7A 4O2LA 1H2XA 1K0FA 3C0KA 4I5DA 2HNAA 1V8ZA 2X2OA 3N58A 5JYDA 1Z74A 3NDBB 3VVMA 4EJSB 1T10A 4FZJA 4BFLA 4ZALA 1J0XO 4CM8B 2JIPA 3EISA 1LZKA 5HFNA 3ZVMA 2FTKE 4AJ2A 4MUGA 1Z33A 1I7NA 1A8IA 2GESA 1CXZA 2Q0QA 2WTAA 5AQEA 1VHTA 2RB5A 4GGOA 3K1AA 1JP7A 5KEIA 1RYDA 3K1AB 1LC3A 4FGSA 3M6IA 5A7FA 3JAWB 4F84A 3G89A 4N8DA 1YO6A 2GTIA 3ET5A 4XVRA 3LDAA 1ZCJA 4TKVA 4F91B 4Y2QA 4ESVA 4RMNA 1TF2A 2QAGB 3EVNA 4I46A 4F4IA 5BYKA 3AOEC 1NSYA 1O89A 1EVKA 1U2GC 4RK6A 4EW3A 8MHTA 3NH9A 2YUTA 3B48A 3FUUA 1DWPA 3FPLA 2KSQA 4CMIA 1ZGJA 4ZREA 2E5LB 3L0CA 5BORA 1P2SA 1CSEE 3PHHA 3SZLA 4DIMA 4EYQA 4ZVSA 4B2YA 5IJ0B 2BMDA 1AJEA 3Q41A 4KO1S 3LHIA 4MQ4A 4B40A 2EL9A 1P19A 4S12A 3AMVA 5FWDA 3TDKA 3IOMA 4PONA 4J94A 3PJGA 4MB0A 3F47A 5FADA 4KMSA 5HIIA 2EDAA 1K7YA 3MTGA 3A36A 2QTBA 2IUFA 2KBFA 2YHIA 3QVOA 1YZVA 4DSUA 1ZN2A 1EU1A 4D9CA 3SHFA 2I1QA 1O4VA 3RFUA 3VR6D 2L19A 2D3TA 3I05A 4C7XA 2O7VA 1N6RA 1OXKB 1A97A 3GZ4A 4XJVA 1WUTA 1V2GA 1G16A 1WWKA 2J09A 3HVKA 2HRDA 2IYSA 3FNQA 2FNAA 3NHLA 4I9NA 5K3AA 4MJ7A 1TQ6A 5ALHA 1QNLA 2O7QA 2Y1KA 3F6YA 4ALNA 3F96A 1XVIA 5G3ZA 3K0FB 1PR1A 4J0FA 2AK3A 2JW5A 4P36A 2Q8NA 4OM7A 3ZZMA 2OB1A 3BTOA 2Q3JA 3S70A 1RYFA 4LGVA 1UJMA 1NF9A 3RWMB 1RHJA 3GLIB 1Y81A 1JEQA 4NFLA 4G9GA 5DV9A 3V1TC 2ID8A 1QTRA 3C5WP 4CCWA 2PUBA 3TBFA 1P7VA 3SBDA 4ZOLF 2LRHA 2P9GA 2CWDA 4YDRA 4ZO8A 4CR6A 4E3ZA 1A8HA 1D03A 1RCTE 2YIMA 2AZDA 3H5VA 3N0RA 2HA4A 4JGGA 4LJYA 4GDMA 5BW8A 1N2HA 1TMKA 2C0QA 4G8JA 1Q57A 5G0TA 3DHEA 4D4HA 1Z18A 2WF6A 2X7XA 1CDDA 1NDHA 4Y2SA 3ZIUA 3KQVA 3IEPA 4IXNA 1HDYA 4G65A 4PFSA 3V9AA 2VPQA 2FN8A 2VCYA 1R0SA 1TUGA 1TYCA 2EBWA 3PEUA 4MITA 3GUZA 4BO9A 4PC3A 5LWHA 4GOKA 4PC1A 2EDCA 2VSYA 3CB2A 4MUAA 1JN0A 2ZEJA 1Q84A 1XYYA 4DS3A 2MSLA 4G0MA 4A6PA 3KXDA 4X1IA 4WZAB 1AGXA 3G1WA 4Y9SA 4F1KA 3VR1A 4CKEB 5K3EA 4ESHA 3PJFA 4KYTA 1N1MA 2X22A 4QFMA 3S6JA 2C4WA 5B12A 1EZ1A 3ZZ0A 4E7PA 1FW8A 1J33A 4O2RA 1Y8RB 4ZZ1A 4KGZA 1UJ2A 4JKIA 4ARIA 3A05A 4KLCA 2YN2A 4NRDA 4LZAA 3LX4A 3MJCA 3TSZA 9GPBA 3KU1A 4TKLA 1E99A 2GGSA 3FTNA 3MRVA 4URHA 4RK1A 4YRDA 3G7UA 4NYIQ 2H4XA 4ENVA 1DC6A 1KFBB 2NUPB 4PLPA 2C5SA 2RHDA 3L1KA 2HSGA 2YN4A 3OPXA 3BD7A 3FI9A 2LE0A 4LYYA 2DR0A 4CLRA 5INTA 3FD8A 3PHIA 2PXCA 2Z3WA 3PDIA 4M7WA 4QLAA 4HEQA 2IH4A 3K2QA 3N28A 3GNLA 5GZ6A 2JBAB 4IIGA 5HUQA 2P4HX 1H2FA 3PC2A 4MUXA 2GSWA 1TL7C 2HJWA 1GPKA 1N6OA 5DM2A 1E0SA 5D51S 4KQCA 4IR7A 3TAUA 4C4XA 1Z2OX 2V3WA 2VA8A 3G3EA 1OI7A 1IRXA 3BL8A 4YMSA 2W6CX 1PHPA 4P35A 1BGXT 1NW9B 4MWOA 4I1UA 3K92A 5BV1A 1GITA 4LJ5A 4XI9A 3FGZA 2QRVB 4Q00A 1XJ0A 4JXKA 4OMDA 4DIOA 3NETA 3TCXB 5CA0A 1OLOA 3L07A 3OQ1A 1ADFA 5E0KB 3A28A 2X19A 4IFEA 1EX6A 1N3LA 1YB1A 3NIBA 4PGAA 2Y1GA 1TQDA 2HO4A 2IYYA 1K88A 3ISJA 2GILA 2JCYA 3L0IB 5BQ5A 1NUUA 2XBUA 4Q3NA 5MDHA 3NJ4A 4AY5A 3TTSA 3ND6A 4X66B 5AHRA 1QZ3A 3QPCA 3PHLA 3V80A 4YT2A 2PGOA 4FPXA 1K5PA 5KVVA 2BFFB 4KR3A 3V8QA 4KR9A 2HTFA 4ZCMA 5BOSA 2F59A 1OUMA 1QPGA 5IP5A 1HR0B 2W7TA 2Q4BA 1IIRA 3OF5A 2WF7A 3CZQA 1JSZA 1NUTA 1RHQA 2AJDA 2YV3A 3S3TA 1UKAA 1O1YA 4NPCA 2FEWB 2EGUA 3PNKA 2BT4A 1E3LA 2RGCA 1O4WA 3KQTA 4RIGA 2GD0A 5D8DA 5TGZA 1L5HA 1MIOA 4D3ZA 4KTTE 1Z4MA 2ILVA 3ZTWA 4A26A 2QBYB 5A2GA 5IYZA 4GXQA 1N25A 2DOKA 1DKPA 1GQQA 2XYGA 5FBHA 4ZYVA 5BMVF 1YQQA 3T1VA 5BV0A 3AUAA 2NMVA 2H54A 2JA2A 3F90A 2IUYA 3PL1A 4PCAA 2PXAA 2CXNA 1GYQA 3G7NA 4DVJA 1U1DA 3DTNA 4UAVA 4AQYB 3ONFA 4HH3C 3R8FA 5TMPA 4R40A 3N86A 4GL4A 1OPXA 1M1UA 1ZJ6A 2IDKA 4PHGA 4PIMA 3RANA 4BVHA 4F0JA 3CLRC 2ZYVX 4JUFA 3FPEA 3TR0A 5I4KA 1A2QA 1Y6RA 3NOQA 4EHDA 2IHYA 4O25A 1GTSA 1WOMA 2QTMA 2WV9A 3L43A 3OTWA 1SIWA 4G1BA 3VSBA 1SZDA 2JFVA 5BN4A 1ADBA 3HM9A 3ABQB 1PZEA 1L3CA 1Z39A 3K0FA 1GKIA 3MTAA 1D1TA 4EJ6A 4U3JB 1H6AA 3BF8A 4J6FA 4R01A 4RHTA 1ZMOA 4EKNB 1UJCA 3WGIA 3JW8A 4R1OA 2HMSA 3AM4A 2BR5A 2EJCA 1NASA 3A6KA 3TFWA 3O4JA 5EN4A 3NONA 5AYVA 4TS3A 2YICA 1T9GR 4BNIA 3HFRA 1QYIA 1VB5A 3JVEA 2AXQA 1NURA 1KNXA 3M1AA 3MUFA 1QIKA 1U80A 3B20A 5HKOA 2OCLA 1NJFA 2EFJA 4Q5IA 3HFJA 5K3DA 4D41A 3CKYA 2WJJA 2GS9A 5CH3A 4RIEA 4HPXB 2Q3HA 3H65A 4BQIA 2NYVA 5A1TA 2BHTA 1UKEA 3IQHX 3IVGA 5KNDA 4BNKA 3WZMA 3L9XA 3PNOA 3PIRA 3TI7A 2R87A 3WGJA 5TVKA 1K6EA 4CKBB 1O96B 2Q5OA 4Q3BA 4FYWA 4D9JA 1XMSA 1CJCA 4YAOA 1WCYA 2AOXA 3STYA 3LQ1A 4WI1A 5KYXB 3OO0A 2I7DA 3VR2A 4O8CA 3AKZA 3VDQA 4RDCA 3VNRA 2XODA 3CG4A 2O8EB 5IKMA 1IUKA 3A6EA 5ADWA 1KBOA 4UHDA 5EXXA 1EWKA 4GGPA 3EWAA 4W8OA 3B6EA 2CVQA 3OOEA 4OOEA 3SIRA 3CVJA 4CF5A 1V8PA 4L78A 5K4GA 3AR6A 2FUG1 3FDIA 5IBQA 2PAFA 5C8YB 2WZDA 3GG9A 3PKJA 3ZDCA 4KR6A 4RELA 2VATA 3AUKA 4WDRA 1WUKS 4RHYA 1CS0B 4DDMA 3OICA 3OOSA 1OLXB 4NYIR 4CGZA 2BJVA 4GUDA 5AKLA 2I8LA 3HGQA 4H08A 3SCZA 5EXTA 2I3DA 4QZVA 3CURA 5MN5A 2CMFA 5FEUA 3GJ4A 1DIHA 1IOVA 1TMOA 4K6FA 1VYUA 5YASA 5IUNC 1ZGHA 3C43A 4RGVA 2BEWA 3V8MA 4A8JB 5FA8A 3RS3A 3K71B 3MCZA 2OY0A 4R8KA 2JIZA 1W4ZA 1WXXA 4H18A 1W19A 4HQLA 4D74A 3RASA 1RWNA 2WJVA 4CPDA 5BVHB 4X6UA 3WTCA 4N7RA 3LPCA 4J2TA 4OG2A 3IMGA 3QSYA 5I4IA 1RFLA 2CYBA 2OOKA 4B43A 4QFDA 4CHGA 3H5LA 5BYJA 3FVVA 1JDSA 3HJAA 1W0KA 2F3RA 3L7LA 5JMOA 1DXYA 4CNBA 3LPMA 3DM5A 3LT1A 3ZG6A 3AF5A 3X1XA 4UHFA 2OV8A 1YVRA 1XXHE 2I80A 3F4BA 5T6BA 3M83A 2FDCA 3UFXA 4DREA 5JG7A 2BVNA 1ST3A 5BO5A 1DAIA 4K9MA 4TTJA 1T6XA 2C5EA 2PQ6A 3L8DA 3FMIA 4TS9A 5KMGB 2R4UA 2YBDA 4M1ZA 4TXJA 1DC5A 1P5JA 3UYLA 4FFWA 3MWEB 3F1LA 4P0PB 4YLYA 1Y42X 5ER6A 4DY4A 1HSZA 1R6XA 2Z8YA 3ONWA 4H7EA 3JXEA 4L6CA 2X8JB 4BP3A 1RQPA 5I4CA 2A33A 2JAWA 4DCSA 1HMPA 1XZ8A 2P1RA 4LHWA 3ENVA 3VO8A 4ARSA 2CNDA 1AC5A 4OPMA 3OZCA 3NHWA 3V8VA 2HWXA 4FFRA 4PBRA 4EGFA 3Q7QA 3Q15C 4TVKA 1IPHA 2AVDA 3LRXA 4PYLA 2MR5A 2SKEA 4HAOA 1C30B 2P90A 4R1QA 3C6YA 2C5FA 3P2IA 4LDRA 1DS6A 4C4RA 3I62A 2HHLA 4CM9D 4IDPA 5FWYB 3VGJA 4EUHA 2FB9A 2I3AA 2WVJA 3BA1A 3R40A 1LX7A 1PSWA 2ZYUX 4QL3A 5IK2A 2V59A 3BIJA 3OFND 1X1BA 1ZU4A 3IS3A 4B44A 4ZCPA 2HW8A 3HDJA 3JZDA 1C8BA 1X6VA 3VXKA 2XRYA 2BHSA 3SQWA 3P5SA 1G20E 4AJHA 3W1WA 4OAPA 5E2AA 1XKLA 3B7PA 3I6BA 3G0HA 3E7PA 1KE1A 3UY4A 1RRVA 3A9TA 1OH7A 4NYJQ 2DBVO 5L51A 3ZZ1A 2ZRCA 3TPZA 2K2QB 2FEKA 4C04A 5I9IA 1JAXA 2L82A 3HCAA 1CQPA 1ZXBA 3NXKA 1A9XB 3Q3GE 2VT2A 1DOZA 2FZCA 4HTFB 4JJ4A 3SBXA 4CLOA 4ZO4A 4K9OA 5K1ZA 4HTFA 1A9XA 4HFJA 1L5MA 2BP7B 2Q9CA 2YXLA 3MLAA 3I1JA 4Y3UA 1S3GA 2AT1A 3BDAA 4KX3A 4N8EA 1A2OA 2JFQA 2QS9A 4GQIA 4NYJR 2CDBA 1KIAA 2I3GA 4R41A 1U6KA 3MAAC 3KYIB 1UKCA 3DPIA 3H4MA 4YGYA 3GW8A 1AKNA 4LRQA 1KFCB 2G1JA 5IJAA 4MAFA 1PL0A 3RSHA 1P9NA 2G09A 2PUTA 2YINC 3CY6A 4QGHA 3DZCA 1G60A 2AE1A 2C3UA 2R8YA 2YHUA 4MI1A 1EXVA 4Y0AA 3DBIA 1HEUA 2YWRA 3MM4A 3PQ4A 4JCOA 2GAIA 2XMZA 3MHPA 5GINE 2UKDA 3UJAA 5E6RB 2H4JA 3QYAA 4HEJA 2D2VA 1NJGA 4R8MA 2WMOB 1RHMA 3NTQA 1FTWA 5T3YA 4JL5A 1XYGA 2FDRA 5B1HA 5KAMA 5TT1A 2YASA 5TMDA 3W4IA 4FE3A 4EHHA 3WL7A 1G2PA 1CJUC 2NZUG 4LXIA 1U7WA 1Z4LA 1IXZA 1F4PA 1H2YA 2XDAA 3I04A 3QPBA 4DHEA 2JLWA 2NUTB 16PKA 4HNVA 4DA6A 2I0FA 2QVLA 4FQ8A 2A78A 1L5SA 1ONNA 2ZQYA 3G79A 5JECA 3DHVA 1L4YA 5B2FA 4MR9A 8LDHA 1MXFA 3FHLA 1ZMXA 4OL9A 4PAGA 4KH0A 3R75A 1GGFA 4INAA 4E2XA 3UQZA 4IXMA 4EI9A 3F5DA 3H2IA 2R6HA 4CXMA 5FV7A 1TJNA 5E2BA 1QHFA 1VLJA 2I6QA 2J32A 2CNKA 3VYTB 1KAQA 4NE9A 4CUJA 2GK4A 4UNIA 5DGTA 3KAJA 4JGBA 3DHYA 5CNIA 3ZHYA 3IIIA 4N03A 4NAUA 1G2QA 3H2ZA 5K9ZA 3ILHA 4E32A 4CIXA 1YZYA 1XMQB 1KSGA 5CB4B 1CYEA 3M6FA 2RD2A 3KUXA 1AS3A 3VO9A 1JLKA 3IBCA 4FNGA 3UWPA 3Q9UA 4CKWA 5IFKA 4BS9A 1D5WA 2QMHA 2Z1NA 3O8NA 3MGAA 3UAWA 3L9WA 1DAOA 1X9IA 1PKEA 3CH7A 5LOVA 3S55A 2GF9A 2FW9A 1WMFA 3BEDA 3S0JA 4FJ2A 2HCBA 1T29A 2GLXA 2Q21A 1Z5UA 2JCGA 5L40A 1O5OA 4KIJA 4WOBA 4FOPA 4D56A 4RVFA 3RGWS 2JLZA 2EF0A 3GCZA 1YB5A 2C3PA 2MYNA 4IRUB 2IPAB 2BD0A 3BHNA 2ZB2A 4I8XA 4GE0A 3IPYA 2JLRA 3MGCA 4IYRA 4BO7A 3UB2A 2BMFA 1WSWA 3SMVA 3FDFA 4B6PA 5JS6A 1JQ5A 5DRYA 1FBNA 1LTQA 4A2QA 1X1SA 4BMSA 5A1JA 2X1VA 3U6BA 3EFEA 1CZKA 4KTVE 4D2IA 2V0CA 3OPYA 1X1QA 2JI4A 2Y0DA 3GFSA 4JU8A 5BUCA 1WA5A 3SYMA 3WL3A 5IZCC 2YH2A 4CEHA 3Q7TA 4D6YA 2BM8A 4ZRDA 2O2YA 2EF1A 4XM1A 3BOSA 1RRFA 1U0FA 2VHCA 4YRQA 4XA8A 3JQAB 2PZFA 3E22A 2BFDA 3FMVA 1WPXA 3CNHA 1J8MF 3W9UA 2ECOA 4MUNA 4OFZA 4KQWA 1UEJA 1ULAA 5IVKA 4R68A 2OZVA 2PRJA 1OGIA 4DM3A 3T0FA 2C2OA 1Y3AA 9ABPA 1NL3A 4IXDA 3C7CB 4RVGA 4DBZA 1CBUA 4DT1B 3W6NA 3ABSB 1LSSA 5F33A 3C7KA 3KD2A 4M1EA 5AW6A 2AOWA 3MJEA 4HUTA 3B6MA 4RSHA 1C8LA 3WGHA 3LECA 1X8LA 3CHYA 1JQKA 1WP9A 2ORED 3O8OA 4FE4A 5CXSA 2PWZA 2Y1EA 4IQ0A 4UZFA 1E2KA 2QZPA 4ZU6X 4Z4GA 1VCOA 2UXDB 2B7LA 2IA5A 4WKNA 3TLGB 5I7VA 3AOEA 2HK8A 2QD2A 3B3JA 4W63A 3NH6A 2XUQA 4IDQA 3QJYA 4MYCA 3WHKA 2GFIA 1GKUB 1X8KA 1NSTA 2JLCA 3OJEA 2AN9A 3WLTA 4EPTA 5GVSA 1D9ZA 2P79A 4G5XA 5FUBA 1EP3B 4PO3X 5JO0A 3FUVA 3DL2A 2A5LA 1RIFA 2MSKA 3LY9A 2DQKA 3MWDB 3LLSA 4PW0A 5CJ2A 3BL6A 2J4FA 5C5DA 1L7BA 3AEQA 3BXPA 2VYCA 4N0EA 1UC9A 4HTAA 1ECPA 2F55A 2FPGB 1YJQA 1YTLA 4E6PA 2CHQA 3GNQA 2R751 2MSNA 4QJ4A 3ETCA 1NUQA 4KIGA 3SHOA 5COBA 2FR8A 3WAGA 4N40A 1T34A 1VHDA 1II8A 4B48A 3SC2B 1V8FA 3VU0A 3UXEA 3IE1A 3WIOA 2VP0A 2QTCA 3P0FA 5T4BA 2WR8A 4AKTA 5D00A 1BWPA 5EKUA 4DZTA 4ACAA 1ZA1A 2C2KA 1A88A 1XZEA 2OORA 1R37A 3U7EB 2GF2A 5AKKA 5GGXA 4Z0NA 5CNJA 5CCEA 5JATA 5IAGA 3NDRA 2WDZA 4OP2A 1Y48E 4NWIA 1XROA 3F9IA 3FPFA 4Q47A 5B3JC 4L02A 2RGDA 1KSJA 1G4HA 1F3OA 1PG0A 2ZUUA 1FU7A 3KEGA 2DBRA 5L3QB 2H0AA 3HV0A 1YQGA 2BGGA 4U9IS 2ZE5A 1AXRA 1Z45A 4LYDA 1R0WA 2RFLA 1B41A 4FGZA 3EUFA 3NT2A 4M3NA 1G8AA 4ASUA 4CFSA 6REQA 3NOOA 3IDFA 1BMTA 3Q7IA 2ZPAA 2WYUA 3N7AA 1L7QA 4ZVVA 4A0GA 4GPEA 5IARA 2W71A 2WU8A 1T2VA 4OB7A 2B82A 3T7KA 1QCCA 3LGXA 1V3TA 3MQ2A 4QU8A 1OYYA 2WE7A 5IAEA 3T8YA 3GROA 2P8JA 2GXQA 4PPGA 3O0DA 1RXVA 2B1RA 4BOYA 3ETLA 5LC1A 2AG6A 2B83A 3LQQA 5JSFA 4MRSA 1XTJA 2M9MA 4MUYA 5AW1A 4ZCRA 5CD1A 3CW8X 4G6ZA 2PKEA 3VPBA 3UWMA 4R2IA 1IZ9A 3CZMA 5TJHA 2JKZA 2EW1A 1M75A 1GG9A 1Q95A 3M5PA 3OE4A 3Q8XB 4LPKA 3PPVA 4YRNA 1NQVA 2WZQA 5JQGB 3Q1LA 1YZTA 4QT4A 1T9ZA 4JU9A 4Q9AA 5K3BA 2R8PA 4BNDA 1L4KA 3R9IA 1G5PA 1WR8A 3GA7A 4EQ6A 3KSAC 2YWEA 3SX2A 1MB2A 2Z2IA 3SLKA 3ZZUA 1KXJA 4E33A 3U5ZB 1P5FA 3AO0B 1MIOB 3F3MA 3GZJA 2RHJA 1WVMA 3BCUA 1CD5A 3K96A 1H8HA 1DC4A 2Y1DA 4DLKA 5HM6A 4RA6B 3BQMB 5CB8A 3QI7A 3NNSA 4L8VA 4Z0TA 1A9ZA 2I4OA 2O23A 4BFYA 3STUA 1BJRE 1I94B 1W75A 1YOVB 2C0CA 4B4OA 2DUUA 4EG0A 5K6AA 4UU8A 4QVKA 4GMDA 1XN4A 3E4DA 4JN6B 4WZZA 3R74A 3GWZA 1LCIA 1BWSA 2NQ2C 3PUHA 1JXOA 3X3HA 1NBMD 4R9UC 2P2ZA 1FSZA 1Y1TA 2IHBA 1KP3A 2D7CA 1BE8A 3G6WA 5BWMA 1Q0ZA 4YRAA 1DPFA 3UCEA 3TZ6A 3GEMA 1PV4A 1GSHA 2VTKA 2WKPA 3U4IA 1YMUA 3UGQA 1LF5A 3GLHB 5THXA 4U2FA 1JEEA 1XBTA 3GT7A 2IS4A 4ZPXA 2ZRKA 4Q1DA 5CFOA 3K0BA 5TY0A 2VZ9A 5JNVA 1L3BA 4X6YA 2NTEA 3PQ6A 5JVDB 5JNTA 3WGGA 2NZ2A 4MS4A 4G63A 2W6ZA 3MUNA 4DA7A 2XNCA 1USKA 3OETA 4IHAA 2QX6A 4OXXA 4JT4A 1TQ8A 1Y6JA 1NR7A 1BROA 2FFJA 2FWAA 1KKUA 2H4WA 5LU8A 4DNXA 5BR1A 4NX2A 1J2JA 3R4CA 2BHLA 4GD3Q 3UTCA 2A3NA 4TPKA 1CIJA 2IHTA 3TL6A 4U2DA 1YZNA 1BDJA 3UXHA 1X7YB 1H2HA 1TM3E 4J9UE 2H8GA 4OQLA 5KNCH 2VP3A 3Q5GA 3BVPA 1UPXA 5GONF 3PENA 1TTHA 4Y9RA 4OBBA 2B34A 4IFIA 1DIGA 2ACWA 2JI8A 2FLVA 4JYCA 1JSLA 2ACVA 2B7BA 4KNWA 1VG1A 4WGFA 4ZXPA 4ARZB 2PJDA 4CQMD 5JSUA 4MVWA 1QANA 1IOLA 3NANA 5F7ZA 3PP8A 2X1LA 4MULA 2OR3A 1PVOA 1WW3A 3LXRA 4G36A 4HMOA 4TWIA 1J2RA 1SOWA 2REQA 1V4BA 2XAUA 4GF5A 4DA0A 3PRKE 5ALUA 3UUEA 3DDHA 1RJDA 1UBLS 5A9RA 4D8XA 3B1VA 3EVGA 2Q2WA 2X9LA 3PXAA 5M7EA 1DJOA 1MRNA 1U63A 1K6JA 1T0UA 2Z2YA 3X1DA 1OHHA 1RZUA 1TJ5A 1DKRA 5AK5A 1HXHA 2EKQA 5D84A 4A0FA 1VHQA 3DH0A 4B7CA 4DMLA 4ZMSA 1GCAA 2LCQA 1ZOPA 1YR9A 2ZDQA 4U8HA 3PEFA 1SU7A 1W0JD 4BPRA 4Y0VA 3AUUA 1EFUA 5D3ZA 4Y2HA 1M7BA 4Q4AA 4PZLA 1U1FA 5B58T 1QU3A 1U7ZA 1B8VA 1G7SA 5EIHA 4LZOA 3UK7A 5JC1A 1TDJA 3FTEA 2WU3A 1ORHA 3OA0A 5BXYA 3B51X 1RTTA 2VDMB 4QYSA 1N0IA 2BFNA 3CIFA 4TVBA 4KE6A 5AW3A 3VV3A 1VI5A 3OFSA 5IT9A 1M7HA 4D25A 4DSTA 2R7NA 3BXFA 3TPCA 1SCQA 3ANMA 4DZZA 4E14A 2FG5A 4NVRA 5AR1A 1MGPA 2ZI4A 3BTUA 3ONVA 5LQAA 4AY3A 2PRSA 2YJZA 3AFMA 1E7YA 3BJRA 4L3WA 3L6OO 3ZKWA 2O7SA 2QQ5A 2YFQA 3MC1A 4PLZA 1JFVA 2X0KA 1Z82A 4PPFA 3BRCA 5KS2A 4LJ4A 1KEEA 2BFCB 4BBPA 2B2XA 1V39A 1NNLA 4UDOA 5K20A 3W5CA 2H11A 3FR7A 1G5IA 2CMHA 1RWWA 1PUIA 1EH5A 1ZH0A 1MA3A 1YAHA 2CF5A 2Y27A 1QYCA 3BMQB 3BK1A 4D97A 3TZLA 4EHAA 1MJGA 4G1VA 2NV6A 2ZRFA 1BKDR 2XE4A 3O2JA 4GI1A 3V1YA 3NZEA 3LV8A 4LRSB 4GE3A 2ZS9A 3WS7A 2HLHA 4NBTA 1JHYA 1XQVA 1RPTA 3EGXB 4X9XA 1USGA 1XFAA 1C7RA 4WLVA 4GX2A 4J3FA 3W8DA 1USIA 4FK8A 2XNJA 1TRKA 2D00A 2VI5A 1U1CA 5AM5A 2Z58A 3LGAA 1M73E 2GZHA 2HA0A 4EI8A 3RIXA 4N47A 2KX7A 4ZGWA 2WWRA 3IIEA 4KHZA 5JARA 2OFOA 5GZ3A 1J5EB 1KSHA 1KKLA 2Q4DA 5G0WA 1Z7BA 5EVJA 3K09A 3PC8A 4LJAA 3IVCA 4RHFA 5I48A 4KE9A 1KERA 4JBLA 2H7XA 1GLVA 2PHZA 3TIIA 1U0NA 3UHAA 4AICA 4ZVRA 4ND1A 1KHTA 2X5JO 5E9QA 1U04A 3ROFA 5LP6F 4FDMA 4LA4A 4MKHA 2DT8A 4P2BA 5LZ2A 3KEQA 3HCRA 1Y6FA 1IHUA 3PFFA 3G8CA 2JEZA 1PJRA 1WDTA 1AGPA 2B4TO 3OP4A 3OOJA 4PGHA 4BZQA 2Z2JA 3EH1A 3F74A 3I2JA 4GX5A 1RACA 3P19A 1KVTA 4X3OA 4Y2TA 1NXWA 5DCWA 1NE7A 4DWJA 3C3MA 3CUVA 4DR5B 1HNZB 3VPSA 2JGLA 4ZYUA 2VHVA 4LZWA 4O6VA 3ICQB 4PQRA 2GYYA 4W5OA 1A82A 3AGQA 1NOIA 3K4PA 4X91A 4KDEA 2JJMA 1YS7A 1JU9A 3P0RA 1E1MA 4QECA 1F51E 1VP9A 3OFVA 3E5RA 3OY7A 5EMNA 1C50A 4FN4A 2QTRA 4YMUA 4RVNA 1WKCA 2FJUA 3Q7SA 2CLSA 4HQFA 2J3QA 4HDQB 1I9GA 3FOAA 2IZ7A 2VDWB 2Q45A 1US8A 1QJCA 2M1XA 3BKXA 4TL8A 4MA0A 4MB2A 4TL6A 3ZWXA 1AZTA 4YB8A 1YNOA 3CZ4A 1S9HA 4HYYA 3AVTA 4B6SA 4CMHA 1HRDA 3HADA 4BFTA 3KR9A 1B3BA 1B8PA 3SI7A 4CMEA 3OHSX 3LLCA 4LXGA 4DM4A 4IQGA 1ZNYA 5CDUA 2IOFK 2IV3A 3K70B 3IT1A 3I5UA 4HSEA 5FNVB 4XYMA 5LJIA 3RRJA 4DEYA 2HLPA 1EVZA 2ZBRA 4HZUB 3M7IA 4MROA 1T9GS 3VZRA 4B71A 1E1YA 3UPTA 4M1MA 2GBPA 4QSMA 3KT8A 1KJZA 1VL1A 1EPUA 1YKFA 4CM6A 2HR1A 2NTJA 4L4XA 4X20A 3G88A 3TQIA 5J1SB 2B6HA 5KNLA 4C2UA 1BE6A 4E1VA 4IICA 3LO5A 4NDNE 5IAKA 2W6NA 4CTOA 4H3KB 3CRVA 4EKYA 2FPIA 5J4HA 4DRZA 4EW2A 1G42A 4V2IA 1BE1A 2OESA 3KSRA 3LXUX 2HOQA 3TTYA 4AF7A 3QE9Y 1G9TA 2QW0X 3AUFA 4HGPA 3F6BX 1M34B 4L75A 1Y37A 3W6UA 2H1CA 4FFSA 2P7HA 1B74A 4R0NA 1Y4SA 2J0QA 1J70A 1U81A 1Z5GA 3D8BA 3I92A 5FPQA 5GONB 1GDTA 1NJ1A 2NLOA 3GDFA 4Q37A 3T94A 4EVQA 1T5BA 3NM5A 4ZT2A 1O03A 2O14A 2FKNA 5BNIA 3FPHA 4DQVA 2AFHA 1KMHA 4JQYA 3WBBA 1AKWA 1N1GA 4MV1A 3CJTA 2GXUA 3ITNA 1P5HA 1C7FA 4AS3A 2CCJA 3W1VA 4ECEA 3JYPA 1HDRA 1UBSB 2W98A 4A2WA 2WWIA 3H3JA 2ET6A 5JDCC 2DKFA 6CHYA 1QIFA 4H3VA 1ZW1A 3ZXYA 1M1YA 1P2FA 1EVJA 1MABA 3A7EA 3CRQA 4MV9A 4M1KA 2GHQA 3A37A 2J5RA 3FX2A 4J03A 4KI0A 4PC2A 4IIDA 4RAQA 2CVPA 3N39C 3KT6A 2JASA 4J0QA 1EFCA 1PL6A 3L1IA 3AUXA 1KY4A 5AKGA 3NWPA 1SB9A 1XWFA 5CLGA 5DIFA 2XCQA 3R3ZA 1YRHA 4MRMA 4DM7A 3HXOA 1Z8FA 3SX0A 1Q2XA 2I22A 3HJGA 1T5DX 2WTBA 2H08A 1ST2A 1J8VA 1RW4A 1JILA 3MINA 6Q21A 1P8AA 2I4TA 4N5DA 4IDGA 4M38A 2RAPA 5A6SB 3S2EA 1SC9A 1UC4B 4F7WA 4UCWA 2GZRA 1DAGA 1POXA 2JFUA 4B2IA 3IUYA 4TROA 3DEJA 4JELA 5LQCA 1CZLA 4RJIA 2RJ3A 4JA2A 1SFRA 2ZVDA 3AK4A 3QTLA 2J3KA 2MMGA 3DFIA 1SC1A 3PPIA 3KPYA 2G36A 1UDAA 5ITVA 1QGYA 2L17A 1GO2A 3WMEA 1Q1EA 3L4KA 4CIDA 2IUTA 1DBSA 4YC7A 2GVZC 4F6LA 1XXHA 5CLHA 1F8FA 4R16A 3TJZA 4G8CA 2FW7A 5KNDD 3CTMA 1EESA 4Q9IA 4IVNA 3PJRA 3RNLA 3KETA 2HIMA 4LCJA 1NOKA 4UCXA 4GX1A 1SQFA 4N49A 5LP6A 2ZRJA 2HK9A 2HT6A 4FYHA 4XPZA 3UG7A 4BQFA 3PA6A 3NU1A 3CRW1 3H2KA 3T5MA 5LZ4A 1S2DA 2D59A 2OKCA 2P9EA 5IHPA 1SK8A 1JW9B 1V71A 4GZMA 1X1DA 2IFTA 2FN7A 2DPMA 3FA2A 3GGDA 1MO4A 4HAYA 1QBKC 4R9SA 2CD9A 5IX8A 3HN2A 4GPIB 4PFJA 3BGWA 3QF7A 5KBYA 1SC3A 1Z17A 2IYNA 4HDAA 3EASA 1XL0A 1D7AA 3QWAA 1H4VB 2A57A 4O33A 4JP3A 4BB5A 5ALYA 1OVMA 2E18A 4MW9A 3MA0A 1N2EA 3H9CA 4J7XA 5AI0A 2GZ2A 4MSUA 2VDNB 4DLVA 4KW7A 1EB8A 4XD2A 2VJMB 5DSTA 2FZGA 2GEBA 4CCAA 5TS2A 4DDWA 4BNDB 5KNBH 1B00A 3UGTA 2DPXA 4WN3A 1E92A 1O7JA 3N76A 4B4VA 2H2IA 5LA6F 1GL9B 1B7GO 1VRCA 5ALTA 5ARDA 3W4KA 5AI6A 3U7HB 1CQJA 1GPDG 3Q98A 3WE7A 1EDBA 2H2WA 4D9HA 1ABFA 1M2KA 1SD1A 1K7EB 1EFPA 2CXQA 5AJUA 3F4KA 1GRRA 2Q4EA 1ZUHA 2YQ4A 2FFQA 1Q1NA 2YHIB 4I9UA 1XVVA 3N5CA 3ZK7A 1EK2A 1GV0A 1OROA 1O0BA 4Q1FA 5T8KA 4LZZA 2J41A 3G2IA 1A8SA 1R9JA 2VYFA 2O0JA 3N8NA 3HXKA 2CXSA 1XHEA 2LR0A 3A0UA 3DEAA 4JLOA 4BQQA 3T1YB 2W8ZA 2E6KA 1KZ7B 3FVRA 4IAOA 3T5BA 3CLSC 3L2OB 3OLCX 4KH1A 3JQ8A 2F4VB 3ZVLA 5IF9A 1MX5A 4PINA 2XDYA 1XTKA 1CJSA 3QGMA 5AKJA 1AB6A 4OYLA 1HE2A 3T7JA 1Z0ZA 4NK4A 3ZXSA 3WGUA 1ZR4A 1N34B 1ISSA 2CMGA 3UW1A 3ESZA 3ZJYA 1USUA 2KLBA 3AFOA 4AMUA 4HC4A 2Q1UA 1VE5A 2GXAA 4DABA 3GOHA 4LFCB 2VRBA 1VCHA 3F5FA 2F8SA 3G59A 1E69A 1QFJA 3NPAA 2DETA 1X94A 3PKZA 5JIBA 3HJFA 1YQTA 3SF8A 3TF5A 1EQUA 4ERNA 1Q7CA 1Q74A 2IYWA 3E2MA 4Z54A 4U02A 3S28A 1DL5A 1LXCA 1RI3A 2QN2A 2I91A 3R5KA 4LBVA 1SUCA 4L8GA 1UPUA 3C4JA 4ZIRB 1X7YA 1PEAA 1JHUA 2JFGA 3COYA 5E9JA 4ENPA 2V8BA 3GV0A 4LHYA 5KTRA 1KA9H 1M83A 1ELOA 1MJHA 4ZK6A 5A03A 5TEWA 4WOKA 4XRGA 3PIDA 3QFTA 4I3HA 3A4YA 2JF0A 1NBME 2XTAA 7YASA 3LUJA 4JEMA 5EJMA 1PNTA 1ZQ9A 1EFRD 3QVXA 4DPKA 5ITZB 1FIUA 5DK6A 5A9TA 1X70A 1V1RB 4JP5A 5F2OA 1VCMA 3DXFA 2XLCA 4F9GA 2HA3A 1PGJA 2XMRA 1OBOA 2ACKA 1JVSA 1T8SA 4JFRA 5JQWA 2A0XA 3U61B 4R2XA 4UUBA 2BFMA 3AVQA 3E1SA 5LL6P 3V4RA 4CU5A 1AQLA 3CKKA 4QTYA 3FIJA 1A7KA 4IHJB 3JPWA 4O0LA 2O3QA 4UAUA 2QL6A 1Q0RA 2NPOA 1W36D 1EJ2A 2CSXA 5GJBA 2OP0A 2HAEA 5LDHA 2WU1A 5C4IA 2YYAA 1K66A 1EEXB 4HX5A 5KOJA 2AQKA 1DTWB 4TT3A 1ULBA 3M2TA 2PXHA 1KDPA 1JX6A 2I2XB 4J16A 4KO2S 4XCVA 4JA0A 4MP6A 1KTVA 3NRJA 4PF1A 1RMTA 3ANSA 4FILA 2BISA 4KWEA 3UYKA 4DIDA 4XM0A 5KDLA 1PNRA 2GYWA 2P3SA 2JJ1A 3LOQA 3D8SA 3O47A 2QRLA 4J3NA 4F45A 3CRZA 2RK4A 1EJBA 2V7BA 2AXEA 2QIPA 2Y1LA 1R6VA 3BK2A 2FOIA 2H4FA 3DHNA 2Q6IA 4EG5A 1XJWA 1WU7A 1JHPA 2J4DA 4HAZA 5FOWA 3BREA 2DYKA 3COJA 1ESEA 3G0BA 4WSOA 5KQMA 2YJNA 1II9A 2ECKA 2UUPA 3DAFA 3WFJA 5LFAA 4UDXX 4UVDA 1JEYA 4G1FA 1Z5VA 1GLGA 4N3BA 2BFCA 3HYLA 4WJZA 1OZGA 1RJEA 2KJQA 3GZNA 4PCLA 1E2NA 4PHHA 5L3RA 4D8VA 4MQMA 1EP1B 1QQ5A 1LX6A 5JCOA 3RS9A 1X1TA 1VPTA 4YIKA 2DPGA 4HDNA 3SYRA 4N4AA 1UBFA 5JT1A 1NV9A 3OPYI 4AUEA 5A3RA 3M4XA 3PV0A 4MKFA 1M0WA 1GGJA 2GD6A 5LU9A 5J2TB 3GJZA 4KO4S 2BPOA 1ND5A 4QXMA 5HKAA 4F3KA 4YCLA 1GTMA 2POQX 2P3LA 4DGQA 4XWAA 4EI7A 3KHKA 2CNWD 4AURA 4QXPA 1JA9A 1FSSA 1QHEA 2X4IA 1BW9A 2G83A 1XTZA 2VBIA 2ZRBA 1F9AA 1YR1A 3KKNA 1ZGCA 3L01A 3QUSA 2PZ8A 3LHKA 4FYVA 1JKMA 3H0EA 4V1CI 2OEPA 1EDOA 1DBPA 1HLGA 4IMPA 1P7YA 3QXXA 4PO1A 3RK1A 4COKA 5AUOB 4S35A 3CX8A 2YHAA 3FJYA 5EFOA 3ROTA 4CF6A 5IWAB 4IV8A 2G70A 5HQ3A 3HA3A 4UXIA 5FR2A 2Y71A 2WWTA 4X3CA 4O4IA 1VSQA 3T5TA 2NNWB 1EUCA 3W5JA 4BLPA 2DFNA 3C5HA 5KSPA 3EODA 3KYDA 4C78A 3KXIA 2C7RA 4FTWA 1P4HA 2FUKA 3TSYA 4F8EA 3F4LA 1EJ0A 3MCVA 2C4MA 1KSFX 4K9KA 5DLPA 4UBMA 5CK5A 3VJRA 3R6TA 3KDAA 3RLFA 1LY1A 1WHSB 5JLJA 1DTSA 5K0ZA 3PR1A 1XQYA 1KDOA 1OT3A 4XD7A 5BXQC 3VM6A 1UOEA 2AFIB 5CVEA 5ELLA 4AMVA 3WRVA 3SJBA 4DBLE 1VGVA 4H3HB 3UAOA 4UNSA 2XMPA 1HNWB 1XZKA 1N0VC 5A06A 4X71A 4WBNB 4BQSA 1SHTX 3SXJA 1UWLA 1ABBA 2KE5A 4IDCA 1H4SA 5HJEA 2LTAA 1D6MA 1YB2A 3PSAA 5DIZA 3TZKA 3UV6A 1P2DA 3WK6A 1YA6A 2IY9A 2EZ8A 4RUKA 5H9VA 3VHLB 3VU8A 3G2HA 2OV3A 1ECCA 3LO8A 4J7UA 1P0PA 4QHSA 5IN4A 4RBNA 4FGKA 2VF5X 1F6WA 3SKXA 1ADYA 3X1WA 4IH4A 2MIIA 4ZYTA 3HVRA 1P2TA 1YU9A 1LJLA 4ESEA 3QP9A 3EG9A 3I39X 5F52A 2BTOA 1LBTA 5I3ZA 1XVTA 2D1RA 3Q6NA 2AFIE 1M2WA 3I9MA 3VVBA 1NONA 1P8JA 3ETDA 1RWBA 1NNUA 4EGQA 3CPHA 3H6HA 4PG4A 4RZQA 4XOUA 3S1LA 1M0SA 2I7XA 4KPUA 2HT1A 1ZW6A 1R6AA 5ALMA 1CUBA 5EJGA 1JG4A 4C3VA 2HB6A 1SOAA 4HG2A 3T95A 4EEKA 2QJOA 3ZY2A 3IUPA 5LBIA 4YLGA 4CV2A 1ZUIA 1K9SA 1T5HX 1FUYB 1SIUA 3HSYA 3WYCA 4E13A 2R1ZA 4EI2A 1OX6A 3OZUA 4UQOA 2VOEA 2YVAA 1Z7YA 2ATXA 2R2GA 3NP7A 2GJ4A 3PGMA 2OTCA 4F5EA 1WHTB 4QUIA 5M5BA 3W2IA 2RE8A 2BUAA 3DEFA 2WUEA 4RQBA 2OHJA 3DPSA 5BSUA 5IVPA 3U3JA 1D6NA 4TT3D 1O0CA 4RDHA 4AF6A 1QH1A 4KXYA 3C6BA 3RC2A 5KWEA 2AV6A 1PS0A 1BOFA 3G1UA 3CLKA 4P4SA 3IEXA 3TUZC 3E15A 3BZWA 4UM9B 1NUAA 2VNAA 4LJKA 5CVVA 3M4ZA 5EJFA 2HQ1A 1GAJA 1OBHA 4PTLA 2Z2XA 1DUIA 3X43A 5CDTA 3L8CA 1L7VC 4LWPA 4Q6WA 2B9VA 4C0LA 4ZQIA 1PL7A 3PEEA 7MDHA 3I01M 4KBYA 3ZCSA 1WUIS 4TQUS 4PSDA 5EIBD 5A5GA 1ZK1A 2HMUA 4FFBA 3SN6A 3GNSA 3CO5A 1RHRA 2H7YA 3MS4A 1U5AA 3QBDA 4US0R 5IVIA 5T6MA 4UZSA 4XX0A 2PH1A 1X7ZA 3JYQA 4MS3A 1OA0A 1YS9A 4LRXA 4R1SA 3UCXA 4ZJUA 2HGZA 3VPGA 1XOIA 1W6UA 2W2QA 3L5OA 4HQ6A 4QOJA 4W1SA 1XCPA 3OZAA 3RSCA 3TIVA 1EUZA 1RKBA 4GSKA 1RI1A 2ZRLA 3I28A 3MCTA 4S0XA 1HC7A 4FR0A 3ZW9A 1HYBA 1YMVA 2O0MA 3P5BA 1WJGA 4RC9A 3D7LA 4UPVA 2WLSA 3H1EA 4FWIB 3CUUA 4D4LA 4C2TA 3O8DA 3EPHA 3IUBA 5EJ5A 2NV0A 1J2TA 3ER6A 3TKYA 2NNLD 3A1TA 3R3SA 4HVAA 4HDMB 3V7UA 1APBA 3RUIA 2ZIFA 2KLHA 2HF7A 3GEHA 1SXPA 3UOAB 5IUKC 4BKQA 4F2GA 3HJHA 5JAMA 3LCMA 2JJ2A 1T2FA 1TCAA 5CLQA 4CMBA 1FLVA 4OIFA 2WSLA 3ZU6A 2QPOA 3F8SA 2R8OA 4GR5A 3NYQA 4I4TF 4CDRA 1UK8A 1A96A 2V1XA 3SVLA 4Q4AB 3ZY6A 3K1YA 4KUHA 3URKA 3ZY3A 1RYYA 4JHXA 1PI3A 4JFAA 3DMYA 3R7NA 4BIIA 5T7BA 4DQ0A 3OESA 1TKCA 1ISGA 1YR7A 3DTVB 4LXHA 4OBXA 3WLMA 3EF3A 1FDVA 4L3VA 1YUBA 3HS3A 5EEGA 3TH5A 1UPFA 2J5BA 4EF5A 1NATA 4D8UA 5CTJA 4ZTZB 3L77A 1HX7A 1RT9A 2BZ0A 3DAOA 4DLRA 4Z9XA 4KR7A 2B8TA 1B14A 1W25A 2QRQA 4UMDA 3PFNA 3BSSA 3K2BA 3ZH9B 1XZAA 2HQRA 4LRWA 1TFUA 3C4QA 5G2OA 3TR6A 4EX6A 1KI2A 1IWOA 2BDEA 2DVMA 1T36A 2UVPA 2VPIA 3A1VA 4TXLA 3RM3A 5DEOA 1XYVA 2PCLA 4KRYA 1Y89A 3M6LA 1E1QA 1U8UA 3B3AA 1EDEA 4TSRA 1IN6A 2NV2B 3OQIB 3B2QA 2G0TA 3OIVA 4NZZA 5G4KA 3REGA 2XKKA 1SVNA 4ZOLB 4XOIA 3L8YA 1TIKA 2W2LA 4G3XA 3N0XA 2ZRDA 2ZUCA 1EFAA 1W1WA 2TS1A 2HSWA 4H7DA 2CZCA 3EXG2 4PYQA 4YS6A 1C3OB 4FS8A 5KNCA 1UPAA 4BGUA 4EW6A 2JCXA 1D2CA 1TVCA 2CCKA 4A4DA 4GWLA 1B73A 2HN9A 3I12A 1N2ZA 3O8QA 4LV6A 2MU1A 3EAGA 1JEOA 4KDRA 4QHYA 3ICPA 3RRMA 5ALXA 4AXXA 1CYDA 2NOAA 4LHEA 3A4NA 5IAJA 4N01A 3BSFA 4QXOA 2VJAA 3P26A 1WCIB 3HGMA 1KH1A 3A04A 1UC8A 4I55A 1PFVA 3RHSA 2J6BA 3RR2A 3INTA 3IMCA 3AH8A 4C6RA 4PTYA 3CU5A 4HPJB 3JRWA 4X1KA 2CT8A 3MELA 2O6LA 3RBXA 3WWYA 2F43B 2LPMA 2CEKA 2X3YA 5EHXA 2G28A 4FZRA 3BZUA 4C1NA 4GYJA 2OD9A 3AX6A 3D4OA 2ID9A 2MYUA 2VQ3A 1N9GA 1UM9B 1A4IA 1VLVA 1WQ1R 1XDDA 2GO1A 3ORFA 4MKZA 4WTOA 2OSVA 4HQNA 1OBCA 4M37A 1BDIA 2FUCA 5KHLB 4LVOA 4B6RA 5KSYA 4ZT4A 4BGVA 1OZFA 4LIPD 4Q4JB 5CEJA 2Z3VA 1ZJJA 5J9FA 3SFVA 4YEDA 3MTDA 4Q4JA 1K8YB 2IT1A 3SE7A 2HPAA 2FSFA 3PK0A 3VI3B 4UW9A 4DIEA 4YP9A 1TFRA 1W4AA 1YHZA 2C4NA 3GRKA 2WFZA 4WKPA 3DWEX 3FFWA 2XXAA 1IMOA 3PTAA 4BVKA 3V46A 4HMQA 2R6GA 2JIMA 2PPLA 5GONA 1YFLA 2J46A 1R0XA 2C5HA 5K8JB 1YZUA 2OLJA 2DTDA 3BILA 2XTZA 2C20A 2VSXA 3D0QA 2OBMA 1G8PA 1CUFA 3EIQA 4RGQA 3THYB 4OHXA 3HJRA 2GH1A 3K31A 3AM5A 3OEYA 5ES4B 2C77A 3U7IA 1S2MA 3ZQ6A 2QX4A 3PGKA 3D6TB 4KXNA 4RM2A 2I1LA 2P65A 2PIDA 1YRLA 4YDQA 2WM3A 4K1XA 4YJ2F 1M5RA 3NUGA 3SLGA 2P2LA 2SCUB 3V8PA 3AY3A 2H1SA 3H4TA 5JE8A 3TMKA 2IHUA 5JNWA 4YAFA 4A2CA 1OGYA 5KYWA 4HAXA 1E20A 1QH9A 4L72A 4YJFB 5DBFA 2XQVA 3IJPA 5LNK6 3LL7A 2WJWA 2FZWA 1ZHHA 3HL4A 5DT2A 2G3YA 3FE2A 2VAPA 3FPGA 1KK3A 2ZJ2A 1G9XA 1ONSA 3HGTA 3LDFA 2C3MA 3HJCA 3PJEA 5ESWA 2FDXA 4O3MA 3AG6A 5A5DA 1AA9A 1FSFA 3KJIA 1R8JA 1J5XA 3A14A 4C6TB 4M0LA 3QEJA 1ZXXA 5AT1A 4QTTB 5J4KA 2IPNA 2V7WA 3EXEA 3BF7A 1P75A 1HBJA 3OJOA 2F90A 1SVOA 3NVKI 3R2JA 5EIAA 2K2WA 1Z2AA 3PKIA 1NXXA 4D5EA 3U48A 4YY3B 1GQRA 1JXQA 1VKNA 1KMCA 3BWMA 4BE9A 2DFLA 1FTSA 3NBMA 4YMGA 5MHTA 4L07A 1JYSA 4FCCA 5LP6C 5AJYA 2XGJA 1YJAA 2ZAOA 2PL9A 1RI4A 4H27A 4FVTA 5EE9A 5AM3A 2H1VA 1SCKA 1E1NA 1S1CA 4LMRA 1QPZA 3I01A 5E4YA 6YASA 3H9GA 1GPJA 5KVAA 1MC8A 4PTZA 4HXYA 3KO8A 3QXCA 4KXWA 4L73A 2XB9A 5AM0A 4CYMA 2YZMA 1PYOA 5U9CA 3V34A 1XNRB 3LY7A 3OFNA 2O3JA 3S8YA 1LC0A 1U5BA 2PK3A 3B8HA 2MYPA 1LSOA 2AJ8A 3DR5A 4RD0A 2VUTA 1DMSA 2DBZA 3E3LA 5SY9A 5LP6B 3QUAA 1G1AA 3TGPA 1K89A 4AUNA 4XR9A 3PFBA 4UTVA 2EU8A 2FOLA 2I29A 2ZU0C 1L7AA 5H4GA 5CD9A 4KQHA 1DOAA 1W46A 3EXFB 2XHZA 3IAM6 3OA2A 3WGLA 2PRZA 2WF8A 3HCPA 4X6LA 1WVGA 5AKZA 3UK6A 3EY9A 2O1XA 4B3DA 4LZJA 1DIBA 3N2GA 4GI7A 3VC1A 5KPJA 3S2IA 3IVRA 1USVA 3HKEA 1LBIA 2OAQ1 3E27A 4TKVB 1U7TA 1E7WA 1DXOA 1QFZA 1YQWA 1VA4A 2IDMA 2QMEA 4MWDA 4WX2B 2IF2A 3QBVA 1HK7A 4TN1A 3SZMA 5CAEA 4EHJA 4PGMA 4WXMA 3I2FA 3E6AA 3U2QA 4C9BA 1SXIA 4AYWA 2EG9A 4GNRA 5J1TB 3L41A 3M3DA 1W94A 1UBGA 1GN8A 1LPPA 1RBMA 1GGEA 1VJCA 2CZQA 2RBKA 2ZBGA 3I72A 3OX1A 2PL5A 4C07A 1NX9A 1QO0D 2D2EA 4WOCA 4XR4A 1DQRA 3K5PA 2VH2A 3RC1A 3U4GA 4MGYR 4N41A 1PYDA 3QEAZ 2XMBA 2PLFA 1RWXA 4ZV7A 3BORA 2VUHB 1V5EA 4JB0A 3A6DA 1G4UR 4AY2A 1VZ2A 4OU5A 1C9MA 4DSOA 5IAOA 2E0IA 4NENB 3T5DA 3U26A 3QZUA 3DCIA 1WNFA 4KFRA 3BQNB 4X97A 1D9XA 3UHOA 3BD8A 1FXUA 3ISTA 3KJQA 4LCBA 1AG9A 2W00A 1LBSA 1V2HE 4O4IB 2NQ8A 3QUBA 2O5CA 10MHA 2GNAA 2Q3CA 4HNQA 1M8JA 3COZA 3VQTA 3NNDA 4EG7A 2YVKA 4KPEC 5IJWA 3MMSA 1NLZA 4FYPA 4FBMA 3PRYA 4CDMA 1IY9A 2JI9A 3BFKA 1QIDA 4CQJA 4C5AA 1XF9A 4AKIA 1B8OA 2VRWA 4O4HF 2GPTA 3RV4A 4X54A 2JLXA 5JBIA 1TMYA 3THXB 1VL6A 2J3DA 3AHIA 2IPOA 1FJHA 1SHLA 3K6JA 3KAKA 4OYRA 4A9AA 3BKWA 5TRTA 3JQAD 3F8TA 3DKKA 1GSAA 1PBTA 1IY0A 5DGIA 4JJ7A 1B1CA 1O97C 1S6YA 3V1LA 1FTYA 5EESA 5CM2Z 3HR4A 2IS6A 3MCAA 3BE4A 3E3OA 1AKMA 4IHJF 2IUEA 3BXGA 4MVJI 3PLNA 3TN7A 1IZ8A 4RTJA 2A1UA 1QK5A 2J08A 3KVNA 2QY9A 3B1ZA 5K6RA 3DQZA 3SMQA 3T9FA 4GPZA 1L4UA 1RM4A 3EDOA 4AROA 2XYPA 4B17A 4U39A 3LF2A 1A4RA 1GEGA 1NIPA 2C2MA 3USZA 3FWHA 2X9QA 3H5NA 3D4LA 4W9MC 2IBSA 2H65A 2X2FA 4NICA 1D1PA 4R4JA 1U7HA 2PS1A 4Q16A 4LVNA 1X1EA 2RAUA 3F6RA 4BKMA 4D42A 1F06A 1G5FA 4HOYA 4BWYA 5I7WA 3T4PA 2C2GA 3WBFA 2AZ4A 1KR2A 3A32A 2LIPA 2X8WA 3QKSA 5K4HA 4BLVA 1A4UA 1PFWA 1NI4B 1IQPA 4R1NA 1IBLB 2AUTA 3EXEB 2QOEA 3PNVA 4M49A 4ZVQA 4BLRA 4R51A 4YI5A 1RXEA 3U9LA 1Z2CA 4UE6A 3EX7C 3H5OA 1UKBA 2PZAA 4G5RA 5KYVA 4KNYA 4YN3A 4KQ1A 2ZSKA 3MFQA 3H1GA 2Q9UA 3MTEA 4TRRA 3TRHA 1T6ZA 1G8JA 4N0DA 3QLEA 3DPUA 5KYUA 4I2NA 3VH4A 3T3GA 1M6YA 1YRWA 1DJLA 3WLRA 1C9KA 3CUTA 3QMMA 2DR2A 1TJ3A 4NC9A 2I6SA 2ZETA 4GU5A 2J7KA 4MVYA 5IJZA 3FZNA 1GUZA 1WU8A 4QU9A 3ZDZB 5I9NA 5L3SB 5ICEA 1HUQA 1T6YA 3IXMA 4Q0MA 1E7RA 4AZVA 1G21B 2C42A 3B60A 4OSPA 2ZKIA 4BX2A 2NO7A 1WXWA 4RV4A 4UBNA 5JD4A 5JJ5A 1W7AA 1H42A 3GCXA 3JQFC 5D5HA 3HDHA 3KWJA 2HF2A 1FDRA 3K35A 1G66A 1K8QA 2OT3B 4MV6A 3UBTA 3AVXA 4L16A 2AEMA 1JEYB 2ZQ5A 1CTQA 1T5SA 3TFQA 3E3NA 4JUBA 3LC7O 3L05A 4D9FA 3GJ3A 1TYZA 2OYCA 3UJBA 4BNWA 3CF2A 5DTEA 5E7QA 4OXYA 5FNVA 4CI0B 4HDNB 4B3XA 4H4CA 1N6LA 3QK7A 2A0KA 1LLDA 2IJGX 1XRJA 1H9CA 1LPSA 2FSVA 3DA8A 4P82A 3KQQA 5IM5A 3RYFA 4AS2A 3R0XA 3KJFA 3A2KA 4MW1A 1BX1A 1YJ8A 5KJEA 7MHTA 5JADA 3V8EA 3Q2OA 2EVWX 5IVHA 2C7VA 4QYXA 3A6ZA 1HYEA 4V0QA 1KJQA 1BCRA 2Q5FA 1AN9A 4PXSA 3ZHZA 3P0JA 4UUNA 4Y6OA 4RW0A 4NAHA 2YV1A 1J1IA 1FNCA 3Q2KA 4EIWA 1KJ8A 4LNUA 3GLGB 4NABA 2HMYB 3AL3A 3F3KA 3V2UA 3EQ2A 2VYNA 2ZB8A 4J1QA 3THYA 4XQCA 5K2OA 4PQGA 3FTPA 4M0PA 2VHZA 3Q6IA 4NENA 3EY4A 3UQYS 1DZIA 1Y8QB 3BMXA 3JASB 3NBFA 5C51B 5KC9A 1TM4E 2RGBA 3E61A 2N9UA 4JXJA 4OQYA 2REXB 1OOEA 4P54A 5JZBA 4PIPA 2YXPX 1UDWA 1M8KA 2JIQA 2PGAA 3HRIA 2VBCA 3RVNA 3ZWYA 4ZICA 3KQOA 4WOJA 2H9IA 1RAGA 5ALIA 4W5JA 2JFNA 3HVJA 4L6IA 1T8WA 3DTVD 3PWKA 1CEXA 4NYMR 4GIBA 3RUCA 3L4JA 1I5OA 4M8SA 3CKMA 5EHNA 1UXIA 3KVVA 4TKMA 4TXNA 4TT8A 3FTFA 5FUVA 2XTNA 4AK9A 3EDRA 4CTMA 2FPOA 2QD5A 4DCPA 1XTQA 3QFHA 1NDQA 1YRYE 4MAAA 3SR4A 1Z25A 1P45A 3CZPA 3GZNB 5L3SA 4FYMA 3M6UA 2WIBA 2OBNA 2Q7XA 1PGNA 4G37A 2ZYWX 1R0BA 1Y3BE 1G3QA 1W8IA 1LDGA 2H1HA 4Q3CA 2YMQA 2F1OA 5LLSA 3RF6A 5FOTA 2AOTB 2B4AA 3V2GA 3LFTA 3VJLA 4KAFA 4N1AA 1JI0A 4J0GA 4NCIA 5AM2A 5JDCA 2HJVA 2A35A 3C41J 4E07A 2PRYA 3K9GA 3STHA 2CL6X 4F56A 4KXQA 1JSXA 1VKZA 1D0VA 2V7EA 2Y99A 1T4DA 5EP3A 2ZFUA 4FDUA 5CDFA 4DCUA 3LK6A 3V42A 2IBTA 4KO8A 1K6IA 1FUIA 3ZE8A 1NYTA 1RHKA 2ZUFA 4TMVA 4OGLA 4UM5A 1V3VA 2Z1MA 1HYQA 5DSZA 2O9JA 1CR6A 2H3HA 1EXMA 2OO7A 2PSDA 3SC6A 4D79A 2Y8EA 4QNNA 4E5DA 4WLFA 3DV0B 1LVHA 1ISPA 2FEMA 1CNMA 1KVSA 4XD7D 5ECYA 4ZGBA 4DN6A 3D81A 4JOCA 2IYVA 2RI0A 3EZ2A 4KMRA 5BYAA 3KJNA 2P9QA 4FIDA 5JFOA 1ORIA 3TMAA 1NVBA 4XFDA 1DCFA 1TA0A 1IM8A 4BNLA 3GMIA 2AKYA 5G41A 5EP4A 2OFFA 4C88A 1VRWA 3MWGA 5AVSA 2P9HA 2XZDA 3DP9A 2EERA 1F4LA 2AOUA 5JAIA 1XNHA 1P7CA 3DHWC 2UYOA 4F4JA 5IT5A 3RVSA 4MWEA 4I9FA 1QS0B 3GT0A 3T6KA 1LBQA 1Y1RA 3RJ5A 2V55B 4EPVA 4FR5A 4TLLB 5HWSA 3AB8A 1T9BA 2J6IA 1GKKA 4ZQGA 2A67A 1W0KD 2R4QA 4CKZA 2EKZA 3IEMA 3AHJA 3L1VA 4D43A 1C9YA 1NMEA 2QMZA 1DXQA 1KPIA 3C7DB 4R1MA 1QZZA 2VHTA 4S1VA 2VDUE 4M0UA 3LPAA 3R7LA 3VVCA 3HWX1 2OAEA 3GFVA 3NR2A 3KTOA 3VNUA 4FCTA 3IDQA 3LM8A 1C4WA 5J23A 1NV8A 1Q7BA 3LU1A 3Q7EA 3CQ9A 4YJ3F 4QDJA 3WKAA 1XQWA 2ONKA 1KZ1A 1XU4A 2ZS8A 2P2DA 3EC2A 4ARZA 1HI9A 1O8BA 3ENQA 4YACA 5ERGB 3JALB 3BICA 3I58A 4KQMA 4DJFC 4QUGA 1MN6A 4LUCA 4QGBA 2FRXA 4K0RA 3WA7A 2VYVA 2IGTA 1XP8A 2YNMD 3NVMB 1N2CB 3MT9A 4MV7A 1V48A 4WQMA 3ZBPA 4MPPA 2CHUA 5CA1B 2Q62A 2AQHA 3HZRA 4XIIA 5AW2A 1QHYA 3EZ6A 1E18A 4LYAA 4XWTA 1DNPA 5MFZA 2OHIA 3I2KA 1ZGAA 5G4LA 3T06B 1Z16A 2WAYA 3TOZA 4BGDA 3WI7A 1RPAA 1PU2A 1ZICA 3KBOA 1GLNA 4JEUA 4J0JA 4LCEA 4RPGA 2CY0A 4HNAB 5IANA 1BMFD 5JI2E 1T91A 3KSMA 3R0ZA 1KK0A 3KAQA 1JALA 1DIOB 3KQUA 2YXEA 5AK3A 1M34A 2ZWOA 3AV3A 3T35A 1U0JA 4S3MA 2FWNA 2TYSB 1NIJA 1QGZA 2CLOB 2FUG6 1Z5ZA 4D57A 1WV1A 1EIWA 1JIJA 4LRUA 3A11A 1OBVA 4NCJA 4BO3A 4JQCA 2QSUA 1GUAA 4GECA 3Q10A 3UMYA 1N8NA 1XZLA 1MAUA 2BOVA 3DNFA 1Q7EA 1ACLA 1T5LA 3EVFA 1KMNA 3X1YA 3RW9A 1MNQA 4LY0A 4B9EA 3TS1A 3W5IA 4I4TA 2GEVA 4KXFB 1E5DA 1E5QA 4Q82A 4QDXA 3TAXA 1OBFO 3U3XA 4R6XA 2A88A 4E15A 1J0DA 3VR0A 4AIIA 1PR4A 3EXHC 3BRWA 5C8YF 3UUWA 1HDXA 5EXPA 4B84A 2WU0A 1F9EA 3ZDBA 4YJKA 1B0UA 2WHPA 4H2DA 4CKCA 2QP4A 3B13B 3OT4A 5C5EA 2NO0A 4XTCS 3ACDA 3QVKA 1NVKA 3EPKA 4I6EA 4BB0A 3THWA 5E6SB 1BJTA 1O94A 3I1YA 4JI6B 1LK0A 2VL7A 5C1PA 1FU4A 2GEJA 2ZBFA 5EIFA 3E8XA 1S4MA 2DBYA 3UJ6A 5CA0F 2IH5A 1B6GA 1DQYA 4UHEA 4A91A 1CULC 2NACA 2CV2A 2ORVA 3SF0A 3AB3A 1N6KA 2JKYA 2CLLB 2GCIA 4YAWA 5FR1A 4MRNA 5JPIA 1KP2A 2VG8A 4U5XA 3M3PA 1ONBA 2J48A 2CVFA 2ZAMA 3U3OA 3EARA 1QX3A 3SZGA 4CZ2A 2XB2A 2WPDD 5FI1B 1H5UA 2WW8A 3FKSD 3OLVA 4Q7MB 4L5CA 1U8TA 4Y2RA 4CLRB 1LS6A 3H18A 1PZXA 3OZSA 4O2BF 2R7AA 1UPCA 3HB9A 3S2ZA 3D3JA 2OVBA 2GB4A 3EXIA 3O4VA 4V1CA 5EUCA 3I42A 3FYTA 3TX6A 1KO5A 4JR0A 1ZUD1 1Y5MA 1N6HA 1JA0A 1UDBA 4LQCA 5H83A 2WMDA 4ZOAA 5JYBA 5I45A 1FYDA 3VNSA 2HDWA 2GCPA 4IQ4A 4RMGA 2UZ1A 3UMSA 3PBKA 4BLSA 4D9MA 2B9EA 2REBA 2X0RA 3O2NA 2IU6A 5TDHA 3EQ8A 2Q0XA 2RG7A 1T36B 1YS2X 1TNDA 2UVPB 1ZI6A 2XD4A 4MUFA 4QFBA 3PD7A 5F3RA 5CURA 3RU3A 5BMVA 4B6GA 2RHCA 1L5LA 1MO5A 1WDWB 4HK4A 4P0TA 4BJ6A 3VR5H 3OIGA 2O54A 2R1TB 3VZBA 1NYLA 4Q1CA 2C7PA 3UN1A 1IZ0A 2GWRA 2XUIA 3QG5A 4IKEA 4LZPA 2R3SA 3HCOA 4V0KA 2CC2A 5H3CA 3ZGNA 1CETA 2VPWA 1PWYE 4P98A 1TZBA 3K0CA 1DBWA 1K5GA 5DHPA 4YRMA 4QNRA 5CFRA 1ODIA 2IOYA 5JTTA 1XZGA 3IQEA 1PQPA 4WKOA 3DYIA 2RGUA 2NUAB 2O1WA 3TBKA 2H18A 1MW8X 4B3GA 1HG0A 1UBJS 2XQJA 4WA8A 4EDFA 4OHCA 1K8ZB 2Q2VA 3BRSA 2BEUA 5ENVA 5T41A 4BMYA 4Z2AA 5LVAA 1G8KA 4N3GA 5D1NA 3EEOA 1J8QA 1P31A 1FFYA 2Q6TA 4UASA 4UU0A 1IM5A 1Q17A 1TUBB 3QWFA 4IIJA 5COQA 2B25A 1WM1A 3EBPA 2VWHA 3V4VB 2HKIA 1Z5OA 3Q0EA 1E79D 3TQTA 4CUZA 4FGUA 4GI5A 4K1LA 4ZC8A 2ZULA 1JPJA 2RC5A 4LOAA 5SZKB 3DMNA 3PHJA 3K15A 1GYRA 4BB6A 1Z75A 3ZLUA 3C3WA 5NLLA 2VDKB 4DFDA 1FP7A 4BEVA 2GJ8A 1RE0A 2IE8A 4IV0A 1E2EA 3F6EX 1QHGA 3UJDA 3A4LA 2AYYA 4YI3A 1PTJA 3WY9A 5IH3A 3EVDA 1HSOA 1M2JA 4YUAA 1U8CB 4Y2XA 3QPWA 1I6WA 1T2CA 3VU1A 4ZP1A 5DLYA 4YCMA 2O59A 2H2DA 4F60A 3R3UA 4GI3A 3S2SA 4M2LA 1CDZA 1NWCA 2PMDA 3L0DA 3RFTA 2C92A 4R9RA 5TPWA 3V7NA 4FM9A 5I01A 1N8KA 2JZNA 1Q0SA 4WK6A 1XUOA 2V6IA 2QUZA 3WGYA 3ESDA 3IHTA 3P9NA 4OMCA 2H2HA 5DI9A 2WWGA 3QKIA 4MWCA 2B2CA 3OE7A 3PXXA 3TSOA 1RXSA 1JEQB 2DSNA 4YFVA 1EFKA 1SUEA 3P9CA 4X7PA 3K6SB 2DH6A 5IXJA 3K4HA 3JARB 3NC0C 5DBEX 4FHFA 2IYQA 4OXKA 1P2BA 1CUXA 3TSAA 4TMWA 1UJ4A 3NORA 5LYJF 1Z15A 3TNFA 2HJSA 5C80A 1R64A 1V1MA 2UZIR 3ESRA 3M6AA 4OI2A 3SYKA 2ZR9A 1PT7A 5DBIA 1QAOA 2BBSA 3SR3A 2MTBA 4LNHA 3G0OA 1ILEA 5C1BA 3ENZA 2EZTA 1V3UA 4IS3A 3SHTA 1HMYA 4L51A 2G06A 3R6LA 4MVJA 4MX8A 3LPNA 3D5EA 3M33A 5SZJA 5LLTA 2YJ4A 2ZJ5A 4DLSA 4J2OA 4H0FA 1ZRHA 1G5HA 1TKBA 2ORYA 1J09A 3S40A 1X39A 4RF5A 1B6TA 4OYYA 3PC7A 5CFLA 1P5RA 3D2BA 4YP5A 4BN5A 1MTZA 3K8ZA 4MOWA 3UCFA 1S02A 1AXGA 2P91A 3DBLB 4A8PA 3VZDA 2C07A 4G1EB 4BNFA 3RSZA 5BPHA 4XJTA 4ZKEA 1Z36A 2BKEA 1HE5A 2GEDA 2WRZA 2YY5A 5REQB 4YYEA 3FPSA 821PA 1P1RA 5IJXA 2VP4A 1NQOA 4R8VA 5TX7A 2DQ4A 4LYHA 4C76A 1YBAA 2H2FA 3LVFO 2FMIA 3ND5A 3PFWO 4GPD1 4LXUA 4P53A 4NNJA 4FI3C 4MKIA 3LCVB 1N3IA 1BAPA 3HA2A 4H4DA 1XK7A 3OP1A 3KSZO 4G41A 4HI0E 3O94A 5JS8A 3JV7A 3EC7A 4PN7A 2GEKA 4DV2B 2ATIA 3AR2A 2R9VA 1V47A 3GRUA 4MWGA 3T4XA 1PYGA 4EA7A 1QH1B 1MLDA 2WJ4A 3DMPA 1DQPA 5FWXA 2DR3A 3CNOA 3QHQA 4N9QA 1TGYA 2D54A 1P2GA 3GJQA 1LK7A 1ANKA 2BBTA 2HEGA 3EBOA 3QPDA 2DUNA 3KQNA 2C7OA 2BM1A 1NLYA 5BNFA 5AVYA 3PFHA 4CM8A 1Y1SA 4I5EA 3ANLA 1FFBA 3B85A 4G9BA 1T0IA 4Y9DA 5AXBA 4PPNA 3Q8KA 5EGNA 2A2ZA 4JJGA 1U11A 4FP9A 3ZZTA 5THQA 4G4GA 1YC5A 4NMXB 4CFYA 2GBLC 3T1NA 4KOAA 2BGMA 3W1EA 1F8YA 4DPLA 4CE6A 4QQRA 4FGLA 2UVQA 4JLNA 1N5DA 2ESRA 2Y3IA 3AR4A 4GKJB 3BBLA 4ZO9A 4QULA 1LU9A 4JOBA 5C46F 4KK3A 4E09A 2V7UA 4P3XA 4P31A 2YIVX 4X64B 5A3JA 4HLQB 2XWBF 2XWPA 3RBVA 3PVZA 1R5BA 2QAGA 1WZIA 2PDAA 2CNNA 3GRCA 3K09C 3I8XA 2RG1A 3O9MA 3PC8C 5HCNA 4HNRA 2OKGA 4CMKA 1ZNZA 1DADA 2AOTA 3E3MA 2QM3A 3ICCA 4IOMA 1KDVA 2YOFA 1W96A 4KQFA 1JHMA 1L5HB 1AZSC 2H17A 3N59A 2DE0X 4DIKA 5F98A 2X77A 1R0YA 1H2RS 1CZRA 3EW9A 4RSRA 2QBYA 1GSOA 3W04A 4EYOA 4R1TA 2A84A 4YTEA 1ZUWA 3AY7A 5IZ4A 4DR2B 2HRZA 4KQEA 4DADA 2HNKA 3DULA 2KB0A 4N9WA 4TXMA 3G0GA 5JC8A 5B7NA 5KKCA 4MYHA 3VZPA 3DSRA 1HO3A 4K26A 1X74A 4F86A 4EA8A 2P9JA 1AQIA 5A5FA 2OZPA 4JQSA 4BZXA 2WINI 3B8EA 3F2IA 2WJPA 4G4SP 4GI2A 2FRVA 1W9MA 2CXTA 3GVHA 4EL5A 1SHUX 4WA7A 4J4BA 4KN6A 2BFEA 3KHTA 5EZ5A 3SYLA 3W2FA 1O77A 2G5GX 2Q2NA 1GGHA 5I9MA 4BLTA 2VXCA 5FV4A 1E9AA 4OXNA 4MQFA 2F6RA 3T9DA 3KYDB 1EM8B 4Z1MA 1RNLA 5CT9A 3G8DA 4URXR 2NM0A 2YC2C 5CM9C 3ADDA 2GA9A 4JSRA 2MT9A 4ZZ2A 3LTEA 1CRPA 3P96A 3WJ1A 2N47A 2IZZA 1ZLYA 4II3A 1JBKA 1NVAA 5IEBA 3UATA 4YXFA 5JVDA 5AWFC 1BVHA 2X4LA 4AJJA 2VQDA 5AJTA 4CMEC 4D4JA 1QZUA 1SGWA 4FLFA 4EG8A 4LF5B 2VWPA 2AS0A 1T4GA 3GEDA 2ZUBA 3O9ZA 4OKSA 2WQ7A 4EVRA 4PNPA 1S2IA 1IEWA 2NXEA 3S44A 1VMKA 4ON9A 4RZSA 3VI4B 2PM8A 3KZVA 4MICA 5AD1A 1AMNA 1TC1A 3OECA 3VHXB 4MYDA 1PJ8A 3EMKA 4Y1GA 3SBOA 5HZHA 4N5HX 2BHRA 4PSVA 1NBAA 4LFAB 1SBHA 2ABWA 2B37A 3L6CA 4LBWA 1LDMA 3PR3A 3U3KA 5BR4A 4RZ3A 4EJ0A 1K8RA 1O57A 4V03A 3S2YA 1BHO1 4GG1A 3EG5A 4GZ3A 3VR6H 4I9GA 3WLAA 4BFSA 3THRA 1VQ1A 2E85A 4GBGA 4IVPA 5EPEA 4BNMA 1PQ4A 1DCTA 3C3AA 4I6GA 4ND8A 1WDMA 2CN1A 2UUOA 4GM0A 1FZTA 1XRSB 2OV6A 3H86A 5K51A 4H31A 1L5GB 3S27A 3KDSE 3TQCA 4US2R 4WUTA 1AUVA 3T5CA 1X7WA 3H3FA 1XVLA 4TTQA 2Q6KA 4UXJA 1KZHA 1OQAA 1UZMA 2JAPA 3NYRA 3LA8A 1X7WB 1NQXA 5BSMA 3PNQA 5LBTA 3TL3A 3WXMA 4D3DA 2RBGA 3C3EA 4JOSA 3ZGYA 5DTMA 3IP6A 4A92A 3NO4A 1KYWA 5AUNB 1NW8A 5EE0A 1OC4A 1U2SA 4L5IA 2GOYA 4AM8A 2XZPA 3H2SA 3HP1A 3UV7A 3BH0A 5F7OA 1J1ZA 4R8RA 3G5UA 1JECA 1GAEO 1T2DA 2RCYA 3QEMA 4R2HA 5FFMA 4DGSA 3CNLA 5D3MB 1X0VA 5EQDA 3HYRA 1IYZA 4C03A 1KOJA 1QO7A 1FRZA 1HM5A 3SVZA 2LW7A 1YHYA 1G3UA 3WYFA 2OV4A 4A6DA 4BECA 5KTYA 5BSRA 1T0HB 4LF4B 1MMFB 1T15A 2JVJA 2OWEA 5IKOA 1HFWA 3KKPA 2AMLA 2AMYA 1VG8A 4IDHA 3W4JA 2X4DA 2MMCA 5I4BA 5ICSA 1XFDA 2I2CA 5CH8A 4ZQFA 2FEOA 3FWKA 4OCZA 4LPSA 4U7TB 1JTFA 4HWTA 1L1RA 5BUQA 2QUAA 4HLNA 2PMBA 2VDWA 1YKGA 1US8B 1YSCA 5ESDA 4BKOA 2NO5A 3WKBA 1AK9A 4NARA 1OX4B 3NHFA 1FU8A 4ZQCB 1QV6A 4FJ1A 2C2HA 2QM8A 3INGA 3ZK9A 2Z6QA 3NC4A 3VX3A 4J1SA 3PGA1 4LSMA 4S0ZA 1J25A 3PFCA 2XWJI 3LQ2A 3VYSB 4YCSA 3REOA 3BULA 1K2WA 3AP2A 4DJ5X 2PO5A 1JGTA 1F6BA 3FF1A 4OJQA 4EFMA 4XAQA 1JFTA 1U2DA 1RC1A 1YI1A 2DZDA 3MBOA 3CUEF 4MKGA 3E81A 1EE9A 4Y6GB 3FHJA 1FFCA 4QLBA 5HF6A 3FSGA 4RJTA 2P6UA 1I24A 2WT4A 4RV9A 2W37A 1FVHA 5AVWA 5JAQA 1BRTA 1F1BA 1DAKA 4FZ3A 4V02A 3RU2A 2C3YA 3VTFA 5CA1A 3TQFA 1DX6A 2DY0A 3WNQA 3DO5A 4G9EA 2VPXA 4P4GA 4EECA 4QREA 4OFWA 1X9HA 2C1XA 2HL6A 3NM6B 3FB1A 3PT5A 4BN0A 3U4CA 3DDWA 2VTVA 4ZXFA 3L7YA 1ZDMA 1TTQB 2X6TA 3KLNA 4CL0A 3ZYZA 2AI1A 3CO0S 3P2YA 5A5VA 1FFXB 3WMGA 3T0IA 3SQXA 1GFWA 3FWPA 3K1ZA 1COWD 3JQQA 5AUPB 4KKVA 4B1FA 3CNNA 5CFMA 1CJKC 1GY8A 4XCQA 3UMRA 5B1YA 4XUCA 4Z3KA 5FAKA 3T7CA 4JT2A 2DB3A 1OXVA 2B5OA 2X8LA 1Z2EA 5LD2B 1VLHA 2QUBA 1H1LA 1OSNA 1SMKA 2SNIE 3ZUPA 1P4AA 5BN4B 3D1JA 1U3GA 3MD0A 4D8WA 3DS8A 1G7TA 4B3IA 3AJAA 2VTBA 5L8VA 2ZTUA 4FNOA 3SHVA 3L7MA 4JROA 1SG0A 5BYBA 3ODGA 4C2AA 5T3UA 2JLYA 1TD1A 2GRUA 1G18A 2ZITA 1PTKA 5LQUA 3CYFA 2R96A 1VHJA 1U8AA 2AC4A 1QQAA 3RE1A 1N6PA 3H5IA 3LFHA 4CCYA 1DG3A 5BRJA 1C29B 3R3VA 5C8ZA 2QRPA 1ZJ4A 1X7HA 2VNJA 1ADJA 3GFGA 1Y3CE 4B73A 1G3RA 2AN4A 5F5LA 4QARA 5TQ0A 4Q4CA 2AN1A 3IXLA 3LQRA 3FAZA 2F9FA 3DZBA 1MHTA 2P3OA 2P4UA 1QB7A 2C99A 2EJTA 2P2SA 1F0PA 2NT3A 1XA3A 3MMNA 1CEYA 3RPEA 3RS7A 1DKMA 4HZGA 3DONA 5C2JB 5LMUB 3CM0A 3A7DA 4PAWA 3U3RA 3HBLA 3TSWA 3ZJ4A 1F8UA 2ZBQA 3JQ7A 1VBNA 4J90A 3DEYX 3U6KA 4YALA 6ABPA 4ZQBA 1EBFA 2HC9A 3VDNB 4KEAA 2BUBA 5TJ9A 1HT1E 3LYAA 4MRVA 2PGLA 4LGYA 1DC8A 1PEDA 4X00A