2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2IHZA 4V38A 2IIQA 4R84A 2EX0A 2IY8A 2IIBA 4V3CA 2IHKA 4R9VA 2C84A 2EX1A 4V2UA 2ILVA 2C83A 2IHJA 2IY7A 4V39A 4V3BA 2II6A 2Z4TA 3S44A 4R83A 2ZWIA
chains in the Genus database with same CATH superfamily
4JJ4A 5G02A 4DSTA 3N2GA 1I36A 4DVJA 3NNDA 2FUEA 1AZTA 5C8DA 2G5CA 1FDIA 2NZYA 2FN8A 3OBBA 4MKXA 3RH0A 1E2DA 1QIEA 4OV6B 3D5QA 1CUCA 2FOLA 1QZUA 1ZNWA 4LYYA 2D7CA 4Q1DA 4F6CA 3RBAA 2POCA 4MNTA 4PC7A 2F43B 1JFFB 2WM8A 1ZP6A 1QQ6A 2I55A 5EKXA 1KFKB 1JKXA 2DOKA 2E4VA 3OY7A 4FW8A 5EL0A 1Z83A 2EWMA 2DCMA 5D6OA 4RDCA 3C1TA 2FMTA 2VQ3A 3HVUA 4GS5A 4C0WA 1CUYA 1ODFA 2AEEA 3TLAA 4JSYA 4IIEA 3ZU2A 4BFSA 4RWEA 3D81A 1QX3A 2CDRA 2QEQA 2UYGA 1Y8AA 3C3AA 3F8WA 3Q3VA 5CX1B 1VE7A 1KOFA 1K5DA 2VXBA 4UEWA 4YYZA 3PDIA 4LXGA 4RM2A 1HDZA 2GTHA 4YRBA 5AUOB 1X94A 2W58A 2KX7A 2NUTB 1BEUB 1SXHA 3P7MA 1PUXA 1QQTA 1T1RA 1E2GA 3CLTC 3JASA 3HXTA 2D54A 1IDN1 3MJRA 3CPJB 3NANA 4V0MA 1RZ3A 4EQ6A 5K0BA 3Q7IA 4INZA 1T9GR 4MDFA 5EJAA 4ZJYA 1MEJA 1N9ZA 2HA5A 5J1TB 3PHHA 4ZJUA 3KQQA 4Z49A 1O57A 3T3IA 1ACMA 3TD6A 1KJZA 1UP6A 3GLUA 4DG8A 3TLMA 4NU8X 3S1AB 2VT6A 3TYXA 4BV2A 2XGMA 4U2FA 4FLEA 5BPHA 3DL4A 1DBQA 1JS1X 2P9YA 3RS3A 4DL9A 1OLSB 3HXKA 2IBTA 1TKAA 2AKYA 3NTLA 4M0EA 4O4HA 3M1IA 3JD3A 1OFIA 1F51E 4LHSA 2DP4E 4R16A 2ZR0A 2G3YA 2NYUA 3ACDA 2M1XA 4KBGA 2Q2VA 1XQ1A 2DQYA 5JAQA 3RVDA 2WTUA 3ZKWB 1NKSA 3PKJA 4URYR 3ZQUA 5J4VA 4IWNA 5EHIA 4LNAA 4WFIA 1M9NA 3BREA 4MRSA 4LYDA 1G7SA 2FPLA 3LX6A 4LZAA 1LWNA 1JJVA 4DAOA 4RJIA 1Q15A 2R1TB 3K1AB 3OFVA 1JXAA 2ZYHA 4XEUA 2GTPA 4ICIA 1HI9A 1YULA 4DTCA 4BO1A 5CXQA 3TLXA 2CC2A 1RXCA 1OA0A 3PJEA 2RCYA 2GEDA 1BKDR 1DU4A 3DDCA 4GZMA 1IC6A 3WIBA 1V9CA 4YMIA 1IOWA 4UFOA 5GPBA 4EF5A 1B8PA 3QW2A 4GC9A 5JSZB 5DM4A 3MF4A 1DARA 1ZQ9A 4MWGA 3RS4A 2C7VA 2W83A 5JRJA 4C4YA 1Y33E 5B7QA 1A9RA 1MV5A 5IBCA 1U63A 1PQUA 2JEYA 3FZNA 3V8VA 1XZ8A 4Z0NA 3ER8A 4L74A 2ZXUA 1C1DA 3QELB 4EG7A 1D3AA 1XD2A 3FWZA 3IBCA 4LTDA 1VLHA 1Z7BA 1R27A 2L42A 3N8HA 5E1BA 4BZWA 2C00A 4FEAA 1IN7A 1A2QA 1NVAA 2GAOA 2OD2A 2R5WA 3SG0A 1L1QA 2ADMA 2H0AA 1C4XA 4GR4A 1JJIA 3VPXA 4EPVA 4AN0A 9ABPA 4MITA 2O54A 2CVOA 5I01A 5BN3A 1WDKA 5DYWA 1QB8A 1HE4A 5I7AA 3IMCA 4RWZA 3VUEA 1TCVA 2ZUCA 1DC8A 2C8VA 5JPIA 1J8QA 4AZSA 2NZVG 1YZGA 5ECGC 3Q6MA 4TL6A 3FE2A 4CETA 4KQ1A 3N5CA 1F38A 2REQA 3VO8A 4TSRA 3VKGA 2A1UB 3UGTA 1C2YA 4GF5A 1GGMA 1AZWA 3TSWA 3AERA 4YCBA 5DTIA 4URXR 2H8KA 4QRIA 2YWEA 1A95A 2VYNA 1PLLA 1YBMA 4M7OA 4QC2A 5HRAA 2VHJA 4PG4A 3WLNA 1ARZA 3GEHA 4U5QA 4AMVA 2IW3A 1MAUA 2W22A 5E3IA 5JAPA 1NU6A 1IB0A 1U0LA 3F6EX 2HNBA 4RHXA 2VDPB 4NFLA 3R9XB 1I4TD 2NXCA 1C30A 3KTAB 5HQJA 2R4UA 4I5FA 1IEVA 4QXAA 2O1EA 2ZBEA 3EJ6A 1W2HA 4GZ5A 1CJKC 4QOSA 1L4EA 4U6NA 2F1RA 5FB3A 2IYXA 2P9ZA 3IMKA 5DHAA 3C3EA 4LEIA 4OI4A 2G28A 2JFWA 1YDWA 1AVTA 3D6AA 3HB0A 3I9FA 4IRMA 1JSXA 1GN9A 2NQ2C 1FMTA 1XDZA 1GPDG 2BBWA 2HEGA 5AJUA 5FNVF 1LLDA 3DMRA 4MKFA 4YT8A 3LQKA 4AVYA 1A96A 1OYOA 3N87A 9LDTA 5IF3A 4J6EA 3SC2B 2GPYA 1NA5A 4UNNA 1H2HA 4E5UA 2CHUA 3BJZA 3K1JA 4RC9A 1QIHA 3IJ5A 4GI1A 5ALJA 3S8MA 3X1JA 1XZDA 2LCFA 2QN6A 2Q5JA 4LXUA 3SK0A 4B6OA 2WJIA 3N8NA 1L5GB 2QBYA 1V3VA 3SLKA 4OQMA 1B2LA 5C34B 1PF7E 2A84A 3H6HA 2C0CA 4GRIA 2APJA 4QRDA 4M8KA 2LKDA 2DHCA 2ZI7A 3B3AA 3C5VA 3FUCA 2G83A 5H5JA 1V45E 2I71A 1ZK3A 3I92A 4NS1A 3FW1A 2PCLA 4ZN6A 1BZYA 1E9VA 3KUCA 1U8ZA 3NDJA 3LBAA 1NXVA 2IDZA 5EJFA 1U4OA 3DWEX 4RSRA 1AKRA 2BBSA 1JKFA 2EJUA 2VDJA 5D87A 4MR9B 5E7IA 5TV2A 3ZGVA 1YR2A 1FB5A 2ZB2A 3OEHA 3GI1A 3WY9A 4KTTE 3CVOA 1SZDA 4Z6KA 3NTQA 1C80A 3C8DA 4LVCA 5LZ5A 4B74A 3PNMA 1EP2B 5CNJA 5T8KA 4DCTA 4DWWA 1VJDA 4RY8A 3D7MA 4QQNA 2IX3A 4FYYA 1E9SA 4E5NA 5I3ZA 1XCGB 2IPMA 2ONYA 4E4YA 1G7TA 1EB8A 4RH3A 1B73A 2WF9A 2WF7A 3DMTA 4LXQA 4JMLA 1LLFA 4XSHA 2R79A 1CR1A 4PXYA 4BECA 4LOIA 4JN6B 2DECA 2NO1A 1QC5B 4D4GA 2PT9A 4OTZA 3DEKA 1A9XB 4NH0A 1UR5A 3H8VA 5C81A 3TIXB 4DLBA 1CY2A 3CSDA 3QVMA 3Q88A 4A23A 3NT4A 1C50A 1QS0B 1QFSA 2CUNA 2VATA 2HF2A 1VP9A 1LX7A 2I6UA 2G1UA 4PAMA 3Q40A 1Y6JA 5EZYA 2GK4A 1R8SA 1TUBB 2QWXA 1PAUA 1GAJA 5ITVA 1P7PA 1Q7GA 4JQYA 4OQPA 4EGAA 3HCEA 4L75A 3Q0IA 2YHSA 3O8OB 1T24A 3GPDG 2QB5A 4C1NA 1GG9A 4CODB 3UO8B 1YVPA 1N6KA 3P9XA 4M2LA 1RWXA 2YXNA 4LF8B 3AEQA 4TLDA 4M3NA 3LTEA 1E2BA 1C9KA 3OF5A 4OUKX 4RU1A 5D51S 3OX1A 1AUXA 2PQMA 2BFEA 1C3LA 3C6QA 1J99A 4A6DA 1NC1A 2XW6A 2Y3IA 5CNMA 2A0WA 2JD0A 1UDBA 2NU6A 4U0JA 3CX4A 3QUBA 1U9CA 1RAHA 3UT6A 1UJMA 3V42A 4FILA 1BHO1 1YR1A 3TZHA 3F1KA 3NH6A 2HRCA 4TQ9A 1JLRA 2QM0A 1KVUA 1QGOA 5DULA 1C5KA 4BV3A 1VJGA 5KNDA 4O0MA 5IN5A 2QM8A 3IKTA 4JB0A 4L1KA 2XZOA 5B53A 1L5NA 2L69A 5TMBA 4F6RB 3O31A 3D43A 4PX5A 2DH6A 4RVGA 4FZVA 1GZ5A 1SXJB 5FIUA 1MOSA 1Q6ZA 5T4HA 3ELYA 4UPEA 1I2BA 4OYYA 4E88A 3WIDA 4LF5B 1TZ2A 2CUZA 4RY0A 5JG7A 2WF6A 4W7SA 2XMPA 1SQGA 3HYCA 4MKHA 5FLEX 4IJWA 3WJ2A 3B1KA 3DCIA 1Z6AA 3KB1A 2BMDA 5JAHA 2BM8A 1P0PA 5IEBA 4DA8A 4KQFA 4YHBA 3LU1A 3FCSB 1G60A 1YASA 3L7LA 4XE5A 5H02A 1US8B 3RIGA 4XUEA 3JQGB 1KYYA 1A0OA 2WM3A 3VR5H 1EA5A 1IZZA 4WCFC 5ILGA 5IM5A 1E2PA 3HR7A 5REQB 1T2UA 2NGRA 3IYLW 4O4IF 4WPGA 5GMOA 2PZEA 2BEVB 4Y2PA 5IMBA 2LZ0A 1Y6QA 3OBIA 4F38A 5DXJA 5JEEA 1E4EA 5E8JA 4CUJA 4IKEA 1YONA 5LKAA 2WP0A 1MFZA 2Q49A 3FJYA 2QRLA 4QVKA 2ZBRA 3CH7A 1O2DA 3EPKA 1E1KA 3L6CA 5SY9A 4HH1A 1QHEA 1U3WA 1JKMA 1WW8A 1YIAA 1WP9A 2C4KA 3INYA 3BRWD 1XVTA 3KOYA 3OT1B 2CXNA 1Z29A 3DV9A 4EHNA 5JROA 5SZHB 2VNKA 2X8WA 4Q3AA 3EQ7A 1UAYA 1EM6A 2YNMD 3OX2A 4K6MA 3IUYA 3PJDA 3NW9A 1NJ8A 1T4DA 4Y0NA 3W9YA 3T1HB 1U2GC 3AM3A 1CNEA 3TMYA 2CUTA 1NI3A 2RKWA 1SOMA 1L3IA 4J91A 2XGJA 4RA6B 3AG6A 4RJLA 1DNPA 3NHLA 3KZXA 1K06A 2QUHA 2ZRJA 3W7BA 4TZ6A 5BWLA 3EDMA 4E22A 5JW6A 3ESQA 2DLDA 5B6PA 2VWQA 2M2IA 1RQGA 2VAWA 3FYUC 3WGVA 2HR1A 1DINA 4W7IA 5TS2A 3S55A 5JY6A 5DGCA 2YXDA 4MV1A 1ZIPA 1NW6A 2EGGA 3D9QX 1NGSA 4V38A 5LOVA 1JU4A 1P81A 5JYDA 3H1AA 2JHPA 4I55F 4DFDA 2VQSA 1YC5A 2HA6A 1G98A 3QVKA 2XAUA 1PS9A 1SKYB 3O90A 3TQHA 5TQVA 1ZWKA 4BP3A 3T5DA 2LTAA 3B51X 4BQQA 4O2LA 1QE5A 2KLHA 2BDUA 1HKHA 3OZSA 3IEIA 4M55A 2D5CA 1E9EA 2VXOA 3DE3X 1UQTA 1KAQA 3WBFA 2FCAA 3UBTA 4HD8A 5FPTA 2NYAA 3WTBA 2IGTA 4P84A 4KITB 4UUBA 5LYJA 1ZN7A 1R0BA 2O50A 3A28A 3LY9A 4N3NA 1RWOA 4CV0A 4YCCA 2QLTA 4M1WA 4MRMA 4QGAA 1G291 1JAXA 5GM1A 3BMOB 1L9XA 3RI3A 1IHDA 4MS4B 4C0XA 4QVIA 1GKIA 2FW0A 2J3IA 1L7PA 3B1FA 2R8OA 3KLBA 3UGKA 4D2IA 4PR0A 3OCWA 3AZOA 3IPAA 4EJ2A 5ISMA 4PC3A 4A0RA 2YOFA 4II7A 3KSZO 2B78A 1OI3A 1JJFA 3IJEB 1Y4SA 3H2KA 4AMUA 1U3VA 2V9ZA 1TPZA 4GR9A 3VU3A 5JCJD 5JH7F 1QLJA 1W5BA 2QAGB 1EFAA 4EECA 1X7WA 3RFUA 3ZN2A 5JD3A 2FUKA 4ENRA 3RYFB 3I0NA 4GLFA 3R3JA 3EUEA 3MTIA 3GJ8A 2J59A 3SQLA 2AOUB 4BO4A 1H66A 3LOPA 1K2WA 4XR9A 1N0VC 3MAJA 3GCGA 2I65A 4FFWA 1L5KA 4DRYA 1B6TA 1Z3CA 2IPLA 1RYEA 3HYSA 3KKQA 3O95A 3ND7A 1V26A 2XXBA 1JEDA 1EVKA 2Q2OA 3IE0A 5CVUA 1ZCAA 3VZQA 4WCFA 1TT5B 3QZUA 1E5DA 4NCKA 3RC3A 4YDQA 4IJMA 3PEWA 3IUJA 3WRWA 4KI7A 4NONA 2N46A 3FSJX 1JZSA 2RB5A 3E1KA 2BFFB 1FNDA 2WC1A 1EE1A 5F5LA 3SJBA 1IH8A 4ISCA 1ORTA 2AK2A 3WLSA 1YZLA 3ZQJA 5FO1A 3HWRA 4TKVA 4MUBA 1BDHA 4EJFA 5CVDA 5D7BA 1RXSA 3A6HA 2D1TA 2XQIA 3VMFA 1E89A 2AQ8A 1QCDA 1IG0A 4HH4A 3GQBA 3H65A 1QHIA 3O4JA 3DT9A 1QTIA 5BSVA 1RWPA 1DIGA 4J4HA 4E7PA 1FDWA 1JLHA 3PNBA 2VPIA 4PTLA 1RRKA 4JI0B 1GTJ1 9LDBA 4QJ4A 2VSYA 1G21B 3QEOA 1II9A 4IZIA 3EOZA 2CB0A 4P4NA 2N3ZA 2VBGA 3PNVA 4FNMA 3ZDYB 3L7JA 4G5YA 2WSBA 3PA6A 3GPBA 4G1UC 1JQBA 2XE7A 3L8MA 2ECQA 4JGIA 4N65A 3U13A 5B30A 5JZMA 3TZKA 3ZJ5A 4EF6A 2GK7A 5HM8A 5ALOA 5HFJA 4NBVA 4ARVA 3GPIA 4YLYA 5HCUA 1KYIA 2E85A 2Y4OA 4OYLA 1I4DD 2R6ZA 3IBFA 4FWIB 4Z9AA 3HN6A 4JWTA 3EPHA 5BR7A 4X6LA 4CUZA 2ZITA 1UADA 2FI1A 1EP3B 3C8MA 2C95A 3PEFA 3NC4A 1CJMA 2OZEA 4PC2A 1CS4C 3LPDA 4UCWA 3LXXA 1VZ2A 4UM9D 5BXQC 2EG9A 1C3JA 4DLXA 1C9EA 2O06A 3A36A 1XYVA 1GV0A 3IIEA 2PL3A 4G4JA 4KCGA 4O2BA 3WSVA 1WHSB 4D8TA 3BT7A 2C88A 1B15A 4TTJA 8ATCA 4UU0A 3L0DA 2Z30A 3OOHA 3TQFA 5TQ0B 2PLWA 2X0IA 5JZ9A 1CX9B 1IAVA 2ADOA 3I0MA 5EQDA 8MHTA 2MYNA 1RXYA 2QE6A 2QSZA 5DGHA 1FX0B 2H85A 2VRCD 3LVRE 2MJLA 3PG5A 2WVAA 2PJUA 3DXYA 4Y1RA 1M1YA 2B1JA 2PV0A 2QTBA 3EZYA 3R0VA 4DV3B 1L8QA 2LIVA 2P6MA 4G86A 4DQUA 2VP0A 2JD1A 2M6SA 4XARA 4LV6A 4L5JA 2HYIC 1GD1O 3QEBZ 2ZBGA 3AKZA 1YTUA 3O84A 3QQ5A 2H0QA 4NV0A 3KYCB 1Z7GA 2W6MA 1OLXB 4J0HA 4LZOA 2D1SA 4ENSA 5J23A 3KT0A 1GM5A 1MO4A 1I4LD 2P0AA 3KJFA 4GWGA 5H7XA 1KRXA 1V25A 1IPFA 3FWPA 3GD7A 2H1CA 3I01M 4F93B 1K5PA 3K0FB 3AOGA 5DTMA 4XQCA 5DN6A 3WKDA 4IJQA 3ZU4A 1NYTA 4YREA 1W25A 1JILA 2IL1A 3BFKA 1QGZA 1GQYA 4ZPJA 2O8BB 1B8NA 1W0CA 4PCUA 3CLKA 2MCFA 1RLOA 3FWKA 1N1DA 2QHXA 3NV7A 5I4KA 4IL5A 2PLNA 1U1GA 3BDVA 4FHCA 1DX4A 1ONPA 3AF1A 4RZHA 4D96A 1H6AA 4YJ3B 3AYZB 2DULA 4HDQB 4CRWB 1SCKA 2R6JA 1DXHA 2JCBA 2JFXA 1JHRA 2JDID 2WZDA 3ORYA 4M9SA 4Q5IA 1XVUA 1Z5PA 1AC5A 3DKIA 1V5FA 1UH5A 4CKZA 3VHRA 5TS3A 1J22A 2C3UA 3L6RA 5BORA 1ZHHA 4NYMR 3UTDA 2H00A 4UE3S 1ODSA 1ZC3A 3H05A 4MVJI 3ABZA 3TJZA 4C7OB 4G0YA 1P6QA 3D4PA 1IK6A 2C2MA 4YGYA 2C82A 1UK6A 4XWOA 1RYNA 1SAYA 3B1XA 4R4JA 1DAPA 2QW0X 4W7HA 2ENWA 1B14A 3CT6A 3OJWA 4WZAB 4LISA 3C24A 2CHFA 2HSWA 1K75A 5CYFA 2G6TA 4RE5A 3ID6C 3G88A 4X93A 4HRAA 1INLA 1M2EA 1O8BA 4B76A 3IMEA 4YB8A 3GDWA 4RUKA 3K9CA 5FOVA 1E7MA 3ZCXA 2PWYA 1QOQB 1XMIA 1P8AA 2I1LA 3BHIA 3DB2A 3GUZA 2VYCA 4R1LA 1M10A 4MSUA 1OGJA 3JSAA 4KE6A 2RGAA 2OLJA 3ESCA 3PD7A 2VNHA 3P9YA 1N2BA 1CJBA 2ZR7A 3ICVA 4HQKA 4DT1B 1RWMA 4DJTA 3G5AA 1B8VA 4XX0A 1U8XX 2QG4A 3EFOB 3A1SA 3GUHA 4UMFA 4NARA 1RIIA 3VH1A 1SPBS 4H4CA 4LKRA 3EFHA 4I5DA 4JI1B 1WW3A 2CBZA 1SC4A 2BSAA 2FDXA 2ODQA 3R6DA 1J2TA 1V9SA 4YA6A 1N78A 4M9RA 4KNWA 2CNWA 5I3CA 2Y1KA 2ECPA 3VJMA 4HS4A 4DDWA 5T7BA 1ZWLA 4LBYA 1NMZA 4JYCA 2CDCA 3L1KA 4DW8A 1Q0PA 3H13A 4PS0A 4H17A 3JD4A 3PWSA 1NRJB 3JVUA 3QBEA 3QE0A 5F73A 3STYA 3S2SA 3S2UA 1WU8A 3QEMB 4RZSA 1H93A 3D4NA 4MA5A 4JYAB 3ENKA 1J9ZA 2YFYA 3O83A 1UF9A 3TIFA 5C8YF 3A37A 5FXMA 4GP6A 3D64A 1VA4A 3OUTA 1GUDA 1HT2E 5T4BA 3UPTA 4G67A 4F3CA 1FFXB 2V7PA 3B5IA 1JHQA 1QIDA 4RPLA 4NZPA 1T35A 3Q8MA 4KPYA 1P7WA 4DPLA 2X4IA 3IPRA 1GRQA 3I37X 2NWQA 4IOJA 3S2YA 3GJ3A 5DE3A 3SX2A 1VL8A 3VR5A 1W36B 2ODTX 1I7DA 1JFLA 1HFWA 3ESDA 4KQJA 4FS8A 4KIGA 3MPUA 2NU8B 2J45A 2AE1A 3PCRB 1HKUA 2HSJA 3GYBA 5A9SA 3X1ZA 1WZNA 2GUWA 5DHTA 1KPIA 2BDEA 3JAWA 4FI3F 1LB1B 4J0EA 3KJZA 1K7YA 1RJEA 5ICSA 4L27A 3DBHA 4QBKA 4BN4A 4BWVA 5B57C 3G59A 3NUQA 4MUGA 1D5CA 3EGEA 5KJEA 3VO2A 3OZAA 3EVTA 1GPH1 4IDBA 1RPTA 4IDEA 4F2WA 3BL8A 5BQXA 5BP7A 4IIJF 2CE2X 3VJRA 4MCIA 4UCQA 1IB6A 4JXKA 1DFHA 1NHGA 2FPGB 1AA9A 1RVV1 2VBCA 3LF2A 4M1MA 1SURA 5FWDA 4PYQA 4IDDA 3UHJA 1C14A 1GVHA 1WX1A 2DUUA 2UYHA 5M7EA 1F4LA 4POAA 1L7BA 1UJ5A 3F73A 2PUVA 5IAAA 5LUAA 3NHAA 3LQQA 5ENDA 3DEIA 4QJBA 2HD4A 1V2GA 3FM9A 1CR0A 1U1EA 4HTFB 1TECE 2CF6A 1OAAA 2FSPA 3DAFA 1OC4A 3EIHA 1JTFA 4MIOA 2V0GA 1WBJB 3RYIB 2Q2NA 2EKZA 4OQXA 3A7EA 2R8YA 4IILA 1SULA 2GCPA 5DT2A 2YFKA 4P2GA 4Z7JA 2PSDA 2VWPA 1O97C 3ITNA 3PJRA 3I4CA 4J76A 1DV2A 5LA6B 1H9AA 1F8GA 3UJPA 5AJYA 3T1TA 3HP1A 2ZE5A 3A7DA 2QPOA 3V1UA 3MWJA 4YP0A 2VJNA 4PXSA 1FNCA 5DLPA 3TW4A 1XKLA 2IEBA 2FWNA 1NAHA 4TWIA 2REXB 4ZVOA 1F8XA 2W71A 4A0GA 3R76A 4IXTA 4BKMA 1RC1A 4BJ3A 5CA1F 3MEQA 1R5OA 2HPHA 2Z9BA 2FPSA 2GD2A 3AHEA 1N4DA 2OM6A 3ECCA 3IVGA 1U2PA 5I4IA 1OF1A 3AHJA 2VJMB 2ZUBA 3PQFA 1EB9A 1UOPA 2B5VA 2PKRA 2V55B 4P4TA 5DP1A 5I9SA 1IEWA 3MGCA 1G8PA 1IRIA 3NORA 2O20A 2VI5A 4IWXA 1T10A 2QX8A 3AP3A 5HS6A 3TSAA 3OTOB 2JFGA 2PSEA 5AMXA 1COWD 1DDIA 1JQDA 3G5LA 3UAZA 3ZI0A 1IUPA 4UTRA 3OZGA 3I9V1 1YZHA 1NF9A 5AVZA 1FMCA 1QV7A 2Y27A 2ZE7A 4H3VA 3S4YA 2I4LA 4GLOA 2BFOA 4IJKA 4RD2A 3H75A 4J1SA 1SK9A 3ANTA 4ABTA 1GYPA 3BZBA 3M82A 2O19A 4AI6A 3OE7D 3WQRA 3BUSA 4N3AA 3DMNA 4JEHA 4P7FA 5A02A 3SOPA 1HDGO 3QOXA 5ALMA 3EG9A 2EFGA 1Q0ZA 3IS3A 3ORFA 3WGTA 5CR9A 1Y8QA 2INGX 5IW8A 1AQ6A 3UWSA 3ZE6A 3TDKA 1QZTA 1RXEA 3K0HA 2G80A 4ED9A 4U8HA 4F7DA 2W2KB 2GZMA 3H5WA 3QKRA 4DLNA 1SG6A 3E0XA 4KBFA 4CKBA 4PPGA 1O96B 4P92A 3D1JA 1BU5A 3ZZ1A 1E6MA 1E6EA 2OO5C 3EGWA 2ZUDA 3QU2A 3HEAA 3Q9SA 1NWCA 4D9KA 1E7YA 4MRAA 4OQFA 3ZHRA 1XJQA 4XWKA 1JG1A 3I0ZA 1PFYA 5DNVA 1UJNA 4ND6A 3HCWA 4UVIA 1Z3IX 1X0VA 3B2QA 3BFXA 1KMHA 4LYFA 2FP4A 4WWHA 1V8BA 5CHYA 5DTEA 4MWDA 3AG5A 1XHLA 2D0DA 1VLMA 2QOEA 1KSJA 3VGPA 3N0VA 3BL6A 5G0VA 3U1VA 1S7CA 1TAUA 2C7PA 1E99A 2FE1A 2NV6A 4BWFB 3ZVNA 1KOJA 3F9IA 5EP2A 5CIWA 2H48A 4DOMA 1Z6QA 3W04A 2FJ0A 1MFPA 2NSDA 2FVYA 2JLCA 2XCRB 3UHFA 3L4JA 1AJEA 1GPYA 3TOCA 1RVDA 2IYRA 3ASUA 4E5DA 2RHCA 3FNFA 5MHTA 3PNQA 2WJGA 4PX9A 1CE8B 1OREA 1TGYA 3THOA 1E94E 1NV8A 2Q46A 3WP0A 4EEXA 2BJHA 4N9QA 5KTPA 1EFTA 1YU9A 3L7AA 3WRXC 3PRKE 3NHRA 3EMBA 4D9BA 2O3QA 4XGKA 1HYBA 1HE8B 4LFAB 1U0NA 2OA0A 5J4YA 1B41A 2OHJA 4KN9S 3TMAA 3QITA 3OECA 3CPSA 5F5XA 1JDUA 1Y9AA 2C4UA 4FMCF 4C7JA 1GZ3A 3VYVA 4A0QA 2IH5A 1EKXA 2FF5A 4B3HA 2RHMA 2FZ4A 3QVOA 4JOCA 4M38A 2AKEA 2QUZA 3LL7A 3NATA 2BGJA 2Q0SA 3GAAA 1GQSA 1ZK1A 4EG0A 4KZPA 1R9JA 3WL3A 3A2KA 3LT1A 1KS2A 5B64A 1FFGA 2R66A 3NEYA 4ZOLB 3RRXA 2ZJAA 1RADA 1PVDA 4CM7A 4OU4A 5BUZA 3RK1A 2B25A 5KYNA 4J94A 4XVHA 3CONA 1T2AA 2H4HA 4JITA 1AG9A 3WWOA 3T3NA 1Q1ZA 2F00A 2R6R1 3BK1A 1X1BA 2DAPA 3MJVA 2OXRA 3MB5A 4DG9A 1JHVA 1GAWA 1XV5A 2OECA 3H3FA 3TTYA 3DHVA 4QIHA 4EUHA 1Q3HA 4FHEA 3GFVA 2AMLA 3FBGA 1NF8A 2IYYA 4MB6A 3B82A 5EEGA 2PR7A 5A4KA 4I4IA 2Q5QA 5BWCA 3ROGA 5BSFA 3O75A 1S8AA 1ZM2A 5FTKA 2RI6A 2GBFA 3HZHA 1A98A 3FUVA 2FSVA 5JT1A 3V9AA 4MKIA 1UMBB 3TSYA 1DTWA 1TIPA 1KE1A 3CV3A 1C4WA 1V71A 2NU7A 4NRDA 5EFOA 3DYVA 4DVGA 3O8LA 2W6ID 3GAFA 4O4JB 2QE7D 2O52A 1C41A 2XPCA 1XZFA 4IWYA 2I4NA 4CQNA 3P9IA 1FXSA 1ZD5A 1Y82A 3GD5A 2AFIA 1CXZA 1MQSA 3GUCA 4WZBA 1VSQA 3RTCA 4BJ5A 3TR5A 4R41A 3KM0A 3KQLA 3DFKA 3U4MA 3AF3A 2GO1A 3D7NA 5AVTA 3ZCQA 4CTOA 4TQUS 2V96A 3P20A 3JATB 4NJOA 3R4VA 3O2JA 1C0IA 4RMNA 4GMDA 1G0OA 4UM7A 4TTTS 1SWVA 2NU9A 3BCRA 2A8YA 2YZNA 4JR1A 2A3RA 4MEBA 2OO5A 4BMCA 4DCGA 1LBQA 4KX3A 4PFJA 2B98A 2OP0A 4QA9A 4MARA 3J7AC 4QUHA 3E9QA 1XMQB 3EK2A 5JNLA 4B82A 1JPUA 4K6OA 4X94A 2J5BA 4DY6A 4RJTA 3IKJA 1CEQA 5T57A 1G9SA 3IULA 4N01A 4IUBS 1HFKA 5K3FA 1S3GA 2W48A 1FDTA 2JFFA 1O6BA 4J7UA 4QHYA 1AH2A 1JEOA 3G2HA 5C80A 3KOWA 1USWA 3VR6H 4EPYA 3LUKA 5AW7A 1ST2A 4UCFA 3IQDB 3KC2A 5CMLA 1IHYA 4IGKA 2ECFA 1SU8A 4H18A 1NMXA 3LDGA 1O3YA 4RL6A 3MWDA 4OHZA 1DCFA 2OORA 2Q1TA 2ZYSA 3W3ZB 2OFPA 3JQAA 2IY7A 1C1XB 1YHYA 1E1DA 4XJTA 2B99A 4F3NA 1U8TA 1ADCA 4GX1A 4U0KA 5G40A 2LCQA 4TYQA 1Z45A 3VVLA 4BTVA 4P4LA 1VE6A 2VXCA 1CHNA 4F21A 1O77A 3DE7X 1BXGA 1K89A 3M1YA 3UG6A 4AROA 1TUGA 4M1KA 1V7PC 4PZUA 1CV2A 2OCDA 3RSHA 4YDHB 2QVXX 3RNLA 2QRUA 3TS1A 2WAXA 1RQXA 3QX3A 1E96A 5ITWA 1JXMA 1G3QA 2QP4A 3CZ5A 4AULA 3IDAA 4DARA 3WBBA 1ODLA 3CW9A 4BLQA 2RCNA 2OPBA 4JB2A 1DRJA 1BROA 3GH3A 3F8SA 4W5WA 2P3LA 5D8DA 3WHPA 5KTTA 5LMCA 3EH1A 3KXKA 1SC3A 4HPWA 2I4RA 3MUEA 5THQA 5CW1A 1IN5A 1G6OA 2VHXA 2VIIA 3H5NA 2HK9A 3HE3A 1KDYA 5EJ8A 2WHEA 4KSCA 1VL6A 1DMSA 1W93A 3BFVA 1LBSA 3LW8A 4A8TA 4ZV4A 5AOAA 2XYQA 3FF1A 4L50A 3E8SA 3I6QA 3QLVA 4Y6OA 1JX6A 1RE0A 2ZSBA 3I53A 4K9RA 2KHZA 1U0SY 3ROEA 3AJAA 1KK1A 4A8JC 5KJ1A 5IT9A 1LI4A 3TI9A 2B4TO 2VJPA 4NK5A 2O2GA 3H0CA 5AKEA 3OCYA 5CFPA 4YRAA 4Q4HA 4F3YA 4J2TA 2IZ1A 3GMTA 4DQVA 4Y7CA 4RACA 2IE0A 3VR0A 5E6UA 1RM3A 2WDPA 5JLJA 5FLYA 1MB3A 1HRDA 3GF4A 2FUCA 4YDRA 4EI8A 1HO3A 3FNIA 2W37A 2XEDA 4F3TA 2I6QA 2BI4A 2R7NA 3R40A 3KSAC 1MAAA 4D57A 4ZYYA 3AJEA 5IYZB 1DP4A 4NNPA 3ZU5A 1LRKA 2IXFA 1DAFA 4L3WA 3U7RA 5HZHA 2CNNA 2BFCB 5DYTA 1PR2A 1XNHA 4KLRA 3FPLA 1VJTA 4PSUA 5FBZA 1PBTA 2G4VA 1LCIA 3TIIA 3J81k 3URKA 5E4FA 3V4SA 2HM7A 4R2JA 1Y80A 3UMBA 2GXUA 3L0IB 1WQ3A 2B9EA 5DOVA 2QTVA 3LX8A 3ZDDA 1PWHA 1E2EA 1K6EA 2BFWA 1J42A 3AOEC 3CEHA 1R6AA 2HCTA 3DCNA 5EINA 3UMJA 4B3RB 1T13A 1CK4A 1Y1TA 2A78A 5TPWB 3SKXA 2ZSIA 4MTCA 4L78A 2SNIE 3QX9A 5IBPA 1KMIY 1S2MA 1L9KA 5ERYA 2OBBA 1QIKA 3AIIA 1PZGA 3GCZA 5K6RA 4WY2A 2HYDA 3CA8A 5FOUA 1ADBA 4IKOA 4PONA 4C04A 2QXTA 3ROZA 1C7EA 1WRBA 1W4BA 3PUXA 4LQ4A 3QWAA 4BIMA 3TL6A 4UE2A 4AZWA 2Y1LA 3EVDA 3I2YX 3O6VA 2GCEA 2HMWA 2NSJA 1U7ZA 3IUPA 1NJFA 1QVAA 3AUJB 4QHTA 4DV2B 1C0EA 5AKJA 2Q0XA 2H3HA 4W5TA 4WLUA 5ECWA 3ZDXB 3ABQB 1YQUA 5I8ZA 1XU4A 3QNMA 4K6FA 1BCRB 4G0ZA 5KS2A 3LWNA 1C8LA 2WTMA 4YJFB 4TXHA 1DAMA 5ADHA 2G9UA 3WO0A 5G53C 5CBPB 4MJLA 5FBRB 2BCEA 2VDRB 4PLCA 1B42A 1OKKD 1XRNA 1TDJA 1O0CA 1PNVA 3IOMA 4G07A 4KGDA 2PH7A 5PGMA 4G9BA 4ZI7F 1JG4A 3DEFA 3DOCA 3BMNB 2ZOSA 1W4LA 3ZZUA 4DNOA 3BXHA 3ET5A 4RHYA 3RVSA 3SOZA 1QH8B 3PQDA 2HSGA 3S44A 1PW7A 4UHCA 1MX1A 1DKPA 1A7KA 1EE2A 3F49S 3I12A 4YRFA 4FD3A 4AS1A 3WJ7A 2A0UA 2BISA 1H1TA 1HSOA 3DE1X 4BO3A 3U0BA 5IF9A 3A04A 3ZNPA 1MENA 5CLLA 2G1KA 4GZ3A 1N3YA 1BMTA 3L8YA 4Q3NA 4F9EA 3VDNB 3GLFA 2PUEA 4NYIQ 1V1RB 3O4VA 1P74A 1F3OA 2PRZA 4HGQA 4MVWA 3O21A 5DCUA 2HMVA 3M8KA 4NYJQ 3AQIA 4AYWA 1GTG1 2YMQA 2VPTA 1N36B 1EK1A 5DI3A 5CB4A 4RV4A 3QTBA 5AXBA 2BKUA 3ZXXA 1KI8A 3A1WA 2Y93A 2QROA 1GNTA 3PRJA 4JT8A 4IS2A 4Q19A 1DWPA 1K5HA 1O6FA 2AZDA 3IUEA 3MMZA 4TMFA 2G70A 2J41A 2JIPA 4TZ0A 2E5LB 3B1YA 4AUNA 1LC0A 1YRHA 2NAFA 2MSLA 2AG8A 2BRUA 3MJTA 3M0EA 3R0IA 5EJMA 4ACBA 1RJDA 4A8JA 1KA9H 5C52B 2C29D 1B0AA 1XRQA 3EASA 1XNGA 5EKUA 4DJ5X 4Y18A 7REQB 4W5RA 2ODEA 2FLKA 3T3EA 4KGVA 3BMCB 4DYHA 2FSUA 4WOPA 4KMOA 4G4SP 2G5PA 4J2HA 4M87A 1PBNA 2Q6LA 1ND5A 2GZRA 3WR5A 4EBFA 3PFIA 4N0QA 5JXJA 1B6RA 3KNZA 3IR6A 5BVGB 3U4GA 3VGJA 2QSYA 3KQKA 2ZRHA 1DBSA 2OXTA 3B6KA 2WEKA 1EYZA 2XT0A 4C21A 3WYFA 4AJ1A 4QUGA 3SJAA 4XOUA 2YJ3A 3U19A 2IYWA 4WBNA 1OTXA 1WJGA 1ZINA 4JC5A 4RA9A 3TX2A 1QE3A 4IGFA 4NU0A 5AKGA 4DXDA 1E60A 3S0JA 1NJ6A 1CP3A 1WCWA 5AXAA 4GKAA 4A92A 1Y7TA 4D8YA 3NO4A 2QP9X 2GA8A 3UFXB 1VKRA 1OLUA 3TEMA 4ANFA 3DHYA 5K4GA 3RRNA 4YN3A 3T4PA 9MHTA 1XMOB 5LL6P 3MWYW 5KPJA 2B8TA 4L51A 3RS2A 3RSOA 3O7MA 4D97A 4IDQA 4DR2B 4EB6B 2ID8A 1KI9A 2AMJA 2EBFX 3AKDA 4P7GA 2AN3A 4OATA 3D7LA 2R1VB 2ZIVB 3FYTA 3KQSA 3WYAA 4EYEA 2FVXA 1M1UA 1UKCA 4CR7A 3OZIA 1IBKB 4W4TA 5DMHA 1XK6A 4YRTA 4IVNA 4LJAA 4PG5A 1DJPA 1QG0A 5KNBD 4HADA 4WY8A 3TBFA 1XRJA 1O8CA 1SHKA 1DOAA 3TN7A 4QG7A 4NENA 5BMOA 5BMVF 5CCXA 2ZYUX 3FLBA 2YR0A 4BFWA 1D4OA 3M4NA 5DIFA 1RRMA 4DREA 5AM1A 4HGZA 3SKYA 3WKCA 1TVKA 4DADA 3DLCA 2XYPA 4BLSA 1JIXA 4EY7A 1ZH8A 4E15A 4YJ2B 4Q9LA 3RYHB 3KOXA 5JSKA 2O2HA 5LC1A 2R4TA 3DNFA 1PT6A 3CMCO 3TLGB 4RKQA 3BKXA 5IFLA 2ZQ5A 3FKQA 1JH9A 1CIPA 1MOPA 3KR2A 2CXHA 3IR5A 4MUMA 1EDEA 1ZUNA 2V7VA 1U7XA 1AUOA 3EXHC 2Q1YA 1IBLB 1J0BA 2BFBA 3FZQA 4AM8A 2YMLA 3T7AA 1QRTA 1Y34E 1GVNB 4ARZA 5C1DA 4J0GA 5AOBA 1EK5A 2KB0A 2WPDD 4EFNA 5J1SB 4ZHQF 4LK2A 3WDLA 2HOQA 4Q7QA 4O4IA 1ZJ5A 4KBYA 4YRQA 4R71A 1V16B 4JY7A 1Q12A 2VK1A 2GYVA 4YAIA 1PZXA 1XLUA 4JB8A 1PG5A 4MWBA 4NESA 4NZMA 4O2AF 4UTXA 4YMSA 5D7NA 1X7ZA 2GCOB 3UAWA 2QNRA 2DR3A 3QUAA 4L4SA 2DUMA 3ANLA 3GA0A 3LMKA 4DSAA 2OR3A 1KORA 1Q1QA 1P9OA 3BE6A 3DLTA 3IIMA 3OKAA 3C3PA 3HMQA 3PPIA 3R5TA 4P7KA 1AS2A 2FV8A 4LSGA 4XR4A 4R8MA 4DA7A 3A1DA 3EY4A 3A4MA 5IBQA 4ZVQA 2IV3A 4ETMA 3K15A 1ZESA 1YZUA 3KJNA 3OWHA 2ZYTX 1ACLA 1G2PA 1EUDA 3G0DA 4G4SO 2UYCA 3IVAA 5C7LO 3NKVA 4HGNA 3CVXA 4RDHA 1Z2AA 1Q57A 2EZ8A 2VYVD 4N8DA 3VBCA 5F78A 3D1VA 3I32A 4JJEA 4YRJA 3ZWKA 4A0HA 4M37A 4F9GA 4YONB 3SGLA 1OT5A 1ZXBA 3FKSD 4GUDA 4WE3A 2XMSA 3HUEA 5L7TA 4L5CA 4TLBA 4K3VA 2WOJA 2NSHA 2OZLB 1IXZA 4OVKA 4IVRA 5F35A 4Z3DA 2ACKA 3JR7A 1VBFA 1SOAA 1ZRMA 2KWIA 3O94A 4XPZA 4I55A 1Z2CA 3PHLA 5KVAA 4BTEA 1Y4ZA 3L4BC 3LLSA 1YIOA 4LRUA 4F9TA 4OQQA 2J3JA 3ZYZA 3TRDA 4BFTA 3SLRA 3ZOKA 3VR6A 1MCZA 4PGMA 3NHFA 5LDHA 5LD2B 3OPYI 2AN9A 4O4LF 3F67A 4AP6A 3V48A 2FMIA 2VHYA 4H2DA 1AY0A 1KQPA 3FA2A 3N0XA 4JQSA 4Q3KA 4Y9SA 4AO7A 4GPBA 4F4UA 5I9IA 4EATA 5GAJA 2AUMA 3A2MA 2KPOA 4JBLA 3CJQA 1GNLA 3HLKA 3K1ZA 4EGQA 4MR8B 3ANSA 5CM2Z 4RMGA 4C7VA 1CYEA 1HTBA 1ECCA 2MIIA 3AFHA 4MVCA 4PTYA 2IOQA 4I19A 3RF6A 5C5DA 3DTYA 3RYCB 1FJ2A 3UZUA 3L8HA 3CIFA 3K4PA 4O8ZA 2NZJA 3E15A 3PIRA 1ZZGA 2IXTA 1C0KA 4JBYA 3RFTA 3RE1A 4BJHB 1R64A 3J81A 3CF2A 1RPNA 4A0FA 3G8DA 5E6SB 2W7TA 3H9UA 1NSTA 2J9YB 3W4IA 2J3EA 2WICA 5IANA 1AS0A 4B3JA 4BOYA 4UNPA 4MKRA 1MRSA 1X2EA 4HQNA 4XFKA 4YAKA 1DOZA 1RYZA 5JH7A 4YRIA 1NLFA 2BFAA 2Y4NA 1H2XA 3TNDA 4YBRA 1P60A 5DWDA 1KY5A 3G0HA 5E9JA 1Y0BA 1K1EA 4I3GA 5KVSA 5JZBA 1EFPB 1N6HA 3CKYA 1TZBA 4KXQA 4Y2SA 1RBZA 3NGLA 5LQAA 1TCUA 1U28A 4KPUA 1AQNA 2G76A 2Q1UA 4GP9A 3VU9B 1DWOA 1PFKA 2YVUA 1AN0A 2V4UA 2AXEA 2VSXA 1H8HA 1O94C 2IP1A 4LHVA 2P67A 3A6JA 1L7QA 5TLSA 3TJRA 3ZJVA 4GC5A 4PXAA 4ZODA 4IDAA 3MOGA 4D3ZA 1YGYA 3JARB 5GP1A 1CERA 5KX5B 2YJ4A 1U8YA 2OV3A 3LZ6A 1WIWA 3ICEA 2YCBA 4LTNA 2WJ6A 3I5XA 1B3BA 3EDYA 4HJRA 3W1WA 4JC4A 2F43A 4G2NA 2HHCA 2VJCA 1DX9A 4IDPA 3ZCUA 4CLRB 4ZQHA 4F12A 5J58A 1XCPA 1W35A 2HJGA 4WW0A 5ALEA 4AF7A 4BTLA 1YQWA 2FLVA 4KFTA 1U5CA 1M2OB 1V8PA 3B6EA 3WKBA 4QT4A 5I7SA 2W0SA 3BIXA 3I9JA 1Y7HA 4NE2A 4NJMB 1X1TA 2IBSA 1KZ9A 1QIIA 3IT0A 3JALB 3EXEB 1UBTS 4HNGA 1F4VA 2CEAA 2WV9A 5EQFA 3UXEA 4EY6A 4UU7A 2DWOA 3CLUC 1KU6A 3QVLA 2MYUA 2YQ5A 3FPCA 3RGWS 1FSPA 2B36A 5CX1A 5CHEA 4WGFA 1A2OA 2F3SA 3G82C 3Q3EA 4MS1B 1IOVA 5ESWA 2EFYA 4XIFA 2J8ZA 4ZV9A 2NUTA 1HYEA 1N6PA 4W9RA 2VPZA 1U04A 4ZOCA 3TZEA 3DP9A 3HHEA 4FYXA 4MV0A 1FP6A 3NMUF 3FCUB 1YVEI 2HRRA 3L06A 3SM9A 1P2SA 4B6EA 2J5XA 3NDPA 2XMQA 3DR5A 3GUUA 2H1IA 4MUEA 1CUEA 4KAJA 4YAJA 3S1AA 5BNWA 521PA 3LBFA 5CNKA 1VL1A 4RS4A 3H3JA 1OLSA 2HJWA 4OLJA 3OD1A 2CLMB 4US0R 4FGKA 5EIHA 5B55A 4KACA 1PFVA 3M6FA 1Y4UA 4TL9A 2ZRDA 3W1VA 3ZKWA 4EW6A 1LZKA 1UP4A 3I72A 1SVLA 4UHJA 5FFMA 3GA5A 5SZKB 4EB3A 3S8EA 1R4MA 3O73A 1GA6A 4M98A 3PHJA 1U9IC 2A9KA 3ZPXA 3RBZA 5HK9A 1NUUA 5D5PA 4KVAA 2WE7A 3MM4A 1WV0A 4KH1A 3PFGA 2CNOA 2UAGA 4X7PA 5G1OA 4BVFA 4COKA 2E4AA 2R1TA 5FOXA 4CYMA 1RQ2A 4TROA 4HWRA 5CVVA 1U4NA 4MCJA 1JVBA 2DBZA 2HWKA 2PKXA 1NDHA 1E20A 2QMZA 2OHVA 1GCOA 3IVCA 3HCBA 1HDXA 4GBJA 4FQ7A 4UBNA 1Q0SA 2PR2A 1FSSA 3H8WA 5AVSA 4N6GA 1ZUD1 1NSYA 5AHRA 2EHDA 3ZV6A 3HBFA 2R6AA 4CCSA 2J7PD 4DCOA 1E66A 5AJVB 2QA5A 2HIHA 3SJCA 1ML3A 3QOFA 2TRSB 1BJTA 2NTNA 1E59A 1Q0HA 3G2IA 4GX5A 3WL6A 3C74A 4FI3C 3X1MA 3V4VB 4ME6A 4AT1A 2IDKA 4PWYA 3E8XA 3L0PA 2C94A 4C78A 4LW8A 1IM2A 4K2HA 1DE0A 1DIHA 2MTBA 4FGJA 4IZHA 5KC9A 4KXMA 1WCV1 1NXSA 3CUVA 3NH9A 1P6UA 2B3DA 3PENA 3PXAA 2C03A 4OHFA 4P32A 4WFQA 3SZUA 3GGDA 4L0CA 2NXNA 5HKKA 1L7VC 3B8HA 3GLKA 3EAQA 3K6SA 3QELA 1KF0A 3MD9A 5EIFA 4B43A 1YB4A 5B2EA 1I94B 5LJIA 3H6KA 1E1QD 1N75A 4CTNA 4EHHA 4YRMA 1NQUA 1RJGA 2WM2A 3THWB 1ODTC 2HHJA 5GOTA 4Q3OA 3WNDA 1P7CA 3AZQA 3DUWA 4NBRA 4TV9B 4KQ9A 1IL0A 4D3FA 2DWQA 1X19A 3D6VA 3EFEA 1ACJA 5KYWB 1PR3A 4N40A 4Y6LA 5DHSA 3OOEA 5KSPA 3ETHA 4TM8A 3UAOA 5AOVA 4II2A 3M6VA 4REOA 3ZIDA 3F8TA 1L1FA 5L4SA 1EBBA 4NZYA 1NKTA 2BHTA 3H9BA 3RTGA 3G8CA 4JR2A 2I76A 4Y6GB 2JGNA 3KVOA 5CGZA 1IG3A 2A1UA 3RK4A 3SDZA 1UDXA 4PICA 1VXOA 1VSUA 2A30A 2Q41A 1OY1A 3IAXA 3BORA 3N8KA 4C7XA 4YT4A 2PZLA 4UZEA 1FNMA 1P9NA 2PQ0A 3A1CA 4IMIB 1KH2A 3ANYB 3F5QA 5B6IA 4BPBA 2I2CA 2SCUA 4FXPA 4G0MA 4NOJA 1N3BA 3ELWA 4YPVA 4MP3A 3RTEA 3LK7A 3D31A 4ZTZB 1IBMB 4GKJB 4EMUA 5I5GA 2GHIA 3ILVA 5G0SA 1IQPA 2X0RA 3DLIA 1PYDA 4QBGB 5EIBD 4C30A 1MC8A 3KTAA 1M8JA 4OMDA 3AXSA 4PQFA 4CNBA 1T5HX 5IKEA 3TSZA 3L0BA 2EX1A 1J5XA 4FNOA 4NQRA 3CZRA 3WNCA 4DSUA 4N7BA 1F0PA 3WK6A 4CXMA 1NVTA 3VZRA 1PTKA 2W6CX 1NUPA 2D5IA 2HLHA 3URMA 1KBQA 3UMYA 1O08A 1II8B 1AQYA 1UPCA 2H65A 4R98A 4P80A 2VDOB 3FIUA 2P2SA 3IBTA 4L08A 4FGZA 4HXFB 4NC9A 2G17A 1GILA 4ZT4A 1AMUA 3TG2A 3MWEB 3SC2A 1TXGA 1DJLA 2QN3A 3CKMA 3GNTA 1JDZA 3ZDRA 1DO0A 1RTKA 3N2KB 1NPYA 1EFVB 5ALXA 5BQPA 3KLNA 2Y9PB 4OHXA 1W87A 5J2TF 4I1IA 1TLFA 4UTZA 2TSYB 3I2GA 1CY8A 2DR2A 1KFEB 2AFIE 2ZTSA 5KQSA 5CXUA 3P2YA 5BSUA 4DUYB 3F6CA 4M9QA 1U1FA 3E6AA 1M1ZA 3DFZA 1BXRB 3KFLA 3ONNA 1WPQA 4LECA 2R7KA 4RCVA 3QTTA 5DBOA 3I1YA 4KIWA 4X20B 3S2GA 1GRVA 4BCBA 1RYYA 3MG9A 3L6DA 4ZYLA 2PBRA 4EG6A 3TQRA 1QLWA 1CJVC 4XIIA 5KQLA 1FBNA 3LKZA 3BULA 2QTFA 4K03A 3BHNA 4XDHA 5KVCA 3C6YA 4MR9A 2Q5LA 1G18A 1XC7A 5GZ1A 1AMOA 3PXCX 4KE9A 3F4KA 2QL9A 5ALDA 2EKLA 1D2AA 1GKLA 3LXRA 1ABEA 3AQ4A 3WHLA 2YWJA 4PM4A 5TARA 3I04A 3SHTA 2AX3A 4NR0A 4W6ZA 5IHPA 1UKBA 4F92B 2RD2A 1CZNA 1C1HA 1GPLA 3C43A 4QODA 4RZ2A 3V4FA 4JLPA 5HIKA 2OFOA 5A2QA 4CTMA 1G5QA 1K6JA 3LLVA 4H6XA 2OG1A 3KETA 1EZ4A 5H68A 3AUFA 4IEFB 3ZWQA 1EP1B 4BO6A 3COPA 2YN4A 4DSZA 2ALJA 5HUQA 1AX9A 2GNOA 3D7SA 3DVRX 1U8FO 3NBYC 5K45A 3REFA 3JQFA 1GQRA 1QC5A 3CLTD 2H11A 2W2VA 2FMFA 3EDCA 1IWOA 4L72A 4BBAA 2XWPA 1Z7WA 1A9XA 3MJHA 5JMOA 3B5JA 1MIHA 1AOXA 4RSMA 2GD0A 2VDNB 4C0JA 4ZI2A 3AUXA 4JJ7A 1G8HA 1H4VB 1AKMA 2J0SA 2QZPA 2Q3LA 2VJBA 3Q6NA 2G08A 4PIPA 5HIJA 3D8BA 1TK2A 3ICWA 1D7OA 1KKLA 1U98A 4FYPA 3PQ3A 2QRVB 3OZ7A 3TBKA 2H1HA 4I4TB 1R00A 1CB7A 4PC6A 3R6GA 3ERCA 3SI7A 1SBIA 3DL0A 1KRHA 5B2FA 2XNKA 1JQAA 3UGQA 4Z1OA 4R01A 1U8AA 3R5KA 1DCKA 3LQYA 3HA7A 4ZQFA 5C4IA 3O4FA 4PPYA 3OLQA 1DWQA 3HXLA 3O7WA 2J3MA 1DKLA 3QQPA 1DEKA 4FKMA 3RWMB 5AM4A 4KJXA 3QLTA 1BE6A 4AJHA 1LSJA 3O47A 1RKXA 1XU9A 4X24A 3H0KA 1Y1LA 4CN9A 1YD7A 3L7NA 3EB9A 4PBTA 3UJ6A 2AJLI 4MUIA 5KSZA 3O0DA 1NQOA 2JAPA 1P4RA 4B75A 2JS7A 2XDAA 5HGXA 1I3OA 1TEVA 5DM70 4LOLA 5FUYA 4JH0A 4DHWA 4F6RA 1N2EA 3ADCA 2EVWX 4EJSC 3AU9A 1GL7A 1SXJA 4W99A 1VJ1A 3OEHD 2CNDA 4H16A 4IDHA 5TJHA 3BWCA 1JFSA 1CZRA 4DILA 3GLIB 3W5VA 4PU0A 4DCSA 1CR4A 2PZJA 1AD2A 2PS9A 3DTVB 4I81A 4DLSA 1TM5E 4OXXA 2X2FA 2J32A 3O9MA 3TRKA 3ZXIA 3HCAA 3HXOA 5GM2A 3NHSA 1US8A 1NQAO 1RNLA 3L9WA 5F9MA 1PL8A 1XVVA 5HS4A 3BG5A 2PXCA 4G89A 4IY1A 4UVEA 3WC4A 3HA3A 3AO0B 1U5AA 2HRDA 4XD2A 3NU1A 3ZE9A 4UTPA 1IM8A 1QBKC 1YT5A 3OZUA 2BEVA 2M6LA 5A4DA 3GZJA 2PV7A 4MQLA 2HQBA 4PEVA 5EP3A 4FGLA 4J2OA 2JHCA 1DXQA 1T4MA 3KALA 3Q15C 4HBGA 3CNHA 1ULZA 3ONVA 3GFQA 1ZJZA 1JLLB 3FOCA 2JW5A 2CWWA 3EUWA 4RW0A 4EM6A 5KDOA 3JD1A 5K03A 5JTTA 4AKHA 4D92A 3ZBUA 4BNGA 1UT8A 1MX3A 3OT1A 4MRPA 1O4VA 3TX6A 1JEEA 3HCFA 2J31A 3IAUA 4MZXA 3PEUA 4KFUA 1APBA 3PX2A 3ETJA 5TXGA 4AZ0B 3ORSA 3BB4A 4BLPA 2BGIA 5KYYB 1U6JA 3A6GA 2H57A 3K8QA 2QG9A 2QY9A 4PLPA 4NBNA 1G5PA 7AT1A 3ER9A 3NCTA 4N5NA 4HWTA 4RA6A 4F4CA 2J33A 4UD2A 1JLSA 1XD8A 4KPFC 4MVJF 2YHIB 4DZZA 3FPGA 4ETNA 1D2CA 2NADA 3ZHVA 3T1OA 2JGFA 2DY1A 2IS6A 1JYSA 2H7YA 3KX2A 1CUZA 3E1GA 2JGJA 2ZAMA 4Y9DA 1G55A 3Q4GA 2OAEA 2P75A 2ZW9A 2QENA 4IV8A 2CY0A 2XA9A 1Z74A 4B8WA 1GL9B 4R51A 2HRBA 4FSDA 4MHTA 1Z8NA 3FG9A 3V1MA 2R8RA 4Q9IA 2YDYA 1L1RA 4UVGA 4JLBA 2Y6UA 2EC5A 2OHHA 2E4YA 4IIBA 1N9GB 2O1WA 2GN6A 1Y9ZA 2D0OB 1Y1RA 2A4KA 2C4TA 2FKNA 2QKYA 4JP5A 3ICQB 4OBEA 2CJXA 3CUUA 4Q03A 5LQUA 1T1SA 1WM1A 2GVZC 5EUBA 4LHXA 5ALIA 1N77A 1ULSA 3UUWA 1OXVA 2C2GA 2IVZA 3U37A 1PR5A 1U7WA 5DM60 2SICE 2CVZA 4GPEA 1XELA 2IYPA 1ZISA 5CU7A 3RUCA 3GLFE 1JP7A 1SOUA 2QD3A 3KJQA 4J0IA 2ZVJA 3K4QA 4LWZA 4R1UA 2XBUA 1N5DA 1E58A 3DLAA 4MS4A 1REQB 1DMRA 4X85A 2AFHA 3VO9A 2DHQA 3REOA 3L82B 2Z3ZA 3BH7A 3OJCA 4LDPA 3ZY3A 4P2BA 4R8KA 2GN4A 4JUCA 3TBHA 1XLTC 1FYDA 1VBMA 5HGJA 3GEBA 4L5YA 3GDHA 3TOXA 5AKXA 1SZCA 1Y5IA 2FW6A 3D8NA 3H5TA 1J6UA 3N07A 2QAGA 4XIGS 5CLGA 4I1UA 3DAPA 3I9KA 3RKRA 4CLDA 4P82A 2C9MA 1UMDB 3GGOA 3CRZA 3N76A 4J4BA 3RYFA 3KKZA 4L8FA 3ZW7A 4BKRA 5LQJA 1CQIB 1JWBB 2R2GA 4HAIA 2DEUA 1A9YA 2JI7A 1E4YA 2YCLA 2AOUA 4MB2A 4MWEA 5TPZA 2D8MA 1ZR2A 4X66B 1SG0A 4AP9A 3LWBA 5H70A 4D43A 1P3JA 4HAUA 4BJ6A 1UK8A 4QPPA 4AW9A 1YOVB 4JASB 2UZ1B 4B79A 3EWNA 3LUPA 3BBLA 4HPJB 1TT5A 1SUFA 3UWMA 4EGFA 1QVWA 2GS9A 1TVMA 5CVTA 2PU5A 1ANKA 4MGHA 1DBVO 2VRWA 4UM8B 2WF5A 5IVPA 2YZGA 2HQRA 4XYMA 2WU1A 1MXFA 2BFFA 1DLJA 2I5PO 1RRPA 3PZBA 3TZQA 2EW8A 3SYTA 3JAMA 3ESXA 4RSGA 4W8HA 4X1KB 1SH7A 3R8XA 2FA9A 5IAEA 3U3MA 1VKZA 2BUCA 4JJZA 3VU0A 1JDBB 5C35A 3Q7EA 4Y6PA 1FFDA 4OHVA 1PSDA 4R7TA 1YRQA 3WRVA 1DX6A 1S4QA 1WWKA 1XPJA 4U3JB 6Q21A 2J0VA 4KWIA 4P22A 1NQWA 2ZJ1A 2G71A 4K9LA 3SEZA 5I8PA 1FUYB 1G2OA 3ISTA 1G7RA 4IMRA 2W70A 1TYCA 2XJ4A 2QRQA 3M5DA 4MQUA 4ZI3A 3BRSA 5IM4F 1IY0A 3OE4A 1M0WA 4RNCA 3GW8A 1M1XB 3C3XA 3UMGA 2VAVA 2I7VA 5DBIA 1QWSA 2ZJYA 3RU7A 4ECEA 1R4ZA 3HADA 1U3GA 3OQ1A 3W2TA 2QQFA 1Y3BE 2OV8A 3H7AA 3GIDA 4FS3A 1TW3A 4QQKA 4DKXA 2CCKA 2V7WA 1EDDA 4K9QA 2IWHA 5C1BA 3OAAA 3KL2A 3PRYA 4UAUA 2NXJA 4G81A 1RU3A 1TL7C 4C29A 1MQAA 5GWXA 1GTVA 3DAYA 4LOKA 3F7MA 1KJJA 2R8EA 3QU7A 2O7QA 2A2ZA 5B1SA 5JS6A 4NZNA 1VL2A 1VHDA 2JBHA 4G84A 2DWPA 5FNZA 3K31A 4GQBA 4QUBA 4BJ1A 5M34A 3CNNA 3VBEA 5FOSA 1LBHA 3A9RA 3ESRA 4J7CA 2GBLA 2A5JA 2JLSA 4IEEA 3VZSA 4N8EA 1NNEA 1WHSA 1U2QA 4CN8A 5FPPA 1O6GA 2ZJ4A 3R3UA 1QVVA 4BEBA 4H7DA 3I09A 3DOEA 4MDEA 5TQ0A 1GRNA 2XRYA 4JLVA 2ZVDA 1CQJA 5AI5A 3EOBI 3K16A 1FX0A 3RKSA 3N59A 3TTUA 2PYIA 4DA0A 1D9ZA 2NQ8A 2Q5EA 1TMOA 3WGNA 4KHPB 2PKQO 4EHFA 2DFTA 4LZNA 1G20B 1BQ3A 4BMPB 1ENYA 1SEPA 1QAMA 1MA3A 2GM3A 2HGZA 3SZGA 1NXWA 2CVFA 2IEZA 3HB1A 1FU7A 1H1DA 3WWYA 5GINE 1XMVA 3TPZA 3K0AB 3KAQA 1NMYA 4ETIA 1ZH0A 3KYCA 3OX4A 1SCIA 4K6KA 4NEGA 1OLXA 3AKYA 3IA2A 3L02A 4FSHA 4BGDA 1ML4A 3MK31 3UTCA 1XLTA 4B3IA 3QW4B 1E2NA 3DHNA 1FTSA 1OFUA 4IIFA 2CFIA 2HV8A 1I7NA 2L2QA 1VHJA 2J7KA 2DQKA 2ZBFA 4GSYA 4DDMA 1W2WB 3IBGA 2Q3DA 4G65A 4C4ZA 5C4MA 1KWKA 3SFTA 2WHYA 2B9VA 2HBRA 4M0DA 3T3MB 4DQDA 1EFDN 2C77A 3A4YA 4Z4EA 1FDSA 1S9DA 2WR8A 3VO1A 1E3QA 3HJCA 2ZB7A 1Y8CA 1SKMA 3PNYA 2CLDX 4MX8A 3A31A 2OCAA 1L6RA 1PVOA 3WLQA 4TN1A 1GUZA 1B1CA 1Z07A 2VP2A 2G1AA 1VECA 2A5YB 4XB1A 2AV6A 3WGKA 5BW5A 2JIQA 3BEOA 3F7NA 4KXYA 3UKDA 1SVNA 2CXXA 7MDHA 5L3RA 2DE0X 2JCXA 4RVHA 2GT1A 5KQRA 2PO7A 1YB2A 3U3RA 1GV1A 1AM4D 2XECA 1QHHB 3WYEA 5F7ZA 1K8QA 2ZK7A 2PMFA 3AHHA 3H4IA 2AG5A 1Q7BA 5GZ3A 4NVRA 1L5RA 1T5LA 3L0CA 4K81B 1RCTE 4FOTA 1UT5A 1E3MA 1W5FA 1UBNA 2Q3HA 1E69A 4NOKA 3ZXSA 2DTEA 1EHIA 2O5VA 1XLWA 3D5TA 3HJBA 1MVOA 3K9LA 3ME5A 1Q14A 4TLAA 3KQNA 1GZDA 3MJDA 3QKTA 5H0IA 3WYGA 3CEAA 1KTVA 3S3TA 1OROA 1WOMA 1SBYA 4HDAA 1OX5A 3NBXX 1WSAA 2LBPA 4IUYA 4N4AA 4JUDX 4N3CA 3QEKA 4HT3B 2B2XA 4UVHA 4DCUA 1K92A 3HRHA 5ELLA 4DBZA 1LVGA 2L17A 3GVPA 1MTZA 1R6UA 3SN6A 1J8MF 3QU9A 5KQGA 1L4NA 2XSZA 2Y1FA 4I36A 3EVGA 4XWGA 3NWEA 2QMQA 3BCUA 1N0UA 1O7JA 5T41A 1IJFA 3L40A 3EFOA 1WA5A 1FLAA 5DNUA 3BRQA 1H4QA 5L51A 3HMKA 4PRKA 1F5NA 1QO0D 1VKNA 1R0WA 1XXHB 3CX6A 1II0A 1ABFA 3OPYB 4Q9NA 1AKUA 2Q28A 4ZRDA 4HHEA 1OA1A 1DLIA 4HZUA 4R3NA 1ZD9A 5CFNA 5H16A 3FNRA 1NE2A 2PGNA 5AHOA 1X8LA 3A06A 3HLTA 1FW8A 2FFJA 4WN9B 4IFIA 3FTCA 3I4LA 2NP7A 2QW1A 2P69A 1JGTA 3MPOA 3W9BA 4E21A 3B3QA 2Q3CA 3WJAA 3TQOA 4JJKA 5AW5A 4ATNA 1NI4B 3UMSA 4US2R 2JGKA 3B3JA 3QEMA 4OOEA 4TS1A 3TQSA 1NYRA 5KTKA 3BEDA 3PC7A 4Q1EA 3KWFA 4PZZA 4F1WA 3OQIA 2DERA 3PITA 1QAQA 1EAMA 5BYKA 1MB9A 3OFSA 4LC9A 4XIYA 5I51A 3RHTA 2AUNA 3BHJA 2AC4A 3E1SA 5DNYB 1FFXA 4KOAA 4J1QA 2F4NA 4CCAA 1O03A 5DNAA 1Z4KA 3RBVA 4BASA 2PCJA 1ULUA 4Q37A 5KDDA 2JI4A 2I34A 3BJEA 4G4IA 5HIAA 2X6QA 3OY2A 4KRFA 4HQFA 2HLPA 1BS2A 3PSAA 3TJMA 1XN1A 3I64A 4OK3A 2PEZA 2LPMA 2A0YA 2FUG1 4PZLA 4YQZA 3M5CA 1A5ZA 4PF1A 2NU8A 4N82A 4G1EB 3GLHA 4KLAA 3SQOA 4OHYA 4NE7A 1LDEA 1YQDA 1I80A 3HI6A 5IVIA 2EEZA 2G40A 4LNUA 5KWVA 2CL7X 2XCQA 2CDBA 4L76A 3HO1A 1VHWA 3IKMB 5DEOA 5K3DA 3TLYA 2IK8A 5K0JA 1X38A 5FTNA 4MWZA 4R05A 2QIPA 1MGOA 4WXRA 3HDTA 4GUAA 2Z43A 4XGQA 2GESA 2Q8PA 2RAPA 2PFSA 4IRUB 2IPOA 3VQTA 4XJVA 5KINB 1WLSA 3I39X 3TL2A 4K0RA 1JPVA 5DHUA 1OLOA 1BOOA 3HBMA 1Z26A 5AXCA 3TFQA 3G6WA 3JRNA 2GJ9A 4J3FA 2R44A 1IM5A 3PDUA 5COQA 2O6LA 1Q2UA 3L6UA 4N5HX 4NIMA 1AB6A 4XRRA 5NLLA 3KLPX 4FYKA 4XXHA 3GO4A 1T3GA 2IQ5A 2FPGA 3O2QB 4CKEA 1MU0A 2VUTA 5H1YA 1E3JA 3TXYA 1QDLB 1Z12A 2ONKA 1T34A 1CJCA 2VOEA 1J2YA 2ZDHA 5DX1A 1RRVA 4L5AA 1ZM4A 3ZVRA 4CFSA 2EBWA 4YRNA 1UBFA 1GQ2A 4S12A 1I51A 2JVIA 3DP7A 4J7XA 4CR8A 2VHCA 1NX9A 1Z82A 3EISA 3OWOA 2QJFA 4NPAA 2IOFA 4OMFG 5CJ2A 4CL3A 5EZQA 4EG4A 3VH3A 4I1YA 4TWBA 1I6MA 2CNWD 4JGGA 4L9SA 1QM5A 2CFSA 4CEIB 5FWYB 4BKOA 3C3BA 3T9DA 1WMDA 3I9NA 1FYEA 5CRIA 4AAYA 3SVTA 2FFQA 2TMGA 3RYIA 1FRVA 4P53A 1N1MA 4D9GA 4CCWA 5KJCA 1B1AA 1QTQA 3B78A 4OMUA 4UARA 2C9ZA 2OLKA 1I4WA 1VPWA 2X8JA 2QQ5A 2NZUG 3R3SA 2HDOA 9ATCA 5FV4A 2Q27A 3KVVA 2C78A 3G89A 3R3WA 1T9CA 3LL4A 4GR5A 5LA6A 4LF4B 3PGA1 3KL4A 4WXYB 2BEJA 4X1IB 4XD7D 1DRWA 2PH5A 4FYJA 5U4XA 4JJ6A 4EVSA 4NMHA 2A9PA 2OZVA 1W34A 2HA2A 4M0PA 3MTBA 4M1QA 1QF7A 1ORVA 4P93A 4XWYA 3V8QA 4LVNA 3RADC 1MN6A 3VR5D 1UANA 3L4SO 2P4EA 1OWOA 1EUZA 2HL6A 4HAXA 4L2IB 1ZGZA 3SC4A 1NXPA 5LKRA 2VJMA 3ESYA 5AIBA 3C7KA 1Y3AA 3BOSA 1EFHA 5FX2A 2X9VA 1TQ4A 3QA9A 2JFOA 2XXAA 3PTLA 4Q15A 1WCXA 1X7HA 3GFOA 4DCVA 1E0AA 3VKUA 4AJLA 4MCHA 5DXFA 2J0QA 2D5AA 1E0JA 3MRSA 4PGFA 3UENA 4DCJA 3G7SA 3T99A 3UGJA 3W5BA 1EXWA 2OZKA 2PXXA 2VK2A 3MGAA 3ZIUA 1JF8A 2O2DA 1W0KD 2IQIA 2PUGA 5CH3A 5C7IO 1UFOA 3PQ8A 3DYIA 2GHRA 1V5GA 5LN1A 1GTL1 5TGTA 4IIDA 1E9DA 3KZVA 1A8UA 2C42A 2ZJ7A 4QUAA 5EMMA 3T95A 3ZWNA 4WLVA 5JI3E 4U2EA 5U4QA 3M4JA 4LRQA 2JCYA 4P34A 2CFOA 4N3GA 1VLLA 3DMHA 3F74A 1OJ7A 3BSWA 4PAWA 1CVLA 4YRLA 421PA 3QVUA 3CR7A 1O87A 4YPOA 3MXOA 4R2IA 4W5NA 2W2KA 4TWAA 4AY3A 4HYTA 4O2AA 1NP7A 1AIPA 3I52A 3R7AA 3UKOA 5LBTA 2SKEA 1VG8A 4D1YA 3TCNA 1QDEA 4IOMA 4RE6A 1LQUA 2MSCB 3MTGA 4HB3A 1CZUA 4LY0A 4WH0A 5IZCA 1FK8A 2B8JA 3CS3A 2GPTA 1TYBE 3WAJA 1IXSB 1DAHA 3ILXA 4L02A 1LF5A 3BK2A 1SD2A 3N8IA 4ZEMA 5JOQA 3W5DA 4GPTA 1M1NB 3RRBA 4CQMA 3EVEA 3LOUA 4JV5B 4Q7JB 2AWNA 1I9GA 5EHQA 1YK1A 4BNXA 3LRTA 4NKRA 2YNMC 5AQEA 4X90A 4B31A 4CIXA 1YRYE 1BD4A 3L7OA 4O08A 2AI3A 3QOWA 4YRSA 4WJZA 1ZMTA 4O1MA 4JVSB 4PRLA 2DVMA 3L6BA 4CIAA 1RPAA 2P3SA 3EZNA 4KUHA 4HGOA 5F51A 1GCAA 4KFSA 4EELA 1M2KA 5DHFA 1TA0A 4BNIA 1C7FA 1CUHA 1ZLXA 1CIVA 4P8RA 4EKNB 1E92A 4ER5A 1C7QA 2Q6OA 3AP1A 3HABA 4PZDA 1GPMA 1MDBA 3UWKA 1OT3A 3FY4A 1AZSC 5FUVA 3ND9A 4ND5A 1Q7TA 5JXWA 1CE8A 4FBGA 3RAFC 3IX7A 5I9MA 4KAFA 4D9CA 1VRCA 2II6A 1CFZA 1N6OA 1FU4A 5JBIA 2EBUA 2BZSA 1GGJA 3GRAA 5ICEA 1Y3CE 2QR5A 4NNJA 5HVNA 3FGOA 4EKDA 4UQLA 4JEMA 1R6DA 4G0QA 4N5DA 4FK8A 4X8LA 4MKGA 2P62A 4C05A 3CSUA 1GEEA 2NPIA 5B37A 2Q9AA 3G9ZA 3HBJA 5EQTA 5E7QA 1C3XA 3EN0A 3LBIA 3ZV5A 2XVMA 4DA4A 4ZYWA 2E9SA 1Z6GA 2EP7A 4C5CA 4ZOLA 1YZFA 1ZFNA 5F1PA 1SCNE 3DE5X 1FUEA 4AIIA 4D4HA 4D9FA 3MCTA 2BTEA 2FRDA 4E2ZA 3WLAA 4GVLA 1SVKA 2H1RA 4XVRA 1KO1A 4B2IA 3UMMA 5EWLB 4W5JA 4XLLA 2YJZA 3I8SA 4HNHA 1LD3A 1Y9EA 4LZLA 5CW2A 4UUQA 2WWGA 4DJDC 3VAYA 1RI5A 4CI0B 3FPJA 2XITA 4REQA 3CURA 3JQBC 4EYSA 1E2HA 3NHJA 4JT4A 2IOYA 5E1OA 2ES4A 2IRWA 2PUTA 1ZDMA 2CHQA 5ESDA 3CGGA 4QDZA 3TINA 5IEJA 5B3JC 2Z98A 1JYEA 3OF3A 5GJBA 4MUHA 4IUCS 1Q20A 5MFZA 1XTBA 1U3FA 3GLTA 5TDHA 2IUFA 2Q0QA 4Q6BA 4A03A 1ZQ1A 3UJ3X 1GXSB 2F8TA 4C4OA 5HTKA 2H2FA 2QN9A 4O4JA 2C83A 3TDNA 4YUWA 2AYZA 2YMMA 5CX4A 4OJQA 1E3TA 3PEEA 3U7GA 1MJGM 3SNHA 2HCJB 2XUJA 1ZIYA 1FFBA 3GRKA 3L5KA 5E2IA 4YRPA 3RVRA 4ZDJA 1G4AE 3H2SA 1UBSB 3ILSA 2ILTA 5GZ6A 3JATA 4PLHA 5GOZA 3PUYA 1VRVA 1MXHA 3K9WA 3W5JA 1QRAA 2QVGA 4MVJP 3GELA 3RVNA 4JGBA 4M8NE 1ULBA 4PZ9A 3GP5A 5FEUA 4X65B 2BY4A 1A4UA 1NFRA 2FPPB 1GUYA 2ZYRA 3C7TA 3I9LA 5TQ2B 1Q0UA 3GJ4A 4MVJH 4XFDA 4D5EA 4EHDA 4NCAA 4WERA 1MOQA 2IYFA 3L0YA 2VXYA 3V8EA 1TO2E 1CUXA 3IUQA 3IALA 3KZ1E 4NL4H 4E51A 5JV5A 1T0UA 1O97D 3QMVA 4C1BA 2FK7A 4LCBA 3UMRA 2A5GA 3BA1A 1FJXA 5LR6A 4OSPA 3G2NA 4BEWA 4X1OA 4PYIA 4D6XA 5LP1A 1XTZA 3AI3A 1QR6A 5ANRB 3V1LA 3VZDA 5A04A 2GM9A 3PUVA 1LX6A 1N8TA 2W98A 2HSZA 5F3RA 1E32A 1L4HA 2R7MA 1A7AA 3BIFA 4GE3A 2HMSA 1EGAA 3H2ZA 3ZWBA 1QGYA 2EX4A 3ENZA 5AIAA 1CETA 1C1XA 2TS1A 1GA4A 5IC5A 3HP4A 2PQ6A 2I66A 2FAXA 3F90A 1Q95A 4DNFA 1GNSA 2V7QA 2P35A 4TMKA 1OHHD 3FRIA 1X86B 2D2EA 1JWAB 2B34A 4KV9A 3W6UA 4BL5A 4F11A 3I9V6 5FBKA 2CXPA 2F67A 3L3BA 3VV2A 1X87A 2BHRA 2VRBA 3SQNA 1POXA 3E7FA 1F9EA 3ITKA 1G5HA 3E84A 3TFWA 4PG6A 3DO8A 2EARA 1VPDA 2ZZNA 4TXNA 1A27A 4UCXA 1E6WA 1QUFA 1SPXA 4MGIR 1ZX1A 1PS8A 1N5OX 3EY9A 4HDSB 3EYAA 1TX4B 1ORWA 4QOGA 3ZDEA 1ENPA 3U1TA 3QMPA 3AI1A 5DBGA 4D80A 3I42A 1G2IA 4M9ZA 3IV6A 2FP3A 1JEQB 2X7JA 4HNQA 1U2TA 3EA5A 1R15A 3DOOA 4IHQA 4E94A 1OTYA 1Z5NA 3AVOA 1N7IA 1L4YA 2AI2A 4G3XA 3ZI7A 2RKBA 5ENVA 1EQAA 2YXLA 4ZVPA 2RGWA 3BFPA 2VS1A 3LVQE 4CJXA 1H2AS 4YMVA 2VZLA 5EKDA 1KY2A 1Z33A 5H4HA 1PN3A 3OHSX 4HDRA 1KEZA 3C5CA 1RXVA 3IVXA 3AGQA 3GAZA 3AR7A 2D00A 1NN0A 2TMKA 4PSCA 4YMWA 1Z28A 1NJ1A 4RK4A 5DVZA 1RRFA 1P31A 2J09A 2ZBDA 3O4GA 3WQBA 4YS6A 4MHOA 1KJYA 1DRUA 2C59A 3DL7A 3HB5X 3OKCA 4FHGA 4RKYA 3RS0A 4PVDA 3KR9A 4DLYA 4PNEA 5AI0A 5IYZA 2YQ4A 1UBOS 1H6DA 2P3OA 4GOND 2BFCA 4QEZA 1Z6ZA 4TKUB 4PLFA 3S28A 4AB1A 2BH9A 4YPFA 1J23A 2YIMA 4TXJA 1NXTA 2GK3A 3L9XA 1S2DA 1RYMA 4AF6A 2W43A 1QONA 3IODA 4RVNA 1E18A 1CR2A 1Y5MA 3HZZA 1GNVA 1ZHFA 3LY8A 3V6MA 1X8XA 5HQTA 5JNWA 3K70D 4QDOA 3SEAA 1GY8A 4EGJA 2I3ZA 2Q2WA 3FR8A 3GNQA 4N1AA 4GKKB 1SCDA 2E37A 1AB5A 2GILA 2Z3VA 4I50B 3GH1A 2FWMX 3I2IA 2AFHE 3P97A 3E48A 4KIJA 3R6LA 3CEMA 1UEIA 3EZXA 2AR9A 3K5IA 1LPAB 3OTIA 3GRPA 4YMTA 4ZAFA 4TRRA 2G25A 2Y6VA 4IFEA 2WWXA 3LI2A 4KR2A 3IELA 3KQYA 2E49A 4TQAA 4RLSA 1E6KA 2HU7A 1E9FA 2I03A 2MMCA 2REBA 5IJXA 3ZEAA 1MGPA 1W5TA 2WFLB 1BCRA 3CWCA 3CUWA 4UM9B 3N39C 4YJFA 3HXMA 1MT0A 3NTRA 4BP8A 2RG7A 4MW1A 2JFUA 3IHLA 4E2YA 3FN4A 5T64A 3LQRA 1WAMA 4BUZA 3OETA 5AVVA 1DAOA 4DBVO 1N8SA 1NVKA 4QQFA 5CPBA 2CZGA 1BKSB 2CMDA 2QRZA 4G0NA 3B85A 5EP1A 1FS4A 1J7KA 3GUVA 1B93A 1UIRA 5JHHB 2A59A 1NNSA 4I7EA 3BVPA 2Q3FA 1CCWA 3BKWA 2UDPA 2E55A 3QHAA 4FFMA 3RFVA 2JJ1A 1TLTA 2B2CA 5DTJA 1T8SA 5HFNA 1GG5A 1NONA 2JBAB 5J2TA 1T2NA 3HVIA 1QR2A 2UXBB 4YT2A 3E7PA 1STOA 3K0CC 2CXRA 1U8EA 4GI5A 1YDFA 1SUCA 1BJRE 2IIBA 4PG7A 1COZA 4IJVA 4R2KA 3GEDA 1XPUA 3R3HA 1O6CA 3HFJA 4IO0A 4FZ3A 3ZDFA 2YH2A 4EHBA 1QF6A 2AF4C 2GYUA 1VJ5A 4MIYA 2VDMB 4K6CA 4PX3A 5JQGB 1XQXA 2NPOA 1ORRA 3SCZA 3AF4A 4F8JA 4AN4A 4Z4HA 3V2IA 3EODA 5C4GB 4V3BA 1EPUA 1XSEA 5E9AA 1JG2A 2VQDA 4ZOAA 1P77A 3G2MA 4LJYA 2XA2A 2ZAYA 4BB5A 2FSSA 3KD3A 4BZQA 4OJYA 1MA0A 7REQA 1P7YA 1DBRA 2ECOA 3BMCA 5T6MA 3U3KA 3AR2A 1NVUQ 3KDAA 4P4UA 5CJJA 2WA2A 3NGMA 3OWXA 4ZVKA 5A2GA 3DTTA 5JZVA 1WZ2A 1KMMA 4HNSA 1ZAYA 2FLWA 1UDRA 1NW7A 4DMUB 1I24A 1W49A 2LP4Y 5JSQA 4R9VA 1JALA 1MJHA 1D2NA 5BVGA 1VIMA 3DEYX 3P4YA 1I1HA 1HQYE 2OO3A 3ROFA 2Q3EA 4TMVA 1RYDA 4YROA 3H9EO 4CM8B 2BR5A 3TOZA 4C4RA 3N2ZB 5AT1A 1YL6A 4MMXB 1YCHA 4RQAA 2IWRA 2RMKA 4YMLA 3DLHA 2OBMA 2VCEA 4J1NA 3F6SA 3QF4B 3O3MB 3RJ5A 4D8XA 1VI2A 2A5FA 5TEVA 1WXDA 1WSBA 4RADA 1QGDA 4WNAB 1RJFA 4G25A 3MBOA 3AFIA 3MILA 2H1VA 1B0PA 1LW7A 5IJAA 3B1WA 4JEIA 5ARDA 3PXGA 1N2IA 1H0HA 1UDWA 3CF4G 2QD1A 4KWHA 3U7EB 2NSYA 3GV0A 1JSRA 5JYBA 2MWMA 3Q1KA 4EB6A 1ZONA 2GH1A 4S1TA 3MLAA 5DJ5A 1KO7A 2BJVA 2IITA 2RGEA 4RD1A 3KDSE 1J00A 2R1VA 1DADA 1S1MA 3WG9A 1JXQA 2H1LA 1T6YA 3BTOA 3THYA 4O4HF 1SKUA 1XZPA 4N47A 3VOTA 3AHIA 2D62A 3LLCA 2XMRA 3AV3A 2ASEA 4LYHA 5EG5A 1O4WA 2Y0BA 3EF3A 5GIPE 5HYVA 3VTKA 3DSRA 1SELA 1U2DA 2PD4A 3DVAB 4TMTA 1OYYA 2IYOA 2PYZA 5DHPA 3B60A 3LKVA 1AT1A 2DF8A 2BZ1A 2J1LA 3FVWA 4J0QA 4N0PA 5BW6B 1VJ0A 3AWIA 4MDHA 3TGPA 5AM5A 4YNBA 3CO0S 2HHAA 1E61A 1X0XA 1BDJA 2V6MA 4KDRA 3UM9A 5KC8A 4XWWA 3C1UA 1HFEL 1MJFA 4IHAA 3T3PB 3CBQA 3WGUA 5C7YA 4G0PA 3RYHA 5JJLA 4BZZA 1YZ3A 3UWOA 1N2CB 1TTHA 1YE8A 4FR5A 1ZIDA 4C3ZA 3OH8A 2FZLA 1RABA 3EVZA 1OFHA 2QMUA 2PYDA 2P0YA 5T5QA 5IXSA 5LLTA 3ETNA 1C7IA 3NWOA 1QKKA 2P11A 4M0FA 2ZM6B 1D0IA 1HG1A 2J85A 4UW9A 2K7ZA 3NYQA 1DC4A 3GRRA 4JA0A 4RCYA 3ZBQA 3OU2A 4OLFA 2WWYA 4ZVUA 2LW7A 3QHPA 3T4EA 4R1QA 2Q4TA 3GJ7A 2CVPA 2YWRA 1BHJA 2RHDA 4MJ7A 2ATIA 3QLEA 1HSZA 2XWSA 2Y1WA 2YUIA 3QBJA 4HVAA 5ILQA 1KJIA 4S35A 3TGWA 2XBMA 1OV6A 2QN1A 4K2AA 3WNZA 1P9WA 1YVRA 1FOEB 5AVQA 1XJ0A 5SYAA 1A9ZA 3TFOA 4XX1A 3VJLA 4QE3A 3NDIA 4PN7A 2GCOA 2Q5IA 3BE5A 1FFEA 1PNTA 3A1FA 4NFSA 4DPMA 5BV7A 5FDFA 5LB2A 4QYXA 3A6PC 1DG1G 2O0JA 4RORA 3A1TA 3P45A 1G1MA 3FR7A 3JQDA 5K0LA 4B6SA 5K7SA 4P83A 3QI7A 1L6IA 4A27A 2V6JA 3OHMA 5J5VA 4HNTA 1CU1A 4BNZA 3GP8A 3G1TA 4X8MA 1UBJS 1YJBA 5TVGA 3IXLA 1GUFA 3L7YA 2HXSA 5FTJA 3WDSA 4RLFA 5KWIA 1EUCB 1O6ZA 2OOSA 4QJ5A 5GY7A 2FWJA 5HE8A 4RF3A 4F4HA 3PFKA 5L3QB 4TLLB 4MVJA 4EKEA 1M2WA 2RARA 4XB6B 1XKQA 1S5PA 3TRFA 1LTQA 5AK5A 1E3DA 3ZEIA 4RV5A 1EVJA 1SO8A 4Q1CA 2OZLA 1ECFA 2V58A 3DZFA 5JCXA 4R8RA 2FR0A 3V97A 4D02A 2QTTA 3A1UA 2IS4A 1A8QA 1HF3A 2CLKB 3WB0A 3TXAA 4CI9A 1RHQA 4MQMA 3FPBA 1JYFA 2A94A 4QDTA 1SNYA 1NBME 3ONWA 3G17A 2D1YA 2YVAA 1RACA 5AM0A 1QV6A 4CFZA 1L5HB 3TGLA 1PGPA 2OAQ1 2RGCA 3UNXA 5EUCA 3C3MA 3VR4H 4C2BA 1H3FA 4RENA 4C0QC 1AK2A 1XA0A 4BY9E 3HLYA 1JHZA 3DPSA 4RAQA 3UCEA 1IY8A 5DNEA 5FI5A 2WSMA 2G9ZA 1H1LB 1NQTA 3PT5A 3VPSA 2I29A 5J2UF 4S3MA 2RK4A 2XH8A 4GSLA 2Z56A 3CKLA 4X71A 3JZFA 4HDOB 3S5JA 3KKEA 1YDMA 1Z13A 3IA7A 3QSGA 1GG8A 4EJMA 3PE3A 5F7OA 2QVBA 2PGLA 4TMYA 3NONA 3U60B 4PIMA 3FRJA 3GLHE 3RYCA 3QEAZ 4Z7NB 4QZVA 1EWRA