2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2ZWIA 2IY8A 2C83A 2IHZA 4R9VA 2IHKA 4V2UA 2Z4TA 4V3BA 2IIQA 4V3CA 2ILVA 3S44A 2IIBA 2EX0A 4V39A 2EX1A 4R84A 2IY7A 4V38A 2II6A 2IHJA 2C84A 4R83A
chains in the Genus database with same CATH superfamily
1NXSA 2HPZA 1JIXA 1S1CA 2BR3A 4NV3A 4MI6A 4UNIA 3E48A 3FYUC 3ZWMA 1XFAA 1JR3D 2IOFA 3U3RA 1KA9H 1ZSYA 1Z39A 1IFXA 3H1AA 3LL7A 3BGDA 4MV6A 4YT4A 1X9IA 2I80A 4TSFA 2XXAB 4LDRA 1DZ3A 3RVPA 5LD2B 1VYHA 4QRHA 1ZVMA 4KXVA 5DGXA 1FUUA 1OR8A 1MOZA 4AJPA 3KSZO 3VPDA 1XDGA 2EGHA 3GRKA 4RQTA 3CY6A 3I4FA 3AVUA 3BX1A 1Q7RA 2V1XA 3SWWA 3NCTA 4WPGA 2EEPA 2TYSB 1KYTA 4R2XA 1ORVA 4O4IA 1V3UA 4BE9A 3PE4A 1OYYA 4MUKA 3R5FA 5JAUA 1M1NB 3KLPX 3LBAA 2WZDA 4I3HA 2J9YB 2YY7A 5JVDF 2G1UA 5JSZB 5DI3A 4TXMA 4HNRA 1BMFA 2CMGA 1PVVA 2GMWA 2A7QA 4IAOA 3P2JA 4UUMA 2CB9A 1KP3A 2FPLA 4UZEA 2GN1A 2G88A 4XDYA 3K0SA 3CE6A 3FPCA 3ZIAA 2PUBA 2TMKA 2VR1A 3L0DA 1RU3A 1SC6A 4DVGA 1JHRA 1PEAA 5ALNA 1WZ2A 2HCBA 2Y77A 4NJEA 2YNMC 2NYVA 1W0KA 2OO5C 3G0IA 3PWTA 4X61A 4PWZA 1CUWA 4D9IA 5CB8A 3JVIA 5B36A 1C3JA 2BJHA 4B43A 1T6YA 3SX4A 2DHQA 2ENUA 3UXYA 4EEXA 2P0EA 3IILA 3EIHA 4RJKA 3I2KA 3AGPA 4PPQA 3G8BA 1OZFA 5DDIP 3KR1A 5C31A 2ANCA 4IRUB 1DXHA 3FYCA 3E9YA 3B9QA 1T4GA 3ZLBA 2QE7A 4EB8A 2YWEA 3OD5A 1W2WB 1V3QE 4DDTA 3RUEA 5CAEA 3S28A 4I8XA 2BTQA 1YQGA 4Q01A 2OCYC 1Z63A 4KZKA 2LKCA 1WX1A 3VNRA 4EG7A 2EKBA 1DRWA 2R87A 4INPA 4Q9AA 3R6LA 4NMHA 1G8FA 3PYXA 4FM9A 5HQ3B 2MT9A 1R6BX 1F2TA 3B6ZA 4RPHA 3KZ1E 5CDYA 3AETB 4P0TA 2CYCA 3MCUA 3IE0A 1USIA 4PWYA 3W9YA 4QTXA 5JC8A 2VYVA 4NBLA 3W04A 2PIAA 4LXXA 4DSNA 4RGQA 1TCAA 1U2DC 3ZXIA 1MRNA 1I0IA 1ZFNA 3CLUD 4V0NA 2W42A 4DV5B 4RY9A 1ZXBA 5DTQA 3B20A 1XVUA 5IDVA 2ONYA 4EDFA 2CXNA 1E5XA 2WTMA 4IMIB 4RD3A 4UTRA 4XGKA 1FP6A 2R44A 4BO8A 1UM8A 5KYWA 1QR2A 3DAPA 5IJ0A 5B2FA 2DY0A 1Z0IA 1A9PA 2F3QA 3N76A 1N7GA 2G0TA 2JLRA 2QXTA 4EGCB 4TYWA 3UG6A 1T8PA 1JLLA 1NYQA 4NNOA 2B4YA 1IHXA 3AFMA 3L8CA 4ZVRA 5C8YF 4BJ6A 2QV0A 1JJAA 3DDZX 3GHYA 2WZBA 3OIVA 4FR5A 4V02A 5ALGA 1JTVA 4NCBA 2B30A 3DE7X 4IH4A 2BYTA 5EVCA 1UDBA 5EINA 2HHHB 2NU9B 5EN4A 1W1WA 2G1AA 5I51A 2RE8A 1YZGA 2EVWX 4Q66C 5IAEA 2I6GA 4R54A 4DA7A 2UXCB 4AKSA 2HCRA 2FNAA 1O77A 4C89A 5CIQA 3WGJA 1QQ7A 2QUBA 3HR7A 1J00A 4JBNA 1KC1A 1XRNA 3DNPA 4MDYA 1EJ6A 4F3CA 1NGSA 1SA0B 2JAHA 4DWVA 5TARA 4LYDA 5GIPE 3RVNA 4YACA 5BRJA 2I4TA 3CT4A 4POAA 1YBMA 5AOBA 4ISBA 4MUBA 1XV5A 5G4KB 3M89A 4O0MA 5LBIA 1Z26A 2ECQA 3IT2A 1KDZA 2J9FA 2WWIA 3KJGA 3TGWA 3T3NA 4Y9SA 1OGYA 2Q45A 1K63A 2GXSA 1PU2A 2P5UA 3R20A 4RFLA 4DBLC 1EK6A 3RRZA 4PSAA 2FZGA 4S3MA 5CVVA 3K9CA 4LZWA 1F4VA 4NTZA 1A3CA 2X9GA 5BXQC 3J81k 3IGFA 3AHDA 5B6PA 2PTGA 3NGMA 4B7UA 1P0QA 1GT6A 1KEZA 1KNQA 1TLTA 3FSRA 3JALB 3KKZA 4K9LA 4RGVA 5FNVA 1JRLA 1QQ6A 2J0UB 4LDZA 4X97A 1A69A 1S02A 1IOZA 1S0UA 4XPZA 1N5MA 3Q3EA 2QX4A 4JENA 4KTTE 1PGOA 4WJKB 2RSLA 5AKLA 1ZVJA 1Q3TA 4U02A 4Q9IA 1FFHA 3PQEA 2QMUA 1EFDN 5D01A 5IJWA 3SE7A 4UCWA 1I2ZA 5KYNA 2ZVDA 4EFMA 4H1WA 1ZUIA 2I7CA 4B84A 3AM4A 4QOIA 2Q3BA 2W2MA 2OO5A 2VHCA 3UAXA 4LF8B 2JRCA 1TYEB 2JGIA 3MJHA 5JD3A 1VDZA 1CNMA 1E4EB 2I1WA 5JMWA 4FYMA 4XQCA 4LFBB 1YAJA 3MLEA 1J09A 1P91A 5B3JC 1LBQA 3R7DA 1EI9A 2E48A 3D7KA 4J94A 4O1MA 5CH3A 1Z5VA 1AKMA 1V7QA 4XQEA 4HXEB 4N3NA 5FJIA 1THMA 4DJEC 3K30A 3UXMA 3X1MA 3FDFA 3M70A 2GASA 3EYAA 3Q9SA 4XWYA 1DG3A 3ZR4B 2ZIGA 1YDHA 2X9VA 1O58A 2XIQA 3DLPX 1E99A 3H04A 3QE3A 3KKPA 2JAWA 2YWXA 1T43A 4WADA 4WLVA 4V2IA 2JFQA 1V47A 4TMZA 3HWWA 4EH1A 2BFDA 2J30A 4IGIA 4L0MA 3IEVA 1FJHA 1JI3A 1QLJA 1JDPA 1O4VA 5JASA 4TPKA 3OZAA 2EGUA 3VR4A 2C7RA 3LUKA 1IBMB 1TF7A 1A8PA 4IJKA 4NAHA 5FO1A 1II8B 5AJZA 1ZK2A 2C8KA 1LI5A 1AB6A 4J8PA 4A8JC 2B8TA 1G3MA 2OHJA 4I1OA 3C7AA 3KRTA 3JVVA 5JT1A 2PVSA 2C3PA 1XF1A 2OV2A 3OIWA 4ZQHA 3UBTA 5DHTA 3VSCA 1NJ1A 3NS7A 2QVCA 3KPVA 2NPFA 5HMLA 1JLLB 3B1WA 5EY5B 3W77A 2QK4A 4LZNA 4AF6A 1B0UA 3L6OO 1KBOA 4WOJA 5L45A 3CRW1 1IXYA 3T3DA 4ARBA 5CVDA 4JDUA 1RZRA 1WXHA 3JQFC 4U7WA 1K68A 1SWVA 3GGPA 3HYRA 4P38A 4EQ6A 1JAZA 1DKPA 4ZKDA 1FS4A 4B1FA 1EGMB 1Q2XA 2NVWA 1BKSB 3GROA 2HJ9A 3QHQA 1U9IC 1XQ1A 5BVGA 1NF2A 3P20A 3M5CA 3WAKA 1MJHA 3EHEA 4ME6A 1GLGA 2LZ0A 3LA8A 3RS0A 3FOZA 4DYVA 1DJNA 1R0BA 1VKZA 5GPBA 4I81A 2D62A 1LTHR 3W6OA 4O4HB 3ZEIA 3F3MA 4EENA 2QEQA 1E9SA 2YWBA 3INNA 2DFTA 3HUTA 2H4ZA 3L7KA 3F7OA 2WJJA 4FC6A 2EBHX 2JGRA 2QYHA 4R0VA 1XTJA 3W1EA 3A1SA 3BTVA 1I3OA 3EAQA 4FNOA 1KJIA 5E0OA 4AZ3A 2NSJA 1ZH6A 3P7MA 2C04A 3EGXA 4TWIA 1PK8A 2Q6TA 4W6QA 4AS3A 1U3TA 3ABZA 4OHCA 1ZM3A 1C1HA 2FLKA 1C7RA 5EGNA 2FSPA 3SDBA 5A4FS 4MKRA 4GLLA 5BV8A 5IT9A 2ZUEA 2DFKB 2BJVA 2E5FA 4E7PA 2Q0QA 3L8MA 3OOWA 2GD2A 1ONSA 3OFND 4TROA 4LHZA 1I2AA 1GVHA 1JYEA 1PV2A 1HDEA 2J3DA 1PQ4A 2QTRA 3AT1A 3D64A 3GEPA 4MW7A 4PLZA 2Y05A 4RA6B 3UANA 4NFLA 3R7LA 3DBIA 4OTZA 2P4HX 3AG6A 1SUBA 3IDAA 2FX3A 3LCVB 5AK4A 1UBLS 1YS6A 1GN9A 2IEZA 3HYTA 2QI9F 4MAAA 3AZQA 4UUPA 1QE5A 1QIDA 4XVRA 4X00A 1BVHA 4RE6A 3LY8A 2ZYIA 1DXOA 1FRQA 2V03A 4YDSA 2HK9A 1DLIA 5HJ2A 3PL5A 3OLVA 5HIIA 3RUDA 5TQ2B 3WYDA 1HT0A 4DCMA 3TMAA 5AJYA 1UMDA 4RHYA 1JQLB 5JBNA 1B15A 1IQPA 2DHCA 1QFJA 4XLTA 2AOXA 3ZTTA 2PIDA 4H1HA 4I4CA 2BMWA 2C9ZA 3TSOA 1JKJA 2ICAA 1T6ZA 3VZDA 1UEJA 4LSMA 2RJ3A 2J48A 4FQ7A 2VHXA 4AY5A 1Z13A 3FUUA 3DFIA 3MWDB 4ABYA 2OLKA 3FTQA 4MCIA 3TAXA 1ECJA 2P9TA 3EEQA 4CFYA 1O0BA 4WASA 3COPA 4LFAB 1NONA 4HAOA 2CMHA 1QNLA 3V5NA 2BKAA 4CJXA 3NP9A 1XD9A 1XLTC 4RD1A 1PUXA 4QG7A 1Y0BA 4WFQA 1KVRA 2Z2KA 3OZDA 1KZHA 2RGGA 4IX9A 3LZ6A 3KOWA 1Z6YA 2Y1CA 4HPJB 1MF7A 4AO6A 1JXAA 1COZA 1CNFA 2HHCA 3OEHA 1QHSA 5LYJB 1QZZA 4RF5A 2VUUA 2C07A 1RM3A 3HCBA 3PCRB 1P31A 4WKBA 3WG9A 3VYVA 2R8BA 3ORFA 4BRSA 1FEZA 1WB4A 5C1OA 3C8UA 3PDJA 4WK6A 3HBAA 3RT1A 1PYDA 1Q44A 3EZ2A 1OWNA 2NADA 1SXJE 5M5BA 4QDUA 4L3WA 3O2NA 3C3PA 4PO1A 4Q05A 2WU0A 5F5LA 2PZLA 3IUNA 3UFBA 3U60B 1NXVA 4ZZ0A 3U4CA 3AFOA 2LVBA 1YIDA 4NJOA 1T34A 1NZDA 4XSVA 1FDVA 1DXYA 1H4VB 3FPGA 3ICQB 4H7EA 1B0PA 2GZMA 4GICA 3GMSA 1L1RA 1LRLA 2ZGVA 4P4TA 2IYAA 4ENQA 4ENRA 3O6VA 5H02A 4XDHA 1W85B 4YRJA 2ZIWB 1CR2A 2I7DA 3OZXA 2XF2A 3IEKA 3N0XA 4I9HA 3IP3A 4ZCQA 3UY4A 2CJPA 3HB5X 4RBNA 5J58A 3FE2A 3E22B 2HSZA 3ORRA 1F12A 1DRVA 2FUG6 3SR4A 1SIWA 1E6WA 3UK2A 3VBCA 1XHEA 4V0LA 2F8LA 4B85A 2JB9A 3MGAA 1QBGA 2NG1A 2YY6A 4RSRA 4J2OA 1TVKB 4GKBA 1OAAA 2Z2ZA 4BNTA 3D8HA 1Y6FA 1N5LA 1DOAA 3CH6A 3G0DA 1Q91A 2IU4A 2OY0A 2QRPA 2H3HA 3FWHA 1P6XA 4IIEA 4B3TB 1M2EA 3IVCA 3GNLA 3HU3A 3P9NA 1B6TA 3TBKA 1QCCA 1RSZA 2I67A 3VPSA 1AY0A 1JEQB 2V6MA 3DB1A 4MCJA 2AMJA 4WCFA 4CLXA 2OKCA 2AW3A 2AH5A 4FLMA 3ZOKA 7ADHA 3RS7A 2FDRA 2BHSA 1MEJA 2A1TR 3RRNA 3UK6A 4P5DA 3Q6NA 2ZWIA 1XLUA 4LGMA 1MPTA 3JQQA 5B53A 5BN3B 1SBQA 4WLFA 2HY7A 1T8TA 3PHBE 2VHUA 1SC9A 4I2VA 1II0A 4B6JA 2E55A 2GRUA 5E7JA 3WB1A 3ABRB 4UOZA 3MQFA 3ZCXA 3U31A 2QM3A 1NASA 3H8JA 2B37A 1V2GA 5T57A 1N2JA 3IAHA 2M6LA 3F8WA 4HDMB 1CVLA 5HCIA 2OXCA 3DC2A 1VI5A 3DDWA 2VDMB 5JWOA 2H2FA 4D4MA 10MHA 3RKUA 3R4VA 3UWOA 1FJGB 3S3TA 1JR4A 1PR0A 4DG9A 1SXJC 3WYEA 3I01A 2I5PO 3O82A 2BSAA 1IM8A 3PPWA 5DBHX 3SC4A 2HAEA 2BY4A 1CEYA 1NUUA 4KV9A 1WY5A 4RVHA 5FWYB 5JMPA 3V1TC 3A9UA 1ZIYA 2Y3IA 2AYZA 4L7QA 3UV3A 3SHTA 5E0KB 3Q8KA 5IC6A 3VDQA 1E61A 3LFUA 1H6BA 1KERA 2ZIXB 3HY4A 3B51X 1R88A 1YRYE 3C4QA 1VG8A 1XMPA 1Q74A 5HKOA 3IIKA 2O8CB 3UH1A 4NESA 5FBWB 1U8CB 2LV8A 3O7WA 4TT3A 1E3JA 4Q7KA 1T9GS 3G7NA 2H5JA 1QZ3A 4YLGA 2J7KA 2GPYA 3BD8A 4Z0TA 4G4GA 3RRYA 4J6EA 1NI5A 1VMDA 3IUSA 1JDTA 1O97C 5IJXA 3VZQA 1RWKA 3DZJA 5FADA 4J7XA 3WB2A 1TGVA 2J5QA 1H2WA 4WXPA 5K0LA 3ZY4A 4D9HA 1G59A 1OLUA 3RAGA 4CXMA 3QV1A 2ODBA 1C2TA 2JLVA 3EVNA 3RU9A 4CLOB 3F8TA 3KKNA 3EGCA 4KLRA 3VR0A 4CQMB 3RAJA 1RKUA 3AG5A 4FSDA 1PJ2A 4GYKA 4WRRA 4IIBA 5EIFA 3W34A 2KYRA 4OL0A 5AKGA 6Q21A 1ML4A 2JI7A 3HGMA 1SKQA 4OQQA 4CIAA 2ZI5A 2P5TB 3GOQA 4ZT3A 2OXIA 5CD9A 3P2YA 2PS1A 4GPAA 1JSRA 1Z82A 1KMMA 5H3LA 2X13A 2ZDHA 4Q4CA 4OK5A 3CZCA 2BFFB 3OM0A 1I9GA 1QKJA 2OGTA 3I83A 1YKSA 4L76A 4PFSA 3WHKA 1BSVA 4A6DA 3LC1O 4CM4B 2Q9UA 4DXDA 2P7HA 3OFJA 4ZVOA 2BGNA 3KTAB 4OHFA 1H2AS 1Q1BA 3OE4A 3ND7A 1XB2A 4BP9A 4B3DA 1JPUA 4PYKA 3SS7X 3RS2A 1K2WA 1ZIOA 2D00A 3ITKA 3Q3GE 3KUKA 1V7ZA 1Z6PA 2O4CA 2VT3A 3BQNB 3W9BA 3RJZA 5AESA 3BT7A 3L1VA 4KFSA 2BI7A 2LR0A 2XQGA 2Y6UA 4PC7A 3PXGA 5BUZA 1E77A 5EHNA 1E7WA 1SR8A 2O7NA 3OIFA 4RTSA 4AN1A 1BE8A 4BLRA 1S7CA 3A70A 3HMKA 4W5RA 3H2KA 2VQSA 3GRFA 1V11A 4MICA 4PYNA 4XJSA 4DR3B 3DHNA 3F1KA 3GJYA 3B6IA 1FFWA 1ZBDA 3LL4A 3FZNA 4AIRA 2KMLA 4PNEA 3SJAA 3UQYS 2DLCX 1N78A 1VSVA 3QE2A 4LZPA 1C0KA 3V4VB 5A4IS 3B6EA 5C5IA 1E3EA 5JAMA 1M76A 1W35A 2FSIA 3D6TB 1PFGA 3HCFA 3M6IA 2R60A 1HNZB 4NOJA 1X39A 1WETA 1C3VA 1S1MA 1OI4A 2XT0A 1QTNA 2GK3A 3ZNOA 3ETCA 4KYUA 4QEZA 4R9NA 2FMUA 3KPYA 1J8QA 4DN6A 1SVIA 3SXPA 1TKBA 3MTGA 4UM8B 3FZQA 3BBLA 5EWJB 1HUQA 4UQLA 1H0SA 1EB9A 2RBEA 3PFWO 4CKBA 2O5RA 4Q3KA 3VV2A 4GNRA 5KJ6A 3RF7A 2VPTA 2CVHA 2QMQA 2VF2A 1IN5A 2PJRA 2XAUA 3M6AA 1TI7A 4L2IB 4QDKA 2JCSA 3AOGA 4XEUA 3GD7A 3HZZA 4GU5A 2LCFA 3RC7A 5DP2A 3U3KA 3VH2A 3ZWVA 3D7RA 3ZU2A 5A4AA 1G38A 3L0CA 9LDBA 2CE2X 2UYQA 4LMPA 2Q5LA 3HM2A 4PZCA 3WTBA 1NURA 2VHYA 3FGPA 2VXCA 4F1KA 5K8VA 1ODKA 1ZZGA 3FPJA 1NHGA 4P0PB 4PSUA 4RD4A 3ZY6A 1XTKA 3FROA 3KHUA 2PWZA 2YQ4A 5LZ5A 1ZHOA 4N65A 5K01A 3KB6A 2ZS9A 1SUDA 4MOWA 3FI9A 3M6XA 4BQEA 1M1XB 1XU4A 1R4ZA 4PZAA 4U5XA 1U0RA 4PZEA 4HB4A 4D97A 4DIEA 2PE5A 4WK2B 5FIUA 1G20E 4GDFA 3FRIA 1L9KA 4F3KA 1E5TA 3ZHCA 1BHJA 4Y2PA 5GADl 5JVDB 1AHNA 2H2GA 1CY6A 1XHFA 2PAFA 2GZDA 3IA2A 4FWTA 4NH0A 4YHBA 1IHDA 4WKOA 1G8MA 2YJZA 2XNHA 4LRXA 4YCBA 3H1PA 1K27A 1GL3A 4PRLA 4JC5A 4P3PA 3CF4G 3OMXA 4X41A 1C7FA 1Q21A 1W1UA 2HHLA 1THGA 3AU9A 3DKKA 2OAQ1 3HCOA 3QH4A 4YJGB 4DIOA 4YV1A 1EHYA 3AJEA 3PGKA 2XGGA 4O4HF 1C0PA 3WNBA 4A9AA 2BN4A 3DOIA 3IMCA 4PZDA 2DWUA 1SHZA 4ENTA 4JQZA 3CTPA 3C3EA 5TVKA 4Q9KA 4L0CA 2H7VA 1E59A 3FHCB 2X19A 1Z4QA 2W98A 4L5YA 4PXYA 1UKEA 4ETMA 4XFDA 1PWEA 1X7ZA 1N2ZA 2L42A 3PWSA 3M5WA 1AZSC 1MV8A 4JXJA 3PNBA 3GLGB 2AFIA 1KS9A 1V2HE 3M1YA 2SHKA 5HQJA 4YRAA 2O8BA 1AJEA 2JIZD 2AXEA 3DW3X 1PV4A 3WX0A 5EVJA 2FFQA 3CCBA 3ZVMA 1FW8A 2BEKA 4RCZA 4RY0A 3UIEA 3EGEA 3G2KA 2PU7A 4IDBA 4EKGA 1SEVA 1WU7A 4QJ4A 4QGBA 4EYGA 1DDGA 1NVFA 3JQBC 3N3BC 1D2GA 1KO7A 1LLCA 4IO1A 4Q4HB 1T9KA 5SY9A 2NU6B 1GQ2A 3HJUA 1VG0B 3FYTA 3HXLA 3IAAA 1U0SY 4M0KA 1MX5A 4ND1A 5KSYA 2IDJA 4PV7A 2BGJA 5GINE 2FG6C 5FLKA 4JLDA 1E6MA 1U90A 4S1WA 4DIDA 3PC4A 4HHEA 4C4YA 2WE7A 1JQBA 4RANA 2HU8A 3SC6A 1U5CA 4O4JA 1L4EA 3U13A 4DIKA 5ED4A 1XWWA 1HC7A 4LKRA 3EW9A 1WM1A 1C7IA 1KAHA 2O4UX 2VUSA 3JQCA 1S9DA 4Q19A 2VC2B 3SN6A 5CB4F 3RSGA 1HQDA 1V96A 2W00A 5KOJA 4XKJA 2NP6A 3EVEA 3M83A 3DDHA 3W2IA 5JDCA 4ZQCB 2R4UA 1PQPA 2J33A 3R9IA 1ZW6A 2CLFB 5EXPA 4DG5A 3ICOA 5CDTA 2JIDA 5IXSA 4WBNF 5JZ9A 2JAPA 3CLTD 3KR9A 4PICA 1OXVA 4K3VA 4ZODA 1RBQA 2IWRA 1GAXA 3UEOA 4GRDA 1VLLA 4H0NA 2C1EA 4CGZA 2GCIA 2IUYA 1M2GA 5LM3A 1HOTA 2IY7A 1CEQA 2XXAA 5ECYA 4A8PA 4W8OA 5K0CA 4KXMA 2X8JA 2BSQA 2ERYA 1PSWA 3JZMA 1OBVA 2O23A 2HUNA 1OTYA 2OGZA 1FY2A 3IEMA 1N5JA 2WQZA 2JK0A 4PLYA 4XWWA 3UMMA 2PUHA 2AE1A 3U48A 4Z5XA 1F9EA 3OCYA 2JAQA 2LXNA 2R66A 2RH4A 4RKWA 3T7AA 1EZZA 2GCOB 4F21A 1TUEA 1TZCA 4URHA 2NZWA 1ECFA 3L6DA 1L8AA 1IZ7A 4NULA 4RNCA 2AMFA 3UMVA 3WJ1A 2YMPA 2P6MA 3VJRA 1YT5A 3IE2A 5JFOA 1E8DA 5CJJA 1CQPA 4YMUA 1L4YA 1U0LA 1TYCA 1STOA 4YCSA 2YJGA 1G5RA 3TQRA 1QIIA 4YRKA 2HJHA 4MW9A 3RSHA 4JI2B 3KOZA 1A1VA 1Y89A 1Y9ZA 1YASA 4KKVA 1M34B 1R6VA 5ECDA 1BVRA 2XD9A 4EPYA 4R71A 3DV0A 3D5QA 5KNDA 4L3OA 2HW8A 3FPKA 1P7VA 2YHIB 4X5OA 3U56A 2J45A 2X7XA 2YJNA 2KHZA 4EBBA 1XTTA 1RBYA 4NBWA 4A5OA 4GMDA 521PA 1TW3A 1TTHA 1C3XA 3SS9X 1WZCA 2GPAA 3JYLA 4OUDA 1H4SA 2B35A 2RDMA 2VA9A 1IUOA 3NDPA 1S01A 3BZUA 2PRZA 3DAOA 4J49A 4NL4H 2NO9A 1M9NA 2OXRA 3X43A 1N6HA 3L05A 4FGSA 4NX2A 3W5BA 1H65A 1BJTA 4JUIA 4ENSA 2O5VA 4DUGD 5JTTA 4WINA 2B36A 4ZV7A 4Z1OA 2PDAA 5C37A 1ZMXA 4KN8A 4G07A 4R6WA 4MVJM 5JI2E 4B9AA 1CETA 1YDWA 3OT1A 1B3BA 4PLFA 1KK1A 4PAMA 3LG2A 4GVXA 4MYDA 2O3RA 1SGWA 1J8FA 4XYBA 4DLKA 2ASEA 1I7NA 2DH5A 2FR8C 1TEVA 1V9LA 3OSZA 1BXGB 5DBFA 1N5OX 3TVDA 1AMUA 2G9QA 1DEOA 4WKCA 4K9KA 1VM6A 4HUJA 1EVYA 2FPMA 2IUTA 1K66A 2OHVA 3LA6A 4XE5A 4D4KA 3H18A 4YIHA 3PZBA 3SX0A 5BSUA 1G8HA 1NMQA 1I7PA 3O91A 1DBWA 4CEHA 1GQSA 1E0AA 3PHCA 3QUQA 2Z6QA 4D46A 1ZWKA 2J32A 2MCFA 4C3UA 1KU6A 2VK8A 4CQNA 1P9LA 1ZITA 3A26A 1T2EA 1QRRA 4IHAA 2PO5A 2OBLA 4MLZA 4X3OA 3ZNQA 2HMVA 4QO8A 5E3HA 2BGTA 1YAHA 1EVZA 4U3JB 3P9KA 3EUEA 4U2BA 1YL5A 4DL9A 3CVXA 3M0EA 2JDIA 4XCVA 3SQLA 2CV1A 5JYDA 4FB5A 3ILHA 2H11A 1U3FA 2FPXA 2HGSA 2XF8A 3C2QA 1WZUA 3RTAA 3UMCA 1UXJA 1HE8B 2DWCA 2LDBA 1VHWA 1JHUA 2I0FA 1JNXX 3GO4A 1KAQA 1Q84A 3BHJA 3IP6A 4JLJA 4MWGA 5ALJA 1NZJA 3OT1B 5CEEA 5LR6A 5BSGA 3OOYA 4NNPA 3GK3A 1UMBB 3TECE 1P45A 3A37A 4GQIA 4R9UC 3ZBUA 3JZIA 5ALEA 1O9GA 1EFHA 1JA0A 1JEYB 1P8AA 3TSZA 4MYHA 4V0ME 4WZBB 1MFZA 1MW9X 1Z73A 2VKTA 3WFIA 3ZTYA 3IR6A 1JGTA 4GZMA 1GG8A 4LZLA 2FWMX 1DAGA 1VMIA 1VKNA 2BELA 2XZPA 5JYCA 5C53B 5DU2A 5I4IA 1PZHA 2Q46A 2P0AA 3HCDA 1UJ5A 2PRSA 5K6TA 1IZ8A 1QMGA 2J6CA 4KQMA 1IUPA 4Z9YA 2JAUA 3HLKA 2H1CA 2GYVA 4BQOA 4CUZA 5KPJA 2GXQA 1LX6A 4L6AA 2A0YA 1BDBA 1GGEA 1Z5ZA 2HNKA 3Q98A 4L22A 4LMAA 2X0KA 4MVWA 4PLGA 3UJ7A 2GXUA 3LBHA 3Q4GA 4R9SA 1Z68A 3K5IA 5CA0F 3AM3A 3HPRA 1M34A 1VJ1A 2GEKA 1O89A 3R5JA 4JB2A 3KQMA 2RC6A 2H31A 2X5JO 4N5IX 1N6LA 1E7RA 4YUVA 3T7EA 1WHSB 4M0PA 2CXPA 2XDWA 2CZQA 3DFMA 2E4YA 3UOGA 1HZZC 4GRAA 4DNPA 4F9EA 5KKNB 1YZLA 3I32A 4TKUA 4TRNA 2WT9A 3DOUA 5FNVB 4IFEA 2DOKA 1SQ6A 1VHQA 5HS4A 1WMBA 1WV0A 1FS6A 2WTXA 4BQSA 4WI1A 4M98A 3H42B 3K6JA 4BNKA 1KEEA 3D81A 2UUAB 2V54A 1P19A 1E2KA 5M04A 2EFJA 1TUIA 2YFQA 2OVBA 3NU1A 3QFCA 4JLPA 4ZT6A 3VO2A 1YRWA 4X20A 5GVRA 3W3AD 5HKAA 1H8ED 2Q3HA 3G1WA 5DLYA 3ZK9A 3ZZNA 3ROFA 2LCQA 1I0ZA 3AERB 4EWLA 1NMEA 1LWOA 2F48A 1Q92A 2PGNA 1YF3A 4WJZA 2B99A 4EHDA 3AW8A 1R15A 1V5FA 3HCNA 4UHFA 2R6HA 1NT2A 4OF4A 4RENA 2ZR8A 2PT5A 2XBUA 3AHJA 4XOIA 1HNWB 4L28A 3AVOA 4AG3A 1D2AA 1RQRA 2OFOA 1C9YA 2WFZA 5ALFA 2ZT8A 1YR6A 2WU4A 4UC0A 3KKOA 5C81A 1RHKA 3CNHA 4ZT5A 4EUNA 3BWCA 2FUG1 1GPJA 1SU4A 4TWJA 3TM5A 4E1AA 1A7KA 4UOEA 1KGDA 3QQ5A 4R1UA 1VLJA 3B7GA 3AJAA 1E1KA 1BYIA 1I36A 4FP9A 5AW2A 3FBTA 3NTRA 3AUKA 1MAAA 5FUVA 2VZ0A 1CPYA 1WHTB 4ZAWA 3IJRA 2C3UA 4N01A 2RFLA 4RZUA 3V7FA 1WOMA 3FXAA 4HVLA 4KRFA 5EJ7A 3Q88A 3KL2A 3E9QA 4Q3DA 1JF8A 3AHCA 4IILA 3KV3O 3MUNA 3I2GA 5BNZA 3SKYA 4U9HS 2H7XA 4LV8B 1XVTA 3PUZA 2IUEA 1Y1RA 3JQRA 1Z5GA 4NZOA 2ZJ6A 3L6RA 4EG4A 4F3NA 1OMOA 2Z5GA 2VCYA 2CXSA 1VC2A 3QA9A 1O5TA 2J0EA 2Z5VA 1JHMA 3PZRA 5JS7A 3H05A 4BO9A 1CRZA 5AKHA 4I55F 1OY1A 2NMVA 4AG6A 3V48A 3NJ4A 5CVCA 1V45E 2FP3A 1DT5A 4Y6LA 1LRKA 5HSGA 2CLDX 1OI2A 1P7WA 4PCLA 1JG7A 2PRKA 4Y6GB 3UYLA 2OZLB 2I8CA 1KH2A 3MJSA 1SPXA 1LQ2A 4PLCA 5FCDA 4MUIA 2JFPA 3DYVA 1R0XA 2A30A 2NM0A 2RK4A 2OHGA 1N9ZA 1I7QB 4JJ6A 4TVKA 3SKVA 1LBTA 2F55A 2GCEA 1QDEA 1GU1A 4HLQB 5D3KA 3HN7A 1UPFA 5C34B 3V33A 8GPBA 4Y9RA 3V32A 1Y5IA 1SVOA 2EG9A 3PQ2A 4I1VA 5KYUB 3TLMA 1S2NA 3V4FA 2ATEA 4RUKA 5EJEA 4PF1A 2RGYA 5LUBA 2I3DA 2H1VA 2I4MA 3PG5A 4ZOLA 2OWDA 1C3LA 3I9OA 5EMLA 4ZCMA 1KKMA 2A9FA 3ZQ6A 1RLUA 3DEZA 3LDUA 1EUQA 1YQWA 2XRMA 3HZRA 4YCMA 1A1SA 4PFQA 2ZTSA 3L07A 3MVEA 4QATA 4C0WA 5JCPA 5LMZA 4DJTA 2C2BA 3A6HA 3N70A 4GBMA 4U0KA 1J0DA 5EZYF 4BFSA 4ZK2A 1J24A 4F6CA 1I8TA 2WTBA 4LBZA 1RJFA 1LNZA 3OBIA 2X4GA 2XUAA 1YJAA 2CLIB 3DCJA 1MDFA 1JQKA 3E7DA 4ZI3A 3FYDA 1N75A 2DYKA 1MXFA 1ZCJA 2HK8A 1A71A 2NPOA 4LC1A 4A4DA 2O3TA 4BFWA 4EYEA 4E94A 4AJ2A 2YZKA 3RUIA 2LRHA 2IHZA 4KYVA 5JYEA 1VE1A 4NFSA 3KQVA 2C61A 3HL0A 2BEVB 4G3XA 4YO7A 5F9MA 3IBCA 2OYRA 1GWNA 2ZAMA 4YLYA 1PF7E 3HVRA 5ICEA 2R97A 2ZB8A 2QQ5A 2Q1XA 4C6TA 2DU8A 3DM9B 5CT5A 3LBYA 3I5XA 1ODFA 1U7TA 5EYPA 1FSZA 1R50A 3EUAA 3IQXA 3WGKA 4KN6A 2ASVA 2DTXA 3MMXA 5GZ6A 5KVAA 1ZAKA 1QTQA 5LQKA 4RTNA 2RHTA 3I61A 5J2TA 4X1OA 2VHZA 5E7IA 1W44A 2G5PA 5E2IA 5HNKA 1VZ3A 2YDXA 4QDXA 3ANYB 4NU8X 2BIFA 5BN4A 1CJKC 3GDWA 1JNYA 2YZMA 3CEAA 1PR6A 1BO6A 1JKXA 4M38A 4CMHA 5EZ6B 4DYHA 4MIKA 1FP4A 2WUVA 3HKEA 5FXMA 4B82A 2C2KA 4JB0A 1PNTA 3QSYA 4FOTA 2Q1TA 3BQ9A 2P8JA 3H86A 3RQIA 4C7JA 1OXMA 3N8DA 1KHTA 1HEUA 1BROA 3G2MA 1JG1A 3W6NA 1NXPA 1JEAA 1PX0A 1TU3A 2FPGB 4YCNA 2V8BA 4WZAA 2G8LA 2XLBA 1K75A 4E5SA 5A2GA 3R23A 3OZIA 5BV1A 2PX8A 4LHEA 2W8BB 3D31A 5TGDA 2C8JA 3NHBA 4HDSA 2BBSA 3SD7A 4EOGA 1OA1A 1E98A 4IGAA 1YJ8A 3AWIA 1X42A 3M33A 5IBQA 1DWQA 2W6PA 2QRQA 3TNLA 3WV4A 4MLCA 5GONA 3IV7A 2RHMA 2P9HA 4HDKB 4EI8A 2X2EA 1F0YA 1R74A 1MJGA 1SCDA 1JPNA 4TQ9A 4AJ9A 2ES4A 2NV2B 4TT3D 3KELA 3TFOA 2CFIA 3U2QA 4V0QA 2JKVA 1TK2A 4BQNA 2XZTA 1XJCA 1DAEA 1TEZA 4K6GA 1OZ0A 4WACA 1FFDA 2XUKA 2B5WA 1SB8A 4HGQA 1KARA 4D45A 1EFRA 5HGXA 1M6VA 4GP9A 4DC0A 1SN7A 1Y1TA 1XX6A 4JN6B 3ZIUA 3KQKA 5ELXA 4FYJA 4P3OA 4DARA 2PXXA 1WBBA 5CXQA 3RYCA 4R2IA 1I80A 3TX2A 4EB0A 4C29A 2IFTA 1ZW1A 4GM1A 1QKKA 2PZAA 4RPCA 3WBJA 5IX8A 3AYZB 5DB4A 1N1EA 2VL7A 3B60A 4LFCB 1QLHA 1AUPA 5CA0A 1A2BA 2I4IA 2YQZA 5EPUA 3L79A 1QGUA 3D7MA 3DDNA 3PV0A 4GMKA 3DG9A 1HR0B 4NXNB 1QFYA 2AB0A 4BB6A 4HQLA 2DG2A 4HRXA 2D4AA 3D1JA 3G8YA 3A4NA 3KT6A 3E03A 5DSXA 2FUCA 1DJPA 5AI6A 3UKDA 4M7PA 1U8YA 1UMCA 1G7SA 1GTZA 4XSHA 4LGCA 4OMDA 2IPMA 4BNNA 5BT9A 5D3MA 1NR7A 1O4WA 1OZAA 4LYAA 3QFSA 2FZ5A 4QYIB 1N0IA 1AKYA 4DJ5X 8AT1A 4P32A 2CVOA 2AGVA 5REQA 4B6QA 3ITDA 4RORA 1MZPA 2FWJA 3WLOA 5GWXA 1IYZA 4D79A 4BHTA 2W4QA 1IM5A 5FA8A 1YJBA 1WUYA 2PSDA 3VPGA 3TI9A 4KSYA 1GLNA 4WXHA 4DLZA 5GP1A 1J0BA 2C4NA 3EZXA 3NGLA 3C4JA 1C50A 3VR5H 5E38A 4HRYA 1E1RA 1YB5A 4C4OA 4G1BA 3WLQA 2YUTA 2GAJA 4PW0A 5F51A 2JBAA 3IPCA 3M5DA 4F93B 4HGPA 1BWSA 1OZGA 3OQ6A 5FD8A 4NXMB 1M0WA 3QU4A 3T5BA 2YMMA 3GGSA 3L8HA 4BGUA 1NDQA 2F3PA 4DC1A 4KODA 2BGRA 5E1OA 3R3WA 3WMGA 2O8VA 1XAJA 1WD7A 3IDSA 1VI2A 2PGJA 1CVRA 2VJKA 3U1TA 4E32A 4PYIA 1DX6A 1VRCA 2ZI3A 3I4CA 1DJLA 3G02A 3EDOA 3JQ6A 1PEYA 3NI2A 4EHKA 4HMPA 1OBOA 2IHUA 4UBNA 4DLNA 3GGDA 5IVKA 4FKBA 3STXA 5BWOA 2YVAA 3R5SA 5BSEA 3RFVA 4MJLA 4DY6A 1V95A 2P41A 4E5PA 4AQ7A 3OOEA 1I4OA 1VB3A 3N2GB 4NFHA 1T3SA 1L7EA 4LHYA 4G5FA 1HBJA 5REQB 1X8KA 5ARDA 5D6NA 4ENWA 2ZIXA 3T94A 3JQ8B 3QM1A 3USZA 1X1BA 1G8YA 1I1OA 4PPYA 3AF5A 4O5AA 2JIBA 5AVYA 1KY5A 3L49A 5FTJA 3RIHA 1ECGA 3AW9A 2EKQA 2QTAA 1BWQA 2NW6A 2ZVQX 5AW1A 5IS2A 1GNTA 3AKDA 3H84A 3V1NA 1P2FA 1U7WA 1ZHFA 3TLAA 4ALIA 2MJLA 2RKWA 3HP1A 3SBOA 3OAAD 3K9QO 2ZRGA 1D2HA 1AKWA 2ZJ7A 3NDJA 4ZEXA 6ABPA 4RD0A 1EDEA 3IJEB 3ORSA 2P5YA 1W75A 2B34A 2H16A 3OPVA 2JBAB 5KTTA 1AGPA 5D3ZA 1YZNA 3KU1A 3OY7A 1JB1A 3SMQA 2ATVA 1QOZA 2GD0A 1LY1A 1BFUA 1P2DA 3LLCA 2Q5OA 1U11A 3N6RA 2A9KA 2PH3A 1MO6A 3UYKA 2JCYA 2JD2A 4BNVA 1SCIA 2HLPA 2BKLA 3E9EA 3OPYA 4Q34A 5FLYA 4XD7A 4PY2A 4RK5A 1JHPA 2PUVA 2JI4A 1DI0A 1POWA 1PJAA 4X7RA 5HX7A 2J9XB 5JXIA 2XRFA 2W90A 2JATA 3TN7A 5I4KA 3TRDA 2X7JA 4UAUA 1UZMA 1ZCBA 4AY2A 2Q4TA 1QHHA 2IKQA 5ILGA 1UPXA 3RJTA 4TZKA 1XDUA 4F38A 1Q1GA 3SI7A 4LJ5A 2P68A 4X24A 2BBTA 2HYIC 4V2UA 3K4PA 2OENG 3CJQA 4FFSA 2XNDA 5DF1A 3RGGA 3E5HA 3F2IA 3AX6A 2ZUFA 2X76A 1ZM9A 4EDHA 4DMRA 1Z17A 5DN6D 4FN5A 4KPGA 5KSZA 4RVSA 2PS3A 4NV0A 4QPJC 4WNYA 4C21A 1IEVA 3OLXA 2GFHA 1F06A 4XOUA 2G7MC 1DCFA 4YI5A 3L6BA 4BNHA 1YKFA 3DQZA 4CTOA 3U4QB 4WXRA 5LQCA 2OV8A 2ZBGA 4ZALA 2RD2A 4G5QA 2WKPA 2Y9PB 4CKWA 5ITZB 4FHDA 2XWPA 3LHDA 2VSQA 2FZKA 1MVLA 2DPGA 2KX7A 4FBLA 2J9RA 1OFGA 3ZW7A 3AY7A 5EIBD 5C5DA 2O8DA 4ZJYA 4AU1A 3TGPA 1JXMA 1LDEA 5HKLA 2V7GA 1H5NA 2VHVA 3A27A 3AF2A 3NGXA 3ONNA 5EFZA 1ZSNA 2JFYA 2GEFA 5KYVA 3S2SA 1C8VB 5A4DA 1XDDA 3GT4A 2BT4A 2GZSA 3GFBA 2RARA 3DLBA 5LIRA 1G5FA 4RW0A 1GZSA 3IOBA 3TZLA 5BRNA 1NTOA 3H9UA 3ZGNA 2WBLC 4HB2A 3R40A 4EMSA 3IUPA 4KMOA 4M86A 3CVWA 1GZHB 1ACMA 1EGQA 1P7ZA 3PLNA 4G9GA 4MCAA 5EHGA 2BZ1A 5HF5A 2E18A 2EJTA 5JNVA 1TKRA 4YUAA 1FZQA 1WIWA 3M4ZA 4AJIA 1L5ZA 4LZAA 3QENA 3WZ2A 3LIIA 2KM1A 3BORA 1L5SA 2M6SA 3ZJUA 2HD4A 3I53A 3RPEA 4JI8B 1F38A 4QUHA 2XYQA 1ZK4A 3ILYA 5FR2A 2GRJA 4JOQA 4W1PA 4X71A 3SZUA 2JG3A 2WMDA 3D9QX 1C2YA 3O1LA 3WQHA 2H0QA 2P78A 1JQJC 3VPAA 4NOKA 4Y67A 2MSEB 3SYKA 2FWAA 3X1WA 8ATCA 1NJ8A 4B31A 3GPDG 1Q7CA 1THTA 1BWPA 3GI1A 2RC5A 4BQRA 3NYIA 4UDYX 4LE0A 1VL8A 2QQGA 3ZC3A 1SHTX 4A0QA 5ITZA 3I9JA 421PA 1E79A 2VZ8A 1P39A 3SJBA 3VDXA 1L7RA 1BA3A 3I2FA 4HY3A 2QJTA 1E6UA 2ZU0C 1MDBA 2SCUA 4PSCA 3VI3B 4LMBA 5INTA 3ZI7A 5J63A 1YQQA 3U49A 2Y0DA 1ZUHA 2QN6A 2W22A 2WMNB 4JVNA 4U6QA 3UUEA 5AI4A 4K9NA 2Z8XA 5ELLA 1HE4A 1N7JA 3H5OA 3PNKA 3GVIA 3R5XA 1Q2UA 2GJ4A 1XVLA 4PBSA 5KYYB 4WJLA 1O87A 2W2OA 1V16B 4HH1A 4JGBA 1RC1A 4O2LA 1TM1E 4F4HA 2V58A 5HG0A 1H1TA 1LS1A 3A9VA 4CUJA 2V0CA 1DKLA 2SKDA 1R8SA 1SELA 5F77A 5LKAA 4MRAA 2HM7A 2ZLBA 3DNFA 3Q6MA 4HO1X 4OUKX 2I4OA 3T9FA 3FOEC 5FORA 3OSUA 1DAPA 1U1CA 1QR6A 2SICE 1YC2A 4MQ5A 4NPHA 2QVGA 4G8BA 4B44A 1PX2A 4NJMB 2NXJA 1L4LA 1WY7A 2YHSA 3V8PA 3ZD8A 2OESA 3LRXA 3E0QA 1WPRA 3BSWA 3UGKA 4DV0B 5ALIA 3AY0A 1ST2A 3NASA 1S2OA 4X3CA 3MMNA 3I9NA 1ZJ5A 1WXGA 3JZDA 3KQTA 2EZTA 1LJUA 1U9IA 2HH9A 4U4AA 3WHPA 1LEHA 1P0CA 1Q6YA 4LDQA 1MHTA 1K9VF 5C32A 4DDKA 3G13A 1O3YA 3BMCA 4HRAA 1VOTA 3AH8A 3FI0A 4HUQB 4BE4A 4BP3A 2OTCA 4F86A 1ADBA 2X1LA 4NENA 4TYYA 1WUKS 2ZDGA 3Q72A 4H6PA 4J1TA 4U2FA 3UWKA 4EFLA 4PLTA 3SXJA 1D4ZA 1CQIA 2OCPA 2XGJA 1R5JA 5BW6B 4IQ4A 2QTWB 1HYHA 2B3TA 1CIPA 5LSAA 2PK3A 3LSTA 2L19A 3FPLA 3IQGX 3K4HA 3W5AA 5A0TA 3BRWD 4LBVA 4O63O 4EGFA 2XNJA 2FRXA 2VIIA 3JCZA 4PGAA 2Q6KA 4N7MA 2Q7OE 4F4DA 4OB6A 4OXNA 1UKBA 5AVUA 1GCIA 1M0EA 3FWPA 3ANSA 3RWOA 4AXBA 4P4GA 1UPTA 2REXB 1KY3A 4KP7A 2NUBA 1OXSC 1EG7A 2EIXA 1O8CA 5KQGA 4G63A 2DZDA 1IN7A 3CA8A 4M76B 1GPNA 1W2GA 1G60A 1I2CA 1RCUA 1U3CA 3S2ZA 5PGMA 5JNRA 3KZNA 3K96A 3K2QA 4QGFA 1JQEA 2Q1WA 2GAAA 5FYDA 1N1DA 1GYRA 2GZ2A 3MERA 4XIIA 4ZO4A 2CFSA 2DB3A 4TLAA 1S96A 2BE7A 3ET4A 1YB6A 4MGYR 4KCGA 4FDUA 3VKWA 3CXRA 4I36A 4II7A 1J1IA 4KOAA 1ZD2P 4R05A 3T35A 4ZVNA 2G1PA 1TX4B 4UBJA 3UJ9A 3EOAI 4LX8A 3KPUA 2NYAA 4MIOA 2FWBA 4N5NA 4K6HA 1OWMA 4EATA 2IEGA 4IJUA 3D6MA 3AR8A 3WDKA 5IWAB 1QG6A 2PO7A 2QT1A 4L51A 3BMQA 5AUQA 3CKMA 4W4TA 4P33A 2I6TA 5B1IA 1SHLA 4O4LB 1PVDA 4B4OA 4WCDA 2HUPA 2QL9A 3KPJA 3NOVA 1W5BA 4RF4A 2FKAA 2QW0X 2QS9A 2B7LA 1DSSG 4MUEA 4ND6A 4Y9TA 1RRMA 2DHEA 2XRYA 3VX3A 4EMBA 3THXA 5TXGA 2PL1A 1RXWA 2RGNC 1JR2A 3ZCRA 2CL6X 1GZVA 1OD6A 2CKMA 2WAOA 4CNQA 5JIBA 2VQFB 1KEVA 3DVAA 1NSTA 2PCLA 2MMCA 4UHCA 5K99A 4A1FA 2VI5A 4JJ7A 1WW3A 2QT9A 4RL4A 2OGSA 2WNSA 2QPAA 2GT1A 2N9UA 5K0TA 1GV1A 2OKGA 3FZEA 3DF9A 4J03A 3NBMA 1QIHA 1K9SA 2ECOA 4QBIA 1XK7A 3S2IA 3K5WA 5IYZB 2A5YB 4BTEA 4YCAA 4HGZA 1ZM2A 3FMGA 3N9IA 4Z2YA 1KK3A 4D0LB 2O2JA 4GVLA 1ZESA 3D54D 3DVLA 1EX9A 1X7GA 1NNEA 3LVQE 2DPLA 4F5WA 4COKA 5IZ4A 3AFHA 5J2TB 3N59A 1V25A 3NTVA 2GB4A 4X1YB 1FVHA 2X0JA 1T1GA 2NZJA 5F1PA 1GR0A 4PZPA 4YALA 5B64A 4I5EA 3FCUB 4IIJA 5EA2A 3VJKA 2H1SA 1RYBA 4BC1A 4ESEA 3H2JA 3OBBA 4WH0A 3L7AA 3F97A 1QMPA 1G55A 2DAPA 3AETA 2PWYA 4X60A 4URYR 1J20A 4YX9A 2C5EA 3D3QA 4IDOA 3MHPA 3V00A 3HTXA 3K9HA 4W6ZA 3O83A 2WVJA 1P0IA 2DMRA 2VP5A 1C1XA 3OC0A 1EEHA 1O95A 4TTAA 5B1SA 3I73A 4ZAXA 1FFYA 2GUGA 3OEED 1SXJD 2QR2A 1BZYA 2AC2A 1JHQA 1LC3A 4KWHA 3VTAA 2PV0A 3ZHBA 3CT6A 3RD5A 1SCUB 1YB1A 3O8CA 1QPZA 1L9XA 5J4LA 3DYIA 5CUQA 5DHQA 4UD6A 2Z5LA 5J2TF 5C8YA 2C03A 1KE1A 5CK5A 3TKLA 4CM8A 4B5LA 3TLZA 4QGAA 4G1FA 2ZJ2A 1AS3A 1FNDA 2IYYA 2ZKIA 1YIAA 2WYIA 4IG4A 4M9CA 3TO5A 4BQIA 5TRTA 2QMOA 4C0BA 3E7XA 5LWQA 4EY4A 3QIVA 4NYJQ 4CEHB 5CNMA 2ZJOA 1SCAA 4IRMA 5I48A 3WNVA 2D0DA 2YIDA 1UT6A 4UARA 5DX0A 1R0KA 2PRJA 3T12A 3NNDA 1NFFA 4L9SA 4DCVA 2QX8A 3V1LA 2X22A 1ZGJA 5HZKA 4U3JA 1DIHA 2Z9BA 2F90A 1UAYA 3QVWA 3UC9A 3H0EA 4LA4A 2ZJAA 2LWIA 4AW9A 1JWBB 4Y6PA 5F7OA 1KMQA 2EX4A 1MIOB 2CHGA 2VSNA 3PSHA 3P26A 2ZCJA 3KLMX 1ACLA 4IIJB 5TLSA 3A2KA 4MULA 3GELA 4WY2A 1WQ3A 1SUEA 2NSHA 2EP8A 3B9BA 1KETA 1LPBB 4H7PA 3RRJA 4UCXA 3ZQUA 2ENWA 5ETJA 3AJ9A 3DZFA 2IL1A 3LC0A 3F3SA 3BH6A 5EIBC 2EJUA 3V34A 2B7BA 1KORA 3WJAA 1XZQA 3DDSA 1H1LA 1Q12A 3GRUA 3MK31 4Z7QB 7AT1A 1RE1A 2Q9BA 3CLVA 3QLVA 5AOAA 4FE4A 4RDHA 3H3FA 3LPNA 1GPBA 3EFOB 1BH6A 5KMGB 1XZKA 2B82A 1M33A 1J2RA 2XMGA 5AK0A 4AZ0B 5EJ9A 4Y3UA 5AP9A 3M9XA 4Q1BA 1QTIA 4AUNA 5JANA 1UKVY 2NO5A 3O3OB 3FPAA 3MM4A 2YXDA 5AI0A 3A6KA 3UAZA 1GAJA 1XR3A 3AI1A 2VK2A 1UKAA 1HK7A 3ENZA 3PKZA 1OW3B 3HUEA 4EECA 2RI6A 5CA1F 2YBEA 3QEMA 4PR0A 3UZUA 2P4EA 5K03A 3E61A 3JQGB 4IHKA 1Z07A 4KO4S 1VGVA 1XK6A 4BZQA 2PGDA 4IZ6A 3RAEC 3G9TA 3BWYA 3SYNA 1UBKS 3VGPA 3WGGA 5T6BA 2UYOA 4QG3A 1CY8A 4UVHA 4Y2GA 4TQUS 1KZYC 2XUOA 2YYSA 1EWTA 4BQPA 4EBFA 1U99A 4HV4A 3FNRA 4IKEA 1O2DA 5JJCA 1GU0A 3GYBA 3LP5A 3R3VA 4I4IA 1UBNA 4MVCA 3EQ7A 1T25A 1QU2A 2B20A 3P96A 1MPXA 1G3QA 2I7VA 4HB0A 1NLYA 4ZAVA 2N1MA 4GIBA 1LV8A 2G5CA 3T9BA 1NVVQ 4YT2A 2WNIA 3UKJA 1JHXA 1M0SA 4EUHA 3RASA 5BSRA 4J6FA 2ZPTX 3C3YA 2WFMA 3TDKA 4DCCA 1MO4A 2PYIA 5BXYA 2NZVG 3CIFA 1MOSA 1M6NA 2H2IA 1ZNYA 5B3LA 1HNNA 4RPGA 1M5RA 1I13A 1UQUA 2PH7A 4LECA 5H7XA 3ZHTA 2R6FA 3DSRA 2DUMA 2M1ZA 4I55B 4IMRA 1RTKA 1QJCA 2GN2A 5BWMA 2JGDA 4O1IA 4EUKA 3HN6A 1M6EX 3ASUA 1D07A 2FMIA 3K0AA 3O38A 1RRKA 4JLOA 2OCXA 1BDMA 3WWYA 3TEMA 3H1TA 4MQBA 3R6DA 4JOSA 3BK1A 1LBEA 2BDUA 4MQEB 3KJIA 1DEKA 5JADA 2BPOA 2GA8A 3F78A 4MEAA 2R47A 3KZOA 3FUCA 1M7GA 1NF3A 1SG9A 2WD9A 3I6MA 5AW4A 3LM8A 1IEXA 2RB5A 1RYNA 1IPHA 1XMXA 4G8DA 4C2UA 1VG9B 1HDRA 5ARCA 2FRDA 2E4UA 4G25A 3PX3A 2BW0A 4G0VA 2X86A 1K97A 3PRJA 1SH7A 1WHTA 3I05A 3ZHOA 1XSEA 3FWNA 5E1DA 4D6YA 3HA7A 3C70A 5JZOA 3TJMA 4U7DA 3DDOA 2ZYGA 1J2YA 1KFJB 1VYTA 1W59A 4NU0A 1MUUA 4D0SA 1D7OA 2W83A 2M98A 3SG0A 1TTTA 1SBIA 1TZKA 1OVMA 2JBWA 3I52A 4OP3A 5SZIA 2C3MA 1A7AA 3EWAA 5CH8A 1EUZA 3KAQA 4P80A 1MJNA 4BKRA 4HK4A 4FZ5A 2BI8A 2IJGX 3K1JA 3TIGA 2HMYB 4Q48A 4ZJZA 2WUGA 2IXGA 2ZE8A 3HU5A 4Z7NB 3JU3A 4Q3NA 3D0QA 1FFCA 2A88A 3R9XA 2F62A 1QFZA 4NYMR 3IVXA 2HA5A 1A5SB 4Z9FA 4C7OB 3E81A 1V7PC 3U3XA 4RADA 4W8GA 3JVUA 1GHTA 1I14A 1WRBA 2OHFA 3MINA 4QYSA 2PL5A 4LOLA 1AQ6A 2X8LA 1XLWA 1QIJA 2D13A 4BLPA 5AJHA 3TF5A 3WKEA 2G25A 4ND7A 2O7RA 2PX2A 3H65A 4PNZA 2VDQB 1AM4D 1JR3E 2P2YA 1VKRA 4JELA 5J2UF 2GJ9A 4X9XA 1NRWA 4YHHB 4S05A 3OCWA 1UEXC 1UANA 5HILA 2V6BA 2P6NA 1P5HA 2W6OA 4V3CA 3FFXA 8ABPA 3WOHA 2UYHA 3L1KA 4ZCSA 1U8TA 1Y8RB 1SOMA 1ZVQA 2IZ5A 2XITA 3BXFA 3BZWA 2B21A 4UOQA 5F5XA 3K7EA 3D8NA 2LGJA 2HJGA 2DPHA 2IXBA 1O9BA 3BH0A 5A06A 1O95C 2F3RA 2VPYA 2OR3A 3N8HA 5T41A 5KOHA 3K6KA 1VGQA 4AUMA 2JAXA 3ID6C 4AS2A 1CF9A 1ZGGA 2YN2A 3CZMA 3DHYA 4MS3B 3KZCA 3TD6A 3TYXA 2JLXA 2EIHA 1E5LA 2GHRA 3ZJ5A 5H68A 1O0SA 4FFBB 2Y92A 4UE6A 3E9DA 1XRQA 3C3KA 3L7NA 2AWNA 3CH5A 4K26A 4QNNA 1TCBA 3T1VA 1EFAA 3T52A 4LJKA 3EISA 4C4XA 2OCAA 5JWRA 4FI3C 5HA5A 3I6QA 4IYJA 4WOKA 3I42A 3KFVA 4GPBA 3JARA 4RWEA 2GJKA 3E7WA 1M2VA 2OMEA 3GBSA 4O25A 1OWPA 1RPJA 3BIFA 3LVFO 2CWWA 4TV8F 3E15A 5CGQB 1E58A 3E4CA 4YP5A 4ZMSA 2AEMA 2HT1A 3M2TA 3EGDA 4XGNA 1UPAA 2IHYA 1HT2E 1CRPA 3LBIA 2AFHA 2AT1A 5BNIA 1JJFA 3ME5A 1NT4A 4LWQA 3U6KA 2XGOA 2PU5A 4BXOA 3CR3C 2DPXA 5H3HA 3QBVA 3E35A 3W1WA 5K3BA 1AN0A 3MUFA 3G8DA 3MB8A 1U4NA 5E6RA 1QZXA 3TW4A 2MYTA 5A9TA 3QF4A 3D59A 3HJTA 4N3GA 4A36A 3GU3A 4B3CA 1YK0A 1ZOLA 3RM3A 4HN2A 2OLJA 2GN8A 2HCJB 3CF6R 2X4IA 3EXIA 1UMKA 4UEQA 3VYWA 3WSTA 4C88A 3HBLA 3LWNA 5IG2A 4DKJA 4DV7B 2IIPA 1JL3A 4HQKA 4FJ1A 4IIHA 4MPPA 3RRFA 5LFAA 1OHHA 3R3YA 4O1HA 5LA6A 1N6KA 2MIIA 1OBFO 1PIWA 5FDFA 1B42A 5CHEA 2QU7A 1HGXA 4TS4A 3RB8A 2FB9A 1OJ7A 1JFFB 3AINA 4IEIA 2O8FB 4LBYA 5COBA 3TM4A 2YVLA 4LQCA 4C2AA 5AVTA 5BYBA 2YICA 1YS2X 1LSOA 3R41A 2J9ZB 2QORA 4PG7A 4A0FA 3QUAA 1T6BY 4UHEA 1RKVA 3ZQJA 1BWRA 3L8EA 1K8ZB 1KPHA 2YN0A 3C7DB 4TL6A 1V6SA 3L0IB 4NBNA 2IIBA 3MMZA 5C1IA 1V43A 1XLVA 5DX8A 3N39C 4DSZA 5I7WA 1ODIA 5CU7A 1EU1A 3ECAA 4K9PA 1Z4PX 1TNDA 3A1CA 1CZOA 1FLVA 2PQ0A 3RSSA 2NNLD 1X1CA 5F73A 3Q7PA 5TJHA 2GBLA 4NI5A 4Q12A 5H83A 3ZK7A 2V7PA 1NI3A 2CXXA 3T4XA 2PGIA 2YWCA 2GAFA 1NTRA 1RWMA 3KYDA 4F2DA 2DCUA 1TVKA 1KJYA 1UDXA 2WYWA 5LQDA 3BQMB 5ICMA 2JIPA 4WY5A 1C9MA 1C9JA 1EK5A 1JUDA 3MSXA 4BMZA 2R8OA 3V8VA 5T6MA 4JUBA 3U6BA 3PFNA 3MAGA 3N75A 3LCUA 4FYIA 2ZRMA 3T99A 2QIPA 3ORQA 3OPYI 4MSUA 1YKGA 4D99A 1XMVA 2NV6A 4XH9B 2HX1A 1JEQA 1Z6TA 4FNAA 3IBFA 1Z34A 1KGSA 4LYHA 4BP8A 2A94A 3F1LA 3JQAB 2J3EA 3U37A 5F1YA 4R8RA 1FU4A 1GZ6A 1RC0A 2V7WA 1ODLA 4ZVQA 3E5RA 2B0JA 3RC8A 2D2XA 2NTEA 5P21A 1NKVA 3P2IA 4NPCA 3WIDA 4HWOA 1PWZA 2XVXA 5EE1A 3FD8A 3P9QA 5IKPA 1WCWA 3OQPA 4L85A 3OMWA 4LQ4A 4CTKA 4A15A 3Q5GA 1EDDA 3KAPA 5IUKC 4KYIB 3IQEA 3VPXA 2CHUA 2XVAA 4K3UA 4Q0MA 4Q4JA 3ZU3A 4NMWA 3FB4A 3S0JA 1G5HA 1IXKA 5K8IA 4GI2A 3S2FA 4B9EA 1HQYE 3I6ZA 4GT1A 3TEJA 4QJ5A 3TSWA 4CG3A 4GXQA 1GU7A 3BL8A 4Y1EA 5CYOA 1E18A 4JBGA 3K53A 4J4BA 1NM5A 1LDNA 5JEEA 1XBTA 3O73A 1U8XX 2C95A 3R0IA 2Q2OA 2FN7A 3EQZA 3KQWA 3KYIB 4L5CA 4QLAA 4TS3A 2IUFA 1A0OA 1EXNA 2I7XA 1PV1A 2V0NA 1L7MA 3P2EA 3V55A 2D3WA 2ZDQA 5SY6A 1QK4A 4AO8A 4RTOA 2RMKA 4UU0A 4MDHA 1P18A 1GQQA 4REQB 1KI9A 4QU9A 2AVNA 4KAAA 1HKHA 1WU8A 3MCWA 1NRIA 1Y1LA 4DDUA 2BAGA 4RH0A 5HE9A 3V4OA 1QVWA 1EUCB 2AZTA 2IX9A 1PWYE 4QPCA 3S6JA 3TNDA 3K8QA 5IARA 4FD3A 4DQXA 2DM6A 2IPAB 2JHGA 2V9PA 4K6OA 1SULA 4JIMA 4OB8A 4Z54A 1R8XA 2EBFX 4Q93A 4R9RA 1VCHA 3F46A 3GLFB 3O2QB 4D43A 5BPFA 4I14A 1I51A 4LOHA 1JG3A 1OLUB 2ORIA 3EF0A 3T5GA 4ARCA 3IX7A 2NVBA 1Z75A 2HA3A 2Q49A 1ES9A 3WA7A 2BM9A 2ZRPA 1D0IA 4WZ6A 5K2OA 3AVVA 4B80A 3N05A 1Y5MA 2VJLA 3FMIA 4MRMA 4BNYA 4DGQA 4N6NA 2OQVA 2CV2A 1QV9A 1EB8A 2ZXFA 1YV9A 1VLVA 4I08A 1VSQA 1P3DA 3TPFA 3IXQA 3OY2A 4J1NA 2FPKA 2BMFA 4N9WA 4FZRA 4OM7A 3SM3A 4FHZA 3HCAA 3IHTA 2ZS7A 3O8QA 4H08A 4ZOEA 4ECAA 1FTQA 4TUYB 1ODCA 5T67A 4TWRA 1FB5A 3I5AA 4LTDA 1A97A 3FIUA 5JSKA 3HK2A 1U0NA 1N9GB 1XFDA 4UKDA 2AMYA 2R00A 1Q0UA 2CJYA 5TJ9A 5L8VA 3HKDB 2WAXA 1GGVA 2Q1UA 1YE8A 2W0SA 1KI1A 2YV1A 3FVVA 2AN1A 4CG1A 2EQAA 2VNSA 1VE9A 1Z4NA 4O8CA 3OUTA 5C35A 4P35A 2AXQA 4RKFA 5I9IA 2NU7B 3E27A 3M82A 1K7CA 4QASA 1KY4A 2G9UA 2AC4A 2BMJA 2WM2A 1OXKB 1UOEA 5AW5A 3ZKAA 1WSBA 1T91A 1NVTA 2BKVA 3UJDA 4O5OA 3CO0S 5K4GA 2CXRA 2XUHA 8OHMA 1GGHA 1W88A 2JFGA 2F1HA 4AZTA 5DYGA 3JQAA 4MQUA 1XYVA 1QNFA 3UUGA 2E0IA 3DPUA 2H85A 4RPJA 3U7JA 4R8MA 5AHKA 4BC0A 4V1CA 4YP7A 3OZSA 1DUSA 1OASA 4LCBA 3SLRA 3VC1A 5IF9A 1PSZA 2QN2A 3RT7A 1U3WA 1PR1A 2YFKA 4NZPA 1BCSA 4MXDA 3NJRA 1RAEA 4GZ3A 3I1IA 4EUFA 2VN8A 1EIWA 1MR3F 4EQ6B 1ND6A 2C5BA 3TQCA 3AEYA 2BEUB 5JXHA 3PBKA 2DX7A 1XG5A 1VJRA 3AWDA 5ALPA 1P2GA 4LJLA 3QEOA 1KI2A 3AOEA 4KBYA 2RJOA 3PFFA 721PA 2BUAA 2FQQA 5LQAA 1DRJA 3QNUA 3FZGA 1O95D 3HBFA 5JQGB 2B3DA 1QRUA 4S04A 1O6FA 4TWZA 5EWLA 3COWA 1Q0RA 1CUAA 1RAIA 5BV7A 2COUA 1P9RA 2ONCA 1VTKA 4N41A 4MR7A 5A05A 2JI8A 2QYOA 3UK1A 1CB7A 1R66A 1RI1A 5HIJA 4B7XA 4IM7A 2Z2JA 5TT0A 5BORA 4JI4B 4LIPD 3ZXXA 3T1NA 3BWVA 3I1YA 3EGXB 1DIBA 2X23A 3CVJA 1V9CA 1FX1A 1ZRHA 2QTVB 1PJBA 1V8DA 3PDIA 4QNRA 4X85A 1TQDA 3EA5A 4KQXA 5BR7A 2P6RA 1K5HA 2COEA 4GRIA 2E4AA 2VVTA 2ZQYA 4U7GA 1FYFA 2J4CA 2IPOA 1L4NA 4ZDWA 3QLVC 3ESQA 1N4AA 4IQGA 4KN5A 4RA6A 5TX7A 4R68A 2IZZA 2WJGA 4DRYA 4JYZA 4JEHA 2FFAA 1TM4E 3EDMA 1JMYA 5H81A 3ZZ1A 5AXBA 3VJLA 3AL0C 1NPYA 4WKGA 1R18A 1RFLA 3ZVLA 3WGIA 1XQVA 2CDNA 3GAFA 4DCJA 3OC6A 1UXIA 3G8CA 2MWMA 1XP5A 4L8YA 4LRYA 4UNSA 4X0EA 5EZSA 4EKNB 3QLTA 2Z08A 4H6VA 1KJZA 2HZBA 3Q0TA 4P2BA 5L3VA 1IDOA 3E9CA 5KJFA 1VMAA 4HR7A 1MB4A 1MORA 2OPBA 3FVRA 1A50B 4LK3A 4CT4B 4FN4A 4LXTA 1W52X 1U1GA 5CFLA 2QRNA 3VMMA 2FHSA 4ZEVA 3KSBC 2JANA 4A16A 3NKFA 5CDFE 1QB8A 2NWQA 5A1JA 5F52A 3ZE1B 3KUDA 3WP0A 1W4LA 2YZ2A 1ONBA 1YUBA 1Z6ZA 2CEAA 4FX5A 4Q3BA 1NN5A 4N7JA 3I2HA 1IC6A 4Y2XA 1X86B 3ANXA 1LF0A 3O8NA 2ZI4A 3CNBA 3WB9A 3ESRA 2OFWA 1EM8A 1DNPA 1HSOA 2DHDA 4R6XA 3WYBA 3ZKWB 4IZIA 2ZETA 1NYRA 1VLZA 1BOFA 3RVRA 4EEKA 4FINA 5I9LA 4LN1A 3QVTA 4DB2A 2C0PA 2DUWA 2E6UX 2YMLA 4ZQFA 2IBSA 4HNAB 3GT3A 4J0DA 3QIAA 3BMQB 1TMOA 3IQZA 5ILOA 1S3FA 1HYEA 2XMDA 5K3EA 1NXQA 3A4VA 1WDMA 4ZOBA 5JNWA 1ID8A 1GPYA 3WISA 1FMTA 2XQKA 4YT8A 3NPAA 4NONA 3LRPA 2FEWB 1G98A 5JMOA 4B3JA 2ZI6A 1FBNA 3UICA 4AN0A 2IC5A 2NUTB 1G16A 1E62A 3ND5A 3HGTA 4K46A 4MZDA 5DLEA 5EZQA 2CNDA 4BVAA 3ZWYA 1SUSA 2KBFA 2IHNA 1SD2A 1Q7BA 5G1OA 1NNUA 1A8SA 1D2RA 4O0LA 2QD2A 3DOEA 3SZRA 2RHHA 4P98A 4IGEA 4YS6A 3I2JA 5AKKA 2FRDC 2RH9B 2NO7A 1Y4ZA 3IIMA 1QH8B 3EY9A 3FOWA 3OEEA 3C3BA 4AS1A 3HFGA 3KLOA 5DLPA 3R0XA 5IYZA 2P2CA 4PQFA 3BYZA 4RF2A 2XBMA 1NBIA 1ZEJA 2OZEA 4F84A 2FDXA 4WXYB 4YFYA 1SCKA 3EIUA 4G9BA 2GLXA 4KMMA 3EZLA 1E1QD 1Y34E 2H08A 5LMUB 3VH4A 1OFUA 3BFPA 2H1OA 1UBOS 2PFGA 3CEHA 1UBCA 5KHLB 1W0CA 3F8SA 1ENZA 2X0DA 3OZWA 1W87A 2Z09A 3SSMA 1Q1AA 3WGLA 1R64A 3HB0A 5LMCA 3ZCTA 5JZVA 5F7JA 1QVVA 4JKOA 4IIJF 4GGMX 4JXKA 3TRJA 1BMDA 5A4MS 5CVTA 5FPSA 3RS3A 2WD7A 4IKPA 4MEJA 3GT7A 3FGOA 2BMAA 3LECA 4RQUA 4ZRMA 5P8WA 2BKUA 1P5ZB 2B8WA 3NIGB 1FC0A 5H59A 1IXSB 2GRAA 1VP9A 1QHYA 3NR2A 4FMCB 3DMGA 1TCVA 2IP2A 3ESBA 1MC4A 2ZB2A 3PD7A 1CNEA 3N2KB 1S3IA 1CFZA 1A5BB 3JD4A 3C0KA 1D3AA 3LPAA 1EVLA 1XAGA 1CQWA 1XNGA 3L4BA 2XB8A 4K6FA 4LV5B 4R7TA 2SECE 4AROA 5K8LA 5DM70 5AHOA 4DIBA 2RI0A 5HQTA 3M34A 1Z2NX 1MD9A 3DWFA 4XARA 3RS8A 3D8SA 1Z35A 4DV1B 1GAEO 3GFOA 5JRZA 3C6MA 1M74A 1ADJA 3AESA 3ANLA 4AFNA 1L5LA 4EJMA 4NAUA 3ZDXB 3OJLA 1DWUA 4RA9B 5DZSA 3WDMA 2JA2A 4XR9A 4TRMA 3NZEA 2BUCA 4QYMA 2WWHA 2VYNA 4MPJA 2P2LA 4HEA6 4B7ZA 3D1LA 2CVQA 2HXGA 3KEMA 2VHEA 2DH6A 3H1GA 1Q1NA 3HC7A 4OQMA 3H0KA 4DANA 3D6AA 1W36D 4YWJA 4XDZA 3TPCA 5L6LB 3ZY2A 4O4IB 4FCVA 3TSCA 4MMZB 3QSGA 4KLCA 5DRYA 4D3SA 4MHSA 4KSBA 4OHWA 3R74A 3RIEA 1Z0DA 2OCIA 3KOYA 5EL0A 3HVHA 4D7AA 2D1YA 3QXXA 3L8DA 3X0DA 3BC1A 4P58A 1KMIY 3KXDA 1CJSA 3IJ5A 1DVRA 5DI3B 1I7SB 3W2FA 4KE8A 2DWOA 1ORRA 2QTGA 4MVJE 4W1RA 2HCFA 3CW8X 3W6ZA 4DQLA 3CWZA 2GBGA 4R0MA 2I7TA 3AVQA 1NVEA 1ZBQA 3Q10A 4ID9A 5CMLA 5H9VA 4D44A 2ZM5A 3R7SA 1HDXA 2XOEA 1LU9A 2LNDA 3A1NA 1WR8A 1KZ6A 3PEEA 4O8ZA 1H3EA 2Q99A 2P5SA 1DTEA 2D3TA 1IOLA 4CV1A 3MAJA 3HB1A 1GKYA 5CW1A 4CM6A 1QYWA 2FSHA 1Z47A 2FFBA 4JNCA 1M54A 3TDNA 3LX5A 1GPLA 4DXHA 3SFZA 4B71A 3NNNA 3Q3CA 5BSVA 1M2HA 1MC5A 2ZE5A 2J5XA 3U26A 3W8EA 5I3ZA 1TRKA 1PZEA 1X13A 2I2FA 2VYVD 4C0HA 3STVA 4A23A 1ARZA 4ZDIA 2WOOA 4C7KA 1FNCA 1UAAA 4S1NA 2ZBRA 2V1UA 2TSYB 4MS1A 2XWJI 2F1IA 3REGA 2A1UA 3PD0A 4GX5A 1DIOB 4B4DA 1CC1S 3DT6A 1QO9A 3HSYA 1XA0A 5JW6A 1ZRSA 4M37A 4O2BB 1DX4A 2O0HA 3OF2A 3OEYA 4FFOA 4F3YA 5H16A 3P9SA 2YV5A 5L40A 4UCQA 3GJ4A 5KREA 1W5TA 2QP4A 4NCIA 4UNQA 1KS2A 3FCXA 2KS6A 1JHYA 1U7OA 1HDZA 3AJ8A 5TQJA 3S5JA 1TD9A 1C3OB 1Z56C 1ISMA 4GGPA 4QSHA 4C4RA 3L2OB 4WUTA 2FN9A 4FUTA 1SUCA 4K2HA 1U0BB 1JFSA 5FWXA 3T0IA 1Z6GA 2C8LA 4KDCA 5MDHA 4D6XA 3VYUB 1KNXA 3CZAA 4OQYA 1ZA1A 1E9AA 4UM9D 3QTBA 1U8AA 3SQWA 5TMEA 4PC3A 4DLSA 3QI2A 5TR9A 1YCGA 4BNFA 2CDBA 5F2EA 3BE8A 2VJNA 4W63A 4YJKA 1UOOA 4RX1A 1P72A 5HF6A 3G1TA 5CT9A 3QY9A 3DE6X 2P77A 4EJ6A 5B6IA 1XTVA 3DEFA 3HABA 2V4UA 4OXYA 3GLQA 5JDCC 1SIUA 3PIRA 1UPCA 3KVRA 2XHZA 3LWDA 3C97A 4OGKA 2GFQA 3QKIA 1USWA 3HO8A 3UCEA 4L50A 3IR7A 2FH5B 4CR6A 5K8CA 2YIJA 2NT4A 3HEMA 4L08A 4PRYA 3AR4A 3PXBA 2D5BA 2EFDB 2IE8A 4OBEA 4ZI5A 3AIIA 3F6SA 2BR4A 3FPEA 2NO6A 3U3DA 3QMWA 2VXBA 3RUFA 4K6CA 5BYKA 3NOXA 3Q7RA 4HAYA 1MOPA 4GUDA 4M46A 5LCXA 3OKPA 1I6LA 3R7NA 1ENOA 4H35A 4RV9A 4C1NA 4D9CA 3PI6A 1ZQ1A 2BF4A 2QSZA 4X20B 3T95A 2CLMB 4NBTA 5SZJA 3FSGA 4E22A 1S8OA 4EX7A 4FVTA 4I50B 3RBAA 3PUIA 5EQJB 4Z4QA 4KR0A 3X44A 1E0JA 2ZXUA 1NATA 4RQAA 1Y42X 4S2EA 4CF4A 2WIJA 4A0SA 4IHJF 3IUJA 4NMLA 3HR4A 1ZMOA 5JISA 1U9YA 3BHMA 4Q82A 3LO8A 3ERCA 5JBQA 5HFNA 2Q8QA 3THWA 3IDQA 4JLKA 4HMQA 1YZ3A 1UZAA 3C48A 1JDBC 2OL4A 1QAOA 3C5CA 1T5TA 4OX9Y 1SQ5A 3KKKA 4Q9HA 2SKCA 1BVYF 5GV8A 2X40A 3OQIB 2B4QA 4BLQA 1A88A 1J39A 2CD9A 4OVKA 1TF5A 2C59A 2MTBA 2M6KA 4ALKA 5LQNA 3ESCA 3S8YA 1VDMA 1J9ZA 1P4GA 4UUQA 1XEAA 4GL2A 1G1MA 3O4IA 3DDUA 1KJ9A 1W9MA 2W2KA 4EHIA 1M5UA 3RHZA 3TMYA 5IK2D 2BGGA 1CQXA 4BNWA 4J0KA 3QQPA 4E3ZA 5BUCA 3KQSA 4ZOAA 1SZDA 4FGZA 2VPQA 3H1BA 4DQUA 1Q0HA 1UBSB 5LOVF 3I8OA 4QT4A 3FBWA 4G0MA 3CX4A 4RK6A 4JJ4A 5FUXA 5EHXA 5DNWA 4ZVSA 3G59A 1DKUA 3EDRA 3NC1C 3UMFA 1L5QA 3GLHB 1YR3A 3L7OA 4YC7A 1N1MA 1GFWA 4HWRA 3KB1A 1D4FA 1ADGA 3SM9A 3SOZA 1TC1A 4ZYYA 4XXHA 3H13A 3EEBA 1SC1A 3NALA 5DISB 2EBUA 5FHQA 3BJEA 4G09A 3VSBA 1G66A 1VSTA 1TECE 1WAMA 1ZHHA 3DL4A 1V39A 1GM5A 4HDNB 3UTCA 4DGSA 5CBPB 2QRHA 5HVNA 1W5AA 5A03A 4CMIA 2XDYA 2RK3A 2V97A 4OGFA 2BM8A 2ZE6A 4ZHSA 3WAJA 5CTJA 3QLJA 4QOGA 4C7OA 4M0MA 4LW8A 2Q21A 1FMFA 3QPCA 2V6IA 1Y9JA 3KBOA 4F2GA 2W2NA 4G0QA 3A06A 4L8GA 4YJ2A 4KGVA 3DZ8A 4ZZ2A 1I5EA 3EDYA 3N3AC 4ID3A 1MAHA 1JIQA 2OEPA 2PR2A 1H8HD 1PR9A 4M1ZA 5B7QA 4U7HA 2YWDA 1BFDA 2I62A 5KCMA 4B45A 9GPBA 3EWNA 1D09A 3FF1A 4UM7A 1SBHA 2NTVA 5I8ZA 1E1RD 1V37A 3CEPB 3L7YA 3LV8A 3HNPA 4RXUA 5KHOC 2P9JA 2AQHA 5HF9A 1FXUA 4DFDA 1Z74A 1G42A 4R84A 4E03A 3BF7A 2Y1OA 3WP1B 2ZJ8A 6NULA 3H4TA 1HM5A 1CUZA 1GRQA 4Q1FA 2HWYA 4YBRA 5JRJA 2ACVA 2HRCA 3E9RA 3MWEA 4XZ3A 2AWOA 2YV4A 1TJ5A 4I4TA 4X1IB 4XYMA 3IUEA 1IRIA 1VPLA 5T64A 1U7DA 3EBPA 4DR1B 2I22A 3EXHA 4ZTZB 2W6ID 1JH8A 4XGRA 2LCIA 4EFDA 5CBPA 1TCCA 4KR6A 4ZEMA 2V74B 2OCDA 4QVKA 2BCEA 4N54A 3EMVA 3PB3A 3KVNA 3QXCA 4JUFA 4WERA 3ADCA 1PT7A 4ZVPA 3WOVA 2G09A 5FQNA 1D8TA 2JGKA 4CI9A 4X7MA 4RULA 2GSDA 4U6NA 5IP5A 3IPLA 4LV6A 4DEYA 3AR6A 1UBEA 2NV0A 1C9DB 3M6VA 1NSYA 2F1RA 2RKOA 2VJOA 1TYAE 1D7AA 2YR0A 1K7SN 4C01A 2C77A 4F96A 4ZO7A 5G4KA 2B1JA 2E9SA 3ER6A 4X7PA 3QOFA 2BMDA 3V2IA 1PR4A 3H2GA 3WADA 1Z37A 4HLNA 4AMGA 4GOOD 1KWGA 1JIUA 1KEWA 4W8HA 1BE1A 2FOLA 3SEFA 1WD5A 4YUZA 1E9FA 1ZAYA 2W2KB 1EA7A 1IG0A 4XWOA 1EFRD 2PT6A 2X3FA 4GYYA 3EBOA 4WZAB 3VHLB 4IKOA 5K1ZA 3GA7A 4ND8B 1M8PA 4K1LA 1IY2A 3WICA 4MMXB 1SUFA 2XQFA 4DWOA 2OORA 3CX6A 5JRDS 1PT8A 1FXSA 2RHJA 2ZJBA 1KEKA 3EOZA 4Q9LA 5COQA 1PFYA 1F48A 2EW8A 4M3NA 1LD3A 1VB5A 3WWPA 5F1OA 4A2PA 3FKQA 1XPRA 4ZD6A 3ICEA 2B98A 2NQTA 3MCTA 4KQFA 5GONB 1U1IA 2CXOA 1KDTA 1LKZA 2MOKA 3A10A 3LLSA 5FBRB 2Q3JA 2YYAA 5B37A 5ER6A 2RIPA 2EKDA 3LAWA 4OP2A 2HFKA 3JD0A 2BZ0A 4BGEA 5DNCA 4ZRDA 4LISA 4IV5A 1PJCA 1UOPA 3W9UA 1K92A 2ZR0A 4CQMA 4DNXA 3F9IA 2VRBA 4I7EA 2EOAA 2P79A 3SEAA 5LZ8A 4KU4A 3UT6A 3PF9A 3G7UA 4UBIA 3WGVA 4I66A 4J0CA 4D8YA 3EXAA 2ZQ5A 1OH6A 4CMIB 2GZ3A 1QYDA 1YHNA 2JJ1D 2LDXA 5DN6A 1YA6A 3DOFA 1DINA 2YJTD 3PVSA 3BD6A 3SYRA 1N34B 5JSQA 2P1RA 4QODA 4TN1A 4R8VA 5CW2A 4JSRA 5LB2A 4BS9A 3UJCA 1E96A 2XGMA 5LP6F 3B2NA 2EJWA 3HWRA 4G56A 5B2ZA 4DQ0A 5IAOA 3U1BA 2I2DA 3LK6A 2GTPA 3R0QA 4FJ2A 3WBKA 2IHKA 3SDZA 1J7JA 3V80A 1K5PA 2FX5A 2BFPA 4NH4A 4N5LA 4U2CA 3T3MB 5B6JA 4GM4A 3MCVA 4M89A 3PU6A 4JT4A 2GHIA 3IXLA 1MOQA 3FETA 4U63A 4IX1A 1XVIA 2A78A 1YZQA 2WJIA 2QRKA 4WWHA 2EJVA 3ICCA 5AHRA 4ICIA 4TKMA 1R6AA 4BY9E 1WS6A 3SS8A 4CMKA 2WWYA 1NNLA 2NPIA 2B8NA 3UMGA 1Z4MA 1BAPA 1W5FA 1Y6JA 4FZ3A 4JP8A 4Z0PA 3IMGA 3QFHA 1L5VA 2O7VA 5DXJA 2VP3A 3LVRE 2KI5A 1FXWA 4LF7B 1KFEB 4OXRA 2CJXA 3ESXA 1U9ZA 1V8BA 4ZCIA 4HP8A 4PR3A 4U8HA 1IHOA 1DO2A 4JI1B 2ZW9A 2GJ8A 3DS8A 2A4MA 1OTXA 4C0QC 2FN4A 1QHXA 2ONKA 5K0EA 2P91A 4KPEC 3O93A 3MILA 4Q4JB 1YQDA 2EZ9A 2Z8YM 1PFWA 2K87A 1SRRA 3I9MA 1GNRA 1P9OA 1TJ4A 3LUHA 5HM6A 5KUTA 3CFYA 2WU3A 1PBNA 1G8SA 1Z4IA 2Y71A 3PS9A 1ZJWA 2Y1XA 1XZPA 1G6OA 4IXDA 3K9GA 1TM7E 3WL5A 5DK4A 2VDJA 1E79D 1K8XB 3OU7A 4WLOA 2FUKA 3O8BA 1KMCA 1FRFS 2AVDA 1RAFA 4HEJA 1A9ZA 3HVJA 2IXFA 4QXPA 5G40A 3L0BA 2AA3A 1YR7A 2NU7A 3EH1A 3A6FA 3BGOS 1TQ4A 3EQ6A 4KV7A 3RVKA 4B87A 1E1MA 4HEQA 1E5VA 4D41A 3ZS9A 2HSEA 5AHXA 1VPDA 4X6YA 1PHPA 3RS9A 3CIOA 5ICFA 1FMJA 5LBUA 3ZX4A 1EUCA 3PIIA 1H2HA 3CNNA 3KX2A 1DAHA 1UODA 2WWGA 2NUAB 2F67A 4BDSA 4FFLA 2O07A 4DPLA 5FHRA 2O1EA 3UATA 3CLRD 2Z9CA 3B3AA 4N3CA 4BZPA 4EABA 5F2NA 3B52X 5IF3A 4AI6A 5ESWA 1H4QA 5ADUS 1GV0A 1RS0A 2IITA 2VDKB 1OX5A 3OT5A 2B6NA 3TNJA 2Y1LA 1II9A 1CTQA 3CRMA 5M7EA 3JWEA 5ALTA 2YHBA 3OEWA 1RLOA 3GFQA 1H94A 4OHXA 4AY4A 4F9FA 2AG5A 3KSUA 4DRXB 1DT3A 3LE8A 1RHJA 1Z0ZA 4JP3A 3SU8A 2HO5A 4ZA2A 1VIAA 5TQ2A 5EMNA 4B35A 1O7JA 1IVYA 5HP4A 4QECA 3AR9A 4QQKA 5IH7A 4HF7A 4OGGA 4IFTA 3VZRA 4XI9A 3ZQKA 2XYVA 1XWFA 3SPXA 3WLNA 4YMWA 2VF4X 2QMYA 3DJFA 4RMNA 3NHAA 1W4RA 3GN2A 5AVZA 3K70C 2HB6A 4W9NA 4ZIRB 5BN1A 1JU4A 1R0ZA 2IYQA 5EP4A 1FE8A 5FBVB 1UIRA 3QVOA 1CR6A 3BFKA 4K05A 4M7RA 1F4LA 1DEHA 2JZCA 3IXMA 3ISJA 1Q0ZA 3K71B 3AIKA 3RTEA 4YONB 2O8CA 4ILKA 4KPUA 4NYIQ 1YQUA 1CDZA 3ONWA 2ZAIA 2P9GA 5CJ2A 4AZWA 4CEIB 2ROQA 2ZB4A 2IOQA 1IUKA 2AV6A 3C3DA 3RU7A 4DMHA 4JVSB 4E2FA 3M6WA 1HKUA 3PR2B 5IN4A 3VR3D 1QVRA 2ZWAA 1D9XA 4G5HA 2HRDA 5ALZA 1I9CA 3EFEA 1L5RA 4Z8XA 1HURA 4A6XA 5EIWA 1YNSA 4UJ3A 5IC5A 1SVMA 4HNUA 4I50F 1DC5A 1NBMD 3HHEA 1VJGA 3CUVA 3O75A 4JBHA 4TVBA 3TQFA 4RSHA 2ZZKA 2RGDA