2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2ZWIA 4V38A 4V3BA 3S44A 4R83A 2Z4TA 4V39A 2IY8A 2C84A 4V2UA 2EX1A 2IHKA 4R84A 2IHJA 2EX0A 2IY7A 2C83A 2IHZA 2IIBA 4V3CA 4R9VA 2ILVA 2II6A 2IIQA
chains in the Genus database with same CATH superfamily
1Z38A 1HDRA 4M1WA 3HBLA 3NB0A 4BNLA 2FW1A 1O54A 1AB5A 5ER9A 5INTA 1B0ZA 4W6QA 3S8EA 4XEHA 2WE8A 3CS3A 1DELA 1EFCA 4BQIA 5ITSA 2HV9A 1SA0B 2RHLA 1GUDA 4AJJA 3RVRA 4Q03A 4KI0A 3VV2A 2BMJA 3SQWA 3R3HA 2BMFA 3UK2A 2WIFA 4J2TA 4UNIA 3LRTA 2GWRA 5BNZA 2BCEA 4UBJA 1XEXB 2VZ9A 5IZCA 2P11A 3O4GA 1FUEA 4F38A 3KJZA 1FXWA 1NNUA 1SG0A 2AC7A 4OV6B 2AOVA 1A9TA 2AR0A 3OU6A 1NVKA 5IZ4A 4TTTS 1EP2B 4RE5A 3ZS9A 1ZH6A 3ND6A 1NG9A 1Y3HA 3ZQ4A 1IN1A 4MW5A 2WD7B 2XUQA 3Q7IA 3ZU4A 1WD5A 2WQZA 2J3IA 3C8MA 1Y82A 2D00A 2GN4A 5EE9A 4RLSA 2P65A 1DRUA 1ESNA 2LR0A 2GAAA 4LOJA 5AICA 1B3RA 3ISJA 1U7WA 1T2NA 3F3KA 1KMNA 1O94A 2XOKA 4HB3A 4MZDA 4RO0A 4X6XA 5EXSA 4QXQA 2B1QA 2YMLA 3NGMA 1JVNA 3O1LA 1NRIA 4HDRA 3MT7A 4OLHA 5T4BA 2OGZA 5JO0A 1NXTA 5EIAA 4UZEA 2HWXA 3MIZA 3U9SA 2C83A 1X1CA 1NJ5A 2PKEA 5FR2A 1DAEA 1F38A 2QL6A 2TMGA 4N5IX 4WASA 3ZHXA 2VNAA 1KRHA 1MABB 2JD2A 1Z4PX 2HCRA 5EYPB 4QVIA 3CX4A 1NIJA 2BEVA 2ZS9A 4OQQA 4UHJA 2LUOA 4A73A 4GVLA 4YHBA 1IB6A 1P2DA 1VSTA 4ZYUA 3UV6A 1CNMA 2C9MA 5FO1A 1QF7A 4L8YA 1XZQA 1NW9B 1YH3A 2CNNA 3UN1A 2O8CB 3CNBA 4DF3A 2Z5GA 3GLGB 5E6RB 2GFHA 1EG7A 3CGWA 4XLZA 5BY2A 3UWSA 1MQ9A 1XPRA 3AGPA 1MR3F 1R66A 2LDXA 1U4NA 4FN4A 1NKTA 3LYUA 1L5HB 3MGBA 5AHWA 3SE0A 1PNOA 4NYMR 5L9AA 1QP7A 4MGYR 4IMPA 5KWEA 2O8NA 5K6AA 1SHZA 1JILA 4YJ2F 4GG1A 1FFXA 3O38A 3Q3VA 2ZWOA 1JSXA 3NT4A 1R4ZA 4FMDB 4UBMA 4LCEA 3E61A 4TQUS 3CMCO 3ZWYA 2VQEB 2HIMA 2PMBA 3CTMA 1QGOA 1Z5GA 3B82A 3AVVA 3THWA 4MYDA 1TT5B 1U0LA 2ZBGA 3FPKA 3OJFA 4ARAA 4PLPA 2ZT6A 3CZ9A 2EGUA 1KNQA 2XZPA 3ABRB 2QLBA 3DOOA 1P18A 2OV4A 1FL9A 3IKLA 3LY9A 1NUSA 1MH1A 3AF2A 3OQVA 3OVMA 5EIHA 2JFOA 4WKNA 4L51A 5CJPA 3SR0A 1B0AA 1KDPA 1WUKS 3ZQUA 1ZOOA 4OMDA 4HQ6A 2ZRNA 2RBGA 1USUA 1TO6A 1CY7A 1XAJA 3WGZA 3PQ7A 4CQJA 4IIJA 3OQOA 2IH2A 4GBED 2FZCA 2HSWA 3EVCA 3SDSA 1C50A 1JHQA 2Q1TA 1H2XA 1XEXA 1P3Y1 2FWNA 2GTIA 3DAOA 4ISCA 4WKOA 4DJTA 4PX9A 4HGOA 1RWVA 2QX6A 2XCQA 3EQ2A 3ITEA 2EFHB 4II3A 4A0HA 4BIMA 4NFYA 3FTFA 3FTQA 3QKSA 2ODPA 3N2IA 4UD2A 4EY3A 5LOVA 4HF7A 1QGAA 3N6XA 4ZHQB 5LNK1 3OCXA 1RRGA 1T9DA 5L3SB 5AKXA 5C52B 1KI6A 3E8XA 2DH6A 5ICSA 3L7OA 4D4GA 5KWIA 1F2UA 2F2TA 3H6GA 1XROA 2QUKA 3BWBA 3NG1A 3BGWA 4MICA 5LZ4A 3SF0A 2KX7A 2DCUA 4S1OA 1IHYA 2FYTA 5IAEA 1N2EA 1M2GA 2PZLA 4DMUB 3THOA 4BWVA 2ZQ5A 3AX6A 4GOXA 1VZ2A 5LXTB 1WQ4A 1MDBA 5I9TA 2VBFA 4CT0A 4C20A 5IDVA 5ADHA 2PLFA 2VFAA 4I4TF 2YH2A 2WWGA 3FSGD 2HBZA 3WWCA 1O4VA 4PQGA 4EG1A 5DK6A 3DAGA 1H9BA 1GKIA 2FSVA 2I2XB 1OH5A 2XB6A 3DZIA 3KO8A 2V6GA 1YTUA 4KQMA 5BUSA 2YCLA 4F92B 1UC8A 4KITB 2WJVA 1HDGO 4YO8A 4F5ZA 1JJVA 2FG7C 3OOJA 2I9KA 5EE0A 3NANA 1TZBA 3TG8A 1YKSA 5HRUA 3PK0A 5CVTA 2QTHA 4MS3A 4Q9AA 4M1TA 2XVYA 3CMMA 3D4IA 4NHEA 1GL3A 4BQPA 3PHBE 4NEQA 2GEKA 4OO3A 4WLEA 4DT1B 1GAXA 3P9QA 1DX9A 2BEWB 1UH5A 2PZAA 2IH4A 2Y93A 3RVLA 4JMPA 1VB5A 5AP9A 4DPKA 2PD6A 1DXQA 4GRAA 4NNJA 1K66A 3OX2A 1RTKA 1XZNA 3BFPA 3KWFA 1U8YA 3K32A 4L2IB 4AIIA 1OXKB 5I6DA 4S04A 4PZ0A 3S28A 2CUTA 5JJCA 5KSWB 4E6PA 1E20A 1KK1A 1TM2A 1JBEA 1Y1SA 1P77A 1DMRA 1IQPA 1E96A 3MXTA 1RJ9A 3Q6MA 1P8AA 3VR4H 4AJ4A 2VKTA 3MTGA 2OUIA 3E05A 2VO1A 1TLFA 5GIOE 2TYSB 3Q3HA 1RXYA 2PX3A 2BBSA 5AJHA 4D43A 3WWZA 2O8FA 1Z06A 3AIOA 3DGEC 4CMIA 4NJOA 4L9AA 2W11A 4TT3A 5EXPA 3VR3A 3AR9A 4WKPA 3SVLA 1P81A 1WB5A 2LPMA 1XOIA 3NHUA 1T6YA 4FI3C 3G2QA 1F17A 4IJ6A 4L73A 1UBSB 1RWQA 3Q2OA 5U1PA 1RRCA 2BEKA 3AG6A 1W581 3H1AA 2CNWA 1NR5A 5EXEA 3LM8A 2Q6VA 4RTNA 3Q15C 2XLBA 4DC9A 2E85A 4KO4S 3U09A 1SWWA 2JJ1A 1T4CB 3SZUA 1IVYA 3IO3A 3X2EA 1J21A 5DN9A 4DCUA 5BURA 4WJZA 3OIVA 1BW9A 2DBRA 1IDOA 1KY5A 1PLLA 2RARA 4BX8A 1XZPA 4C4SA 1FP1D 1GRRA 2P6MA 2L2QA 3W2HA 4ZIRB 1GQQA 5JVDB 1BJRE 3QEAZ 3URKA 2PKXA 2BKAA 4KX5A 3L43A 3K05A 5BQ5A 5BN3A 3FPAA 4LE0A 4CJXA 5JS6A 4LS3A 5ALZA 1L5HA 5CITA 2FZ4A 2VDPB 3H9EO 1WXWA 4JBHA 4RX1A 1XJ5A 5CNJA 8OHMA 4YHHB 3Q11A 2VLBA 5JD4A 1UDAA 1PJ2A 1Z6YA 3ZHYA 1O89A 3ZPXA 2JFZA 4O5AA 4CF6A 5THQA 4J0CA 3PNPA 4MITA 4MJ3A 1CEQA 3EC1A 3GEMA 2UAGA 4KQWA 3DOUA 4PX5A 4U2GA 4JL6A 3SGLA 3ZWKA 4DR4B 5SYMA 5F9FA 4X1IB 3PYXA 4BVAA 1ULBA 2J0VA 4OJMX 1W4LA 2WSIA 1V8DA 4PTYA 2IPOA 2R1VA 1OVGA 3EWNA 1D0IA 3DKIA 2WAMA 3I62A 2BGIA 4YA6A 2PSHA 3GAAA 4F1KA 4M22A 3EVDA 1PYDA 3FHTA 5LNK6 3DHNA 1SY7A 5IH3A 4MS4B 1WB4A 1IM5A 2JRLA 1QR2A 5COQA 2J0SA 2MIIA 1JDTA 5SZHB 5E1BA 4D3ZA 3KAPA 2C7OA 5KJFA 2BSQA 4IFTA 5GVRA 1F9AA 3ANSA 3RVJA 3U80A 1G9SA 4A23A 3WY9A 2EDAA 5T4FA 1ZGGA 3PC8C 4N49A 4L74A 1R9JA 1DCFA 2B5OA 4QIHA 2XWJI 5AWFC 3W3AD 3VJRA 3U61B 5C81A 1JF8A 2R8ZA 2YV2A 4FBLA 5B2EA 3KAQA 3I04M 3KZKA 3IRUA 5EMJA 1OLOA 3HS3A 5KHLB 2AWOA 2HXYA 1Z68A 3C48A 4BFZA 4Q4CA 3RIYA 1LDBA 4GECA 4JBWA 3RRNA 4B7XA 3GZTB 4LXQA 1MAWA 4PSDA 4IV5A 2O8EB 2B8NA 1V9LA 4BO7A 2CEKA 2R4UA 4QU0A 4KXYA 4HGPA 1JXAA 3K1JA 4JAVC 4OHWA 1JG7A 5AI8A 3ZXXA 2XQIA 2F8SA 2YINC 3LS2A 1ZW1A 5JNSA 1SEPA 1JJFA 1N7GA 2ZTMA 1XQYA 2FH5B 1TA4A 3OF5A 4ZVKA 3OO0A 5HGXA 3U7RA 1XHFA 3HNOA 1N36B 4DUYB 2FR1A 4E15A 3MLBA 1Z7BA 2VTVA 5HJ2A 1C8BA 3I1JA 3MMSA 4RF4A 4RV4A 1EX1A 4HYTA 3BM5A 2D62A 1U9IC 5DYIA 4DC1A 3C3EA 3U40A 5LOVF 1HRDA 1BMFD 4B6GA 2H4ZA 5DYNA 4LY0A 4M0MA 2V9ZA 4DEXA 2R87A 1RAGA 3HXTA 4LV6A 4NG5A 5EJ8A 2PTGA 1VMAA 4E2WA 3MQFA 1MNAA 4YO7A 4UREA 4GSKA 4ZQBA 3GRFA 2AXNA 5H80A 2QX8A 5I9BA 4KQFA 3RFXA 3ODPA 3WG9A 4JNCA 1OXVA 2PWYA 3FCOA 1L1RA 3JVDA 5FT9A 3TLBA 1E1RD 3L8DA 4EPTA 3IKVA 4WLUA 3VSDA 2XSZD 2XTNA 3VU9B 2VWQA 2ZIVB 5AVZA 3HDHA 3HL4A 5FUWA 1LPBB 3I42A 4EVIA 3DB2A 5F2NA 1AZTA 2HZ7A 2XWPA 4OB7A 4Q9LA 4EHFA 1IOLA 1E5TA 3L84A 2X4LA 4RJIA 3TOZA 4X7BA 1ND5A 1OJLA 5CB4A 4JOQA 3FAZA 1GU7A 5A4MS 1VL8A 3HJBA 2FG6C 4EJSB 3U37A 2PE5A 3P96A 3G1UA 1JNYA 2ABWA 2ZT5A 4OXKA 3G2HA 2HHJA 3G3EA 4FHCA 1CDZA 3NAGA 3ZW7A 1OTXA 3ZWAA 3RYTC 1W5TA 4LC9A 1BFKA 4R3UC 3EGXB 5ENVA 3KZOA 4WBNA 3H4IA 2B2NA 3LUBA 2J5XA 1DJNA 4OLJA 4PBRA 4HAWA 4DBLE 2NSHA 4GR5A 3ESAA 2OD2A 2E7ZA 2Q3BA 1KETA 4N8SA 4MWCA 1IXYA 3IL2A 3QWHA 1VA5A 2Q3LA 5FBKA 4D4MA 2PKRA 3Q7EA 5CXQA 4PPNA 1Z0DA 1F2TB 5DHAA 3LLMA 2FXVA 1QYXA 2ZRMA 3C2QA 4ADSG 2VH1A 1YRWA 2AN9A 1E9AA 1HYGA 5L4LA 4YX9A 1VRWA 2VF5X 4MV8A 2HH9A 4ZFNA 2I5PO 3Q3JB 2EDCA 2OCYC 2ZJYA 1LRJA 2FSGA 1IATA 3O93A 3MCWA 4MR9B 2X2EA 1SU6A 1C0EA 3DBLB 1CDDA 3IMEA 5KYKA 4QT4A 3PT5A 5JI2E 4YJGA 3WYGA 2R2GA 4V1CI 4D02A 2V0CA 3H1BA 5I47A 2POQX 1R12A 1ES9A 2EBHX 1C4XA 3U1VA 4H2DA 3P7MA 3DULA 4LJ5A 1M67A 1PZEA 2CNBA 3JV7A 4G84A 2J9FA 4IDEA 1QRRA 4IEIA 3TRFA 4NU6A 2QD5A 2AHRA 3QVWA 4NESA 3PSAA 3VR5H 1RXUA 4BUZA 4XVUA 3K4HA 4RWZA 4DA8A 2Q2NA 3IBFA 4EDHA 3FBGA 5J2UF 1H93A 4OUKX 5EP1A 3A70A 1E5QA 2FUG1 3PPYA 2HPVA 3QY9A 1OA0A 1IJEA 4KWHA 1PEKE 4H16A 4AJ1A 4PBSA 4H1WA 5FNVA 3GQBB 1A1SA 1E7WA 3COPA 4ZYVA 5GADl 2R8RA 4W5HA 3RHSA 4UTRA 3A9TA 3RSQA 5L53A 1PYGA 4NZMA 1U5BB 3AFOA 3F5SA 1ML3A 1G18A 3EJWA 2BDEA 3O84A 1OZHA 4J76A 3LQFA 3TNFA 4NZPA 1J99A 2FNAA 2XITA 2PZGA 4P92A 1TJ4A 2DM6A 5AKKA 3RS5A 4EW6A 2QUZA 1J39A 3CEAA 1MB3A 3TKAA 4LHZA 5IBPA 4M8IA 2FMIA 3LXXA 4P5PA 3U7GA 1GFIA 4CV1A 4DTIA 5GZ1A 1GZSA 5T6BA 4I81A 1DIAA 3IUMA 3PFIA 4ZOCA 2X58A 4NJEA 5ED4A 2QN1A 2WTEA 1U2EA 3EEIA 2QUHA 3M7IA 3HUUA 4ARZB 4DV2B 4FMCF 3M70A 2G4VA 1UMDB 2JAQA 2NO1A 2R8BA 3OWOA 2IHBA 4P2BA 4V3CA 5KQMA 4BGIA 1VMIA 2Q3HA 4PPGA 2XCSB 1N3LA 3EZGA 4TGLA 5CYGA 4IYRA 1GXSA 4DLRA 5U4QA 2QSZA 1S4QA 1U3TA 2KM1A 3OPVA 4EHBA 1A9RA 3JQGA 2NO4A 3GG2A 4B3TB 3ASZA 3WI7A 2QLFA 4KQCA 5ALGA 4JLJA 2MSWA 5LBIA 4BP3A 1I2MA 5JRJA 2B1GA 4ND3A 3H4VA 4RACA 2RHHA 3FFXA 1EZ4A 1XQVA 3DHYA 2DWQA 4YJHA 3G79A 3MNFA 3ASUA 1C7RA 4J29A 3CZ5A 5H16A 5D2CA 4JVNA 3TNLA 3BERA 4Q3KA 1EXNA 1WMEA 3AESA 2FETA 4Y9UA 3KFLA 4F2HA 1E64A 5C4GB 1E6KA 3TMAA 4J3FA 3AEKA 3IO5A 3ZE0B 1RCTE 3HSKA 4LJKA 4Q3OA 5J63A 4NARA 3EF0A 1L5NA 3VPFA 1J0EA 3C1AA 1DCMA 4PC3A 4UTOA 1G2PA 2GZDA 2VXCA 3E3LA 3HKEB 3R7NA 2H9YA 4JLNA 4S1NA 3REQB 4AMBA 3PDHA 3Q6NA 5D3QA 3HYRA 4MYTA 3LZ6A 1V11B 1JFSA 2CWWA 5EC8A 4D3YA 2QGZA 2BM8A 3K9GA 1A9QA 5FUXA 4BWGA 1AGPA 4Y0NA 4DM7A 1FK8A 5AW2A 4M7OA 5KVAA 3LV8A 4CV3A 3GFSA 4Y9SA 5D84A 2HW8A 4NMLA 2FVXA 1Y98A 2JIOA 1V3VA 2RHOA 2UUOA 4GI2A 1BA3A 1M5UA 4ILEA 2IELA 4OI1A 3N0VA 3MAJA 4YRBA 2PT7A 3H42B 2BHNA 1AO3A 3UUGA 1A2QA 3IIEA 1G3QA 1J90A 3PPVA 4TRNA 2ENWA 3C43A 1LX7A 4R2WA 2B9EA 5FPHA 2D6FA 4Y2PA 3CF6R 5IANA 3JWPA 3LOQA 5AI4A 4MUMA 2XVXA 1I0ZA 4PY2A 2IX9A 1FX0A 2HBYA 1IY8A 1KZ9A 2ZI9A 4LBWA 1HZZC 4XEUA 4O1HA 5IK2D 2QMHA 3EPHA 1AHIA 4PHGA 4H0FA 4O3FA 1ZUNB 3A4TA 1KOGA 4MOWA 5IXYA 1ZNXA 2ZKLA 1PBNA 3F9CA 3UM9A 1KXJA 1W4CA 3DMDA 3VBCA 1EA7A 2D13A 2KHZA 3DV9A 2WUGA 2BI8A 1SCIA 4N47A 1SKBA 1SU7A 3PE6A 1T8SA 4WADA 2ZR0A 4KXMA 4H6PA 4GP7A 1X1QA 4BNMA 2A8YA 3GL9A 4DLUA 1LTHR 2Y1OA 1ECFA 2ZULA 4NPAA 4C0QC 3ZX4A 4D6YA 9ABPA 1A3CA 3DBRB 3STYA 2I6UA 2FPXA 4QYMA 3RRFA 2WVGA 3OTIA 3WICA 1ODLA 1JQAA 4Q9HA 1IYZA 1OLSA 1L6RA 1ND6A 3EYAA 3FY4A 2RGYA 3L0CA 4RL6A 3VJLA 1C4WA 3HJCA 4OXYA 4JBYA 3FYTA 3HJAA 1IXRC 3JYNA 3FWZA 4N40A 3I2JA 4NF2A 6NULA 3LPAA 2XUPA 2I7TA 3O73A 3P0FA 4QYWA 4E2YA 4KREA 1ZWKA 1ZHFA 3BWVA 3U4CA 1R27A 2HBQA 2PWPA 2LNDA 2EKQA 4Z8YA 1JX6A 4ZC8A 3NUGA 1I4EB 3SR3A 4D80A 3FCXA 5CVEA 5DM1A 1SHKA 5CD9A 2QAGA 1A9XA 3HCDA 3V2UA 5LU8A 1TZCA 3FGOA 4H59A 2REXB 4TQAA 3HL0A 4LFCB 3W1VA 1GD1O 5LFAA 5K4HA 3QZUA 3ZWPA 5LLSA 4IIJB 1Z5UA 2L17A 3P9RA 5C1OA 3KLBA 3K2QA 3F6EX 4GLOA 4CLXA 3KX2A 1OFGA 4P31A 1AZSC 2ECPA 2NVBA 3QW4B 1XVAA 1H94A 3Q2IA 2BGGA 2V97A 1UR5A 1JE1A 3A2NA 4MVXA 3PENA 1N2CA 5EN4A 2KLHA 2VJLA 3PKJA 2PGNA 2CV0A 2HHCA 3IS3A 1UKCA 2QRPA 4K5QA 4YP9A 3WA7A 1BRMA 4EGAA 4GM4A 2OCLA 5JARA 3GJ4A 1DDGA 1S8AA 5ELXA 1XDSA 2A35A 3B3QA 1YB4A 1CF2O 2H48A 2V7BA 1T2FA 3FNHA 3B6IA 5EE5B 4EGQA 4UOQA 2P0EA 1U9ZA 2MU1A 2PRJA 3R40A 3V1MA 2QYHA 3WKAA 1PWEA 3GXBA 1JT9A 3HV0A 4K28A 2ZXEA 2W0MA 2TMKA 4XQEA 2UYGA 4ZCLA 3EIUA 1GNVA 1YRHA 1QMGA 5KVCA 1U2GC 3B9BA 4GZ3A 4AUEA 4LFBB 2P90A 5AVTA 3JRXA 3WP0A 3B85A 4E5UA 2WMDA 1BJTA 3K6JA 5AW6A 4BAGA 1HNZB 2W58A 1GGEA 4CL0A 2C7GA 1XB2A 1QVZA 3WISA 4PN7A 1G55A 3O9VA 1CUHA 1E6WA 3H9UA 2BDUA 1X7ZA 3SS8A 1JRLA 3VOSA 3WBBA 3TGPA 3ZWCA 3OZGA 2A9QA 5IJXA 4R2JA 1J8FA 3A11A 3BMNA 1OPXA 5TQ0B 2IOYA 3UWMA 5BVHA 3MWLA 3KQNA 1Q0ZA 5LA6F 1GVHA 2B98A 3CVJA 1T3HA 2QW0X 3B48A 2NVWA 4B84A 3K9NA 1X13A 2HADA 5AESA 1GLVA 1G6OA 2WTAA 1CR6A 5EWMA 4G5FA 1V8ZA 4XJTA 2YS6A 5IUKC 1XU7A 2DHRA 3C8HA 3LLVA 2Y67A 4FE4A 2OZLA 3L9WA 4ZZ3A 3QH4A 3BCSA 1E3QA 1MORA 3N74A 4S2EA 3I2GA 4CLEA 3UUWA 2XUGA 2L69A 2MYTA 1NAHA 2XUKA 2P3QA 5GONB 2QSJA 2VOEA 4QJ4A 2PIAA 5G40A 1NULA 3TQRA 4U7TB 5CJ2A 3RIXA 1S9HA 1WCWA 3ICPA 2CFTA 4AZ0A 2ZIUB 4WOBA 5E8RA 3IFSA 2Z2ZA 4FR0A 4I5FA 3EX7C 3FTCA 1M2KA 1W29A 3DQPA 2WJZB 1NJ1A 4G85A 3FNGA 3V1KA 4E5PA 2FP3A 5GOZA 2G80A 3V4FA 4DTCA 4TTJA 3EG9B 1EBUA 1LLUA 1FUIA 3PFFA 1AE1A 3NKLA 1NMQA 2F62A 3FDIA 2PUBA 2GOYA 4MCHA 4DNQA 4C7JA 1MXHA 1Y6JA 2GYVA 1JMKC 1XCLA 2HMUA 1E9RA 1ZRNA 3E2IA 1Y48E 5IJAA 3ZV5A 1COZA 4ZOLF 4KFTA 1GN9A 3F98A 2BI4A 1PDOA 4NYMQ 2Y71A 3BULA 3NS7A 3DOEA 3EOBI 3R6DA 4MPJA 4TV9A 5ESWA 5FOVA 1YKGA 5GJVC 3GGOA 3ZXUB 5ICMA 1F2DA 1S4MA 3A1EA 5E6RA 4PR3A 5DNCA 5THXA 4OF4A 3AU9A 4BYMA 3DONA 3BE4A 5DNWA 4AG5A 4TKUB 3ZV4A 1Z0IA 3F3MA 3FFBA 1DG3A 3RTGA 1KERA 4YRSA 1ZYUA 4L4SA 4IVPA 1AM4D 1R00A 1QG6A 4LCJA 1J5EB 1MA0A 1XKLA 1OH6A 4M99A 3QVLA 2YBEA 3IHLA 3T4PA 1RPTA 1FMFA 1G8MA 3PQ5A 1X7XB 4JHLA 3KVRA 4L4YA 3GT4A 3OQMA 4JL5A 5EPUA 5J3JA 3NAMA 4FZJA 5A71A 1XRPA 3G8AA 5L45A 1P0CA 1ZCBA 3GJQA 2ZIFA 1CS0B 4OM7A 3OEYA 3DWGA 2P2DA 3G2LA 3LAWA 4PYMA 5FOXA 4PSUA 1H69A 3VNQA 2J6HA 4XM0A 5G2OA 3OHPA 3ACCA 4HDSB 3ELDA 3QVJA 4IJUA 3CLTD 1TB4A 5HA5A 4TT3D 4BO2A 5EJFA 3C3WA 3RUEA 4Q5IA 2YICA 4LMPA 5DE3A 1ZL2A 4FUQA 4ND8A 1H2HA 3AZPA 3FBTA 4M1QA 2GT1A 3E27A 3N8HA 4Z4QA 3BMCB 2IEDA 2H1SA 2QTCA 1NVAA 1X3LA 3EXFB 1S3IA 2C29D 3OPYA 3K73O 4GO1A 2JEOA 2XUJA 3VDNB 2D2FA 1FQJA 4XWYA 1YI8A 4GPZA 2NZ2A 4C4XA 3N2YA 1OWPA 5KAMA 4ZT4A 3M5WA 1G20A 3OM0A 2G9UA 4I19A 1QZTA 2ZW9A 4W5NA 1P80A 1CR1A 3FN4A 3T4XA 3W5IA 3OTWA 4ZDKA 4HNQA 4JS0A 4GICA 2R1ZA 1KEEB 5A3QA 5IKPA 1QQAA 4OHOA 2B3DA 2VHEA 3GLQA 5F1PA 2EZUA 2E4AA 1SQ5A 3ZHRA 2ISSD 2RH4A 1BHJA 1KY3A 1O3YA 3N0WA 3VA7A 1JSZA 4FEEA 4LC1A 4RHYA 1AOXA 4W82A 3USZA 4D9BA 1XLUA 3GFVA 4S0ZA 3VKWA 4LGCA 1TW3A 1PJLA 2ZAIA 2H17A 4BKMA 1B93A 2WPDA 4CQMB 3H17A 2O5RA 3SJUA 2NTJA 1MFPA 1CZNA 4HTFB 4N3NA 3TUZC 3O1JC 3KV1A 4B6JA 2B99A 1F2TA 1VSUA 2J5QA 2PY6A 1NOIA 1H42A 1CY6A 4HPJB 4MRNA 2AN3A 1NYTA 3DE3X 4K9QA 5TXGA 2RGBA 2ZUEA 1I1QB 4ZAWA 5JBNA 1CQJA 2LP4Y 5KTPA 3RRXA 5BR8B 2HU2A 1FFGA 4YEDA 5KQPA 2E48A 4JYZA 3M5PA 1TJ3A 1HE5A 3G9ZA 4LYAA 2NUAB 4XQ0A 4AXBA 2G72A 1PR4A 4IILA 5HZGA 5JNRA 1Q12A 5K8JB 4ILKA 2VS1A 4L2IA 3HGQA 4RFSA 2Z58A 4ZPXA 4AQ7A 5AKLA 4FJ1A 2V6IA 1UOPA 2C2BA 3SLRA 4F8YA 3CLRD 4DBVO 4J90A 2VSNA 1T5SA 1XQWA 3UT6A 4LK2A 2C4VA 5H0IA 3FGPA 4URFA 3TD6A 1ZGJA 3LUGA 4UM8B 1JWLA 2PQ0A 4AP6A 4CGYA 5JTTA 4G63A 1MIOB 3P20A 4JFAA 3PUHA 1D2AA 1BX3A 3L0OA 3HE3A 3G17A 1X9HA 2Q3JA 3I9FA 3R0JA 4CGZA 4A5SA 4LE2A 2C59A 3DDZX 3UXMA 2ZUFA 3G0DA 1SOAA 1R4NB 3QTBA 1NP6A 3L46A 4G01B 3PPXA 1Z0ZA 2JFXA 3EHDA 3NYRA 4RVNA 2UV8A 4YMGA 3FI9A 4L4RA 4Y2YA 4CM8A 3BCUA 5JYBA 4AZ0B 4FFNA 2WDZA 1XXLA 3VPCA 1W34A 1N2BA 4M9RA 1VE9A 1P72A 2QP4A 1P74A 1YCGA 2V96A 5SZJA 5ALIA 4I3HA 3T7CA 1ZD8A 2Q07A 1FS6A 4LPSA 4YN3A 4QL3A 1X1AA 2YMQA 3DV0B 1MX5A 4L78A 2EFGA 3U31A 3MTIA 1ZR2A 4UM9D 1Z47A 3HPQA 2NUPB 2ZSEA 1XTJA 1BMFA 3PJEA 1N2SA 4RK5A 5DGXA 2HAEA 2QTRA 4HDKA 1EFRD 3OZAA 4MB2A 3TQTA 4PQRA 1G21B 3PIRA 4LCBA 2PZEA 1A9XB 2QAGB 4BMNA 2OXRA 4EW2A 1FMJA 2QPOA 2ZE6A 3BS4A 1IIBA 1NVMB 2NZWA 3AY0A 5BSFA 5FLEX 5J5AA 5DBEX 1EAYA 1NV9A 3MRSA 5FWDA 1BDBA 3RJ5A 1WDMA 5SYAA 2P9FA 4Q24A 4P3NA 3H2KA 3II6X 3MINB 2BBOA 3PD7A 1YU9A 2P27A 4P80A 5ERGB 1Z4KA 2BFEA 6ADHA 4XTRA 1BDIA 1HE4A 4F8EA 5FUMA 1ZD9A 4YK7A 2VAPA 1OLSB 5ULLA 1JQLB 3D4LA 1QH8A 1Z0SA 5F73A 4XWOA 6AT1A 3KKOA 1KSJA 1IOWA 3PXUA 2QTVA 2VHCA 4ZODA 2FX3A 3EN0A 4R05A 1DLJA 4WY5A 4PZDA 3SNHA 1ZVVA 3IJRA 1YMQA 4DCVA 1TQ4A 2Q2OA 2QZPA 5FV7A 2IUSA 3GRUA 4J0QA 4KK4A 4KXXA 3DM9B 4U9HS 3N75A 4QFCA 5IXJA 1Z8HA 2QHXA 1L7QA 4NZNA 1W8DA 4QRDA 4ZOLA 4C05A 1Z34A 1KI2A 1ZCJA 2H4XA 3JVVA 1VKOA 1Z6GA 3WYNA 4JA0A 1XZDA 2J7PD 4LJ4A 3Q0EA 1K92A 1CNFA 3L5OA 3QWIA 3R09A 5KBYA 4Q6BA 4DUPA 4EDFA 2J0EA 5B4VA 4K26A 5CU7A 5KTMA 3AB8A 4I3GA 5CNMA 4FKZA 1E1CB 2R47A 3WIVA 4AUNA 3H87A 4J4TA 4OAPA 2OP1A 1GZ5A 1CJSA 3C4JA 4P7FA 3T7TA 1WMDA 4GSLA 5HYVA 2G08A 5FD8A 1W2GA 2V59A 1I0IA 1VG8A 4AKSA 1H6BA 3E7FA 1VSVA 4K9PA 2RGRA 1ZO8A 3BREA 2G77B 1VKNA 4NYIQ 1WZCA 4M54A 5HF5A 1DU4A 1L7VC 2AR7A 3KKMA 4EYEA 3SVZA 3E1KA 1W4BA 3OWXA 3GUUA 3H8JA 3PX7A 4TMXA 3OZRA 2VHYA 4LHSA 3K2BA 3W78A 3HB5X 2QU8A 2WJAA 4IUYA 4H31A 3UANA 4AYTA 1JEQB 1LPSA 2Q4DA 3Q7RA 1IN7A 1B8VA 1LKZA 5A9RA 5IKXA 121PA 1U1DA 2J48A 3EG9A 2DWCA 2HU5A 4Z51A 1YJ8A 2WSLA 5DISB 4I14A 1ECGA 3IVAA 3NOVA 1RJGA 4TL6A 5FX2A 3N3AC 1Q0QA 4RD1A 2ZJ1A 1OUMA 4NFSA 5I9IA 5CCXA 3DCYA 5G1OA 1ZJ6A 1XCOA 3H5OA 3DMNA 4BV9A 1ZEMA 4N76A 2PFSA 2O1SA 5F5NA 3PVSA 2I6XA 2YHBA 3BXHA 4OPMA 3QLUA 1X80B 4FLFA 2P9YA 2UKDA 3GA5A 1DQSA 4PSCA 3K72B 1FX1A 1NF9A 4RPCA 1NLYA 2XODA 4XWAA 4B3JA 2C97A 3RSSA 4D8YA 3LG2A 2WU3A 4PYNA 2VPQA 5G0UA 1XEWY 3HP4A 3NOXA 4DCSA 1NJSA 4RKEA 2X5NA 2XCUA 1AKVA 2A33A 4QPJC 3ZNQA 3MA0A 3CCFA 2EFJA 2BFPA 1ZMXA 3K53A 4BGEA 3ACBA 2V3WA 5C1IA 4EZEA 4AT1A 1SXQA 2WT8A 2CMGA 2O8BA 1O03A 4MLDA 4XA8A 2YIMA 4KLZA 5CDGA 4G1UC 3EOAI 4PCUA 3F90A 3B5IA 1C7EA 2V9PA 1OPRA 1SVIA 4I46A 4U3JB 2XDAA 3C3YA 4OA5A 2SICE 4NV0A 4XZ3A 1EK6A 4HNUA 2V58A 2OV1A 1XVUA 4P4SA 1TW2A 4F2PA 2VUIB 4MVJP 5JAPA 1IQ0A 1UMKA 1WTAA 2C92A 4PCVA 3TO5A 4C0AC 3BF8A 1N5MA 4F4JA 2HJWA 4YT2A 3IBTA 3QBVA 5KNDD 3VVMA 2GK7A 1NBIA 2IT1A 5HS6A 1HMYA 3QWFA 3HC7A 2EJCA 3P9XA 4E5YA 3I61A 3DZ8A 5J59A 4CR7A 2YJZA 4XJXA 2I2AA 4L50A 3NEAA 2GCPA 4RE6A 1E9SA 2XIJA 3KJHA 3LUCA 4RKQA 5JBIA 4N4AA 2ZK7A 1SD5A 2LGJA 3H18A 3MM4A 3HDTA 4H7HA 4L9SA 2JI7A 4CFSA 4CCSA 4WXHA 1C3OA 4C3UA 2NYUA 1FP2A 4IGIA 3KL4A 3LYAA 1EB9A 3EEYA 4M9CA 3VNAA 2R6GA 2IGBA 3GEPA 4LQLA 4TUYA 3RWOA 4EEXA 5HXAA 2YXEA 3IGFA 5TY0A 1LNSA 4MK4A 4YT4A 1X74A 4JV5B 2FP4B 3S6JA 2I22A 3RUDA 1XQ1A 1S8NA 1TAQA 1GYRA 2C0PA 5H3CA 1GFWA 3LQRA 3KZVA 2O14A 5D3MA 1G8YA 2F6RA 4RF2A 3QFCA 3A05A 1XNRB 4QSHA 4E2ZA 5KSPA 1ZOLA 3KPUA 4IX1A 3PDIA 1KMQA 1Q14A 3L8YA 2P79A 3W6PA 4Y2XA 2QP9X 4JI8B 2QN9A 2F8MA 2YYYA 2CK3A 1B0PA 5KZMB 3X1JA 4C0HA 2GWHA 2V7XA 3TSCA 5CB4F 3EZLA 2CFRA 4JC5A 4LXIA 3WYDA 3TFWA 1U3GA 4PSKA 1ZONA 4HNGA 4H0CA 4N7BA 5C9ZA 1CJBA 1L5LA 4LWPA 2OFWA 1E4YA 2P6OA 1UJMA 1G3MA 3VTZA 3HCRA 4KN5A 1F2UB 3GFTA 3Q7TA 3Q6IA 3TF5A 1US8A 7MDHA 2D5BA 2HX1A 4TL9A 3E9NA 4M87A 2H65A 4C4AA 2V7TA 1JU4A 2I76A 2Y0CA 1TYCA 5AI9A 1GTSA 1XZGA 1GA6A 4NWIA 2UZ4A 1KVQA 2DQYA 2G0AA 5EZ6B 1JIUA 5ALLA 4FMPA 4ER3A 2DWPA 4JI1B 3PFKA 2QU7A 1JLHA 3LWNA 3CLTC 2UZIR 2RGXA 2XH8A 4GFDA 2GBCA 5HZHA 3RFFA 3A4NA 2WY2D 2ZR8A 3VU0A 2WU8A 2FP4A 4IJKA 4YXWD 1H8HD 4LRYA 2R66A 2ZYGA 3JWIA 4MKRA 2CZQA 1QH1B 4FFVA 2UYOA 2BP7B 3BTVA 3MS7A 2YJNA 2QQ5A 3OQPA 3QBTA 2JGKA 3VPGA 4BX0A 3UMYA 1F48A 4C0SA 3O3OB 3WK7A 2CMDA 3LK7A 2ZB7A 3QFTA 1E7MA 1U0OC 4Y67A 2DWOA 3OH8A 4GVXA 4TLBA 4DGQA 1UK6A 1IG0A 2BMDA 2XE4A 1EFLA 1CUYA 1VC2A 2PBFA 3DE4X 1MO5A 1Q2XA 3O8QA 5CEFA 2AJLI 5JYDA 1YACA 4K81B 4FC7A 4Z3KA 3F47A 4RIIA 4Q9KA 5K0ZA 5T6MA 2ID4A 5EHIA 4H3VA 2WUVA 3TTXA 2OMEA 2O0HA 2QRNA 3F74A 3GRVA 2GESA 4IV0A 1MD9A 2VUHB 4PTZA 4M9ZA 2TECE 4KI7A 2CYBA 1I7SB 5TMDA 1MAHA 3HCCA 5E4JA 4CM1A 5KNBD 3NHRA 1C9MA 2JA2A 3I2IA 3GYGA 2A5JA 4ZQHA 1HEIA 4PZCA 5E6SA 2W6ID 2BJHA 2YN4A 3EXEB 4LJSA 1KP3A 4YB8A 4CQNA 3ZHTA 1EVYA 3ADKA 3AW9A 4ZMRA 4BXOA 1FNSA 3QWAA 4M88A 1QO0D 4EB8A 3SBEA 3N8DA 3EXIB 3MHTA 2FUCA 1H1TA 2VATA 3IURA 5DNAA 4OH1A 2WA2A 5GV7A 3TTVA 3DEZA 4CLHA 2P4HX 4MV5A 4X00A 4U0KA 1U1CA 3GEEA 1WAMA 1KGDA 1HE2A 2NX2A 5FWYB 1A5SB 1XELA 4J7CA 2FSFA 2Q1YA 3VPSA 4BE7B 821PA 2P1DA 3QF4B 3ZHQA 4KE9A 1DSSG 5E1OA 1G5TA 1TPZA 2ODEA 3Q9NA 3CX6A 3UUFA 5KTOA 2QORA 5DM4A 2CHFA 2WKRA 4DADA 4B3XA 3BGIA 5K3BA 2GPYA 4REQA 4HAYA 2BZ0A 2M6KA 5F51A 2GM9A 1U99A 2KJQA 3GCZA 2BFFB 3X1KA 3DZJA 4NLLA 1A2BA 3QI7A 4V0SA 3AHFA 3HUEA 4Q05A 2AA3A 2XMQA 1JJ7A 4PYIA 4A0RA 4EZBA 3L7KA 4ZV4A 4FNGA 4C5AA 1E2JA 1HUQA 2JGFA 4IDHA 5A4IS 1QR6A 2PX0A 3UAZA 1K88A 4N18A 3GELA 1YRBA 4ENWA 5BMVA 1ZD1A 2PKQO 3CEMA 4EB3A 1O1YA 3SWWA 5DGTA 3P2IA 3H1TA 3GLIB 2JDID 1T8UA 2OHOA 1OSNA 2XKBA 3GAFA 1N6KA 3C6QA 1KI1A 5FI3A 3UBTA 3FTEA 3INTA 4P4NA 5CX1B 1W47A 2HF8A 1GA1A 2IVFA 3DVLA 5KYGA 3AO0B 3Q8LA 1H6DA 1PL7A 3ZVKA 3KBBA 4K8RB 5TQ2B 5FBZA 2BUBA 1D8AA 1D7AA 1VFNA 2V3VA 2JZOA 4NXNB 3QY0A 1CRQA 4ISBA 4U0JA 1Q7CA 3HR8A 4YAEA 1SXJC 2F4NA 3KKNA 2ZBVA 3IUNA 4EG0A 2K7FA 1FJXA 2H4JA 1YR3A 4MUFA 3REGA 2IU4A 5LVAA 4A2QA 1GPKA 2B82A 5NULA 1TM3E 4R1PA 2RAFA 3ENZA 3MT0A 4RVDA 3TIGA 3CLSD 3HSYA 1C1YA 2ZR9A 2BFFA 1OAKA 2Y99A 1G9TA 1KMHB 2BEJA 1PDWA 4JI6B 3VR5D 1E7QA 2YIVX 2PCLA 3ITKA 3N2LA 4MR9A 1Z7WA 2H8KA 3H6HA 5FTJA 3S40A 1ZIDA 3KDSE 1RPAA 2QB5A 1HWYA 2OLJA 4G1FA 4ZREA 1YDFA 1MEEA 4EPYA 4P4LA 3TLGB 1I2BA 1IONA 1POXA 4AJ2A 3BE5A 5REQA 4RTLA 4R7TA 1CIPA 2YJTD 1I6MA 1JU9A 1VI6A 3BWCA 3NBUA 4MRPA 4ZQEA 3CWZA 4B6SA 5I7SA 2CGEA 2KW5A 2AUTA 4I4CA 4D3FA 3CT6A 4Z9FA 1NI5A 1ZI8A 3EXHB 2ZB3A 1CYDA 4LY9A 3WDMA 1N57A 3KDAA 4BO1A 2J6BA 5LQJA 1L7PA 2P35A 1QIIA 4BP9A 4C0LA 1LJ8A 2C3OA 5HCUA 1VHJA 4BMDA 3AQIA 2C4MA 4CBVA 1YJ5A 1JAYA 3K2EA 3IIIA 1T35A 4J0FA 3A4MA 5FCDA 3OLCX 5HMLA 5FWNA 2YJ4A 5F64A 1LPNA 1CJMA 3R6WA 4HXGA 1V4NA 3O6VA 1T36B 4MWSA 3YASA 3A6DA 5LP6B 4ENRA 1Z6QA 5HJEA 4AJOA 1N6PA 1JE0A 3JZAA 1G3UA 4S3MA 4OHCA 4WNYA 3ROZA 1KVSA 3ZDYB 1AUQA 1VPEA 4DNOA 2ZWPA 3U0VA 5LZ8A 4BASA 4ED9A 5BR4A 1UXHA 2RH9B 5CXSA 1F6WA 2BZ1A 1QC5A 2R96A 4EY5A 2XADA 2IXAA 3K30A 3RYIB 3GT0A 1UPAA 2NN3C 1JKJB 1P17A 1U2DC 2OK8A 3O1HB 3UGKA 1EE1A 1XPOA 1UKZA 4AY6A 4G97A 3S44A 1JT2A 1AXRA 2GA9A 1EUDB 5E9AA 3ENVA 5CYFA 1ULSA 3EIXA 4U02A 1RBMA 5EWMB 3R8XA 3VSBA 5JOQA 2APJA 4LECA 2WYWA 3WBJA 4COKA 2QT0A 2D3TA 1ONBA 2WW8A 4PLYA 5B58T 3ZLBA 2Q5HA 1TA0A 1L5KA 2G82A 1NQUA 4F5WA 4BQEA 2QWXA 2F90A 3PNQA 1U3FA 1UMBB 3E7WA 1ZL0A 1UBEA 2V8OA 3MIIA 1E0KA 2O7RA 1CD5A 2OORC 4J7UA 4X61A 2VBGA 3RKSA 1KIAA 2ZBRA 3ZIAD 4CETA 3KZ1E 3ANYB 5JCOA 4BYGA 3B8HA 3CQ9A 1L2TA 3ROFA 4NPHA 2OB1A 2JBWA 3TKYA 1U7UA 3UTCA 2D1FA 5C1PA 4FILA 2ZJFA 2JLWA 2Q5QA 3M8KA 4FHEA 2E4XA 3OOWA 4BXOB 4ZT5A 1DAOA 3JW8A 4FSDA 5JU6A 4YT5A 3N28A 3PNYA 4I6EA 3D43A 1LQTA 1HF3A 2CF5A 1IHOA 2R4QA 3E18A 1KH3A 1V1MA 5F12A 3C3AA 5B36A 4MEJA 4INJA 3EZXA 5JPIA 1U31A 2NNWB 2RKOA 2MYPA 4AZVA 3U5ZB 2ACKA 2OV8A 1ZM9A 3N6VA 3OPYI 5IDWA 3X3HA 5I8WA 4IRMA 2Q6KA 4BNKA 1NTOA 4F3YA 2OR3A 3J81A 2CMKA 1TEXA 1JDSA 4FJ0A 4IG9A 1E1MA 1AUOA 4OBWA 3VO2A 5B6IA 5EJ9A 3ZKAA 5JJ5A 3MMZA 1I0LA 2PVCA 2VDKB 4LY3A 5KKNB 2Y0DA 4B6PA 3HKDB 1DZIA 1ZINA 1XSEA 2NTNA 3GWZA 2GCOA 4CG0A 2GF2A 5BV2P 2HHHB 2P9ZA 1ZVMA 1GTZA 3BC1A 1WSAA 3A4LA 3PVZA 3C1TA 2ERCA 3WDKA 1SXJB 2Y76A 1QF6A 5I5EA 1MUUA 1XWWA 4MV0A 2H51A 2BFEB 2PT5A 1NV8A 1W2HA 3BD8A 4P82A 4Q37A 7REQA 2OC4A 1FFXB 1ZS9A 2C5FA 4B1FA 5B2FA 3DDCA 4MAFA 2YJ3A 2HA5A 3K71B 4N65A 1C14A 1LBQA 4WNAB 2A14A 4OATA 1XFDA 4E4TA 1PVOA 1R4MA 2JK1A 1BD4A 3MMPA 1U8XX 5AKJA 2FDRA 2GAOA 1V8FA 3DLTA 4FQ7A 3L93A 3EGDA 3TX2A 2GZ2A 1S01A 4PBTA 2FFAA 1QBGA 3WGGA 4IQ4A 4BZWA 5JCJD 4W8GA 3VKFA 3ADBA 2VBIA 2G9QA 2VJQA 1HK7A 1AZWA 3FKJA 3NHPA 1IJKA 2I4OA 3QW2A 3R0IA 4R69A 3PFGA 1TU3A 1TF2A 4JXKA 1KJQA 3H2YA 1IMJA 1DBRA 4EG6A 4PNHA 5FWXB 2O52A 4IKEA 4RHXA 4ZI7A 3J7TA 3RRJA 5B4UA 1ZBQA 2H18A 3TBHA 1U7DA 4IHJF 1JWBB 2A3NA 2HA2A 1NUAA 1W46A 2NXJA 4QGBA 4QDUA 5F2KA 4CPDA 4HL6A 4D4KA 3LBFA 4YV2A 5AW1A 4KO8A 1NXSA 2ZB2A 4PHCA 1EVKA 2HA4A 3ZWMA 5AXBA 4G9GA 5LOVB 1CUEA 4BNTA 2YZGA 3TXYA 4CW7A 2HC9A 1JPJA 1KJNA 4UQOA 2G70A 5K45A 1M8JA 1P1IA 2X8WA 1UCFA 4ZI5A 3AB7A 3K9CA 3P97A 4OBEA 3F2IA 1V35A 3LC2O 4PZPA 4MGHA 2Q29A 1SBYA 1CUWA 5TARA 3HXOA 2PUWA 1E1RA 2RJNA 3IV7A 1QYRA 4RXUA 3V9AA 5KJ1A 4FQ5A 5TS2A 4A0SA 5K0NA 1FOEB 2R1TB 4O6VA 3F6CA 1BMQA 1NAIA 4P0PB 4QU5A 3GO4A 4PRZA 1X1BA 1C9NA 1N2HA 5FL7A 3O8RA 3A04A 3HWWA 5KDOA 1PL6A 4ZAZA 4RTSA 5CDSA 1R50A 1VKRA 3ZCPA 3MELA 3COWA 1LJUA 2IIVA 3FH0A 1A5ZA 1A27A 3Q8XB 1DKPA 2IXGA 1XTIA 1DKOA 2GD0A 3ER9A 5EGSA 2ERXA 1JA9A 3EDMA 4A4DA 3JAMA 1FJHA 1N2IA 2JASA 1QIKA 1AUVA 2GH1A 2QI9F 3U7QB 4C5BA 4OH7A 3DGFC 1MJGA 1P6UA 4LN1A 4B76A 2F3QA 2GN8A 2JS7A 2Q4TA 2VTBB 1NBHA 1X0VA 2AG5A 4YMIA 5LBTA 3QRWA 2WTNA 1L4FA 4UDYX 2I2WA 3C8DA 3KOOA 3M3DA 4P81A 3GU3A 3TSOA 1Z8DA 1I1NA 4OXQA 3LHKA 2X5KO 1AHHA 3Q9UA 1DBIA 3NPAA 3NVMB 4IGFA 4BJ1A 1FRVA 2W93A 5EJMA 2BFBB 2IS1A 4YRRA 2HNBA 1G8GA 2RAPA 3R9KA 2A6PA 1T8YA 4XB1A 3ZHCA 2JB9A 1V96A 1C7JA 1L7EA 3CWCA 3WYCA 4YFVA 2NU9B 4L1KA 2RGNC 1W30A 2CE2X 1XN4A 2NZ8A 1ZM3A 2XUHA 3I1YA 1SZJG 1Q6ZA 1WXGA 3NTOA 4K6KA 4LTNA 4Y1EA 2C4NA 3KXLA 1H0RA 2G36A 1Z73A 5CPBA 5DM0A 4UEOA 2BGMA 2H0QA 2PL1A 2Q5IA 4JGIA 1JEYA 2W48A 5EHNA 4JI2B 3BMNB 4TLEA 5TQ0A 3LCMA 1K5GA 5ED0A 2H07A 2X19A 3NBAA 2VPXA 2UVQA 3VV3A 2UUCB 3RYIA 1DC6A 4KR9A 4MYUA 5LQNA 4AIRA 3RG8A 3T5GA 1EUCB 3HB1A 4D4HA 5B3LA 5HG0A 3G2KA 3I4FA 4Y30A 4EHJA 2W22A 5ITWA 4TLLB 4BGDA 1MG5A 2RIRA 5ELMA 2WR8A 3HDJA 3EMKA 2DPYA 2B1IA 3ENWA 5D85A 4DQUA 3THYA 3CXRA 1FLNA 2ZYDA 3R7WA 4H7FA 1ISFA 2Y0EA 3JTMA 4BBAA 3TECE 1OWLA 2DTEA 1WXQA 3HCBA 2OTCA 4PE5B 3WLPA 1YZVA 3LFTA 5L3VA 4CWAA 2BGRA 3B7PA 3GJSA 3QK7A 5AKZA 1O5OA 1Z4IA 3FRIA 3QNUA 5FTMA 4DV0B 2P41A 4A2PA 3VGJA 3B2EA 4N0DA 5JZ9A 5FI0B 4F4DA 5IVHA 2QX7A 1E1QA 4JI0B 2SKCA 1OD6A 2G4CA 2VHXA 2GYYA 3FPHA 5DBFA 3OCWA 4W7HA 5F9MA 1J70A 4MKZA 3P0JA 2WIGA 2GYWA 2PRYA 1AKWA 1G291 4AZ3B 1Z2EA 5ICGA 2KBFA 4HS9A 5LD2C 1FTQA 5EPOA 1PQWA 4BU1A 4D98A 4R6WA 3SSMA 1KSHA 1SUSA 1T9GR 3LT1A 4HQLA 1VKHA 4RTPA 2WPNA 2DE0X 5LBUA 1RRKA 2FRDC 3HABA 4KAFA 3AXSA 2HWWA 3LL7A 4TX1A 1ECCA 3CW2A 4P38A 5IJ0B 4CT4B 4INPA 1ACMA 5KYUB 4GLFA 2LCFA 3KUKA 3P2EA 1ESMA 4QVKA 3WFZA 1SKMA 2BTEA 2J8ZA 3RSOA 3TLJA 2DPHA 2WAXA 1OFUA 2Y2VA 3BUSA 3WRXA 4P3KA 4YUXA 3KQHA 4YV0A 3NBYC 2IEBA 5JO9A 2GPTA 1DFGA 2DPXA 2AQHA 1JAXA 3PGA1 3U7HB 3QLJA 2B30A 1DBPA 4EZIA 4KQJA 1KBOA 2ZU0C 4KNVA 1KFKB 2CC2A 3QMWA 4HK4A 4OSEA 5EVJA 3NP7A 3T34A 4C76A 4QDOA 1CZLA 1M72A 1O8BA 2G83A 4XM2A 5DIZA 1R9GA 4G5YA 4L4ZA 3PQ3A 2JJ1D 3KXKA 4BAZA 5I48A 2E18A 5JNTA 1OU4A 2ZWVA 3DWIA 4JITA 3U3ZA 1WXFA 1R3UA 1UEJA 2Z6VA 1CP2A 4FNOA 1JYEA 1IDN1 1SAYA 2Y4NA 1QIEA 5HM6A 1UMBA 5E0OA 2DX7A 5CFQA 1WKVA 3OCJA 1U90A 2BEUB 3Q10A 4DE5A 3T7IA 3U3DA 3JVUA 3B5JA 3ZS8A 1OHHA 1YR1A 4BMYA 1FDWA 2AJDA 2CLEB 2O7NA 2P1RA 4HAUA 4FCVA 1UPTA 4K9RA 5CB0A 1IY1A 3AHCA 3EIQA 1NJ8A 2WFLB 3COSA 2VXYA 3JRNA 4G4SO 4MNTA 3P1JA 4EKEA 3RRYA 3F1KA 2HUPA 2WNHA 5DRYA 4BMCA 1BXKA 5G41A 2ZJOA 4X1YB 4F71A 2V3CC 5CD1A 4Q16A 1RT9A 1W4RA 3KOXA 1EK1A 2MINA 5K2OA 2AX3A 2P6RA 5DF1A 1CUAA 3SJZA 3WSWA 1AGRA 5G1NA 5JMWA 1KRWA 1KQFA 2V74B 1RHKA 3UJ9A 1V3QE 2IU3A 2ATIA 5B7QA 2I4NA 1EXVA 2QTMA 1CIVA 2Q46A 4EGCB 2MYUA 2KS6A 3PQCA 4C30A 5BV0A 1FTYA 1F0KA 4YJ2B 3HMQA 4HQFA 4WVLA 5DW0A 5FPYA 5LIPA 3I2HA 2O20A 4V0OA 2H1RA 2OCKA 5ES4B 2LXNA 1ISGA 2J32A 3VAYA 1Y3DE 1Q0LA 2E4YA 3Q5EA 4P2GA 4XYLA 3PEYA 3SDZA 5FBLB 4AJEA 1WSBA 1VIMA 4IZHA 1DAPA 4D96A 5EKDA 2WWRA 1Q0PA 3MF4A 5EMLA 5A3SA 4CDRA 1KYYA 4DIOA 4OK3A 3HWX1 3VXKA 1T26A 4RZUA 3ZQ6A 3AH8A 3HDQA 5C32A 3HFGA 1WQ3A 4L5YA 4KX3A 4R41A 3AJDA 5T8KA 4KUHA 2ORED 2Y9PB 2QUBA 1PHRA 3R6LA 3UAYA 2X3YA 1EP3B 1XZJA 3FB1A 4C04A 4CZ2A 1WPQA 4RLHA 4D56A 4XCXA 4ETNA 1SWVA 4BCCA 1M3SA 1Y6ZA 1K8QA 1EFKA 1OFHA 4MV3A 5CW1A 2QPTA 2Y6VA 4ZVMA 4BEVA 2AVDA 3GDFA 4HT3B 4RH1A 1E32A 3ZI4A 4BVGA 2C9DA 2FW8A 4PHTA 2OO5C 1SRQA 3DTTA 4AMZA 2FUEA 5K6TA 2Q50A 3GJTA 3IQXA 3RKRA 4I08A 3GH3A 3QG5A 4BMZA 4FZRA 1XAGA 4U00A 2WDPA 4UXJA 1W85A 1T91A 4XWGA 3V5NA 1DOZA 2A2ZA 4EX7A 4O5OA 2M9MA 1JXOA 4XRGA 1ZUIA 2ZJ2A 3L8GA 3PHCA 4WDRA 1GL7A 2GCOB 2YY6A 4YAWA 1KJWA 3VUFA 2IHUA 4NVRA 4QZVA 4N3BA 1RC0A 3UJ7A 1GZVA 4UU0A 4G56A 4KXVA 1DDIA 5MFZA 3L5KA 1J4AA 1E2FA 2C7PA 1DWOA 5E4YA 1Z2DA 3KPYA 2ZBDA 3BAFA 2G28A 4RHUA 4DCMA 2AF3C 1U7ZA 2VCEA 3MOSA 1IB0A 1VCOA 2PKQP 4NABA 2X9QA 1E6EA 3R7LA 1E4VA 5FADA 2BN4A 1S9DA 1FP7A 2CCJA 3KVNA 3QIVA 5TC4A 3DO5A 2QE6A 1ECPA 2FCRA 1YDWA 4LZPA 1ZNZA 2DULA 3A1CA 1XK7A 3L3BA 3M6IA 4BN0A 1KEPA 3D5EA 1PJ8A 5HWSA 3GR6A 5IASA 4GR4A 3KE9A 3JPYA 3AUFA 4M4SA 1FMLA 2PZJA 4MRMB 2R65A 2XW6A 3NT2A 1O95A 1RJFA 1V1RB 3CUUA 2EWVA 1L5QA 1QWOA 2F3SA 2JLBA 2QAGC 3EXHC 3IEXA 2JIZD 1TZKA 1VCHA 2YWRA 3R76A 3IAAA 5JCXA 4B75A 4KR3A 4C6HA 1PZNA 3EVAA 1V5WA 2J08A 4QGAA 3UXYA 5KX5B 4R1TA 3GXOA 1GKUB 2X1VA 1Z12A 1PT6A 2JFQA 3DF9A 4F3NA 4FOPA 1PSWA 2MR5A 1KEUA 1C0KA 3NC0C 4HAXA 4GX5A 3RU7A 1WDWB 3B6ZA 3I28A 5SY4A 2W4MA 1P7CA 3DA8A 4PONA 3A14A 4GW3A 2XUDA 2QP3A 3MERA 3E58A 3OOSA 1GG9A 1PDVA 4MA5A 4TKZA 4C6TB 4QUEA 4B35A 3N2GA 2B4QA 2EBUA 2SECE 3D4NA 4MHOA 3W1WA 2OCBA 1ZC3A 3FKSA 3KUXA 5HW0A 1XG5A 4GZLA 1PV1A 1SRRA 3AKYA 3UK6A 3KCQA 1XKQA 3SYNA 5I7AA 2GRUA 1MQSA 1A7JA 5EIBC 4TWBA 5F1KA 4Y7CA 3LYHA 1VHDA 3CVVA 2LD4A 3IBCA 4JROA 2CFIA 1L5OA 3VOBA 3VUEA 1O0BA 4A92A 1DL5A 4H6WA 1GL9B 1RYEA 1C30B 1O9BA 4MVJF 2QBYA 1FLAA 1EK5A 1OI7A 1NFRA 2EYUA 3ZZMA 4F4UA 1VIVA 3JZIA 4BO8A 3EAGA 5DGCA 3AERB 3R1IA 3IKJA 5F77A 1ISRA 4GYYA 1JEOA 2WF6A 2NT3A 3VDRA 1IK4A 4ENQA 3H5IA 5D7BA 2Q28A 1M1NA 3NYQA 1RYNA 2NP6A 3ZXIA 3SIXA 1QIHA 3OQJA 2B4KA 1E6CA 3LVBA 4PYJA 3D2BA 4CN9A 1N77A 2MSEB 2P3OA 4OKNA 3TTUA 3X2FA 4ESOA 2J6IA 3GRYA 2HOQA 4LYDA 4PX3A 4L22A 5DI3B 4XUEA 4I5GA 5EQJB 1Q1EA 4LWZA 4Z9BA 4FYVA 5BMOA 4R9VA 1W8IA 2G7MC 5HJ7A 5K4GA 1UIRA 4D9FA 1R0BA 2IEAA 2R7NA 2O3UA 3FWKA 4OP1A 3LECA 2OBNA 3WLTA 4AX8A 4XFKA 5LCXA 3DNMA 3F8SA 4KEAA 3NONA 4HQOA 3QEKA 5EINA 3GMTA 3R6GA 2E4WA 1JLKA 5A9SB 4O2AA 4Z6KA 1XDUA 1Y34E 2WYVA 3AJAA 4QLOA 5IJZA 5GZ3A 1U11A 4TLMB 2XT9A 3WRWA 4OGWA 2GEUA 2O54A 2W6OA 5F5LA 2O3QA 5HNKA 5FFNA 3H5VA 2R9VA 5BNIA 4BMOB 2OVFA 1QKJA 4ARIA 3OMLA 5IWCA 4XFDA 3U19A 4B3BA 3TR0A 1V43A 1KAEA 4EVQA 4DDTA 2G9ZA 2X7JA 4C4RA 2N9UA 3RT1A 1T1IA 4AZ3A 4DMCA 4C2UA 2GZAA 2XNDD 1B8OA 4Y6RA 4B7CA 4B8YA 5M3BA 3EQ6A 3UGTA 2W0SA 2VQ6A 3PITA 4RVGA 4KXUA 1KRXA 2GFIA 4K9DA 1S2NA 2WZDA 3AKDA 1QHYA 4HCJA 5CJJA 2KBEA 3V7UA 2GQ0A 2YW9A 4B8ZA 5L4SA 1RP1A 3I8XA 4N12A 1HORA 5F98A 1GXSB 1Q21A 2R1UA 5CX1A 1FVHA 1KFCB 1UM9A 2Q0QA 2VJDA 3RAJA 4JP1A 1Y3FE 4DQXA 5TT0A 4KDRA 5HFJA 4MHTA 2JLCA 1ML4A 3DTNA 4N9WA 4P35A 1RXCA 2JKYA 4O4IA 1YIAA 1CW2B 4A27A 2Z9BA 2V4MA 4CIXA 4FE3A 4MRAA 4AICA 2DQZA 2FFJA 2QW1A 3KOWA 521PA 3G0BA 1V16A 1DQRA 3ABQB 3GJYA 3HLTA 1EQ2A 3NYIA 3FFWA 4R1SA 4ZCPA 1RYFA 5ALRA 3SLGA 3PXBA 1H4QA 5F9HA 2VPWA 3RROA 5EPEA 3WXBA 4ZAVA 2VHTA 2IXFA 2OZPA 1FTGA 1LVHA 1DP4A 2CSXA 1WHSA 3KR0A 4M9SA 3KTOA 4RK1A 1SGWA 1ZUNA 5M7EA 1AK2A 1W35A 3M9LA 4KNWA 3WMEA 3IP8A 1C3LA 2EHJA 4OQDA 3SHWA 5C5IA 3E70C 1XKXA 4RJ2A 2WWXA 3PGJA 3RUFA 1W36C 3A28A 4QKQA 3MCUA 2EHDA 4KB5A 5KYVA 1CQIB 1ETUA 4G5OA 3VNSA 4I4LA 2PQ2A 2NO7A 2WB4A 3T5MA 1HURA 1NKVA 2V03A 3IUQA 1KHHA 1QIMA 3K94A 2XCRB 2ZKIA 1GZHB 1SZPA 3BG5A 4AJKA 3CJQA 4JBNA 1YVEI 5T5QA 2DSTA 4MWDA 3RBXA 3ROEA 5KSZA 1UBNA 5BSVA 4OA8A 3FOZA 3GDHA 4QUDA 4V2IA 1UINA 4WPGA 2O1WA 3FZEA 4WZAA 1U8FO 5KQGA 3Q5GA 2AZXA 1RE0A 1K0FA 3F6BX 1XQ6A 4MCIA 5E1DA 1Y81A 3B9QA 1NP7A 1ENYA 3FOCA 3NRJA 1XVVA 4FDVA 5DPMA 1MJFA 2C2HA 3LH5A 2WOOA 5BRJA 1Y6FA 3GEGA 2HSDA 5JWHA 1UAYA 3I1IA 1N5KA 5IXSA 1G41A 4AS1A 5IJ0A 3V1YA 1MP0A 2Z4SA 4DCNA 2E87A 3GCXA 4QREA 3L1IA 2ZAYA 4UHDA 3RSGA 2UU9B 1SHLA 1F2VA 1WEKA 4J4HA 4NQRA 3WDLA 2FPIA 3FJ1A 3PWZA 4F93B 2C2YA 2HRDA 3AM3A 4N8EA 5AQ1A 3L7AA 3NIWA 1OB2A 3B1JA 1P7ZA 2E4UA 2P40A 4DM4A 2GRJA 2VYND 4MYRA 2IA5A 4PGMA 3JQAD 4M55A 3A32A 1QKIA 3QPDA 3FNBA 1CYEA 3E5RA 3G5MA 3RVBA 4C7VA 1RWNA 2MT9A 2V7WA 3KEFA 1SVLA 4DPLA 5KDLA 1TU0A 3W4IA 3CO5A 2ORYA 5BNTA 3PWSA 3CSDA 1AXGA 1UMDA 1KFJB 4GI5A 4LGMA 4XPIB 5AUOB 3MTEA 1JR3D 2EFEB 4JSYA 5GTDA 3OE7D 3E5MA 4H1HA 2M2IA 1RLJA 4CEJB 1XBTA 3IPYA 3LGXA 2IYVA 5EXDA 3HY4A 1LLCA 2QVYX 3I6ZA 3ITNA 5A9SA 2ICAA 4K6FA 1N2JA 4M37A 4BRSA 1T9HA 2H1WA 3B5EA 4YR7A 1MENA 4GX0A 2BEWA 4DUZB 1Z5WA 4ARVA 1VMDA 5EJ7A 3HVJA 3R3UA 1VHWA 4MMZB 1G8SA 3DUFB 4JELA 1FFCA 1O6ZA 4TRRA 2EG5A 1MT0A 1ZRMA 2ODQA 3EGEA 1T3SA 2CUKA 2XUFA 4LUCA 3KWLA 4B3DA 4ZAGA 1AUXA 3PC8A 3GPCA 3L82B 1XZAA 2VT7A 1DI0A 2YXDA 3FLBA 1HEYA 3DZFA 3VMMA 1J1IA 2QYTA 4GXTA 4AAYA 1KZGB 3WSTA 1NX9A 2XXBA 5K3CA 1VL5A 2JZCA 4WOJA 1YA4A 5ALPA 3EW9A 4XIIA 2AN1A 1LSOA 3FCYA 1PJ4A 1VGQA 3LY7A 5ARCA 1WVIA 3WYEA 5TNXA 2ZJ3A 4OP2A 4ZU6X 3ZHBA 4F1JA 1UBRS 2INGX 3BMXA 4YBRA 1BE8A 1L4UA 2FMUA 5LQUA 5SYNA 4URZR 3QXCA 1RYZA 1SVSA 5FI5A 3U39A 1X8KA 4JNKA 4MO9A 5C7IO 1LU9A 1L1FA 3G1WA 3KBOA 4GOOD 3DMTC 3GFGA 1N78A 2XB8A 2V0GA 1IXZA 4X6LA 1I3MA 5CA1A 3QVOA 1QU2A 5EESA 2X86A 3LP5A 4GAEA 4MWTA 2JHCA 3MAGA 2VZEA 3CZRA 3Q2KA 4PLFA 1H0HA 1CQPA 1VGVA 2K2QB 3HLKA 4MLZA 3WFJA 3OKCA 1N9GA 3C6BA 4HEQA 1IIRA 1AH2A 1WUYA 3ZU5A 2PMWB 3GEIA 3OZEA 1P75A 4G4GA 4PPQA 2GLXA 1BW9B 2CXNA 3V2IA 2IXEA 2PYZA 3E23A 3KQSA 5EUQB 2MR6A 3T38A 3SYTA 4XJVA 4FHDA 3TSZA 2OHVA 2ZIXA 4HO1X 2B6HA 1ZMBA 3HU5A 4ND7A 4W5RA 4K8OA 1VFPA 4DMLA 5DCUA 2YCBA 1RLTA 5J2UA 1N0HA 2EJWA 2VP5A 2YUTA 3LW7A 4PZAA 3TI9A 5HF9A 2EWWA 3EFEA 2G1UA 1IC6A 3K5HA 1DEHA 4RVFA 1TF7A 2CMFA 3D3NA 4HTAA 4KRYA 4HD8A 3V8EA 5IN4A 1GRVA 2HN9A 1UWLA 1XRNA 3OCZA 4WXPA 1HZJA 2J07A 4X44A 1NY6A 3REFA 3F5MA 5CM2Z 2A9KA 4QUAA 4F72A 5IMSA 2DGDA 1MGOA 3FDZA 3TOCA 3CPHA 3VI4B 2OUKA 2A5LA 3B3GA 5EQDA 5BQ3A 4WKBA 3IEMA 3IILA 4YAOA 3BXEA 3RYFB 3KT0A 3SC4A 4Z0PA 5ADVA 4MJ7A 5DSTA 5IUNC 3K0FB 2I3DA 4RVHA 5F35A 3PC6A 3ZDBA 3ABIA 4AY4A 3OOEA 4GXNA 3W5UA 3HN6A 1HGXA 3IOEA 3AJ8A 3RVKA 3CRMA 4I50B 1PKXA 2Q3DA 4IMRA 2AFIE 5FLKA 4OXXA 4N5MA 2QROA 2P4EA 4R5MA 5JLAA 3ETEA 1IEQA 1L9KA 3FSGA 5K9ZA 1P4SA 2Q1SA 2X0JA 3C6XA 1U63A 4ESVA 4CLOA 4D97A 4HDKB 1H8ED 2R8EA 1UWCA 3LQ1A 4Q3LA 1B1AA 1T10A 3QQ5A 3N7TA 3ILHA 3DL7A 3AB3A 1RRFA 3K4PA 4UXHA 5B7PA 5CW2A 5DLQC 2PYIA 3IBSA 3AHEA 1PR2A 1JXQA 5K6RA 1CUDA 3N70A 3R9WA 3K8YA 4XUCA 4MV1A 4MLCA 1JZQA 1P0QA 3P0EA 5EJ4A 1TUIA 5K20A 3FXAA 3VOAA 2WVAA 3IULA 2VYQA 4PWYA 4P0QB 4GGMX 4Q1CA 4UEWA 1DKQA 1E2GA 1JDNA 5K0EA 5ALFA 2WQ7A 4IIXA 1P0PA 1RKBA 1RLUA 1JMYA 4G0OA 4IDPA 2Y1LA 3NTXA 1SUPA 3O83A 4KSYA 1M6NA 3ESQA 4OSPA 2H00A 3I34X 4IHJA 1YC2A 3DFUA 4G8JA 4OBBA 2DVMA 3TLGA 3LLUA 1R8JA 3DG9A 3PIIA 4QUHA 5GJCA 4RZIA 3TZKA 1D4AA 2BELA 1KJ9A 3KQKA 2OESA 4YRMA 4FYIA 2I7DA 4IIHA 1SD1A 3RC1A 1GILA 2QRVA 4AYWA 1W6RA 3DLHA 4TN1A 3NHMA 1ZLYA 2X7XA 3SJCA 1A8PA 2G8NA 4KV7A 2ASVA 1WHSB 3GGCA 4GDFA 1F9EA 2HMVA 1XJCA 4P84A 1KTVA 3LZDA 4G0PA 5DTIA 4RD4A 3SXPA 3VJMA 5AR1A 1PIWA 1SVOA 3RS0A 1EESA 1UEXC 1DTWB 2OWDA 2Q2VA 1EM8B 2I8AA 4HFMA 2QQFA 2P9JA 1ODCA 2P67A 3G7NA 1PEYA 5CIWA 4LF9B 3O4RA 3OP1A 3UT5B 1I51A 4PW0A 4Q7JB 4YCSA 2GVNA 3ORHA 1IY0A 2JLZA 5M29A 2ET6A 1CF9A 3AF6A 1NONA 3K0AA 1MGPA 1GUAA 3K09C 1U8AA 3RC2A 4DXDA 5AI6A 3DV0A 3PUJA 4KQ6A 2PWAA 3H5AA 4LZJA 1OFIA 1YZFA 1B7GO 1VLLA 2C4WA 2XRFA 3CNEA 4HG2A 4ZV7A 2CWDA 1Q1QA 2N75A 5ALTA 4J7AA 5ESXA 4DWOA 2GKOA 3BB1A 4RSGA 3Q40A 5HQTA 2B69A 3TLCA 1FQWA 1TO2E 2VRNA 3L40A 3H9JA 4H7EA 4RTRA 2NSYA 3NQ41 3W2GA 1Z4QA 1U0NA 2W9XA 3RSLA 3RAGA 1R4NA 1COWD 1XRRA 1NVFA 3TVYA 3RLFA 1SZCA 5A5DA 3COYA 1NN3A 5DO9A 1Z5ZA 5K3SA 2BGTA 3A31A 1L3IA 2C9CA 2YQ5A 3VSEA 1DUSA 5LC1A 3DLAA 1FUYB 1CJCA 2GAIA 2HZBA 2PSJA 3E2PA 2ZOSA 1VGRA 1WE2A 2J31A 5TJHA 3ICQB 3IQEA 4M1SA 3RDPA 2PJRA 2AUNA 4DVJA 1G20B 1MHPA 3GJXC 4GQBA 2FPIB 2NG1A 4MKGA 3I2FA 4YXWA 5TB5A 1KDOA 2NVOA 3HJTA 3LKVA 2QMEA 1SBQA 1XNGA 3NP9A 3MWDB 4RVOA 1ILEA 4TT8A 2VXOA 3L7JA 2QSUA 5CFZA 2RCNA 4G65A 2HA7A 2P2GA 4CIDA 5JQWA 4PGAA 1ZJWA 4EUHA 1I32A 2OILA 1QRDA 4YRAA 3Q72A 5C8VA 1A9SA 3IP5A 3H9BA 2P8JA 1PP4A 3WGNA 4CMIB 7ADHA 1XI2A 1E5XA 3AL3A 2XYGA 4GKAA 4ENPA 4JR2A 3DQQA 1IOVA 4FYPA 3U26A 1JVSA 4CYMA 4CL8A 2D7CA 3JD2A 1E18A 4WTOA 2CD9A 1RI3A 1CULC 2HLDD 3DZKA 3TLYA 1GN8A 1VLVA 2VLIA 3F8TA 3UEOA 1DO2A 1V1JA 2O3TA 3I05A 4FEYA 4PU0A 5AXDA 4DN6A 5J1SB 5K8UA 2WHPA 2A58A 3NBZC 3K9QO 3ZNNA 1KMIY 4NIMA 2GJKA 2OQIA 1PSZA 2CDCA 5FFMA 4V0ME 2C0CA 3TRJA 5KNLA 2D59A 5C3MA 3ITDA 2ONZA 3EVEA 3ZVMA 3C5VA 1GYQA 5HQJA 4FFWA 4U7FA 2QLNA 1NXWA 1ORVA 3HJNA 1L9XA 3FWYA 1FQKA 4G37A 8AT1A 1E9BA 3SAJA 2EQAA 1L8OA 1J0XO 2GO1A 4WK0B 2ECOA 1ZD4A 1KHTA 1XP8A 5EMKA 3SZRA 1M8GA 1XNQB 2H8GA 4MZXA 3LUKA 4A15A 4FFLA 4WEOA 3RFVA 2E21A 1V6AA 1V8PA 1CQIA 3HN7A 3Q3GE 2OG1A 2R8XA 3GIWA 5CFNA 3A1DA 1XTZA 3DS8A 3TZHA 4GYJA 4HWPA 5ALJA 5CAEB 3WADA 3PEWA 1O97C 2Q6IA 3TUIC 3VR4A 4JY7A 3T3DA 4DWVA 4YV7A 5B3JC 4GS5A 3ZU2A 4FCTA 4EECA 1MB4A 2A9JA 1THGA 1I1HA 2CDBA 4UMFA 4KPGA 4BVJA 3GLUA 3FOAA 3FDZB 4V0KA 5CVUA 1AT1A 2CXSA 3F4LA 1U3DA 3FWNA 1MC8A 3DSRA 3THSA 1XK6A 3PICA 3ZEIA 2PAAA 2R6R1 4KWEA 2H2DA 4WZZA 3PX3A 3U49A 2CLMB 5DYYA 2WSBA 3AM5A 2IYQA 4NMHA 1JBKA 4DLBA 4G4JA 4RPHA 2D1SA 3PQ4A 3QQPA 4X9XA 1L5ZA 1BU8A 3GF4A 4DDMA 4HWOA 3TQFA 1DEAA 2N3ZA 2JAXA 4MS1B 4NAVA 2ZITA 2J1LA 2AG1A 1SULA 3LIPA 3TLZA 1AG9A 1R5OA 1TVMA 1YHYA 2UZ0A 3F1LA 1AF4A 4JX9A 2QRJA 5KOIA 1Q19A 1OFTA 3TM5A 1XYYA 3WNDA 3K8QA 1OHHD 3FRHA 3HZOA 3TZEA 2XT0A 4Z4EA 1NZJA 3TR5A 2ZP1A 2GYUA 1Z5VA 4FDUA 3RUPA 2C57A 4P86A 5FIUA 1G59A 1E9CA 5CUQA 3B1WA 4D3DA 3UA4A 3N58A 4ITUA 5JAZA 5KYWB 1ZK4A 2QIOA 3M83A 5DT9A 4EO9A 1QHXA 5H5JA 2OFXA 1C7ZA 4OQXA 5AOCA 4JDUA 1QDLB 2QNBA 1XR3A 2A4KA 4IVRA 2BGJA 1NW8A 4MQ4A 3RD5A 4OYHA 2OAP1 2YWXA 2BKVA 1P1CA 3GLFA 5CLHA 2IHKA 3E9YA 4D9EA 1GADO 2XCOA 3HJRA 3SSNA 3OJCA 2PJDA 1J22A 2BM9A 4EKGA 2XZDA 4H7DA 1BZYA 3EPRA 1DIOB 4D8VA 2Z3WA 2HJRA 4TV9F 4PNEA 1P5ZB 3ZWNA 2V7QD 1PYOA 2JCVA 1IM8A 5BV1A 4J4BA 2UXCB 3HKCB 1DTEA 4DVGA 1N1MA 3D0QA 4MRVA 4Z7QB 1JG3A 1RQGA 3ELYA 3LFHA 1YRQA 3PYMA 2BFWA 3ACDA 4UMDA 3MPUA 4XYEA 4A0QA 1NFFA 5FHQA 1Y89A 3SPXA 2JLVA 3C6MA 4MDHA 1K1EA 2NV0A 1KOLA 4M1OA 1UBCA 3HEBA 4A91A 1Z6XA 3BH0A 5J58A 1R6TA 3C87A 2PXAA 3DUWA 3PDJA 1DO0A 3T12A 1E9VA 4C3OB 5JZMA 3NH9A 5ENZA 4DBZA 4M49A 4JIMA 4S12A 4UFNA 1C1DA 5EKUA 4ARSA 2OVBA 3R0ZA 3BF7A 4F06A 1W2WB 4PF1A 2I4MA 4QASA 4KC0A 1ODSA 2A4MA 2XZLA 4G5GA 5GIPE 4ZTZB 3KHKA 4KLAA 1VE7A 2Q5JA 2XNDA 4Y98A 4IXTA 5KDDA 1V2HE 1QRUA 1KGSA 4Z4CA 2IHNA 1BE1A 1TE2A 5LQMA 2YY5A 2PNFA 3N39C 4UVIA 3U7QA 4PRLA 3INGA 4NDZA 1P4RA 1EP1B 2KQUA 3F97A 4U8GA 5CT4A 5EQFA 2F59A 1O94D 1U0HC 2XOKD 3JR7A 2Q21A 1N5IA 1QO7A 2FPRA 2WJGA 1I3CA 3DB1A 3EXG2 4RFVA 3VU9A 5ICEA 4WQMA 4ON9A 1SUEA 1PUIA 3AQ4A 3TN7A 2O0JA 2PVPA 3I4CA 5A5FA 1ZVQA 2BKXA 2CUZA 3R3VA 1U0TA 2J33A 4BC1A 1EZ1A 3QF4A 5AVXA 3EPKA 1ID8A 2O2ZA 3AGQA 3B13B 3LMKA 4Q3NA 4E4YA 2FWBA 4HWRA 1NHWA 1NMSA 3GJRA 4KR7A 3PQDA 1M2VB 1AHNA 1XVTA 4LRTB 1R9NA 1P33A 3E9EA 3OTQA 1RPJA 4UUNA 4B71A 3HACA 4FX5A 3JQCA 5TIIA 4UM5A 2WFLA 3UAXA 1NQWA 3G7UA 4PAQA 5FTKA 1P9NA 3O21A 4X3PA 3SF8A 4BP1A 1NVEA 3TIFA 1SBHA 3SZOA 2A9OA 3THXB 5ECGC 4E31A 3W05A 1RAFA 1T2DA 3RNLA 1EXWA 3UBMA 4DYHA 1EDDA 3DMFA 2ZM6B 2V5VA 3GK3A 3EWSA 3PP8A 2C5HA 3AFIA 4RHCA 4WCFC 3R7DA 3U4AA 2OZKA 3HR4A 4F6LA 5CFMA 5G4KA 1BVHA 4DRYA 4FPXA 2O7SA 5CG1A 1NBAA 4HKTA 4ACAA 4EQZA 2QUIA 1PFUA 1U0GA 3LCVB 4KQGA 4CI0B 5D3MB 1IXKA 5I9LA 1JDPA 4PSAA 3CGGA 3TXAA 3SHQA 3CB4A 3ZIDA 4KAXA 4M89A 4CTMA 4U6SA 1RKUA 4JJ7A 3JQAB 1I3OA 1MJHA 2F48A 3BHIA 1SC9A 4Q1BA 4Z9AA 4F4FA 3HXPA 2D54A 2VJOA 2X3UA 1EMDA 3GDGA 4FNAA 3RS7A 4JBIA 3ZX5A 3PNLA 3A3OA 2W83A 4TVOA 4UKDA 5E2AA 3G68A 1NM5A 3V34A 4AECA 3K6RA 3L8FA 4B47A 5BSHA 1HA3A 4BBPA 4D6PA 4OX9B 1CE8B 1CFJA 1ELOA 1N5JA 2VYNA 4FR5A 1A71A 3D1LA 5LMCA 1XZIA 4KMRA 621PA 1FS4A 3R75A 4CLRA 3C6KA 3PWKA 5GJBA 1PR6A 2AOTA 2PBLA 4C06A 4ZDJA 2Y77A 1KO1A 4UAVA 2H0RA 3T9EA 1ZD3A 3PR1A 4COOA 2NSDA 4N48A 4LJ7A 3QYPA 3C5CA 4X5OA 3JD4A 3PPWA 2GEBA 2ZTVA 5EMMA 3AK4A 5JD6A 4MP8A 2X0RA 1JR3A 3U3KA 1KF0A 1DJLA 1WCV1 3I6QA 4XD2A 3RYHA 1SUDA 5IH7A 1QP0A 4MV4A 3JQDA 1LNQA 2WIJA 1ZEJA 3BK2A 3WQBA 2W2MA 3KEGA 3KYCA 3TWOA 4YT8A 3A3YA 1V9SA 5ALEA 5DNVA 5EUMA 4LXHA 4L02A 1UOQA 3R2JA 4D3SA 4EYGA 2TMDA 1TQ6A 1Q0HA 2HLNA 5D5QA 5IM5A 3COVA 2D74A 3BHJA 3V1TC 1F51E 3L6DA 2WG0A 4CDGA 2AI1A 3W6OA 1QYCA 4YJ2A 3E22B 3RVDA 1U8UA 5FAKA 3P2KA 1JL3A 221PA 3H5TA 4QDTA 2BPOA 1NC1A 4AJIA 5LZ9A 3BEOA 3T3GA 1WX1A 4FHZA 2IKQA 2H1IA 3LQKA 2XJ9A 5A0VA 4D5GA 4LY6A 2FPGA 1EEHA 1QRAA 1A8QA 1E3JA 2AOUB 3LSTA 4FE7A 1V11A 3I5YA 3P9YA 4RU1A 2X6RA 1ZX1A 3PTLA 2W4QA 1VHLA 5A0FA 3V4SA 2H3EA 3C7KA 4XR9A 2JVKA 5IJWA 1W73A 1QRTA 5LQCA 1NW7A 1L8AA 1YOVA 1Z2NX 3K0CC 3TAHA 1LDMA 3AEKB 2QD1A 1P61B 3WYAA 4RY9A 1A5AB 1L4HA 1ZN2A 4QUIA 2G9RA 3K7EA 4Z1MD 4DZZA 3NR2A 4C43A 4DWJA 5K0BA 4L6IA 5DBOA 1AMNA 2GPNA 4JI7B 3I6IA 5JFTA 4I55F 4C4OA 3OO1A 4R8LA 2R8YA 5FAXA 4MDFA 1EFRA 1EA5A 1M6VA 2O8VA 1Z88A 1FB5A 3KE8A 1J8MF 3PQEA 4BCDA 1XMOB 3UENA 4ECAA 1Q17A 4JODA 3RK4A 1NF8A 4FGUA 4GPBA 4LOAA 1GQSA 1SVWA 3FHCB 1J0BA 4W8HA 3ESZA 5D3ZA 3PJRA 3GN1A 3W7BA 1W5AA 4KCGA 1GU0A 2RJOA 5EZSA 5K6AC 1KDTA 4EG5A 2G07A 5CNKA 5EKTA 2O4UX 3A2LA 4QPZA 4Q7KA 2OQ2A 4UEQA 4CM3A 4DUGA 1B43A 1N1EA 3PSHA 1TCCA 1IQRA 1HI9A 2DT5A 4Y0AA 1KSGA 3QITA 4TYQA 1UQTA 3V8PA 3NDIA 1YZ3A 5T3YA 4HRXA 5LR6A 3PHLA 4IHKA 5DCLA 4OGKA 3WKBA 5NLLA 4FHFA 4KPFC 2HDWA 4JT2A 5C2JB 2KPOA 1FC0A 3BTUA 3O3MB 4V24A 1N0UA 3A7EA 1CSEE 3FVVA 1WP4A 4ZO7A 4D44A 5EEGA 5IWAB 1GPLA 1TKCA 2J3JA 1V37A 3NETA 4Y9RA 3QENA 3K0CA 3OZVA 2FWJA 4OFBA 3H5WA 4YMHA 1LVGA 2DUMA 2AJTA 3OOYA 4IQFA 4WXRA 4ECEA 1FDTA 4N6GA 4MKFA 3ORFA 1TYDE 1A50B 2HSGA 2CXRA 4LG1A 2O8FB 3QV2A 3UJPA 2RFLA 3WA6A 4HN9A 4OLBA 1TQDA 1XZEA 1NXOA 3IUYA 2H2WA 1R5BA 3OBIA 1BGVA 4L4UA 1JUDA 2ZRQA 4XGKA 4ZCTA 2IUTA 3BXZA 4M0FA 3SOZA 5FQNA 2VC2B 3PLNA 4C0XA 4P1ZA 2RHGB 1BHO1 4MTCA 1WY5A 3AVXA 3DXZA 4EHHA 4IDBA 3QEBZ 3FIJA 1YQTA 3C0KA 5F7XA 4ER7A 4H6XA 2WKSA 3D8TA 2CNKA 2NVUA 4HBGA 5IT9A 1WMAA 1SUAA 3KL2A 2A57A 4IYJA 4KE7A 4PZZA 1DBWA 3DW1X 3OZUA 4QX6A 5A4FS 1VCIA 3ADPA 3IVCA 1HE3A 2FJPA 1N92A 2GUGA 1AQJA 2WAOA 1ZY2A 1TTHA 2D2XA 2FU5C 3OZFA 4QOSA 4KP7A 5I5GA 1S2MA 1WULS 1XDDA 3RJTA 5BW8A 1JKIA 3I8SA 3LGSA 3IRVA 4X1OA 3G2OA 4OQ4A 3AI2A 3IAM1 5BQOA 1ZSNA 4IIEA 4RGBA 1F8UA 4OSOA 4HJXA 5ELLA 2JRCA 4KYIB 4RF3A 4FGZA 2YR0A 3SKYA 7AT1A 3FUVA 4UE2A 3L0ZA 4AP9A 4C7OA 4Z1MA 5H9VA 4HNAA 4RJKA 4S24A 3T3HA 2H9AA 4J0HA 3HFJA 4MHSA 1LTQA 4ZWNA 1QE5A 2O2JA 2NYAA 1XEAA 4I8DA 1D2GA 3V97A 3F7OA 3H65A 2GA8A 3PRYA 1LBIA 1L5FA 3PGXA 3WLIA 3M1YA 2CZGA 4DLVA 4DXAA 2AFHA 1H6AA 1QK5A 3KT8A 1H23A 2FOXA