2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
b'SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2Z4TA 2IHZA 4R84A 2IIBA 4V38A 2IY8A 2C84A 2EX1A 4V39A 4R83A 4R9VA 2IHJA 2ILVA 2IIQA 2C83A 2IY7A 2ZWIA 2EX0A 3S44A 4V3BA 2IHKA 4V2UA 2II6A 4V3CA
chains in the Genus database with same CATH superfamily
1XL1A 3IOMA 4R8RA 2XCQA 2ZK7A 4NEHB 4CKCB 3CPJB 1UAYA 3C7DB 5CK4A 3A4TA 2XCTB 1IBKB 5CM2Z 2J31A 1NNSA 1NXWA 2BUBA 3CCCA 3FDXA 4BVHA 1U2GA 2C7BA 1IBSA 3A05A 3M6IA 3T52A 2WJAA 1EX6A 4K05A 2NU8A 1G6OA 4XWWA 1N25A 2ZI5A 3H9CA 5C37A 3HR4A 4CIVA 1L5GB 1QG4A 1BWRA 1EGVB 10MHA 2XMGA 3TQCA 2FRXA 4DSOA 5K3OA 1GCOA 2GRJA 2PNFA 1RLUA 4KMRA 4EKGA 1U0GA 4I4TA 1NVAA 2AZDA 2FPXA 2V8OA 4YNBA 4AT1A 4TVOA 1TTHA 5CM8B 4HDRB 4M8SA 4RORA 4JX9A 2GJSA 3MJCA 1KL7A 3S1LA 1N0WA 1P81A 5C5DA 2W43A 3PFWO 1HZZC 1VCNA 4GX0A 5BSRA 3U7FB 3WNCA 3WGLA 1VBKA 5SV2A 1XZ8A 5D5HA 5FR2A 4KLNA 2O2SA 5IWAB 1V5EA 1H2AS 3ZNPA 3STYA 5GADl 1JH8A 5ILQA 3WO0A 3RBVA 2VO1A 1UOPA 3WS7A 4YCLA 1L7DA 2FJ0A 1IFXA 1TAHA 3KQNA 1XU9A 1Z6AA 4UHKA 4DQXA 1XMOB 2WJZB 1T91A 5L7TA 2PL9A 3FZQA 2FW9A 4GMXA 1L5QA 2RHRA 3V8RA 4FIZA 3FM9A 4D8YA 4AP5A 1J99A 2DULA 3TZHA 1HYGA 4K1XA 3S7ZA 1ADCA 5FPKA 3H86A 4W7IA 1N32B 1ZPDA 4D9BA 4IHQA 4MS3B 3FCAA 1B4DA 2QLLA 1H3FA 3O1IC 3B36A 3ODGA 3PD0A 4QNMA 2PSDA 3W2HA 2QVYX 5G53C 1GDTA 4KN9S 4V0RA 4GMKA 4GPEA 4OM8A 5DTEA 1YMUA 1KI1A 1HT2E 1M8GA 3R7BA 4AMZA 2CFOA 3DXFA 2IYVA 1BU5A 1IL0A 1FNCA 1H05A 1LLDA 1TPZA 4F7WA 3QW4B 1H4VB 1JQJC 1KMQA 1MABA 2WT8A 4V0LA 1NLZA 4FFRA 1VZ3A 3A4IA 4LYGA 3UOGA 2IH5A 3EQ2A 1YRHA 4U6QA 1BAPA 5LUAA 1W35A 2ZKIA 2BBSA 1Z2CA 4IL5A 5FLXA 1Z5NA 2GBLA 3F5QA 4FZ3A 2X8WA 3A26A 1N34B 1GXSA 1WW3A 2A94A 1GT6A 4WD3A 3RAPR 1OYWA 1XQ6A 2ZRHA 2LBPA 2A8YA 3G9TA 5HE8A 4FMCF 1ECJA 1F5SA 5HS6A 5BSMA 5J58A 1OH5A 3M4JA 4D3YA 3RHFA 3NC4A 2HWYA 1PQ4A 5BSWA 2DUWA 3IQEA 4NCAA 3KD2A 4R2WA 3GUZA 3IIKA 2O1EA 4NV0A 5IVDA 1XGKA 2QRNA 4QXOA 5AKHA 3T5MA 3S6JA 4AJJA 4B85A 1KZYC 1OTHA 2QJOA 4PC1A 2UUCB 4PGHA 1AGYA 1W25A 1TF2A 2XRMA 1TYDE 3CUKA 3JQDA 1NF8A 1DFHA 3JQBC 4PZPA 5EPEA 4G97A 2HHAA 3RANA 3GLIB 1WP9A 2XODA 3IDOA 3LA8A 1IHXA 1K4KA 3O8CA 3KQOA 3ZJ5A 4DSZA 2FY8A 2H8KA 2FRVA 3F7TA 3OLYA 2PKRA 1JR6A 1CR1A 3B6KA 5E1MA 2C4HA 1ZBQA 1Y1RA 2OGUA 1DO2A 2A5LA 1NXOA 4C6HA 1WMFA 3QF4B 3BIOA 2BF7A 2H4YA 3NAMA 2JBWA 4DLVA 5C4GB 4NK4A 1O0SA 1H0KA 1ZAYA 1NYLA 1NUTA 3K8YA 1VHWA 2ECFA 2OHVA 4I4LA 4IOJA 3W3AD 4ZA2A 3OMXA 4I1OA 5C1IA 4EEZA 3LC0A 3HGMA 4BCBA 3WHIA 2QZZA 5ALOA 2O3QA 3L7CA 3VO2A 4DE5A 5LZ8A 1DFIA 5WRFA 1DXHA 4KPYA 3AHDA 3E27A 5ALLA 1ACLA 3FNQA 3A9VA 4MYSA 4C0QC 3CMMA 1KOGA 2UVPB 4RUKA 3Q8LA 3GWZA 1TKRA 1J00A 1MC4A 3EDOA 4UXJA 5AK4A 4BEJA 3R0VA 5C1OA 3FCUB 2HSWA 3ZWWA 2UZAA 1C2TA 5IHPA 1KGSA 1ZHFA 1Z7YA 3KKEA 3IKMB 3PCTA 4PNZA 1DOHA 4XQ9A 5AK5A 1V48A 4TSFA 1LFDB 1SD1A 3U60B 3ESAA 5CNJA 1DAHA 2HOQA 4O2AF 3B5EA 4DOMA 3GNQA 2GM9A 2GYUA 2IZ5A 4MWBA 4EB0A 4ME6A 4R83A 1ZKDA 4HVAA 1E98A 1DAPA 2J9ZB 3I04M 5IK2D 2B92A 1DSSG 1R0ZA 4OXQA 3L40A 3BCUA 4WACA 3VUFA 4DG9A 1VJGA 3HV2A 1Z5PA 4JEMA 4MUYA 5I5EA 3TQRA 1UANA 3WIUA 1C3OB 1SKAA 2DAPA 3NTOA 1Q17A 4DKJA 4KR3A 2Q7XA 2B3TA 2YYYA 4QO7A 4U2EA 2DFPA 4X3CA 4B09A 4TYWA 3KHSA 2OLEA 4W5NA 3FKSA 1EXVA 1NLFA 1VMDA 5F5NA 4AAYA 3IBCA 4FNGA 1WKCA 2VDUE 5U4XA 3RRMA 4Q7QA 2C3YA 5HUJA 1VFPA 4N12A 2FR1A 2LE0A 3OKFA 2JATA 4MPJA 2TS1A 3I6MA 4MMYB 2EZ8A 5DGIA 4F97A 1XMIA 3KHUA 2CMDA 1W5EA 1TU4A 3MBIA 2BVNA 1EHCA 2JHFA 4I1SA 5B1EA 2A84A 2FFHA 2H9AA 4N9WA 5TGZA 4RD4A 2PUTA 1GGVA 3ISTA 4K6MA 4HB4A 4C3VA 4G63A 4EJMA 4FNAA 5K45A 1R6BX 2JIOA 3BSFA 4CZ2A 3O4VA 4QGAA 5B3LA 4L27A 3QX7A 4J0DA 4MCIA 5G0UA 4ZZ2A 3LJKA 4TROA 5HRCA 2ID7A 3ZHZA 1P1FA 1XRQA 1KK0A 2A9PA 2KI5A 3R7NA 1XA4A 1NURA 4M1YA 5AJWA 4PYJA 3DNFA 1S89A 2HIAA 5TEWA 1RAHA 1YB1A 2P9YA 1SFRA 4HWPA 2CE7A 1JW9B 4CFYA 2LKDA 5CVUA 1YBFA 2IL1A 2IUSA 3M9WA 4LNAA 3LZCA 3BAFA 1YJAA 2ZYIA 4TTTS 2ORYA 4PPFA 3HWWA 1J1UA 4U3JA 3X1JA 2XLCA 2AC7A 5LJLA 1PS0A 3BRCA 3OT4A 1IZ9A 1XD9A 1XT6A 4HY3A 4MK4A 4RA6B 5B36A 2EDAA 3CRW1 4U7GA 3CX6A 2JAQA 3KSZO 3MIIA 1N4AA 3RYHA 3HSKA 3B48A 3W2IA 4P3XA 1JILA 2J7PA 5DNUA 1ENYA 3DZGA 2JLCA 3EVFA 4HWRA 5H59A 3ZWAA 3HMKA 5I3ZA 4IDQA 4XX1A 1L1QA 3GAAA 3VTAA 4PAGA 3L4SO 1O58A 3GEPA 3IAAA 5BXQC 1PZGA 4OJMX 3VNAA 1L0BA 1ADGA 2X13A 1MLDA 3GPIA 2QJTA 2GNPA 4HNRA 4UM9D 4YUWA 2X5JO 1XTRA 8OHMA 3EOAI 1WOYA 3JD2A 4E4YA 4C7XA 2VDKB 1FFXA 3O83A 4HHEA 3KSUA 3RVPA 4LXUA 2E87A 2VSOA 1YAHA 5TY0A 2PT7A 3TS1A 1H9AA 4R9VA 4GNKA 1Q84A 5FHRA 1MVNA 3ZHQA 4URXR 4QNRA 3DR3A 1CK4A 3ZLUA 3EFOB 3ISJA 1NZDA 4O8CA 1TZMA 3PFFA 5KX5A 1G3UA 1UC8A 2WUDA 1QVWA 2FUNB 3L8YA 3WKDA 4H7EA 3MEQA 3K70D 3OZDA 3UUFA 1X8XA 2FPWA 2KJQA 2EU8A 3A9UA 3AETA 3G7SA 3MMNA 4C7VA 3MCVA 4PNHA 1H8HA 1C3VA 1VG8A 3FDIA 3AB3A 3MJEA 4FLEA 1JQDA 4ILKA 4XWKA 4LKRA 3JALA 3UJ6A 4QQ8A 5L40A 5ALMA 4M55A 4PCVA 4O6VA 1OKKD 1UJCA 3HG7A 1ZIYA 3MTJA 3I8XA 4NI5A 1HR0B 3ZGYA 5FP0A 4G0MA 3E4CA 4MCHA 5G02A 2LWIA 1KDYA 3UIEA 4A92A 1YRAA 2A5FA 4XQ0A 1BVUA 5FPHA 3WXBA 3D4OA 3H8SA 5FUQA 4DLRA 2G3YA 1AQYA 1E94E 1GPLA 1H5QA 1XEWX 1HT3A 2BHSA 2FOLA 3JAWA 2WQZA 3OSZA 1TMGE 2H3HA 4RHEA 1GOTA 2JH9A 4FGWA 2AW5A 4BMNA 4PG8A 4JC0A 3GH1A 1DBIA 3MT9A 2BHTA 4DNXA 1E62A 4F0JA 7REQA 1RBZA 4J91A 7MHTA 3UJCA 1KRXA 1QMGA 5HE9A 3E84A 3FUVA 2QRVB 3IVXA 3MPUA 4JBIA 2FEAA 3EXHB 1UMCA 4L6CA 4R84A 4B3TB 5KOIA 1W4BA 5HZKA 2A4KA 1VL1A 2C4TA 5BY2A 5HVNA 2MYPA 4NBLA 1AJEA 5E1OA 2EIHA 2EYUA 4D99A 1ODIA 1ZHOA 2V7WA 5DT9A 3HLKA 3MS2A 3IAS6 3BCRA 4FKZA 4DPLA 5HFNA 1Y0BA 2GZHA 4HL6A 4CKEA 4IGAA 4BMXA 4CKXA 1ECGA 1A5TA 4PS0A 3BWEA 1Y3HA 5T4BA 3EF3A 3TVYA 1TF7A 3IUSA 5K2MA 4HNHA 1JAXA 3VC7A 4ZI7F 2VNAA 5JMWA 4ZZ1A 3WY9A 2ENWA 1J25A 3BMOB 1RMTA 4J4HA 3ECCA 4DLNA 4IOMA 3W9SA 3QVGA 4UTRA 2WQ6A 1J0CA 3T0IA 5JV5A 1TTTA 3AFHA 1XZDA 1G20E 2C8JA 3A6JA 4FCVA 3MJRA 2MYUA 4I0WB 4Q1FA 3HSYA 2IF2A 4FIDA 4O0LA 4YAWA 1E9AA 2CBZA 4R2IA 1VSUA 3NB0A 3OLCX 3BB3A 4FDAA 4LZLA 3WBKA 4E70A 3R6WA 4HSGA 4KSBA 2GN2A 2Y9MB 1QQ5A 3ICPA 1WPGA 2UYOA 2XUJA 4RM3A 3I1IA 4EHHA 4ESEA 3IOEA 4MRRA 4Y6GB 1G7RA 1NXTA 4ZMSA 3DNPA 5ALYA 3UKOA 4AWXA 4AXBA 2OZVA 3BCSA 2Q6LA 2PSHA 3COWA 3UHOA 2GFIA 1GDDA 2XA9A 3JVIA 4KWTA 4RHXA 3I5XA 3PHJA 1IRXA 3V8NA 1GCAA 2HCRA 3FZYA 5KHOC 1C4XA 2VAXA 2VXOA 1N2HA 3BK1A 3PEWA 3W9UA 1HDYA 4IMJB 2R6FA 2ZB8A 1LPSA 4HBZA 4GYKA 3VISA 4YYZA 1CZLA 3I61A 4XYBA 1ZZGA 2YRWA 4ZCQA 4KXFB 4YR7A 1YA8A 3EQ8A 3KQUA 1MIOB 1H6AA 4NTZA 1JZSA 2BOVA 1G9XA 4HDSB 3AR9A 5E2IA 2HV9A 3PTZA 4IDFA 1KDZA 3UK7A 3CUYA 1CXZA 5AXCA 1BKYA 2BGJA 2VHTA 3T3IA 4C5BA 4CMIA 4DIFA 4DVGA 4HV4A 5AJXA 2R8EA 1U8TA 4L74A 3CG0A 1A71A 5IULC 1VP3A 1E8DA 4J4TA 3GRFA 3I2KA 4ALIA 4COOA 3PUHA 5F98A 4A03A 621PA 4CN8A 4F4JA 4MWGA 3SBEA 1FVHA 1YO6A 1J2UA 4JLPA 4B6FA 2JRCA 1KERA 3EK2A 1PGQA 3GRCA 5FPPA 4RKFA 1GPAA 3D9QX 5HKKA 1O08A 1MF7A 4M38A 4L15A 3SR0A 1R6XA 2FEWB 1EE1A 2Q6VA 4B44A 2RBGA 1YI0A 4CL2A 1QCCA 2JGDB 4TTPA 4IGFA 1IEXA 2CUNA 2NO4A 4JYPA 1JQ5A 4INPA 3AGPA 4WZBA 3LUHA 3RSLA 2PX3A 2P5TB 2Q3MA 4MLPA 2G9VA 4ZC1A 4JI4B 2BFDB 3RG8A 2BTEA 1KFEB 4KQJA 1KY3A 1YZUA 2GDJA 3U4QB 1R0CA 2BY4A 2PK3A 1UBRS 2XWPA 3IT2A 4EFNA 4ENPA 2PWAA 3C3WA 3DOJA 1QVVA 3H75A 1YQGA 2ZI4A 4TWRA 4OB7A 3VM6A 3LXRA 5JCOA 2Q07A 1LWOA 3RAJA 3A9SA 3TL6A 1V1RB 4OGKA 3KC2A 2EJVA 1E4VA 2QMHA 2XV1A 5CCDA 3FPCA 5BR7A 1B26A 1QX3A 3HYNA 5G2OA 2BFEB 2FQYA 2H48A 2VSYA 3IMGA 2WB4A 1JKJA 3A7EA 4UE3S 1GV0A 3ER9A 3JRNA 4KAAA 1GG8A 4GFDA 1UKVY 3WGJA 1SXJC 3WMFA 3RTEA 4G9GA 3H17A 4JSRA 1PEYA 5BXYA 4LSZA 3NANA 4CLRA 1XKQA 2D8MA 4HNVA 2CV2A 4BUZA 5BSHA 2MYTA 4R5HA 1DZIA 1UMBA 2R4UA 5K0BA 3E53A 3ZZNA 1VE5A 2FPMA 2GWRA 4B33A 2C8VA 4L2IA 5DHUA 4LF4B 4YN3A 1MX9A 2LD4A 1Y1KE 2DLNA 3BXFA 1NW8A 3H11B 5JI2E 1STOA 3H2YA 1PJ4A 2IXFA 5HCNA 2HDWA 2XUGA 4C7JA 5LP6B 1F51E 3CR8A 3L92A 4OQLA 3AM3A 3AUYA 4TVBA 5G4KB 5EIWA 1T2EA 1NUPA 3OIFA 1U65A 1YR8A 5DM2A 5ENVA 1EFKA 3DGFC 2IIQA 4QUBA 3UUGA 4CV1A 5K6AA 5CNMA 1DRKA 5BYBA 1WG8A 3HUDA 4JWTA 2GI4A 2I76A 4L75A 4YGYA 4J3JA 1T2CA 3EGWA 3QH4A 1QGAA 4J3FA 2N1BA 2PRSA 4FD3A 1WHTB 3QKSA 1EE9A 4QQNA 3FVTA 2QRUA 2AUMA 3T54A 1QHEA 4ZHSA 1JAYA 2J87A 2JFOA 5FI0B 3V7FA 1P5RA 1KH3A 1KYTA 4R8SA 2JJ2A 4M4SA 4W9RA 3EBPA 5L51A 1Z4NA 2DWUA 4XVQA 3V32A 1HX7A 3KBBA 4K9MA 4CM3A 5EXDA 1NR1A 4ZO8A 4DLKA 4IV0A 1CUBA 2JCYA 4DCGA 4MS4B 3NFYA 5C18A 2IP1A 2GXAA 4HYTA 1V8BA 5KOHA 3IVAA 2YCLA 3VDQA 5H81A 4B6OA 3UG7A 2RGBA 1TXGA 4ATNA 4OY3A 3VPSA 3AJ9A 4FXPA 4D44A 1A9OA 1R0LA 3ENWA 4CV0A 1E2HA 3L41A 2OV4A 4X61A 1PTKA 1OLSA 1P0FA 2QG9A 5FFFA 3GJXC 4CQJA 4EKNB 5ERXA 1D5WA 2XPCA 5ILOA 1JG3A 4PZDA 4WNYA 4KNYA 1FJGB 4KODA 1WVMA 1E61A 3JXEA 3M7IA 3NT5A 1W85B 5DM60 3BT7A 2W6JD 2EZUA 1SG9A 2O4UX 3GA7A 3H1BA 2X1VA 5I7OA 3KYBA 5IXSA 3ORYA 2R6AA 3F3MA 4WCFC 2ZQYA 3BKWA 4I2VA 4QPCA 2VPXA 2G4VA 4JGIA 1SY7A 2BZGA 2X40A 1O6GA 3JYOA 1XFDA 5BYAA 1TVEA 4LXQA 1T2FA 2W4IA 1ISJA 5KAPA 1ZNQO 4IVNA 4MVWA 3IP9A 3AM4A 1BDMA 4Q7JB 3V8QA 1JHYA 4RZ2A 1GDHA 2HLPA 4ETWA 1K4YA 2JEYA 2PA0A 3Q3HA 4CTOA 5FBQB 3GRPA 2DETA 5BNWA 1K7SN 3RIHA 1EBBA 1XELA 3OCUA 1DWQA 4JLDA 1NTRA 1X6VA 1KK3A 4PN3A 1WUIS 4HS4A 2IVFA 4RSHA 3GD7A 5M04A 2XRFA 5B7NA 1EFHA 1B43A 2GM4A 3BQNB 3L7BA 1F12A 4Y2QA 4B87A 4DREA 3QGMA 4W63A 1EUCA 1WZUA 3SVLA 4A91A 5LIPA 5JG7A 1OIWA 4AD8A 1GFIA 1E96A 1GPKA 2QNBA 2RK6A 2VHYA 3WLAA 5AK0A 2PUBA 2O3RA 1RFLA 2XF8A 1PJSA 3IPCA 3OWXA 1U1CA 4ZVOA 2B5OA 4HR7A 4M1OA 2AYZA 2LPMA 1X7ZB 2E0IA 1VIMA 2DECA 4YUXA 2QN3A 2G88A 3QVVA 5AHRA 3ISVA 2XUAA 1UKYA 2GD0A 2XQKA 3KDAA 4H0CA 1SUSA 1CNEA 2UUPA 3OOJA 1ESEA 5KTPA 5FQOA 5EP2A 3LTNC 2ZAGA 1CZOA 3TGLA 3ZLJA 1LDNA 1JQEA 2B69A 3ZV7A 1YQXA 4OK6A 1FA9A 2W37A 4Y1EA 3MA0A 3DHNA 3SSMA 2RBEA 1WVGA 3LVRE 4R81A 3V1TC 3SCZA 3MJDA 4WEOA 1LQTA 4EX7A 2YUIA 5A3SA 4DT1B 2XE7A 5C8XA 3UJ9A 1B8PA 1I0LA 1Z4MA 3BMCA 4FOLA 2DRIA 3L7YA 3GI1A 1R5BA 1NYQA 1FUYB 1YJ5A 2ZI3A 5SYMA 2ZT7A 1A69A 3D3QA 3LOUA 4LYYA 4WZBE 3TD2A 4RZIA 5DRYA 3L7MA 4YI5A 4JFRA 2WTNA 1YHNA 3N2YA 1FZQA 3D8RA 4CCSA 1O0BA 1B6RA 1LQ2A 2RGGA 3Q0TA 4DCPA 1K27A 3BK2A 1Z38A 1GPUA 2WJPA 4O1MA 3W79A 2G40A 4IRUB 1SBCA 2KW5A 2V9CA 2VPWA 3K0CA 4KE6A 1T36A 2WJHA 3QXSA 4J94A 4CMCA 3LXMA 4ZV4A 3OQHA 2QPTA 1ENOA 3C97A 2BGTA 4KTVE 3IVGA 3H5IA 5DIZA 4OI1A 3QWFA 3LLCA 4FYYA 4F8JA 3W8NA 3LT5A 2PLRA 2GJKA 3EIEA 3K4QA 4MRNA 2GVNA 1RQRA 3USES 4C01A 2G1JA 1Y8RA 4B7CA 3ED5A 4EM6A 4I08A 2GTIA 4E51A 3KXPA 3DLHA 3CEJA 4OFBA 4BNDA 4CCAA 5ABPA 3V8PA 4KE9A 3DE0X 3K3PA 2CNKA 5HF5A 3LOQA 2H6EA 2AMVA 2J3LA 3DCIA 5KTRA 1C8LA 1YVPA 3K1ZA 1G20B 3N0VA 2CDRA 1G8FA 4Z53A 5DJ5A 1OD6A 3NALA 1UPUA 3M1AA 5EMJA 3R5XA 1CFJA 5AO9A 4JCOA 2R4QA 2XUOA 2ZU0C 2YXPX 3BBPA 4GXTA 4K2HA 4D8VA 4DIDA 1Z0SA 3PCXA 3RAFC 3S68A 3T06B 3PD7A 4MQEA 1GQYA 1H2ZA 2D1RA 4HWSA 4RDCA 4DQKA 4HNSA 5K09A 3ABOB 3H3FA 2XLBA 4LF7B 1Z35A 3U3MA 2ZJBA 2V4MA 3WGIA 2BAGA 3DAFA 5G1NA 5FPYA 1CJCA 1Z6PA 1JN0A 1IN8A 1U8YA 5BMOA 1M76A 1E9DA 2GSDA 2VATA 3DMGA 3QV1A 3TNYA 1RIFA 2LCIA 2JHPA 4CF7A 1BMFA 2CL5A 3FLEA 3LK7A 3M8KA 2QXYA 5AK3A 1DHTA 2NUTA 2IHTA 4X0EA 1SUIA 3FOAA 3T4XA 1FUKA 1FDSA 1QR2A 2WZQA 3SC2A 4JEIA 3ZNNA 1S96A 3MD0A 2AVNA 4TVKA 2RGUA 5AKYA 2PUGA 2EXXA 2QRJA 2JW5A 3HBJA 1Z73A 2C7PA 1R74A 3AEQA 1OYYA 1LSSA 3QPUA 4Z3KA 5BN4A 1YR1A 3KB1A 1E77A 3FXAA 3GRAA 5KREA 2GH1A 1DMSA 4ZOBA 4ZAWA 4B9AA 2VP3A 5A03A 4R2LA 5J2UF 1MW8X 4OBEA 2O1WA 1QIFA 1XLTA 3UPUA 4WZZA 1Q0ZA 3M5DA 5CHYA 5HUQA 2WA1A 4GP9A 4HQ0A 2OAP1 4JP1A 5A6SB 2B98A 3LXUX 4R2MA 5HFJA 2H4XA 2YASA 3HB7A 1VM6A 2XUDA 3KNZA 1GUAA 4HF7A 4HJRA 4Y6PA 4LC9A 4PX2A 1KO1A 4DRYA 5A05A 4WNIA 1G2PA 3X1KA 3FRJA 2F62A 1NW9B 4DARA 3KETA 2BKAA 1EFUA 1SHZA 2BKVA 1LC3A 5JNSA 4ISBA 1G21A 3C85A 2ZXUA 4CLEA 4IDDA 1M2KA 1W1WA 2M6KA 3Q6NA 4QBKA 2VHEA 3IUNA 1RS0A 2A6PA 2A9QA 2XCOA 4NOJA 5CMLA 1NDQA 5J2TA 2PBRA 1D2NA 4YI3A 1S7CA 5LQSA 1M9NA 3S28A 4CUJA 3HXLA 1P17A 2GKGA 4P54A 1NDHA 4U8HA 4Y2PA 1NW5A 5AKEA 3D1JA 3OF3A 1DAMA 1FFXB 3H87A 3ZWMA 1RXUA 1MQ9A 1P4SA 1RW4A 5F52A 4ZO7A 1A8SA 5HEKA 4DCJA 3LL7A 4QTYA 4NZYA 2VPPA 3DBOB 1KPGA 2W2MA 2YC2C 3P96A 3WYCA 4Q1CA 1LUAA 3DD1A 1PW7A 5CVVA 1MX1A 2AKAB 2WE7A 4CMJA 4X20B 2R5NA 5L9AA 3RAGA 2WA2A 1SBYA 3PC8C 5CK5A 5U9CA 1ZD3A 4FGZA 1PFUA 3AR7A 1NTOA 4V03A 3FHTA 1BYIA 5I51A 2GA9A 5F23A 3SEZA 5LD2B 5JSYA 1QCZA 4R1UA 3ZZ1A 1Z6GA 1DAIA 4D4GA 5A2GA 1ABBA 2PKEA 5AQEA 4QYMA 3DZHA 4QYIA 1Z16A 1AY0A 3E0XA 4Y30A 1Y4SA 2I1QA 5EKXA 1RTTA 3DFZA 2A0KA 1YUNA 5IZ4A 2ZRNA 1D6MA 3JAWB 5KWIA 1W5BA 2GGSA 3Q9SA 3O8QA 3CLSD 4UVIA 4KP7A 2DMRA 4Y2JA 2ZSIA 3AF6A 4FP9A 2IXEA 4X7PA 1QQBA 2ZJ3A 4IHKA 1A77A 5HJ5A 1VL2A 2JVJA 2JZOA 3WGNA 3DDNA 5EA2A 1ZHHA 4GQIA 4FKMA 4Q7EA 5G0TA 2XNHA 1RWXA 4DXDA 4EG3A 2CW5A 1UR5A 1XKXA 3A1FA 1A9XB 4YMUA 5IUJC 2XBUA 1J1ZA 1OWPA 4X8LA 2L42A 1X9IA 1A8UA 1XZHA 2DQ4A 4FSXA 3IAFA 3G85A 4NMLA 3PC3A 1AG9A 5COAA 3RI3A 4F93B 3FDJA 3DEYX 3PTLA 5LMNB 1KQPA 5FI5A 3LPAA 4M0DA 4HTFA 1RRFA 2FPSA 4LJ6A 4QSHA 1BRMA 3FWPA 3P1JA 4R1PA 5DK4A 2CLHB 3ZD6A 3FUTA 4OHPA 1P33A 1Q7RA 4QDTA 2YWXA 3MVEA 3E8MA 1PX0A 1VDMA 2ZP1A 1U0JA 3NRJA 4FEGA 2HADA 4LE0A 5GVSA 4FQ7A 1GUDA 1O94C 1M2FA 1LLCA 4IUDS 1JHVA 3DL7A 5B7GA 5HKOA 1RQ7A 3I04A 1NC1A 3WDSA 2C9OA 4H4DA 1TYZA 2COKA 2X58A 1QH9A 2DLDA 3OLXA 4JFAA 5DF1A 2XMZA 1CULC 1JEAA 4HKTA 1P45A 1J70A 3OO1A 5ERYA 3SN6A 4XR4A 3WGYA 1H2BA 1JXOA 3JAMA 1D4FA 5FUYA 3U37A 4JL6A 4E5VA 1L7MA 4H0FA 5KYGA 2ZBGA 2YXBA 3FJYA 1J06A 1ONBA 1A4IA 1ZK3A 3A58B 3N28A 1G6Q1 3PR3A 1YRWA 3SYLA 1IY0A 4B32A 2R7LA 4QTTB 2GO1A 3B5JA 4GQAA 4E5UA 3N8DA 4XX0B 4OJYA 2C88A 2Q28A 3PK0A 1MTOA 5D2CA 2P7IA 3S8YA 2SKDA 3S99A 4ZJUA 3OEHD 5EEGA 3UT5A 4LW8A 4TGLA 2ZI7A 1MT0A 2GARA 4TN5A 4B3DA 1M1YA 4FZRA 4NKRA 3V4LA 2I8AA 3DUFB 1FU4A 4P4GA 4Y6OA 3FLAA 1DIGA 1MJFA 3DH0A 3O3OB 4R68A 1J1IA 2NZVG 3BL8A 2WJ3A 2Z2XA 3C98A 2QV0A 4D9HA 1C41A 2VJAA 1OBCA 3WYFA 2OK7A 4HRYA 1F06A 1KMHA 2BC9A 1LPMA 2OWEA 2OSBA 3G5UA 1SBTA 4MWCA 1GPWB 2I91A 1K0UA 1U3GA 2HTFA 1HKHA 1PYOA 3T7SA 1BVHA 3DVAA 3DHWC 3CN7A 1FP6A 2XUPA 3VC2A 3D2CA 4UUQA 5KQGA 2JFXA 4LDRA 3AY0A 4PCLA 3PNBA 4MXDA 1YZNA 3G0HA 4Q9DA 3MCTA 2IOYA 1S3SA 4QJBA 3BJMA 1CEXA 1MGOA 1YVDA 4CMIB 2GHQA 4X1IA 1F0KA 1N6NA 1SU6A 2W6OA 1G16A 4MR7A 4Q6WA 4CEIB 4IF6A 4K0KB 5EFOA 2P0YA 1R6AA 2JNWA 2AN9A 3RS0A 1Q0LA 4QU0A 1YRBA 2IYXA 1JZQA 4RZ3A 1Z12A 3QUBA 4UHEA 3V4ZA 1XEXA 4B1FA 4RJ2A 1L6IA 2JCSA 2X23A 1MFPA 3O9ZA 3MT0A 1G21E 2P7HA 4ZRNA 3F73A 1Y4AE 3JPWA 4KL8S 2OO7A 1YE5A 2PYDA 3EIFA 1QGYA 4WZBB 1FTSA 1UWLA 3RBZA 3RIXA 3GLFA 1Y1QA 1C29B 4HWOA 4IIBA 1L1RA 2Q6IA 1UXJA 3MWKA 3NTUA 4J6EA 3ZCRA 1AM4D 3O03A 3TGPA 3G2QA 2P8JA 4UMFA 2PX5A 3DYBA 4QSMA 3ZPXA 4S24A 5DNYB 4ED9A 5I9NA 2YX1A 1I6KA 2G9QA 4BKRA 4DTCA 3V7NA 1SUDA 1NQAO 2CKMA 4G5RA 4YRPA 1JTVA 3VMFA 2HJWA 1DJOA 3PUYA 4JITA 1JSCA 1ZNYA 1R0RE 1X86B 1I51A 2I0FA 2Q0HA 2Z4TA 3OY2A 4KXXA 3U13A 2XX3A 3GBSA 5HDQA 2DPMA 3LY9A 1JKJB 4R3UC 1A9ZA 3BIWA 4NCHA 5JNRA 1M83A 1E89A 5KNCH 2NSHA 3E9QA 3N0RA 4LZNA 1GPMA 2GM5A 1LDEA 2P2CA 4NCJA 4OX9B 2MHCA 2WD7A 4M0FA 3X1YA 5D00A 3SFVA 4S1OA 3W2EA 4BFWA 2F8LA 4EJ0A 5LFAA 3IEVA 1UMBB 4XH9B 2XTAA 2QUKA 2W2XA 1RZVA 2QZ4A 3PXXA 1R0XA 2ZUSA 3IT3A 4L2IB 4MA5A 5DE3A 5EJ8A 1C81A 2BW0A 3QMWA 4BZXA 5A5FA 1PCXA 2QAGC 3TMYA 1QM5A 1RAIA 2Q62A 4F4UA 2QTAA 3MWGA 1ADBA 4J2HA 2D3WA 4N9QA 5BNTA 1RLMA 2VHJA 3QU5A 3ZWVA 4P58A 4ER3A 2Z43A 4DJ5X 3DZCA 1D2RA 2FPUA 1MXHA 2R7NA 2R87A 2IW3A 4KG7A 4MVJM 3NM4A 3A4YA 3QI7A 2W58A 3KSDO 4HAOA 4KFRA 4QQRA 4FOSA 4DJTA 3R74A 3EA5A 4UBLA 1EJ6A 4NP6A 1MGPA 1Q22A 3IAUA 1TPYA 1Z06A 2YWRA 2O06A 5C9ZA 1XXHE 1ZX1A 4C1NA 1NL3A 1PUXA 3QKSB 4U6SA 3T1QA 3ZXUB 1KAEA 5KINB 5PNTA 1Q83A 3QXHA 1N3LA 2GRUA 2VDMB 1WTCA 3U62A 6LDHA 2OZEA 3E58A 1Z6TA 4LMPA 5J4KA 3NDBB 3TTSA 2XDYA 1RT9A 3IXMA 5EEHA 4CM9A 5T64A 4UTNA 1RHJA 5K3SA 4JP5A 4BYGA 2JH3A 1Q2XA 4C03A 3PNKA 1U0BB 3ZU4A 4X9XA 4KYUA 1JBEA 2EGHA 4LJSA 3WMEA 3A1VA 4M1KA 1SIWA 5KOHB 2CYBA 3UMMA 3KZMA 4PYNA 4TYMA 3OKPA 1ZA1A 3MRXA 1CNFA 3QG1A 3O3NB 3VXKA 2R1VB 3CIOA 4K26A 5ITWA 3OY7A 5G1OA 5I9MA 4MVCA 3F1KA 4C2UA 4NECA 1TO1E 4LE1A 1S02A 4JLUA 3LO5A 4PSKA 4E2XA 3RVKA 3U1TA 4KQ6A 2PO7A 3FDFA 1UWCA 1X14A 3E48A 2BLLA 4YH1A 1QG2A 2O5RA 2OKCA 3ZV4A 1YOVA 1WV0A 2R6ZA 2P41A 4IJUA 3BFKA 1Y4DE 5EGSA 4JJZA 3RODA 3MUEA 2E4ZA 5IN5A 4CETA 3K2BA 4I5DA 4J9UE 2V7VA 2ZIWB 4LZZA 3M89A 5ALWA 4XSHA 3PEYA 1YKFA 3GJRA 4ML3A 4JB3A 4R0MA 4IFBA 4P0PB 2HYIC 3TRIA 3PFGA 4IR7A 1Y48E 2WK1A 1YJXA 4PQYA 5IAEA 4B83A 2F1KA 3ABRB 1Z0ZA 4MIEA 1H5NA 5IUKC 2ZUEA 3O8LA 2ZG6A 4X3OA 1CF4A 3DMDA 3AY7A 3PUWA 3GDHA 4RIGA 1I6LA 3PVCA 4YHBA 4UZSA 1X3LA 5CGZA 4N5MA 4LKOA 4YRAA 3IR6A 4MULA 4W99A 4YA6A 2ZJZA 1WPQA 1VPEA 1F9AA 3CT4A 3GMTA 4MAAA 4EK9A 1WQ1R 2CVZA 2AUNA 1J21A 3I5AA 3WZMA 1WABA 2F3SA 1EUCB 2XE4A 1BEZA 4OHUA 2P91A 1PZXA 1MVOA 1G59A 1X92A 4J43A 4WH0A 1PD1A 1EM8A 5LXTF 1F2VA 1Q92A 4AIRA 3C39A 2Y93A 1MORA 2KPOA 5F73A 1XJWA 3V2IA 3B6JA 3PXEA 1GLNA 4ZOEA 5FOWA 4JN6B 4YRJA 3P0RA 2D7JA 2E5WA 3A10A 3DQPA 3FROA 4WN3A 2I4OA 2HCJB 2NP7A 3HKBA 3B1YA 1H2WA 2HV8A 3MRTA 1N1DA 1GA4A 1WXWA 2ZIXB 3LBHA 5CYFA 3LWNA 3IILA 2ZUWA 1E18A 4C6RA 1I9GA 2HUNA 2XAUA 5HUHA 2GILA 1NQOA 2FSFA 5TXGA 2QSJA 5B6IA 3TNFA 3JU3A 1OC4A 4PNEA 1PVDA 4ZEXA 3TSYA 3ORFA 1U0LA 4HAVA 2IPNA 2G7MC 4BKPA 3FUXA 2QVXX 2X6RA 2WP8J 3VZBA 2R84A 4RTMA 1AKTA 3GLFE 4BX3A 4CLOB 2YY7A 3N0TA 1EXNA 2O0HA 1YS4A 4QBHA 5C8YB 4Q82A 3S2EA 1Q77A 1YZKA 3JRXA 2IGBA 4N47A 3KVVA 4L7VA 1B16A 2Z04A 3JARB 3SGLA 3I6QA 421PA 1E9EA 2NU9A 2OXIA 3RBAA 3WWPA 1WY5A 2XCLA 3AQ4A 4CEHB 1O5TA 2GUWA 2H1OA 3RSQA 3KQHA 2P9FA 1K89A 3QVWA 1AQ6A 1HV8A 1W1IA 2Y4OA 5DNWA 4OHYA 1AKEA 1YE3A 1AQUA 3JWPA 3KR0A 1X1AA 5ALZA 4BIMA 1TM7E 5CPFA 5AVTA 5IYZA 3NU1A 2P90A 1Q20A 3B6EA 4J6FA 1JS1X 5BVGA 4NDAA 3OTWA 2VTEA 3U4MA 1Y8RB 3I76A 4RLQA 3T7JA 4ETNA 4G67A 4RACA 4HAYA 5H16A 1XWFA 1GSIA 1VPVA 3NIWA 1LI7A 1JFVA 1M0WA 1W2GA 4Z0TA 1Q6YA 3W0LB 4UNRA 2VDPB 5TV2A 3HYCA 3PEEA 1W0KA 3EZ6A 1QIEA 1KJJA 5TRTA 1IBCA 3RSSA 3OQ1A 4YYEA 2ESRA 5K8JB 3WBBA 3ITEA 4BLUA 2ZCJA 3NPAA 4MW7A 4ENSA 2PVCA 4QC2A 4CIAA 1FDRA 4UE2A 4QUDA 2UAGA 2W8ZA 1E79D 2ZETA 4MQEB 3IQIX 5LDDC 3I6IA 2BFBA 1Y5IA 3AR3A 2Q8PA 2XMBA 4UHDA 5EP4A 1M5UA 4G89A 3B85A 1MNAA 1E3QA 5K6TA 1QTIA 1E9VA 2OO5C 4F6CA 1XMXA 2J9FA 3INGA 4YDQA 3GLTA 1VFNA 2YVAA 1ZI9A 1L7QA 2NUTB 2ZE6A 3K0HA 3WLLA 5JFOA 2XA1A 4EI2A 1XZJA 1GTRA 4BU0A 4DRZA 3PUXA 1ZN9A 1Z6QA 4A4DA 4CLXA 1Q44A 1OVMA 1YVUA 3L6OO 1KARA 4TLDA 3BD8A 1CY6A 3C0KA 5DLPA 3CVYA 4QG3A 3PHBE 3SK0A 3H1PA 3UT6A 2FEXA 5BN4B 4AZ0A 3JVDA 2GBIA 5IKOA 2Z6UA 2Q3DA 3BREA 1XK7A 2C5EA 3HBAA 1C30A 4PFKA 3TSZA 4DXAA 2QUZA 3PBKA 4K6FA 1E9BA 5JBNA 4TLEA 4YB8A 1D6JA 1QK3A 3WA6A 3L4KA 3W1EA 3UEOA 4N0QA 2ZRAA 2ZQ5A 1SZDA 1LVGA 1P4JA 3IHLA 2Q9CA 3D6VA 1ZKMA 5ISMA 4V1CA 5ECDA 1JIUA 5KYYB 5E3JA 2YUTA 2YHSA 3D6MA 4G85A 4N7JA 5JJCA 3TLZA 5AM4A 3MHPA 3NJ4A 1DJMA 2PZFA 3N9IA 4Q3EA 1KZHA 2JANA 2CCGA 3QSGA 1UZNA 2OXEA 2WZDA 3V3KA 3PI6A 1G64A 1XZPA 1VL0A 1KI6A 2I6FA 1A1SA 1XZEA 5KWVA 3QFSA 2J07A 4FONA 1JMKC 1XVAA 2VLIA 3CTMA 4A0FA 1MV5A 2I71A 5EXPA 4ZICA 3U7HB 1TQ2A 2BDTA 1E3DA 1KVRA 3VGJA 1ADJA 1Q74A 1ZUWA 4YAFA 4LFCB 1KMIY 5J2TB 3EGDA 3N05A 5DH9A 1JA0A 3DPIA 1M2OA 3EFEA 3NEAA 5DP2A 3TBFA 4BRSA 1FDUA 4F9FA 4LXTA 5KU7A 5GJCA 4E21A 1YVRA 3F98A 3RNLA 3AKZA 2R48A 1ZW1A 1T26A 3TRHA 4F84A 4KQCA 3RUCA 3BRWA 4YMSA 1ZFNA 3U3JA 1ORRA 1UDAA 3CMCO 3R7DA 1U2GC 3EG9B 3TEMA 1MB2A 4OQZA 2BFCA 1LBHA 3AX6A 4D9EA 5JJBA 4HQOA 2R7KA 4M46A 3K4HA 2C3MA 3CO0S 4BC1A 3HXKA 3T34A 1XVLA 4HXGA 4EG7A 3ODPA 5CFPA 4S04A 3P2MA 4YUAA 2DSNA 1DC4A 1XYYA 2PJDA 4OKNA 1BVYF 4WWHA 4AG3A 4DIUA 3PUZA 4MO9A 2GFHA 4E03A 4BO0A 2IHYA 3PNYA 2CY0A 3CW9A 4OOEA 4BO9A 3H3XA 1CRLA 1D8TA 2OOKA 3BXZA 3NASA 1FS4A 3NT2A 4RMNA 3TW4A 2NV6A 1ISFA 2F9FA 4QYIB 5TNXA 2DLCX 2PLFA 3N7UA 4TSRA 1MH1A 1U02A 3GQBB 4PIVA 1WR8A 3KEOA 3ZU5A 2R47A 3NHRA 3EH1A 3UMSA 3N58A 4K6KA 4L8WB 2WDZA 1ZN2A 5E9WA 5A2QA 2NIPA 1I32A 2Q5HA 3KUUA 5J4LA 1EX1A 5KTKA 1NYRA 1OZ0A 1XLWA 2A9JA 3AXTA 3H5RA 4LXHA 5JQGF 1UAAA 4R2JA 3I2IA 3R0IA 3VA7A 3UMYA 2RGEA 3E9DA 1GSAA 1TQ8A 4AZTA 5A4MS 1PW5A 4J1QA 4G4GA 2C42A 2FMTA 4B7UA 3UOWA 2RD2A 1XXHB 3QPAA 1AZSC 1ESCA 3ZYCA 1BS2A 1RADA 2QU7A 4B75A 4GXNA 4BFSA 4MV5A 3L8GA 3QWHA 4B43A 4NX2A 4HEQA 1LJUA 2GZ3A 4LRXA 5BR4A 3JWEA 2KQUA 4FZVA 3QW2A 4HDMA 3LW8A 3IODA 4KREA 1QLJA 1VKOA 2AI2A 4JASB 4X1OA 3S3TA 1NT4A 3VO1A 1Y6GA 3UAGA 1UC9A 4JT2A 1RWOA 2HSJA 4UC0A 3FSGD 4UULA 2CNDA 4RQBA 2EZ4A 3DTVD 3KZKA 3R20A 4LHSA 2UXCB 2A5DA 2JAWA 3QY9A 4QU5A 1IHOA 4FHZA 5E0KB 3LPMA 3QFCA 4KO8A 3GHHA 1A98A 2X9GA 2GBLC 2W2LA 5EIBD 3WP0A 2AOWA 4LRSB 4MW9A 2I4RA 4WZAA 2M2IA 2JJ8A 1H6CA 2O8NA 3ICOA 3EQ9A 4HBGA 1A97A 2D0OB 1BS9A 3WDKA 3OBIA 4LJ8A 5EJIA 4ZCSA 2A7QA 2I67A 1D4AA 1HH4A 1Y7IA 4WINA 5EINA 2OENG 5BWMA 1FXUA 4X8MA 3MB8A 2A67A 1E32A 5SY6A 4WY8A 4DCVA 1KDTA 4PHTA 4XOIA 4L4RA 2REBA 5IJAA 1KVSA 2OXFA 3KWJA 4P7GA 4MOWA 5JXHA 2IHBA 4DCOA 3LDAA 4NARA 1G41A 1UBFA 4Y0NA 2OFXA 5ESDA 2RK4A 1X1SA 2G76A 4EJ2A 5A0VA 5T6BA 3W8EA 2XNDA 3ORRA 2GLUA 2HQ1A 4PAOA 4ILEA 3TAXA 2O2YA 1VLQA 2BEVA 4JC8A 4EQZA 4GR5A 2Z5FA 4YDSA 1I5OA 3RLIA 3IAM1 1AKNA 2ZYSA 1E1DA 4OHFA 4X6UA 4B79A 4BX2A 4L22A 1NRJB 2A30A 3SJZA 4ZYWA 3P0FA 3TRFA 4OXYA 1PZNA 5C31A 5IAKA 3T7RA 1AHPA 2W2KA 1G1AA 1IE3A 1QF9A 1Z22A 4WV3A 1SEPA 2W11A 1OBOA 4JODA 2ZT6A 3OLVA 2O0KA 1ZOSA 3C7CB 3PD1A 2GK6A 2F3QA 3H2BA 3ONVA 2SCUA 4C04A 2AEJA 2VP2A 4AO7A 3AT1A 4NLLA 5E0OA 4EFKA 1NAIA 5IDYA 2JJYA 3D7NA 4RVUA 3AFIA 5AUPB 2N9UA 3HXPA 4UD2A 5ALPA 2CK3D 5REQA 4DWVA 1B2RA 5JYDA 1ZEJA 3BYZA 5KO2A 2KM1A 1A9TA 4ZQBA 1G1MA 2E4WA 3HRKA 4YJHA 1E2FA 1ESDA 2IEBA 2L19A 3BH6A 4IHJB 3TZLA 1D2AA 2QW0X 3TTTA 3FHCB 4WLVA 1SPXA 1BOOA 4RV5A 4ALJA 3I6ZA 5K3AA 2F7SA 2PZBA 1XEXB 3DLAA 1R9GA 3CLRD 3E0QA 5LM3A 2YHIB 3LI2A 3MFQA 4WI1A 4P2GA 3SYTA 2AJCA 5THQA 2XXAA 2CLKB 1PL6A 5KYVA 3CCFA 2O3SA 3DA8A 3NOVA 1CZKA 1X7WB 4PVCA 3OTGA 4US1R 4EDHA 2QN7A 2QRZA 1JEEA 4I4TF 4C4RA 1F8FA 1RIIA 2NG1A 1U31A 4FLFA 5F7JA 4JI5B 1FSSA 5JDCA 1AO0A 4H6WA 3CX4A 4KQXA 4MVJP 3CPHA 1UPXA 5HM8A 5FWDA 3O8RA 3P0JA 3KV3O 4B6SA 4ZHQA 1THZA 4M7WA 1COZA 3WAJA 1NUAA 4L9RA 3DC2A 2YN0A 4JQYA 2OZPA 3AC0A 4PQEA 3AILA 5IANA 4P4UA 1JDTA 1ZNWA 1ZW6A 2W4MA 1ULHA 2CFSA 3GR6A 2EL9A 3N5CA 3U4GA 4B31A 5AW3A 5JCPA 4QT4A 1ULSA 1JQ3A 1J49A 2DC1A 3IR7A 4NENA 5ALVA 5L6LB 2RJNA 5J5CA 4PX3A 2WD7B 2PKXA 5COQA 4ZPJA 3K5WA 5E1BA 4MQLA 5G0SA 1FVOA 2C59A 2XYGA 3KB2A 2W6PA 3I2HA 2WU0A 1FNDA 5LP1A 3B3FA 2AFIA 4TMWA 1YE8A 1UZLA 2E2WA 2AQ8A 5CD9A 2OBXA 2PY6A 5TARA 4U2FA 1MOQA 1Y37A 3CVUA 3H8WA 5KKCA 4F5WA 2WIFA 3U4DA 1B8VA 3S2UA 2QP9X 1IBRA 2V4UA 2I62A 4LTMA 3W9YA 2EKDA 4IHAA 5FLEX 3RT7A 4EABA 1EVKA 4XYEA 3RUHA 1XZNA 4HWKA 1AS0A 1Q19A 3D3NA 2FWIA 1TLFA 5LBTA 4P7BA 2F4VB 4HRAA 2O2DA 3PLAE 1VIYA 2FAXA 3BERA 3GUUA 1HUQA 3F6BX 4HQRA 4MW2A 4QL3A 1ZMOA 4RIIA 5DU2A 3WIBA 4BJ6A 5EQTA 2VPTA 4U9IS 5DEIA 1ADFA 4TV9B 1E1YA 2UXBB 1X39A 3F96A 1PYGA 4YWHA 2WFAA 1IHPA 1JXAA 1E2EA 1PEAA 2I3BA 4MGYR 1RWBA 3QE4A 2A4MA 1XTSA 2ZIUB 1PN3A 3KQQA 3IELA 1NG9A 1QBGA 2AFHE 1OILA 4Q3LA 4YJ3B 4IGKA 3NCHA 4N8SA 4D4IA 4JI2B 1QP8A 4WNAA 1O8BA 4LBVA 1FEZA 1OA0A 3ENQA 5EGNA 1OI7A 2WNSA 3QVJA 2AT1A 3CVJA 2IXAA 3PQ7A 4FM9A 1NLYA 4DV5B 3PEVA 5AVYA 3HJRA 1TKCA 2Q6TA 2W2VA 2X0IA 3AV3A 3TO5A 5C5CA 1JFRA 1ZIOA 1YKGA 2M1XA 1M2JA 1MJ5A 3WI7A 1L5OA 2JJ1A 3JWHA 2V5UA 4EPRA 1FTYA 2HPZA 1QXSA 1JP7A 3P27A 4FFDA 4DF3A 1R8YA 3P20A 4LVUA 5CVCA 4KTTE 1YIAA 3F97A 3HBMA 4Q37A 2OBYA 3RLFA 4L08A 3RUFA 2OAQ1 4DG5A 1YCGA 1YOVB 3VO8A 1K68A 1SA0B 2OORA 4GO1A 5EZ6B 2E4YA 3W06A 1CJMA 1AUQA 1C1HA 3KVYA 3DTNA 5FJIA 3W5AA 1CUDA 1Z07A 4GLBA 4RWZA 5HCUA 1O03A 4KO3S 1U2RA 3STUA 3VC3A 3ADPA 3HEMA 4XKJA 6YASA 1JVBA 1HT1E 2F43A 2QXTA 1IHYA 5E9QA 5F4ZA 5BO5A 3WQSB 4Z9AA 3AY3A 2Y0PA 2GK4A 1U9IA 3DM9B 4J75A 1GTG1 1G66A 1GA1A 2QTHA 2QN9A 2C99A 2XTMA 4IIEA 1QC5A 2WJ6A 3I23A 4ZPXA 2I78A 4RPHA 4UMDA 5G40A 3AW9A 4MIKA 2BP7A 5GV7A 3RSCA 4BO3A 5C1PA 1TAUA 1DS6A 1N2IA 2C4NA 2LXNA 1T9CA 4CNBA 2XNCA 5CVTA 3G49A 2PFSA 3EVEA 1HLGA 2B7LA 2FW6A 3FVQA 1SBNE 1CUWA 3KK0A 3R5HA 1DPFA 1XP5A 2C5GA 4QPZA 4AYTA 4C3ZA 2A14A 1KWGA 5DW3A 1WP4A 3L4BA 4C30A 4A15A 4CODB 4DCSA 1EM8B 1U2QA 3EDCA 2MSWA 3W1WA 3NATA 4F6RA 4I8IA 2BEJA 2QY6A 4ICIA 1YDFA 5H8WA 1PF7E 1KZGB 4X85A 3FYUA 3I3SR 3PDUA 1KFKB 4PZYA 3CE9A 3GZNB 2H9IA 2WZCA 3QBJA 4ZEMA 4C08A 3HKBB 1NNUA 5NLLA 1RFGE 2P2NA 2B61A 5A7HA 3Q2KA 1IATA 4MIOA 2C9CA 2D0DA 3U0VA 3QA9A 4OQPA 2X0DA 3WWYA 3QU9A 5DTJA 5H4HA 3TQOA 4ZD6A 5AW2A 2CJFA 4LHZA 3VR6D 5GAJA 2FZVA 2Q5OA 1JLLA 5KNLA 3R77A 4RC9A 3K96A 3ZIAA 1TW3A 1YR3A 3HUEA 4R1SA 2CFTA 2LR0A 4X41A 1Y8QA 2Q2WA 3MOIA 4IQGA 2CXPA 3WK4A 3U61B 1NI4B 5IDWA 1A8QA 2OTCA 2YC4C 3COYA 1FNBA 2E4AA 3HVUA 4EX6A 3UGKA 1ZGBA 2WWRA 2NU9B 3RC2A 5IZCA 1TAGA 1L8OA 3TW8A 4KNWA 3CSSA 1WXXA 3PFKA 1CUCA 3A37A 2O8VA 3K8QA 1QGUB 1AZWA 3DTYA 4R8LA 4EHJA 5AM2A 3OU6A 2Z2JA 3DDSA 3WYAA 4HYYA 2H59A 4A10A 4Q4JA 3SLRA 1B00A 2FZWA 3M6XA 3O7MA 3ENKA 2PZMA 1I8TA 2JIDA 4EJSA 2R8ZA 2B2CA 5HIIA 1EUDA 1FS5A 5H80A 2HRBA 1HSOA 1Z82A 1SQ0A 1EDOA 3DGEC 3VC1A 5BVGB 5BUZA 2PD6A 1VE9A 5CG2A 1XPOA 3NHYA 2AD1A 5DBFA 5K2OA 4MVJA 4GVPA 2AFIE 4DMHA 1JDZA 1KR2A 3CW8X 1C1DA 2QT1A 5F4BA 2VZEA 4Y2SA 4YAOA 3Q0IA 1Y98A 1S2NA 1L5YA 4P8RA 1NVWQ 1J09A 4UARA 2FSVC 3RYFA 4EW2A 2H2AA 1DBSA 3LUFA 4TMYA 1J6UA 1G5IA 2OD7A 3N8NA 2RONA 3L7IA 3D02A 1N4DA 3QRWA 1BIFA 3ADKA 2A0XA 2J30A 3N7TA 5KI6A 3U4HA 3COPA 2A9VA 3INRA 3WGTA 4ZJZA 2EJWA 3KB6A 4LYHA 1VGVA 1DHRA 1VRWA 2AMJA 4KWEA 4N54A 4W82A 5DVZA 4ZANA 3ROFA 3FVWA 5FBVB 1WS6A 4Y2VA 4BVKA 5H4GA 5IXYA 1ES9A 2YMPA 2Q46A 2GA8A 3OPXA 3THXA 4PU0A 3I62A 1XNHA 1DKQA 3KVRA 1C7IA 3G7UA 5KX5F 3QX9A 2HREA 2Q5FA 2RCYA 1E0DA 1PZFA 4EBFA 1N3YA 4TT3A 1YKSA 2XYHA 1P7PA 2VXBA 1RRPA 3O21A 4PYKA 2BM9A 2C29D 3O84A 3QV2A 4JJIA 4NPAA 2K2WA 2YNMA 2ZUBA 3CWCA 1NVKA 4BDTA 2JK0A 4H4EA 4ZT7A 1Z7BA 3RQSA 1GEGA 1M6YA 4INJA 3Q0EA 5JCOC 5AUOB 3KQKA 4EQ6B 4RTLA 2UKDA 3FBTA 1RJ9B 4A7PA 1H1TA 2Q3HA 2YWCA 3LHKA 3VOTA 1C30B 4TV8A 1PKXA 1XTIA 4FFPA 5C4MA 1CCWA 4XIIA 2RAVA 4IJMA 2W98A 1YCHA 1ZVQA 4LF9B 3K0KA 1I13A 4D9NA 4B47A 4KCGA 1R2QA 4ZVUA 2EGUA 1WDKA 1DEAA 4GEKA 4V1CB 2HCFA 4FDMA 3ANTA 1E60A 1X7XA 3F5SA 1E4EB 1Q7GA 4HLDA 4HYQA 2PIDA 4MHSA 2HMAA 3A6GA 3GMDA 4L4XA 1J9GA 1PG0A 3DWGA 2RB5A 1T5HX 3QFRA 3OCXA 1CLUA 1ODLA 4UNNA 6CHYA 5EIOA 1CQIA 4WLNA 3BCHA 2QZPA 3RFXA 3BSSA 2JBHA 3L18A 1NBMD 1JDJA 4QEKA 1ACJA 4G56A 4E5SA 1IN6A 4L8LA 1VYHA 5FI3A 1SOMA 3C14C 4GUDA 3PR1A 1ZRHA 3P5SA 2O8EA 2QX4A 1A82A 5ESWA 1M2OB 4YAIA 3DNMA 5IKMA 5K6AC 3HA5A 1XCPA 1N6HA 2HNKA 1Z36A 3G0CA 3LCVB 1WCV1 1B3BA 1XHFA 2Z1MA 2A92A 2DPGA 4W9NA 5B57C 3DEKA 4GI3A 1JB9A 3OZBA 2HF8A 1BCRB 4GZ6A 4PAQA 3S1AA 2P69A 4IV8A 1VCIA 1GG2A 5AYVA 4YWJA 2BFCB 3KR1A 3JY6A 4R05A 3JQAA 3LQ1A 5U1PA 3M70A 2EBUA 2YWHA 4ZVRA 2BBWA 4XM0A 1KYXA 2HK6A 1OT3A 1I1QB 4LYFA 3KUKA 4ZVQA 2X2EA 3DOFA 3GCWA 4DNOA 4DCTA 3QEBZ 3EMDA 4MUEA 4GQBA 2AHRA 3ZDXB 4IUBS 1I1OA 4JV5B 4J0CA 5MN6A 1VTKA 1U28A 2FPIB 3TBKA 4URZR 3N75A 3OPQA 2XUKA 2PD4A 4RY8A 4BX0A 2AGVA 1D0VA 3QHQA 5BWOA 3QHPA 4B80A 1GR0A 1G0NA 1NRXA 2QG4A 2VKTA 3WISA 3ZWNA 3GYBA 5A3RA 1U8EA 3QJGA 1VYUA 3GRRA 2AQKA 2X2PA 1WLYA 3NHLA 4DYDA 1K9SA 4FYMA 4EEKA 4AUNA 5FX2A 2P3LA 2X8LA 5A0TA 1QGOA 3A9CA 1LLQA 4KQ9A 2XB8A 1LXCA 2NACA 4L0DA 4GXQA 1I4DD 2CHQA 4KVGA 2PH7A 5TDHA 3VPAA 4B82A 2R6GA 3ONDA 1H3EA 1MJGM 4TKZA 1PQWA 4B45A 2BDEA 4PLFA 1X15A 1L7OA 4DWJA 2XZDA 4EDFA 1DV2A 1RYBA 1I4TD 2RHJA 3L07A 2K7FA 1YIOA 3I4FA 4ZQHA 5EKDA 3KV1A 2REOA 4EHAA 3I58A 1WSAA 3OJEA 4GS5A 4B34A 1U3DA 2KBFA 1RWKA 3DG9A 1KVTA 3VNBA 3HLYA 1QBKC 1X9GA 4Z2YA 4AY5A 4CW7A 3K6RA 4Y1RA 5HMLA 5SY9A 3ZW8A 1LSOA 4R71A 5ICMA 2AWOA 3TPCA 2F59A 2VYFA 4NJMA 3VQTA 3VR5A 4LHEA 2XUHA 5ECGC 9LDBA 2AFHB 4LXIA 5I3CA 5TPZD 4EYKA 2XVYA 2ETVA 3A3NA 4ZU1X 4L85A 3GRYA 2JDID 1YNOA 1YDHA 4DIMA 1DUVG 5H82A 3TMKA 3K9CA 3AEYA 4B3XA 4HPXB 3R5SA 4KACA 3IKTA 3BKXA 5IABA 2JI7A 4D45A 4GIBA 1C9EA 4MVJE 1HXHA 3FA2A 1BE6A 2LRHA 1II8B 4ROSA 3R7LA 2HCBA 2YJ4A 4G84A 3ZHBA 4L9SA 3W7BA 3WLRA 4XCVA 2ZZNA 1YS6A 4M8KA 3LLSA 3UGJA 3DMYA 1KJQA 1ZVJA 1S8FA 2WVGA 3AUFA 3B1WA 2J5KA 3OO0A 4H15A 4IILA 3BRSA 3BBLA 1ODTC 2KLHA 3DULA 3FDZA 1QUEA 3O4RA 1AHHA 4HH3C 4PGMA 3T9FA 1J33A 2ONYA 1YJQA 3S0JA 1NIJA 2V6BA 2OILA 1ZIPA 2CZGA 1TA9A 1I80A 3CS3A 3CF4A 3EGOA 4G8BA 4FPXA 1GKUB 1WD7A 3NWJA 2GCEA 4LDZA 5AQ1A 2JFZA 3HC7A 3VYWA 3MBOA 4IIJA 3ROGA 4CGYA 4RHCA 2CNLA 2H00A 4U00A 4GWLA 4KRFA 1N2SA 4ZYTA 3EUEA 2BEVB 3MMSA 5SZJA 3HCEA 4LPKA 4OREX 1YUBA 3TCNA 5F3WB 4QWWA 3WL3A 1IXZA 2GCIA 2ZXEA 1RE0A 4UHHA 5DNAA 2LIPA 3K32A 5FO1A 3Q7TA 5FULA 3DAPA 1YRQA 4TRJA 4CXMA 1FFHA 3LY7A 4D8UA 3DZFA 2QMUA 4BFUA 2FKNA 4UEOA 1J8MF 3U49A 4XWAA 3TL2A 3NTVA 2ISSD 3HDVA 3TWOA 4ADSG 1KY4A 1Z0JA 1L7EA 4X66B 2D00A 2IU6A 1VL6A 1PGOA 1S2LA 2Z08A 3D8TA 3K0CC 5BNFA 1G8SA 4KWHA 1ST2A 4O4HB 5JUWA 3QENA 1IK6A 1O6BA 5F2KA 4ZTUB 3OU2A 4PTYA 3R9XB 3HPQA 3P9YA 4JP3A 2ECPA 4PYMA 4QT0A 4ZI3A 1W7AA 4OXRA 5CFQA 2V03A 5KYXA 1C7JA 2GSWA 4OK5A 5AJHA 3VHLB 1GJRA 2QIPA 3DDWA 4H9GA 4KQMA 4WFJA 5DOVA 4E4TA 1QHSA 3U56A 2WF5A 1ZYUA 1UINA 2WJ4A 1SC9A 4P98A 4YS6A 4AYWA 4J0FA 3BS4A 4QEZA 1ZK4A 1IEVA 4IRMA 4N8EA 2V7PA 3IDQA 4FE7A 2AN3A 3BHIA 1R4NB 3HU5A 1KPHA 4NR0A 5EERA 5FOVA 5P21A 3UENA 4MQ4A 5KSOA 3CVOA 3MPOA 2BR4A 1MD9A 2RHLA 4GT1A 5KQPA 4JUBA 4ZREA 1ISRA 2ATXA 3K5IA 3P2KA 2I2CA 3R9WA 4BGIA 1JL3A 3LWZA 4TKVB 1F4VA 2RAPA 3OPVA 4PIMA 3GJ7A 4JVLA 4LOHA 2NQTA 1KYZA 2AMYA 4YJ2B 1CNMA 5IEJA 3HCNA 4LV5B 5GGXA 1KEPA 3CEAA 3DZBA 4FWIB 3RDPA 3TFWA 4INZA 3TEJA 5JSZA 4OL9A 4BTLA 3OZGA 4RHTA 4ZHQB 3RWMB 1T6ZA 2VDOB 3L8FA 2A5JA 4Q3KA 1KVQA 4PVDA 2JVKA 1X1CA 3V55A 4DSUA 4FHGA 3C5WP 4D57A 3FAZA 5HSGA 2EX1A 4LJ5A 1E9RA 5T6MA 2O0MA 4MRMB 3B6ZA 3RHSA 1N1MA 3IPXA 1I0IA 3ULKA 1JHRA 2XYVA 1JHOA 1ONOA 4NENB 4EI7A 4F4HA 4PM4A 3WLEA 2V3CC 4NXNB 4KPUB 4I2NA 4MGHA 3T4UA 1MKYA 4N6GA 1C7QA 2VF7A 2X19A 4OU5A 5KYWB 5D6OA 3SBXA 4A8TA 3RYCB 2GD1O 1Y3BE 2WD8A 5A4KA 4S05A 2ASEA 1AK9A 1C0PA 1KIAA 2W48A 2QL7A 3PQDA 3WP1B 3A6PC 2ZDQA 2OCPA 3VPBA 4X6YA 1SC1A 4QDOA 3C8ZA 3OZWA 2CLFB 3DBVO 3QG5A 4ND3A 4R6XA 1DEKA 4JBWA 1VOTA 4LF5B 1CZNA 2G09A 2WF6A 1BSVA 1VXOA 1P7CA 5LIRA 5EIHA 1Y82A 2BCEA 4HGRA 1E92A 5FNZA 2QTNA 5K3FB 5TB5A 1E3TA 5IAOA 2X5OA 3BVPA 3DV0A 3NTXA 2Q9BA 4MGIR 3JQGA 3TZEA 1KORA 1U0FA 4GI5A 4DUPA 1NY5A 4LDAA 4TWZA 2QOEA 4LZWA 1QAOA 1OFVA 4FYHA 8ATCA 2A9OA 4FFVA 1V71A 4CM8A 4D3SA 1HL7A 4DL9A 2GEJA 3ETNA 3LC7O 3C4VA 1Z5UA 2Q5CA 5JPCA 2IFTA 1Q0HA 1DRWA 2JEOA 1ZMBA 5F64A 3WX0A 4D46A 3KB8A 4YAUA 4RL6A 2Y92A 4C5AA 2E1PA 4OUDA 2EIXA 1SZCA 2CC2A 1A88A 5LA6F 1UPTA 2NAFA 1G8KA 2XUFA 2COUA 2GAJA 1P75A 2GPJA 2Z30A 3BWCA 1W36B 4ALKA 3A1UA 1V25A 3RK4A 3HCPA 1RYDA 4HI0E 1QFXA 5LYJA 1Z4QA 1FC0A 1UM8A 4OLBA 2YOHA 5COBA 4MB2A 1PJLA 4EI9A 1C3LA 4QYWA 1PD0A 3LRPA 4Z9FA 1SZPA 4JUAA 3TG2A 1T3HA 2IODA 4GRIA 4JT8A 2VNKA 4MTCA 1F2TB 3BMQA 1FRFS 1SGWA 1D07A 3S70A 1KO8A 1OJLA 4P2BA 5T3UA 2FEOA 4P33A 3WYNA 3O2QB 1N5IA 3IQXA 1T4BA 4GDFA 1DAGA 3NGMA 4QNNA 3ZHYA 5AW1A 2H8GA 4YAGA 4YUZA 4U7PB 1GILA 1OTXA 2Q2QA 3VR4D 3OFVA 1SVIA 1KBZA 2VPIA 3TOCA 3ZY4A 4E6EA 2WU3A 3PDJA 4E33A 2YXDA 3ANXA 3GPBA 5DXAA 1NUSA 4A6PA 1V8FA 4N3GA 3AHIA 2Q27A 4V0ME 3RAEC 1O4VA 1SCQA 1RZUA 3NAQA 1BFDA 1FBTA 1IULA 2ZEJA 4CR7A 4C7MA 2ZTSA 2Q7DA 2WF7A 1N0HA 3CSDA 4QOHA 1NNLA 3HKDA 4HQFA 4OB8A 2G6BA 4P3KA 3GVIA 4L5IA 4UTOA 3KKZA 4Q9NA 4TWJA 5EXXA 5EN4A 4DC1A 4EELA 2X14A 5BYKA 2XWQA 3NEPX 4UCXA 3OP4A 4RD1A 3IEIA 1MVLA 2FYTA 3ZY5A 3OURA 1W0JD 2PMBA 4NYMR 4GLJA 4ESOA 3B7WA 3KO8A 2VZ0A 4KUHA 4KBFA 4HUJA 2J0VA 3EXEA 2GESA 2AZMA 2QJRA 5C46F 1NULA 2F17A 3I28A 3B7GA 3IAM6 1XZMA 3OE7D 4L8FA 5DTIA 4C05A 2YMQA 3JS5A 4ZGBA 1RAGA 2OPBA 2AJLI 1UJNA 1UF9A 1PWEA 4AS3A 5JAMA 3K2QA 2JFYA 7ABPA 4FK8A 2C8LA 1FXSA 1LJ8A 1S01A 4HFMA 4I55B 4MEJA 2PSFA 2FUG1 1KK1A 3X2SA 3FYUB 1OW3B 4ZGWA 1AU9A 1E8MA 1HDOA 5I01A 1NRIA 3KDSE 2PLAA 1H2RS 4N3BA 5JTUA 4AVYA 2VDJA 2H2IA 5CX1A 5JAIA 2WPNA 3SHFA 5K4AA 4D25A 5ARDA 2EG5A 3GEHA 1MHPA 1PBTA 3V34A 3MWDA 5A5DA 2C98A 5IH3A 1LCIA 2Q1TA 2QLFA 1LPBB 3OIDA 1PFWA 2FWMX 3BEDA 1R4MB 3OWOA 4Q4HB 1D0SA 4W5WA 4PPGA 2VHQA 4LMRA 4ZEVA 3P7MA 1C8BA 4PO3X 3RC8A 3A6DA 4WN9A 4Q7KA 3TTXA 1U1FA 2J5BA 1TU0A 2O7VA 2R1TA 5K0FA 2WINI 3IE0A 1I7QB 1K06A 3R0XA 2PXXA 1IQ0A 4JX8A 4WPGA 5F9MA 1UKBA 3VVMA 6REQA 3MJSA 1RACA 3MW8A 2WJIA 3AUUA 4YRTA 3HJNA 3NDJA 1QUFA 3NDRA 3WIVA 4ANFA 1JR3D 3L04A 2A57A 2OA0A 1A8PA 1G3RA 1K7CA 4FR5A 4I50B 4KO1S 3DF7A 1D03A 4ITVA 2ZBDA 3I32A 3QKIA 2QM7A 3TX6A 3TW8B 3ZI0A 3ZI7A 3TF5A 4R1NA 1J56A 5HP4A 3ACDA 4X65B 1WZ2A 3K71B 3SYMA 5IHXA 4RDIA 2V7EA 5ENDA 2CFRA 2VK1A 1VSVA 3KHKA 2JAUA 4KV9A 2IDMA 2XWBF 3FFBA 1L3BA 4RM2A 2X9NA 5KNBA 4HMPA 2RIRA 4MV0A 4XVRA 4EJSB 2A0WA 5EHQA 3W6PA 5J2UA 2B8TA 4MUMA 4E5NA 4EW1A 2D5AA 1F0YA 1LS6A 2Q4BA 2G6TA 3BFJA 4GECA 4GYWA 1D7OA 1GYPA 2DE0X 3MC1A 4CVNA 8ABPA 1PLKA 2NUPA 5DN6A 3T1NA 1ZH6A 2NZ2A 1C1DB 1XLUA 1WV1A 2PVPA 3OTOB 3FB4A 1T2NA 3JR7A 2XKJE 3WGUA 4ER0A 4JA0A 4A5SA 3RYFB 4PRLA 1ZCAA 3N8HA 3RRJA 2OQIA 4MRSA 2HQRA 5J2TF 1FOEB 2WIGA 5CBPB 2G82A 1DAEA 3CG4A 2BUAA 3H2SA 4BVBA 3NKVA 3P4YA 1VKJA 2IOFK 1N8KA 5CYPA 1QX4A 3TOVA 2XQVA 4BB6A 4C6TA 4CMHA 1FXWF 1R5NA 1T2DA 4UU7A 4IV5A 2JIZD 1IOLA 2KS6A 1ID1A 1S2MA 2Y1KA 4MWTA 4NBTA 4WFIA 3WMWA 2RG1A 4Z86A 5MHTA 3Q3CA 1JA9A 3MGBA 1S2OA 4Y2XA 3HA2A 1VMIA 4W1PA 3GLHA 1CVLA 4X64B 1CKEA 1XDSA 1RRVA 2Q6KA 2CGEA 2EGGA 4UU0A 4I14A 1RYNA 5CUQA 1E66A 5FV7A 3L49A 3ZEAA 3OESA 2I54A 2Q3CA 1T1RA 3QKTA 1DUIA 1FNNA 1I4WA 1R9MA 2LIVA 5AVOA 2GASA 1UM9A 2H1HA 4A26A 2DWOA 2I33A 4A1OA 5CLHA 1D5CA 3L0YA 2C61A 4WAUA 2OBNA 1SXJD 2R11A 2ZWPA 1V2GA 3MINA 2ZSHA 2VUUA 2VYVA 4HZIA 1IHDA 4X1YA 2VC2B 4RKRA 2XE6A 4TV8B 4XGIA 4ENTA 4JELA 1Z4OA 2FJPA 1O97C 1Y89A 4KH1A 3WKAA 2D59A 5GJBA 1KI2A 1EK1A 2I3GA 1U6KA 4Z1OA 4P82A 5T57A 8AT1A 4DM3A 3R1IA 1SN7A 2FR8A 3ZGXA 2BE7A 4G0NA 4D80A 1X7XB 5FOQA 5H3HA 3R4CA 2J1LA 1DIRA 4E32A 3VO9A 4BV3A 1P44A 3Q5DA 2QNIA 3EXFA 4ND5A 3IIMA 4RY2A 3G2OA 1CQIB 5DHFA 2FPKA 3IT0A 5F3DA 3RVOA 1YRYE 3A1CA 3S7TA 5CDHA 1DKMA 5A3QA 1CY2A 1ISPA 2QL5A 2V0CA 3T5CA 2I65A 2R9VA 2ZSEA 1LNSA 4ZRDA 1RXWA 1F8XA 1DRVA 4LF8B 3TFOA 1OLUA 3ERCA 2VK2A 1UBHS 5KIAA 2HMYB 2AS0A 3GGSA 1SOUA 1TZCA 5I48A 3S2IA 1PR4A 1R8QA 1NFRA 2WSLA 1X7YA 3EXIB 3MMXA 4KZKA 1OVGA 1XTQA 2BHLA 2VPZA 3AERA 4A6DA 2ZE7A 3IFSA 3AI1A 3R9IA 3IP1A 3TMAA 1A9YA 1SUEA 2YJ5A 3UICA 2YICA 4FHFA 2BKXA 5AVJA 1CWUA 3ICVA 1JYEA 2H7VA 3NQ41 4DMGA 4GR9A 3TIFA 2V45A 1JHXA 1JPJA 2YZNA 3VKGA 1KC3A 4DM4A 2OGTA 3QBTA 1XQ1A 5GONF 1VPTA 1QYXA 1X2EA 3G0BA 2XDWA 4O08A 1OX4A 3CPSA 4MP8A 4HXFB 4MUAA 2BFFA 3CUVA 2ZR0A 2NVUA 3V4RA 2Z6QA 3VTFA 1YB5A 1I24A 3TZ6A 3D8BA 5K9ZA 2A7XA 4MUNA 3LHIA 5KOJB 4HX5A 3RJMA 2VUIB 2ACEA 1OI2A 4EZIA 1JECA 3FD8A 4ZEOA 3E35A 1GNLA 2GBCA 1QG0A 5JADA 1K3FA 1FPQA 3K2IA 3VI4B 1FFDA 4OHZA 1EX9A 1RQNA 4BNKA 4XGNA 1W87A 2J3KA 2QTMA 2PL1A 4LYAA 4L5CA 4PZ9A 5EWMA 3VOBA 5I4IA 2J09A 4H17A 1Z4JA 4M7OA 1P9RA 2H1SA 3EGCA 3FNRA 5CRIA 2W6JA 1ESNA 5D51S 1XIVA 3LPLA 1KP9A 2HM7A 1HFEL 4AL4A 1X42A 3OPYA 4CWAA 3MM4A 2IDKA 1MB0A 5LNK1 3KOXA 3NHZA 3P2OA 4NZZA 1H94A 3GUVA 1V45E 3IEKA 4IDEA 1GNQA 4J0GA 521PA 1SQFA 4Y1RB 2WWVD 2HAEA 2XTNA 4RS4A 5HOEA 1F6DA 1N6LA 1X13A 2VNSA 2RC5A 4NJMB 1AC5A 1BYUA 2HZ7A 4OXIA 4KVAA 3QHAA 4HPJB 4R4JA 3HFGA 3FOZA 1YVEI 1FW6A 2G8NA 4U2GA 3AM1A 1BXGB 1NKSA 1K5PA 2VBIA 4R54A 4UD6A 5ULLA 4YO7A 3SQOA 1Z5OA 1U1EA 5JIBA 3IBTA 2ZW9A 4WGGA 5ES3A 1VJTA 5DP1A 4ZT2A 2I1LA 1JEQB 2IV2X 2YWFA 4QUEA 3QKRA 2GLXA 4INOA 1OBHA 1YS7A 4URVR 3U16A 1YZQA 3PVZA 4NG4A 4NVRA 4O3FA 2VHCA 1Z28A 1RMQA 1UFQA 4IS2A 3L06A 3DLCA 4MUFA 1JFSA 4BNZA 2NXCA 1GGHA 1ZH4A 4QYSA 2QYSA 4G3XA 2VOJA 3PUJA 4CIWA 4U7TB 1VBMA 5JANA 2EWMA 2J3HA 1BFUA 1QQTA 1OFGA 4U3JB 3ZWPA 3RARA 2XT9A 1TIBA 5ICGA 1CP2A 2ODNA 4YQZA 5JCZA 3QZUA 5HK9A 1T4CB 5GV8A 4PYRA 2GBFA 2R62A 3IUJA 2IUYA 1LK0A 3NX4A 5C0OE 1FFGA 3G02A 1BWQA 2CKDA 3GX1A 3VJLA 3C5EA 2WG1A 2Y99A 3RRXA 3TLAA 2DTXA 1ULZA 4N1AA 4CQLA 1NBOA 5H9WA 2P6NA 4U2CA 1YV9A 5F2EA 2V7QA 3AI3A 5SYNA 4FBLA 3A3OA 3Q3EA 1OV4A 3G2IA 5K0ZA 2RGXA 1TNDA 1AB5A 3OJOA 4C2TA 3HL4A 3QLEA 4IS3A 3L7DA 4NYJQ 4PO9A 2GN1A 2X0RA 4U2BA 4EF6A 3NHMA 4GZLA 1F7UA 3HI4A 5EAIA 2REQA 3IQHX 3E2PA 4HWTA 4YALA 1N5DA 2FFAA 4TWBA 5AW6A 3EQ6A 5KNDH 4RF2A 2P2SA 1D0IA 4UUPA 3MSXA 3VAZA 1UBTS 3FYCA 2Y1DA 1P74A 3QVKA 3ED1A 4IGIA 4F06A 3T5AA 3BA1A 1VJ0A 1C9KA 4W1RA 4LUCA 4IJ6A 2IQ5A 3B9BA 4G0YA 2LCQA 2D1FA 4KV7A 1FMTA 2X76A 3QBEA 4HYEA 3OJ0A 1JBKA 2IOHA 3KKKA 4ND6A 2XYQA 1AKQA 2ADOA 2C9ZA 1GZSA 3I42A 3OLWA 4K9DA 4M0LA 1RM3A 1ODFA 1ZICA 3CLUC 1QF7A 1C5KA 2WAXA 4H7PA 5DYTA 2GNOA 2ZUTA 3L0ZA 4RF3A 1TE2A 2I87A 4KIFA 1TYEB 1H6BA 3ZY2A 5FOUA 1HI9A 3KIPA 4C6SA 3ZHUA 4GD3Q 1JQKA 1ZRNA 2AZTA 2PRIA 3PNMA 4UNIA 4KJZA 3V4PB 5F1YA 4QJ5A 1UXKA 1T6BY 2NUBA 4CL0A 1OT5A 3FGPA 4CIXA 1IYZA 1XAJA 2C7VA 3CFYA 5FTMA 4F60A 3O4GA 5CDTA 1V8ZA 1WEKA 3NVDA 2WTXA 4QO8A 1JHPA 1RI4A 4RMJA 3U31A 3DOHA 4BU1A 2C2XA 1PSWA 4AURA 1WW8A 2QJFA 1S5PA 2I4LA 4QPPA 2IPMA 4FYXA 4LMBA 4OJTA 2I6QA 3WDLA 3F74A 5DI3B 3WFIA 3D0KA 1ZG3A 4HG2A 1FUUA 1RAFA 4GKJB 2QI9C 4RTPA 5K0LA 1WW2A 2FKAA 2PKQO 4OKSA 4NS1A 2OECA 4XDYA 2P9ZA 2I4MA 1NA5A 3I9NA 1IWOA 3EIQA 1D2EA 3L43A 4I36A 4YRZA 1D4ZA 2V55B 3IR5A 4LDQA 3KOMA 1S9HA 2QB5A 5KC9A 2ORED 1DTWA 4JBXA 3ORHA 1E2DA 1X3SA 5JPIA 3IQWA 3SD7A 3G0GA 3KZCA 4L4YA 4HDCA 3W6ZA 3WB1A 4A3SA 3RSOA 1ZBDA 1OZAA 1S1CA 2OCDA 2ZI6A 3CZMA 3GUYA 3K9NA 2ZR9A 2BEKA 2V3VA 3AXSA 1CB0A 3NJ8A 4U0JA 4URYR 1DQYA 1FYFA 5I9TA 5JO9A 1C3EA 4N49A 3T5DA 1H0RA 4BS9A 2WJVA 1WKVA 4AJPA 2ODBA 1R27A 3EXAA 1FDIA 3B1ZA 4DIOA 2AJBA 1Z5WA 2OGWA 2Q41A 3DV0B 4BXOB 2H16A 2HTEA 3QI2A 4KPEC 1W76A 1M6WA 7MDHA 1JHMA 1PK8A 2XQFA 1EVLA 2Y27A 4MV6A 5CB8A 1BDIA 4UFPA 2B35A 4P3OA 1TADA 4DNFA 5BQXA 5CX4A 4QOEA 4R1MA 2ARKA 4WJKB 2PMWB 4TMFA 3BIFA 3DM5A 3AUTA 4GKAA 5MN5A 1XPJA 4OUDB 3ZVLA 1XJQA 3WC4A 4JJFA 1ZM7A 1CS0A 4KPFC 4BO6A 4CU5A 1R4ZA 2NWQA 3G1UA 4UM9B 1M7BA 1GSHA 1V5FA 1XKLA 3E05A 2AR0A 4S12A 4YRKA 3WNDA 4PC2A 3FR7A 1QH8B 3OF5A 3VU9A 1E1NA 2HC9A 1NAHA 2ZVDA 3RROA 2FVXA 4Q3CA 1TIKA 4HLUA 2VJMA 4GVLA 4G41A 3K0AA 2EG9A 4KAFA 4KGDA 4QBIA 5C2JB 1EVEA 2QP3A 1QFYA 5AOCA 5DHQA 4LVOA 4XFDA 4D6PA 2CBGA 1JB1A 1U1GA 4EKDA 3KHTA 1G7TA 2WG2A 1BHQ1 5CU7A 2QR5A 3WWCA 3K70B 5C32A 3FG9A 3M83A 1NJGA 4JVSB 2NZYA 5DISB 4M1MA 3J80A 5FUXA 3VNQA 1SIBE 1Y9JA 3SM9A 3IJPA 4UM5A 1ITZA 3H0CA 3TK1A 4UEKA 1EZ4A 2QD4A 2CJWA 4WKPA 1PV1A 4BX9A 1OOEA 1IG3A 3FWYA 1QP4A 2OLKA 5DGCA 3BPSA 3ZD8A 3S8EA 1CR0A 3IKJA 1O8CA 3IP6A 3N53A 1OFTA 3THSA 2I55A 3PPWA 5MDHA 4P7FA 3Q7PA 3ZD9A 1LF0A 3NIDB 2GPAA 1HFKA 4FUTA 4OFWA 4BDSA 5FT9A 3D2AA 4DSTA 1N33B 1IEQA 4QGHA 2H0RA 4UHCA 1K6EA 1QB8A 3FFAA 2GCOA 3FTNA 1A95A 3UUWA 1K75A 4H08A 5EZ5A 1KYWA 2BF4A 2FMUA 1QAMA 3ZBQA 1W36D 4XIJA 3NHUA 3UXEA 5IYZF 1VMAA 2OBBA 2I6TA 1Y3IA 3EULA 3ZNQA 2HPVA 4PLTA 2G9RA 3PYLA 4US0R 4DANA 4KWIA 3CZQA 2HHLA 3EPHA 3M3PA 1QF6A 1MNQA 3RK0A 3EXEB 3KKPA 4M1EA 5EZYB 5JLJA 1FYVA 3MWFA 3WYGA 4OMDA 2J3EA 2JVIA 5ILGA 3UYKA 3SQXA 4RO0A 3DDZX 3DJYA 1N2ZA 1O94D 5E8RA 1KZ1A 1CUGA 4D0SA 1D1TA 1HDEA 1SU7A 5EI5A 3IIIA 2EP5A 2R751 2X8BA 5TEVA 1X74A 1K8YB 2HF2A 3VPFA 5JLAA 3WGZA 2J67A 4LQLA 4F72A 4BLWA 3DBRA 2NSYA 2NW6A 5TMEA 1XRSB 3RS4A 3WRYA 3VPXA 4JU8A 2AN4A 1F3LA 2QV7A 4WXRA 1PDVA 3DWFA 1LRKA 1YACA 1U1DA 4XIGS 1TJNA 3AUAA 1QRRA 2E4UA 3I12A 1OA1A 4LV8B 3MWDB 5ED0A 2GXUA 1DC3A 4YMLA 1DDIA 3CZPA 1SUPA 2Q21A 1V5GA 3HB5X 2IGTA 1MDFA 2ZSFA 1GCGA 1W1UA 4L3OA 3FFTA 5DYGA 3ZDFA 3ZLTA 5BN3B 3GJ5A 1SQSA 3H2GA 3QNUA 3L7AA 4JJ7A 2IYUA 2QI9F 2IRWA 4NMHA 3T1OA 4A8HA 1UL1X 2R1TB 4WLFA 4NU0A 1DWPA 2RHMA 3PG5A 2O2JA 3UJ3X 1HDGO 1BE8A 2WHPA 2OC4A 5ICFA 3WQHA 4G5SA 1SOVA 1WXGA 1PWXA 4GSLA 4TMVA 3TLCA 4B71A 5AIBA 1FF9A 2CVFA 1SURA 3FYSA 2PXCA 3A2KA 3OEHA 4NMXB 2C96A 3UWKA 1XRJA 3AF0A 1E2GA 2PSSA 3OTIA 2ZR7A 2Z1DA 3UMGA 4H1WA 4AYXA 2B1QA 3UK1A 3N2KB 1R0WA 1GQSA 3OMWA 4LTNA 2I3AA 4DEVA 2CB9A 4X63A 4BC0A 2XSZA 4RQUA 3U3ZA 1T2VA 3Q7QA 4RD3A 2H4JA 3MJ4A 1NF2A 4KBYA 1PIWA 2PCJA 4F21A 3ADBA 2F48A 3RBXA 4JDPA 1RP1A 1KP3A 1PO7A 3EAQA 4PLWA 4WK4B 1M2WA 1ZM2A 1NMSA 4Q4AA 1PT6A 2YHAA 5LVAA 2IBTA 3LDUA 2DT5A 2WVHA 4G4JA 5FOSA 1RD4A 5BV1A 1DBWA 2IYSA 2NX2A 4HFRA 2XB9A 6GPBA 3QUSA 1B8NA 4G25A 4ZJYA 4P3PA 5JFTA 3QWBA 1WPXA 2UV8A 4PZLA 3SYKA 2ZS9A 4D6XA 1XDDA 5F7XA 3SS9X 1RXSA 5AKLA 2QD1A 2OCGA 3OIGA 4D56A 1WCWA 3NW9A 2I3DA 4B46A 3OFKA 3G68A 4I46A 5A6VA 2Y0EA 3UAXA 4IUCS 3V4OA 1XYGA 2WVJA 1DQSA 4AJOA 3QELB 2NU6B 3GT7A 1RTKA 4Z8YA 2YKGA 2DPLA 1LQUA 3A0RB 2GMWA 3N6XA 4QU8A 5CFZA 5CTJA 1PI3A 3UAWA 1EFRD 4JUIA 4WJLA 4BJ3A 1C3JA 3DXYA 1GNTA 1U7ZA 4LJ9A 4UM8B 1PG2A 1SOAA 3ROKA 1VSBA 1ZSVA