2C84A

Crystal structure of the sialyltransferase pm0188 with cmp
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
389
structure length
377
Chain Sequence
SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTNNPYVKVMRRLGIIDESQVIFWDSLKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-2,3/2,6-SIALYLTRANSFERASE/SIALIDASE
publication title Structural Analysis of Sialyltransferase Pm0188 from Pasteurella Multocida Complexed with Donor Analogue and Acceptor Sugar.
pubmed rcsb
source organism pasteurella multocida
molecule tags Transferase
total genus 126
structure length 377
sequence length 389
ec nomenclature
pdb deposition date 2005-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2c84A01
2IY8A 4V39A 2ZWIA 4R83A 4V2UA 2EX0A 4V38A 2IIQA 2IHJA 2EX1A 2C84A 2ILVA 2IHKA 2IY7A 4V3BA 3S44A 2IIBA 2Z4TA 4R9VA 2II6A 4R84A 2C83A 2IHZA 4V3CA
chains in the Genus database with same CATH superfamily
3DWIA 3EQ2A 3I04M 1YQXA 2CVPA 1CLEA 3IUYA 3OZEA 5AKHA 2HSDA 4M89A 4D8WA 8ABPA 2J07A 4MB2A 4FOTA 2BMFA 3EZLA 5LB2A 5F73A 1FL9A 3K2EA 5D84A 4ZHQB 2PANA 1GCGA 5D87A 4FB4A 4BO2A 1W25A 2XCQA 1E3JA 2IXGA 4ERXA 2VF2A 4F5EA 4BB6A 4LN1A 1T1JA 1LF5A 3X1YA 3H0CA 4OLAA 1ZI9A 1Z5PA 1OLUB 3V1KA 3G9XA 2JLCA 2HRBA 3VYUB 2F1KA 4OXXA 3KEMA 4MO9A 3ZQUA 2RFLA 2JIOA 4ND3A 1NJ1A 3S2IA 1KAHA 3FX2A 3ROQA 1XMIA 2XVYA 3DR5A 3K5PA 3IKTA 1E0JA 1UXIA 2PUGA 2HIGA 5G0VA 4OB8A 1ZICA 4BE4A 4CMIB 4PYRA 3R76A 4ER0A 3IPLA 1NVFA 3IVMA 1R0KA 1Z88A 4RW0A 1QMPA 2HSJA 2VUUA 4MUKA 3DA8A 3UW3A 1XIVA 4V0LA 5KKCA 1ZLYA 2VEOA 2XHZA 3O4IA 5IKXA 2QRZA 3IODA 3ETCA 2C7BA 2I1VB 1FFBA 4UZSA 3HXMA 8AT1A 4JB0A 3KJQA 4GZ5A 3H87A 4HDSA 1XZLA 4LQLA 3O74A 2DFDA 1PR5A 3RRFA 3IVRA 4Q3BA 1V25A 4LY0A 4UASA 4ZDKA 4C6TB 1O54A 3QI7A 2ZJOA 4M21A 3EULA 1L8LA 4ZVTA 5ELXA 3D0OA 1CZHA 5FV7A 2O7SA 1A9PA 3WLRA 1WZEA 3M6IA 3VO2A 1F38A 4ZCPA 2WWYA 3MJDA 4R71A 3OWHA 1M34E 3EZ2A 4LJ7A 5CNIA 4AZSA 4LDAA 1ZH0A 1YR3A 3UOWA 3JV7A 4DILA 3LCCA 2IH2A 5CLGA 1O89A 3NOXA 4ZRNA 1AKTA 2X4IA 3HJFA 1J00A 1V11B 4LRYA 4BN4A 2F8MA 1WUKS 3H4VA 1NLZA 1YQDA 3ECAA 4FW8A 3KR9A 1VDZA 5J2UB 1DQYA 3H2GA 5CA0A 5HZKA 4XGRA 3QH4A 1WA5A 4YASA 5I51A 4XQEA 2GN8A 1U7ZA 3KOMA 3P5BA 4AS2A 4OA8A 3CG0A 4J4TA 4QU9A 3WDSA 5I7RA 1RHJA 3URKA 1AUXA 1YZHA 3MINA 2VT6A 3WIEA 1OBVA 1F2TB 4ARVA 5G1PA 5KB3A 4MS3A 1FRZA 2Z2JA 1SCDA 2MSLA 4YV1A 1J90A 3V55A 4KXMA 5K8CA 4QGHA 2G71A 1ZZGA 4LAFA 1DAMA 3G7SA 2DUUA 1F7VA 4YWHA 1IBMB 2O8CB 1LQ2A 3TRDA 3LXRA 1NR5A 3WRXC 4AWBA 1GAWA 3IEPA 3BDAA 1X70A 2GEVA 1H8HD 4NL4H 3AQIA 2ANBA 5L4NA 1R15A 3ZW7A 4N5MA 4DCGA 3K72B 4G41A 1NQVA 3K70D 5H8WA 4RVOA 3RVPA 3TDKA 3EODA 3GFGA 2WRZA 5B1YA 5K99A 1EBUA 4WADA 2R9VA 2DPLA 3IURA 4QSHA 5EE3A 4GVLA 3L8DA 4HGYA 5H82A 1FY2A 3GN1A 4BWGA 3M3DA 2BKLA 3AERB 3OICA 1KSJA 1G55A 3TOCA 1KK3A 1IUOA 2JAPA 2O4CA 3U44B 5B2ZA 4OPMA 1WQ1R 3VHLB 5BV8A 1Q0RA 1TVMA 3EZYA 2ECFA 4QUGA 1AUVA 1AVTA 2J5XA 2RC6A 4BFSA 4I1YA 4WI1A 4PLYA 1RVV1 3P0IA 3OAAD 3T8YA 3Q72A 3UHOA 1WAMA 1YS9A 4G97A 2C5AA 2IRWA 3TNFA 3CYFA 2GM4A 2DWQA 2QMQA 3LPMA 4EMUA 3LHKA 4CKCB 2WNHA 1SC4A 4AG3A 4CG2A 4F7DA 4MAAA 4OQQA 4YQEA 1V3QE 4BNJA 4HSGA 2X13A 4GLFA 3A6KA 4ZZ2A 2PLWA 4Z4QA 5IFKA 4AJPA 1TC2A 3LLUA 2H08A 3T7SA 3WB0A 3P2MA 4H1VA 4E0BA 4UOEA 4RACA 3OM1A 4REQA 3UWSA 3WTCA 5C35A 1NI4B 2IDMA 4PSDA 1KU6A 4YLGA 3TLEA 3FSJX 4YRSA 3G5AA 2NTEA 3ICVA 3N53A 2OC9A 2DQ4A 1WCYA 2OAGA 2Y3IA 4FFWA 3TMAA 1FDUA 2ECQA 2BHNA 5I7HA 1Q91A 5F7ZA 3SC3A 3L1KA 3INNA 4M53A 4AJJA 2NU7B 4L6AA 6Q21A 1F3OA 2BEUB 3AQ4A 3ICWA 1G2PA 1WXFA 1PVDA 4JI3B 3TTSA 2FN7A 2P62A 2QPAA 3JD3A 4LW8A 4CM3A 3G0OA 1JAHA 5JDIA 5K0FA 4N5NA 1Y7IA 4HNHA 1NVKA 3HCCA 4R2XA 4TWIA 1T8WA 1JR2A 4PU0A 2HHLA 3PVCA 2IYQA 4QJ3A 1SUIA 3SJBA 2UZ4A 1N6OA 1SHZA 2RB5A 2G1PA 2PZ8A 2X58A 4CMEA 5A4IS 3HZOA 2DC1A 1LA2A 3DHEA 2GD1O 3NH9A 3SLGA 4BP1A 5JNLA 1ZMRA 1VPWA 3G7UA 1UM9A 4L6CA 4UTXA 3HFRA 5AQEA 3CURA 1D2NA 3QENA 3UMBA 4RGQA 4H7EA 1R0WA 4X62B 1NBME 3Q5DA 3BHJA 3G3EA 4IIDA 3SJAA 3EFOB 4B6GA 2BEWA 4RA9A 3TBKA 1DBIA 3ZWMA 4CCAA 3LX8A 3EFHA 1P29A 1E94E 2ZS9A 4JJ4A 4QUBA 5CR9A 4HPXB 1QO7A 4MR7A 5IT0A 2W37A 3Q4GA 4P86A 4PQFA 3GRVA 3OE4A 3EYAA 1TJYA 2V96A 3IAM1 1WP9A 5CPFA 4M55A 1X92A 2OORC 3P8ZA 4CYMA 2LZ0A 3CWZA 4UAJA 2GXUA 1YJAA 2AQ8A 2FR8C 4K9QA 3AF6A 4HH1A 1T13A 1JQJC 1IZ7A 4W7IA 5GMOA 4DZZA 7YASA 2C5BA 1MRNA 1ND5A 1YA6A 1QVZA 3FTEA 1XDWA 5ARDA 3UCEA 5F2NA 2JZOA 4Q47A 4ZHSA 1AKWA 1F0YA 1NN1A 2Z2IA 4KNWA 1MW8X 3LYHA 3T1OA 4CUZA 3HLKA 3VOSA 6ABPA 4FW9A 1X9IA 2QW0X 4PSKA 3W2TA 4Q4AB 4RO0A 2ZETA 1SOAA 1T0PA 2CHQA 2A0UA 4JDPA 5JAZA 4JBWA 3IMEA 1EKXA 3IQEA 4WV3A 3DD1A 3VYTB 1UKCA 4AROA 1JQAA 1JG1A 2O23A 3WGUA 2WG1A 1WTCA 4F3NA 3JQ9C 3N6VA 4QJ5A 2ZRAA 2XT9A 4F0JA 2OHOA 4KO3S 1IPHA 2B34A 3KVNA 1G3RA 2WFAA 3AEUA 1P5FA 3JD0A 3K05A 1YVPA 2H7YA 1OV4A 4KJZA 1E69A 1QGDA 1MV8A 2UYGA 3L6EA 3MTQA 4NU6A 4W5HA 3LT2A 5SYAA 3AUAA 1MD9A 2IY7A 3NBAA 3WJ1A 4TVOA 3CVWA 3WRYA 2NACA 5IDYA 1JPVA 3TR0A 3T5AA 1LQTA 1QPGA 4NEQA 3OF3A 3TD9A 3VU9B 1PT7A 3SKXA 4CIWA 5KVCA 2OK8A 3K8QA 1KY3A 2Y0DA 3PXDA 4KVGA 1IHYA 4FTWA 4BVEA 4UPEA 4RTKA 2Z8YM 2WWHA 4HY3A 2PGXA 5JZSA 3T1YB 4M1KA 5BVHA 3PRKE 4FDMA 3LGSA 4A8JA 3LIPA 4R54A 3LBAA 1PV4A 1XD9A 2BE7A 2BFFB 2V9ZA 3VTFA 1FYXA 1RZUA 2BF7A 3ZH9B 3MJ4A 3Q11A 3O7WA 3CVVA 2I2CA 3KXKA 1TJ3A 1OPRA 4G1BA 3O8LA 2X23A 4ZYVA 2HU7A 4MVJP 2BKXA 4Q4CA 3LLSA 5T6MA 4F1WA 1AK9A 2IVZA 3PCXA 4XLLA 2IUUA 3G0IA 2A9QA 4O25A 5HXAA 1J9ZA 3FI9A 5CK4A 2GGSA 2RH9B 3L6BA 3PQ6A 1I3NA 4BNKA 1NF8A 1JA1A 2GBIA 4G81A 4MVJG 1D07A 1Y0BA 4G86A 1IEVA 2DBYA 1FDRA 2H0QA 3FOCA 3L0BA 2SICE 3RM3A 2HRZA 1N7IA 1R50A 1Z0SA 2PRKA 4I4LA 4CQLA 4D74A 3LBFA 3R7DA 1YTLA 3H2HA 1FU4A 4NXNB 1Z6XA 3NHJA 2PZEA 2EBWA 4LPSA 3QFFA 4RA6A 3TLXA 1U3TA 1BMQA 5FH9A 4B3MB 1LUAA 4TV9F 1XLTC 3ILHA 3PK0A 2C5SA 4Y6SA 4M46A 1G20A 5TDHA 2IXFA 3T4PA 4V02A 4U2EA 5GIOE 1SRQA 4R41A 4DJAA 1Z33A 1WPRA 1QBGA 1RBYA 1XAHA 1ZJYA 2C9ZA 2I4MA 2NVOA 3ME5A 3OO0A 4DIOA 2PMDA 1N75A 4IWYA 4L8GA 1JG3A 4GMGA 4DA9A 3U1VA 5FAKA 5JRJA 1NZDA 4QYIB 4OVKA 5GJBA 1NQ5A 5THXA 1QYVA 3HO6A 4AURA 4CL8A 3MPUA 3JYHA 1HDOA 5JE8A 1PZHA 1PT9A 3E3OA 4FXPA 4B8WA 2XECA 1ZA1A 1QBKC 1XCGB 3PJGA 4B87A 4MYSA 1C0IA 3FCOA 1IQRA 3ENNA 4IX9A 4BO0A 4U9HS 5K1ZA 1DKQA 1RLJA 3HI4A 1EQ2A 3OEHD 4JB8A 4RHTA 5KI6A 2I3GA 4MARA 1UBUS 3W4IA 2J46A 3QEMA 1G1MA 3AVQA 3WNQA 3PDCA 3O8NA 5LPNA 3PFHA 4Q6BA 4LBZA 3OMWA 3QJYA 4JV5B 1RBZA 3LUHA 5ITSA 4ZALA 4KK3A 4N03A 4QNNA 5FUWA 1MPTA 1XZFA 4DLYA 2QNIA 1N8NA 3NMUF 3EXAA 3QXGA 3F98A 3C6QA 1OILA 4M98A 4GBGA 1S2NA 1PWYE 4DTCA 4DQDA 1P9OA 3OOEA 3FUVA 2J3HA 1G41A 3A14A 3AY3A 3OPYA 4N49A 4NU0A 3PHCA 4PZYA 1QV9A 1PK9A 1R5OA 2WYOA 1X3SA 2EARA 1UFVA 3ELBA 1JQEA 3EF1A 4UE6A 4WCFB 1GYRA 1YVDA 2W2QA 3KR0A 1RI5A 3COVA 4PHTA 3HPQA 4UAGA 4AW9A 2BM1A 4M0EA 3VPBA 1Z6YA 2D8AA 3O93A 4AO8A 4MI9A 2AFIA 3BXXA 3CE9A 1F4LA 4KKVA 2XYVA 4WN9A 3A70A 4KQJA 3T1NA 2GO1A 4KFUA 4YJ3B 4AMGA 4Y6RA 4FBLA 4I4IA 5LIRA 1ZU4A 4N3BA 1SNYA 3ZVLA 4LDPA 2AOUA 2FDXA 4HZUB 1O9BA 4PIMA 1WXGA 2Z6VA 5KVAA 1TTTA 2B2CA 2XMPA 3D6NB 4LXUA 4XWYA 2FUCA 4FDLA 3VU1A 2FPMA 2NUTA 3UZUA 4RPCA 2RH8A 1GVHA 3D7LA 4EP1A 2Y6VA 3G2OA 2ZWVA 5CH3A 1GNLA 2C8KA 3V1MA 4YMTA 1W4ZA 2APJA 3OTIA 1CBUA 5JCOA 4KOAA 4LY3A 2CYCA 3CXRA 3IS3A 4JQZA 4EG0A 1JIUA 1PGOA 2P9TA 4OQZA 1TI7A 5LOVF 4PX3A 1T0BA 1T9GS 4OO3A 3O4HA 2A33A 1A4UA 3R8CA 2I03A 2ZTSA 3N2YA 4LV6A 2BL4A 2QAJA 2O8NA 4HOYA 4P3PA 5EP1A 3OUTA 4G56A 3WB2A 4WRRA 4B73A 4EHLA 2I1LA 2UYYA 4X00A 3PXEA 2DPMA 5SY9A 4DCNA 3D43A 4EHAA 2Y67A 2ZULA 4XOUA 3I0ZA 5EMHA 3UAOA 2BELA 5F78A 2P9HA 1UBTS 3C3BA 3L7MA 3KETA 3ZCRA 2YHUA 2X8JA 2Z57A 5FBQB 1V3VA 4YV2A 3OQJA 5JY6A 1ZM9A 4XJVA 5THQA 4QNRA 1VIDA 3I28A 2CB9A 1SULA 2J7PA 2HA2A 4K3UA 1SBZA 4QM7A 2Q8PA 4D9NA 4ZK2A 1H4SA 3UAGA 1CK4A 2N1BA 2I6FA 4JI5B 2XQGA 1AXRA 2C78A 2QWXA 4BB0A 3K30A 5EIFA 3U26A 1BJKA 1XA4A 4DJ5X 2Q4DA 2CL6X 2XDQA 3MAAC 2OB1A 1FPQA 3IXQA 4BNDB 1N2IA 3HYCA 5IT5A 1NE2A 1SCKA 1BZYA 3L07A 3AF3A 3TTUA 1TEXA 3W7BA 4RTOA 2XRYA 4NE7A 4GBJA 2FQWA 3ZDQA 3VC3A 4D0SA 1NJ2A 3ISTA 5A06A 3M4NA 2CHFA 1N5KA 4G5GA 1AQLA 1M1NB 4CKBB 1E6CA 2FNAA 3RUIA 3SEZA 2XIJA 3CLRC 3H65A 1VG1A 3P19A 3TCXB 5TR9A 5EYPB 3TRJA 3VO8A 4AUEA 4ZYTA 5IUJC 2J1LA 3HVRA 2BHSA 2YIDA 3IPYA 1P9RA 2RCYA 5JCJA 1SVKA 2WJAA 5EJ5A 3IJRA 4UHEA 4W9NC 3UF0A 1WXQA 3WKBA 1MIHA 1ONSA 2XE7A 2UXDB 3O2NA 5F4ZA 3WK5A 2ZRIA 3PC8A 1DJPA 2XE8A 1J24A 2FJ0A 1CLUA 1F51E 2XA2A 5SYMA 1XMJA 3A9WA 3KHSA 3LW7A 4COKA 4V1CB 1YK0A 1PSWA 4KHPB 2EX1A 3AHFA 3IQHX 2HPVA 3G8CA 4YTEA 3FPBA 3FYUB 2R8YA 3LY7A 4LK2A 2FUNB 5JSHA 1S8AA 3Q12A 4YJDA 3GLTA 1FUYB 4L9WA 1ADCA 3BFXA 1N2CB 2QVXX 1OIWA 1V5IA 2CMKA 5DP2A 4K9MA 1S2LA 3HNRA 3Q8WA 2PH7A 1JH8A 1QE5A 4LDZA 4Q1AA 5IN5A 1SA0A 4BFVA 4RV9A 2P2ZA 1W88B 3NONA 4Y6LA 5KZMB 1K88A 5LZ7A 1OLXA 3O0DA 3DMYA 3WLEA 5TPZA 2PMFA 3VDXA 5CURA 2W6MA 3GUVA 3LDHA 3KVYA 1CUWA 1XJ5A 2OCAA 3G8AA 1OBOA 2AIRA 3ILSA 2AMFA 3V4LA 1XRLA 4ZAXA 5JNWA 4AKHA 1ATZA 4S1WA 2IH5A 2RARA 1D0VA 2GPAA 3PUXA 4ZD6A 2VXOA 1AO3A 1NV9A 1Y8QA 2V45A 4HC4A 4P4UA 4FNMA 2AR9A 3CS3A 4B75A 5LP1A 4N5DA 5K4AA 5KYWA 4JVOA 4ZAVA 4GGPA 2GA8A 4FE7A 4BNHA 1LX6A 4NAVA 4LMRA 1DG9A 2WIAA 5DHAA 3HJNA 3VKHA 3BK2A 5AVXA 4KN6A 4Y2PA 2VDKB 2R7KA 4TSKA 3OM9A 4M7WA 2W2KA 4LK3A 1TNDA 1ZC3A 3L8MA 3CH7A 1JVBA 3LHFA 3P7MA 3QU2A 3FIJA 3OD5A 4HPWA 4L8VA 4MVJA 1M8KA 5EL0A 5BQOA 1W34A 4L5CA 1MX1A 2BBSA 4F3YA 1NJ6A 1G64A 1NF9A 3RQIA 3IT2A 4RLHA 4OCZA 1SBQA 4O4JF 1JFFA 4OIMA 1KSHA 1M74A 1WE2A 4EGFA 1T4DA 2DPHA 3F74A 5JMOA 2ID8A 3DMNA 2QTZA 3GBSA 4LZAA 3KT3A 2BCJQ 5FBLB 3NTVA 3NUZA 5AM0A 4BMCA 2ZP1A 4YAOA 4UM5A 5KQGA 4WACA 4AZ0A 2QD5A 2WWFA 3MLBA 4AYWA 3QSGA 1WU8A 4CV2A 3RRNA 4H7JA 3BJRA 3GRKA 3EPHA 1JMVA 2F00A 1TM3E 4EKDA 1G6OA 2DECA 4BFCA 2X0IA 5IANA 2XNHA 1I10A 5FJJA 1F9AA 4RQAA 9MHTA 1Y80A 4I5IA 3S99A 5DYTA 1G3MA 4QUIA 2F9FA 4ZVLA 3NKVA 3MM4A 1TCUA 3W2EA 1Y5NA 4LGMA 3PEWA 4ZTZB 1Q0HA 3GLHB 2FPOA 4IMJB 3GT7A 3K0FB 3H8JA 4IGAA 4FUQA 2O52A 4EL5A 3ZD7A 2IYAA 3JQAD 5AW0A 1E4EB 3EDRA 3C7CB 5AFSA 3GPLA 3ZE0B 4UATA 4EYSA 3EOAI 5BWNA 4JXZA 4BGIA 4CG1A 4TKLA 3TOVA 3ULKA 1MLDA 1TF7A 4L9RA 2Q50A 3GPIA 4WERA 5HKLA 3BCRA 1T5LA 4DLSA 3GLRA 2XUGA 4A2WA 5CUQA 4F9TA 5LCXA 1JJ7A 2C84A 2V5VA 5LYJF 3LC1O 4O4IB 1RYFA 1T9GR 4X1KB 1QO9A 1R66A 2WE7A 5IKOA 1PJTA 4PO1A 1W36B 4UUNA 3X43A 1D03A 3LTNC 4GPZA 1YL7A 3JU3A 4H9GA 4HNRA 4KRYA 1GCAA 2INGX 5LMZA 4WKPA 1D2RA 4K6GA 4UMFA 4UUAA 1CJTC 1FS6A 3R74A 3R75A 3IVCA 4WBNA 2TRSB 3OP1A 4ARIA 3DTNA 2ZU6A 3SP1A 1XVUA 5K0NA 4RY0A 4ZOEA 4G85A 2XW6A 3U3RA 1B42A 3HLTA 1AZTA 2DHRA 3KOWA 5DM0A 4ZV9A 1I7QB 4CF3A 2C7QA 1B6GA 1X77A 2NUPB 3MPOA 2H4WA 2GCIA 1UK8A 2QQEA 4HRYA 4XVCA 4ZVPA 2JDIA 1MC8A 5K3EA 4IRUB 1RQPA 1NHWA 1RTTA 1Z6AA 2HTFA 2VNSA 5EI5A 3UK6A 4A23A 1RWBA 2PR2A 4ZO9A 5KHLB 3QBVA 2ZREA 1IQUA 4L72A 3QMMA 4PZPA 3PUJA 2IYXA 1PWZA 1GPKA 1P72A 3DMTC 4TS3A 2KLHA 2QVYX 3SYKA 3OZBA 1N1DA 1MT0A 2IFTA 5EWLA 4ZV7A 4BKPA 1X8JA 3UPDA 4QQRA 1X0VA 2W71A 3ETEA 4BEBA 3TFOA 3DCNA 2R0QC 2HYIC 1HEUA 5CIYA 3MCUA 3NIWA 3KOYA 3OE7D 4TQ9A 4L3WA 4FB5A 2YXDA 1USIA 3FTCA 2ZBPA 4GUAA 3P2JA 5JJKA 3G0DA 1NBHA 4IHKA 3DOJA 4RIEA 2OV6A 2HYDA 4GKVA 3PX7A 2R4QA 3EUEA 3SIPA 4HDAA 1OXKB 4E5NA 1EFRD 2YWHA 3DE5X 4Y2VA 1PQUA 4KXUA 4V0KA 3SHOA 5JFOA 4YRDA 4E03A 1LVUA 2CHEA 4MWZA 5FWNA 1ZPDA 1XGKA 4DWJA 3T3EA 3WKCA 5EQFA 1YOVB 4D9JA 5BY2A 2VP3A 4XWAA 3QOXA 1CB0A 2F4NA 3V7WA 1DV1A 1YE8A 2ZDGA 1IVNA 1K5GA 5DBIA 1C14A 4EPWA 1CIPA 2X9GA 4RX1A 1CUXA 3W5AA 1XVTA 1FYVA 2P2SA 3IAS1 2O7NA 3EXEA 1L8OA 4Z3DA 2V3WA 1FVHA 1HURA 2W5UA 1WVMA 1VL6A 1J56A 1NMZA 3AG6A 4PO3X 3I9FA 1FXWF 2JVKA 4EJ6A 5IVDA 3HDGA 5TT0A 2QP9X 4S35A 2AKEA 3PJEA 1CRWG 2R79A 2VHZA 3FMGA 1SCIA 3GF4A 3HJAA 3RRXA 3H2BA 4LQ4A 1DX9A 4EMBA 5BMVB 4G8BA 3S1AA 1WHSA 1XDBA 3UFXA 3MTJA 1KNXA 2O8BA 2V3CC 1QIHA 3DYIA 1R0SA 4I50A 3R7AA 3ZDFA 4I5EA 2BZ1A 5B5SA 4MS4A 3M2TA 1A69A 3L6OO 1U0JA 1QGUB 3AI3A 1DIRA 1K7CA 2JGKA 1BQEA 4QGGA 4G01B 3UTCA 3QKUA 1UJBA 2WAAA 2QYOA 3D4PA 3MRXA 4M1MA 2EGGA 1Y6ZA 2JA1A 3WLSA 1OWPA 1ETHA 5IVHA 5GV8A 1ODJA 1R6AA 2YWBA 3FSEA 1DEXA 5JH7A 3H97A 2P90A 2IWHA 1HM5A 1YS2X 3S8MA 5ICGA 3JRWA 3WQBA 4J1NA 2QG6A 5I9MA 2PEYA 2XKBA 4D02A 2PGDA 4HH0A 4Z4CA 4GKKB 3QXHA 1O7JA 3TO5A 4YMIA 3HVKA 3ROMA 4QU8A 1WNFA 2ONYA 3I72A 4J03A 4LJYA 2R751 2AK2A 3FVVA 4MQEA 4XEHA 4D4IA 1EA7A 1LSSA 2UZ1B 4AB1A 1QYWA 3B1YA 5D6OA 1U7HA 3SJZA 3ETDA 3SQLA 4CMCA 1P5ZB 3I53A 4ZYLA 2WIDA 3AFIA 3A6DA 1LRJA 3JQPA 1G1AA 3OPMA 4OQMA 5K8IA 1DJMA 3QPWA 4GYWA 1ZOPA 4NJEB 5KEIA 2IXBA 4ZCIA 4ZOLB 3TSOA 2XUAA 4Z9YA 3FB1A 1NJSA 1T0HB 3TZ6A 2ZJFA 3V4OA 5IULC 2B8NA 5A5FA 3R5SA 2POCA 3C3XA 4FEEA 1XD2B 2AEEA 4P7KA 3H5OA 3RYFA 3L8HA 2WYUA 3FRJA 1LEHA 3A4YA 4NMXB 4RTRA 5EUBA 5T3YA 1GZ5A 3MHTA 2YJ5A 4Q3OA 2EKLA 3K9HA 4R5MA 4OL0A 2NZUG 4REMA 4B4DA 2AN5A 5FUQA 2PSEA 3IBSA 5DOZA 3GCGA 4RORA 1T2CA 1HY3A 4YV7A 1E0DA 2X2EA 1NUPA 5K4GA 1VYVA 3GIWA 3L4EA 4NOMA 5IH7A 2H0RA 1IXRC 1T2AA 1RAFA 4Q9AA 4Q7KA 1QORA 1KMHB 2OHGA 4CLOB 1E1QD 3Q40A 4PQGA 2OZLB 4P7JA 3ZVKA 3PUIA 4BCBA 1V6CA 3AKZA 1T5SA 4LJAA 3A3OA 3WLIA 1QRDA 2QN2A 3I42A 3DO5A 3KT8A 5H1YA 2ZGVA 1UT8A 2NZJA 3ZDXB 1EVIA 3KFLA 4DIUA 4LG1A 3O4VA 4E70A 1WIWA 3AI2A 4MO2A 3QELA 4WZ6A 3ZCVA 2AX4A 4U7HA 1T4CA 1T8PA 4QU5A 1S02A 3PUYA 4LYFA 4UAUA 3G2JA 2C8LA 2VAXA 5EAIA 3U19A 1J0AA 2V54A 2MR6A 1WKCA 4B45A 3P9IA 4PNHA 4F6LA 3RS5A 3SDSA 1B0UA 4MYUA 3W8FA 1X9GA 1Y6QA 3COZA 4CR8A 1SVSA 1DP4A 2ORYA 4OAPA 3RYCB 2DLNA 3VR6D 2PA3A 3VZRA 3QUAA 1AE1A 2H31A 1CZOA 3CY6A 3IULA 4TSFD 4MIOA 5K3DA 4C7OA 3U4IA 5EJIA 1CJBA 2CDBA 3DL0A 3TE7A 1ZINA 1E98A 1TZKA 2J7KA 1OREA 2YHAA 2J3LA 5JALA 4EF5A 3D81A 3NAQA 3NNNA 4ND2A 1BMFA 4V2IA 3ZJUA 3H2YA 3PRHA 1J9EA 1P4JA 3MELA 4HNGA 4ZCTA 3R4CA 4ICIA 3E7DA 3B51X 5JDIC 3JQ6A 3AF0A 3N87A 4FSDA 1W94A 4BX9A 5KNLA 1Y3DE 2B8EA 4NBUA 1AU9A 3JARB 1MR3F 1N0HA 2G06A 3UNXA 2XNDD 3AW8A 3BE5A 3QKRA 4PPFA 1HRDA 3BT7A 3THYB 3AZQA 3HCNA 1XCOA 3DDHA 4KIGA 4CMEC 5KSYA 3HKDA 3HR4A 3MJTA 4PSAA 5P8WA 4YJHB 1Z06A 2RC5A 3JQFA 3STYA 3N8IA 3SZOA 1W49A 1SHLA 2EF1A 3KL4A 3O94A 4CE6A 1Y8RA 5I6DA 3NM4A 5D1HA 2H1CA 4QXAA 3P97A 3UG7A 2R87A 5HG0A 1QH1A 5BN5B 3U4HA 1ENOA 4BQIA 2AL7A 2R6AA 4JVMA 1CULC 2QQ5A 3H16A 4ZI2A 1TK3A 4BO8A 5JQGB 3SFTA 5FD8A 1J70A 1O5OA 3EOZA 3NAMA 4S0XA 1K1EA 5FPQA 5JD5A 2A30A 4GMFA 3WIOA 2I65A 3D2AA 1UOOA 3W5JA 2JD2A 3K0HA 2QX8A 4PGHA 2QZPA 3BE6A 4WXHA 5IZCA 4RKYA 2Q1UA 4ZQHA 1MFPA 1I80A 2NZVG 3CUSA 2QVGA 3IBTA 5I8ZA 3UK0A 3PQ2A 3AILA 4AZ3B 3C1AA 3K1JA 3TBFA 1IZ0A 4WKCA 3I9V1 2XDAA 1AZSC 4ZOBA 2QK4A 1V9SA 4Z9AA 5C3MA 3UA3A 3GNLA 5JU6A 4Q1FA 5EPOA 4A6XA 4BCCA 4BNGA 3EQ7A 1GYQA 3O6VA 1I33A 3RVMA 3A25A 1J1UA 1FQOA 3MRSA 1LX7A 4EKGA 1KERA 5C37A 1Q50A 4JSTA 4UU0A 4ZDJA 3B2NA 3I9KA 4U7WA 1X6VA 3EIFA 5P21A 1GL6A 2UUOA 3KPVA 1N2EA 3ZZNA 2AZMA 2P9EA 2XAUA 1TF2A 3P0JA 5HRCA 1E0KA 1YR9A 3LP8A 1XL0A 3WMGA 4GGMX 5CFNA 3JPWA 1LPPA 1N9ZA 1NY5A 1VDMA 2DBVO 3DHVA 3PDIB 4MJXA 5B7NA 4EITA 5A7FA 3VR3A 5BNIA 2UAGA 3MTGA 1QONA 2GTHA 2I55A 1BVRA 3B8HA 4DRYA 1B8NA 3ZJVA 2V5UA 3AT1A 4AY2A 1NXWA 4AWAA 3PS9A 5IUKC 1YJ8A 2QOEA 3TECE 2BFEB 2DLDA 4H6VA 4DLNA 2OCXA 5DLEA 2A9FA 2B61A 2CJYA 2NYAA 2Z09A 4P3YA 1T5IA 5I7AA 3ONWA 4TZ0A 3FHTA 1VE6A 2IEDA 2ZYWX 4JSYA 4A8JC 3GEHA 4HNUA 2XXBA 5D3MA 4NC9A 5A05A 5FI3A 1NW6A 4QUAA 3SEAA 4KAFA 4MUJA 2G0NA 4B40A 1ZC4A 1M6WA 1KDPA 1PX0A 2BP7B 4IJ5A 4IZHA 4DRXA 1Z6PA 4O3FA 1Y4ZA 3IJEB 3PENA 3MWJA 4QBTA 1T0IA 1UJ6A 4ASUA 1ULBA 5JROA 3EMKA 1S4MA 3SNKA 3ZKWA 1NTOA 1NXQA 3P2EA 1OH8A 1Q14A 2BGNA 4B4KA 5AKLA 2XVMA 2M6KA 1UPAA 4HNVA 3DJYA 1NBWB 2YN4A 3B9RA 3CKLA 2B7CA 3I4LA 1KI3A 1G8JA 4WXMA 1KJIA 5AKYA 1GCIA 4OHCA 4UQPA 1VJGA 1E60A 1G6Q1 1MGOA 3QQPA 5JJIA 3CU5A 5D2CA 2JVIA 4CLRB 4XDZA 5F51A 4D4GA 1QRTA 4OLJA 4C2AA 3EW7A 4K0KB 4D56A 2IZ6A 2ZEJA 2XB8A 1KJWA 3HE3A 3Q6MA 4ERNA 1IY9A 1LSUA 2VDNB 3CLTD 4XTCS 3GXOA 1B16A 1J42A 3C15C 4MEBA 3RS2A 3LOUA 1NMYA 1AKNA 3OWXA 2F1RA 1O96A 5FA8A 3EDYA 4ZVOA 2YV2A 4FS3A 4JMLA 16PKA 1DSSG 1QKIA 2YMLA 2PT5A 4D4KA 2CF5A 3O92A 2QJTA 4URWR 1ZAYA 1JI0A 3KL2A 4Y1GA 4C1NA 2BD0A 4H4CA 4B8YA 1YKFA 1KYWA 1KC1A 4JC0A 4WZBE 2Z1MA 3VDQA 1BGWA 2QSYA 2NOAA 2YHSA 3P2OA 4J1SA 5AHOA 2O6HA 4KHZA 1N3LA 4IY1A 4NH4A 1G5RA 1UBSB 4GKJB 1I2AA 4G37A 3S5UA 1AZLA 4RD0A 1YZUA 4F11A 3OJCA 3ZJTA 4G6ZA 4OHYA 5HIMA 2PT9A 1D4FA 1CJUC 3G2QA 4X7PA 1TFUA 3S7TA 5K2OA 3DBLA 4GT1A 3RUFA 3UMYA 4P0PB 1MG0A 5T3UA 1RWWA 1D2HA 2VIIA 2G9QA 2JH8A 3NAZA 1SXJA 3K96A 2ES4A 4OMDA 4P58A 3KYDA 4D98A 4JU9A 3SSMA 4C5AA 3WG9A 3CZ9A 1MHTA 1DXQA 4EH1A 4WKNA 1X7ZB 2O2HA 3IUQA 4BMZA 5CP8A 1Q6ZA 3BTSA 2QLFA 4QEKA 2QHXA 3WLLA 1GADO 2A5DA 2CVOA 1P4AA 5JCPA 3FGZA 3HKEA 5JFTA 3AKDA 2JFVA 2CHUA 5LJLA 1Y6FA 2YR0A 1JP7A 4DANA 4LRTB 1KYQA 2QF7A 1M72A 1A76A 1FRVA 3I58A 4NCBA 2DULA 3C3JA 1E1NA 5JEDA 2PKYX 1OQAA 3BDVA 3DDSA 3I2GA 3IP8A 3NEYA 2HT1A 4MH0R 4RVSA 5J2TA 3V9PA 3ZD6A 1FP4B 5TGZA 4EUFA 1NYTA 3D0RA 3P9KA 4RVHA 2WDZA 5DM2A 5UKDA 5JT1A 4RHXA 5EXPA 4KNVA 5KNDA 4GIBA 2E18A 4I9UA 4BO4A 2VHCA 1JEEA 4J7XA 4PCLA 4OJYA 4WIAA 5IJ9B 4C4SA 1KKUA 3WYAA 1A7AA 4K0RA 4X20A 1MB3A 5E4TA 1OJ7A 5BN4A 2BFDA 2BIFA 3IT3A 4KWIA 3B1VA 4HKTA 3STVA 2SNIE 1USKA 4QWWA 3EWAA 4YCJA 1OFIA 3DXXA 4YYZA 4EEXA 4J0IA 3CONA 4TV9A 1JVNA 1KMMA 2ZJ0A 3CW9A 3HV0A 2DFVA 1YNSA 3K09A 2WU8A 4XUDA 4N3AA 1XYVA 3OFNA 2CZQA 5ANRB 4C76A 5LR6A 4PM4A 2I9KA 1BD3A 3HP1A 4PPNA 4URHA 2OXFA 1A2OA 2OBYA 4MWTA 2I62A 2BGRA 3DVAB 3IEKA 1PI3A 4Y2UA 5ESWA 3PV0A 5JSKA 3V7FA 2JJ1D 4ZHQF 3BD9A 2HV9A 1FK8A 3R3YA 1GXSB 1BJTA 4UVIA 5C8XA 2QAGA 1WD5A 2CK3D 4XB6B 3W1VA 1E6EA 2NTVA 2W6CX 1GGVA 2QZZA 3ZE2B 2FCAA 2GBCA 1IHPA 5KKNB 2Q7DA 1SO8A 3GZJA 5LNK1 2G09A 3IT0A 3O8OA 1PGNA 2J0VA 5CG2A 1MT3A 1JAIA 1A3CA 1O95A 1J2JA 1OXSC 1NYQA 1R74A 3MWKA 3RSGA 3UUWA 3KQUA 3A28A 4GLLA 5A4MS 4BY9E 1EIWA 5FT9A 1MQSA 3HS3A 3LU1A 2H2GA 1L4GA 4KMOA 3T06B 2PK3A 2VJBA 3NDBB 2QL9A 1BFUA 1WCIB 2WOJA 5I9BA 3A9UA 2IW1A 3HM2A 4R8VA 4YFYA 1L5GB 4JJ8A 3WGQA 2O9JA 3ZU4A 4ZT4A 2JI9A 4R2KA 5HHTA 1KJ8A 4KGVA 1CZUA 3FTNA 3C6YA 3PQCA 1PK7A 4C7JA 3O9MA 3GARA 3H75A 2FWJA 5L3ZA 3KYCB 1BHJA 3D7RA 3VNBA 1C4OA 2QDKA 2ZJZA 4Q6WA 4ZRDA 4ABYA 2X5JO 1OHHD 1B2RA 1TD1A 1WLYA 3A1NA 4NVRA 4X7MA 1W59A 3V80A 5JS8A 2C7OA 1E3SA 4KW7A 4M9SA 4MVYA 1S5PA 3DW1X 2IX3A 4U3JA 3OTWA 3X1JA 2Z58A 1HQYE 1ZD9A 1ORDA 2O0LA 3I6MA 5EIOA 1IWBB 3RQSA 2GJ9A 4M8NE 1U3GA 4P1ZA 5GOTA 4BEVA 1QUEA 1G38A 5K3FA 1UAAA 5CEJA 1KDOA 5MHTA 2E48A 1HNWB 2DKNA 3LL7A 2ADMA 1JPNA 4WJKB 4HNAA 3Q10A 4AIRA 4EB6A 4URXR 5HUQA 5U9CA 3GWZA 2J6IA 1SXHA 5FWDA 2JH9A 4FWTA 4DLPA 3PGLA 4RKEA 5A7GA 2WUDA 4TS4A 3HSYA 3U7JA 3TVYA 2LP4Y 2GN6A 1YZQA 5EKUA 2C97A 2EF0A 1MPXA 1YR8A 3N8KA 1YFJA 4A0SA 2QTHA 4B4WA 5B58T 1AQJA 5J2UF 1A9RA 3PC8C 4UVDA 3C8ZA 3TI7A 3ZVMA 2A1UA 2YOFA 4I6GA 4O2BB 5FI5A 2IIPA 4CT5A 1NVMB 2F43B 2PO5A 3BN3A 1YNOA 2NO6A 2A5YB 5LOVA 4RJKA 1QO0D 3BRWD 4O1MA 1WRBA 4OSEA 5BQFA 4OXNA 2ZT7A 5TEWA 5KNBH 5A7HA 4CT4B 5INTA 4BVGA 3BXZA 4HT3B 5A1TA 3NBYC 4OK3A 1U11A 4RMNA 4FFRA 1PO7A 3ETHA 2W2OA 3C7TA 1J5PA 4E3ZA 1ZH4A 3E9QA 3LLMA 1U2QA 3RFXA 1Q1BA 2IOQA 1HTBA 2IZ1A 1W8DA 1MJGM 4EGCB 1P2DA 3ODGA 4QRDA 5B55A 5EJFA 1DC5A 3HSSA 2WWWA 3IBFA 2JGAA 2TECE 1CUZA 2WYHA 1R4AA 2V6MA 1NQUA 3LZ6A 4UXHA 7ADHA 1EX6A 1L4LA 3FI0A 4HDRA 4LX0A 3WOHA 1M5UA 3CGWA 4R8LA 3B6KA 4YRCA 1OZ0A 4ZXPA 3FGOA 1PW7A 2DOKA 4G9GA 4P54A 3T1VA 3KLMX 5DRTA 4FILA 5CBPB 5F9FA 5HMLA 1NATA 4CFZA 4BNUA 1U02A 1GOTA 2BJHA 3CZMA 4Z6KA 1AMOA 1P91A 2WT8A 4F8JA 5L3SA 2IGBA 4MIYA 2Z08A 3ROKA 3KK0A 4WW0A 3CLRD 1ILEA 2AMJA 4DW8A 1SUPA 1VCHA 2UV8A 4R2WA 5DTIA 2DR2A 2X9VA 1ZKMA 1BD4A 4G8JA 1ZIOA 3HVHA 2GEDA 3GMIA 4OGFA 2XE4A 3FLAA 3FZGA 4UTOA 5CHYA 2NZ2A 2GCEA 3GR6A 3ZY3A 2J0EA 4I4NA 2DSNA 4DMUB 3TW8A 3CX8A 3K1AB 5EOVA 3D9QX 2SBTA 3C7AA 3O95A 4QGFA 3S70A 1VCIA 2M1ZA 4WLNA 3PFKA 1LLUA 4I55B 4I2VA 1XMXA 2NXWA 4DB4A 1J2EA 3UEOA 4NBLA 4AS1A 2YIJA 3KD3A 4AUMA 4CMJA 3OQOA 3H1AA 3DBRB 3B70A 3NH6A 1J5XA 2H3HA 5I9LA 5I7EA 1JKFA 1NVBA 1LPNA 3ZHZA 3OZGA 4IHJB 4BU0A 3NVKI 1DKOA 3B7PA 3JR7A 5HA5A 4CDMA 3PRYA 3WZLA 2OC4A 1AKYA 3E9YA 3SEFA 4EQ6A 3V4SA 1TAHA 1VA4A 2WMYA 3CVJA 1FMJA 3TB4A 1DKUA 2IU6A 3H1FA 4KWCA 4R8SA 4GX1A 1YE3A 4WX2B 2ZUBA 3N05A 1EUCA 4EG5A 3K4PA 1FJHA 3NXSA 2R1UA 1M5TA 2ZYIA 4JJKA 4MMXB 5D8DA 5F5LA 5I4BA 4XSVA 1YONA 4D9EA 1JNXX 5U1PA 2MWMA 2PBLA 4KBGA 2PUFA 1XJCA 2W6ID 3QW4B 4XH9B 1ZRMA 3RREA 1A98A 1JEQA 4HX2A 1UEXC 4RFSA 3N2NA 2QRVA 1VRCA 4YROA 1YKSA 221PA 1LTQA 3P0HA 3OIFA 4O5OA 4TL7A 5CB6A 4BJ3A 1GNTA 4OJKA 2QORA 2HUNA 1I3LA 5EC8A 2DLCX 3R1IA 4UDXX 4ED9A 5EP3A 1IVYA 4MDHA 3W0LB 3BMQB 3VO9A 3WYBA 4YCSA 1JTVA 1T9AA 4CVNA 2FWAA 4ND8B 3WV4A 4B6QA 2J67A 4D2IA 3TDNA 3VR4H 3KFXA 1ZR2A 1Z36A 4DQ0A 1G6KA 3UUGA 1U8YA 1IBRA 4MQLA 3STXA 4BZPA 3KB8A 3GPDG 4KJXA 3UMJA 3RBVA 3KEFA 1KPIA 1YUNA 1Y1QA 2WKPA 2EIHA 3DZGA 3HH8A 3C87A 2GPWA 3CH4B 5FLEX 1QG6A 1EFDN 2MSWA 3E7XA 3E22A 5FOSA 2YVAA 4AULA 1EHYA 1SBCA 4LHWA 1GIAA 1C3OB 1WSBA 2JD0A 4XGIA 3SSOA 1SHUX 1OI4A 1THMA 4B85A 3CLSC 5KYKA 4I5FA 3V34A 5AYVA 2GEUA 3I9OA 5H5JA 4F60A 4KSCA 4MA5A 1P5HA 4FYJA 2WMDA 5HF5A 4R8MA 2GO7A 1JI3A 3GRZA 4AYTA 9LDBA 3SX4A 4O4JA 3U7QA 3QWIA 3TEJA 4BZZA 4DC0A 4D92A 4ZC1A 4F96A 3N2GA 3AR4A 3MWEA 3BXEA 3DKKA 3QLUC 4HLDA 4BC0A 4YLYA 5GONF 1LSOA 2PXAA 2X0JA 4G4GA 2CVFA 1Z62A 2ERYA 2FEOA 4TTJA 5A4KA 1R4NB 4CMHA 4A15A 1E64A 1U04A 2KMLA 4CM8B 1WQ3A 3U1TA 2CUZA 1MAAA 1P62B 1UKAA 3H05A 5EVJA 1SIWA 1QFSA 1NXPA 2BMDA 1E99A 2WPDA 3OO1A 3A4NA 4HSEA 1JYFA 4IH1A 3TGPA 3ZIDA 4AY5A 1NUQA 2HTEA 2PFKA 4TMWA 2GTIA 4TRMA 4YNBA 5JOQA 1THTA 4Q1EA 2CV1A 5H4HA 3SYTA 3SXPA 1W0JA 1BGXT 1NQWA 4HDOB 3COWA 3DE2X 4J2OA 2VQSA 1Q7GA 1XVVA 2B5VA 4QTYA 5IXJA 4OHVA 4OV6B 3T0GA 3WJ2A 1D09A 1TA4A 1W6RA 3AUTA 5E95A 5BT9A 1CY8A 3UXEA 4CM7A 4NCXA 4TL9A 3SYMA 1ENZA 3FDFA 3GHYA 3OQIB 2MINB 1SUFA 2CJXA 3CO0S 4FGSA 1T43A 4WBXC 1ZIPA 3P2YA 3RIEA 4RVNA 1OT3A 5T41A 4RV5A 4OB6A 1NXTA 2FEXA 2I6SA 4QEZA 5HEKA 1X1QA 3U17A 5G1NA 1BRTA 4EAAA 2FZEA 4P5EA 2Q7OE 3EGOA 3RIGA 4WPGA 2QMUA 3V8BA 2X9QA 1F6WA 2R84A 2YOHA 3WKEA 1JSCA 1C2YA 1KZ6A 3KTAA 2FPPA 1UBMS 3EXHA 1QPBA 1ZD8A 2NXEA 1SJ9A 1F2UB 4AF6A 3EGXA 2CFCA 2J4FA 2XGMA 2YMQA 3B53X 3DDOA 3MOIA 5LYJA 3T5CA 1VC2A 2GEJA 5CCXA 3K0SA 4MP6A 2WM9B 1N7GA 4PSCA 3OOJA 5JYBA 3H6GA 3H5TA 3GFSA 1FTYA 3MEQA 3GV0A 1J09A 4Y9RA 1Q6YA 2R97A 2IX9A 3PNMA 1ZVJA 2X41A 5DI3B 4DRZA 3STHA 5JYDA 1A5ZA 1M0EA 1FQWA 4OGWA 1BVUA 4ZZ1A 3EMDA 1RWMA 3G85A 4P3OA 1XZIA 3ASZA 2XGSA 1PFUA 4N5IX 5FA5A 3T3DA 4YIKA 1V5GA 4AQYB 4AKEA 4EM6A 5MFPA 5ICSA 3GQBA 1QTNA 1H6CA 2DBZA 2JARA 2OV2A 2M1XA 2Y1GA 3H2JA 1PD0A 3NOVA 3VR2D 2UYHA 4DNQA 4GVPA 4KPYA 2G4VA 4G1CA 1KWKA 1PCXA 3U4QB 2HRQA 1HEIA 1T34A 4LYEA 1YO6A 2QE7D 3ZV3A 2VDRB 2P8SA 4O0MA 4HLUA 2ROQA 2GPTA 3ORSA 1BCRB 1XEWY 1YDMA 4F71A 3FTPA 3ZNPA 2X22A 4ZGGA 1Z0UA 4DMCA 3C3MA 4LYGA 1Y6RA 4HWRA 1CNFA 2Z3WA 4YUVA 2IS6A 2I7CA 4XR4A 1DMSA 3SXJA 2ISQA 2YV1A 5FPYA 4JXXA 3FPCA 4IMPA 3DJFA 1UWCA 8OHMA 2OYRA 2R44A 3WL5A 3LQFA 1T36B 1OYOA 4GSYA 3NOOA 5K3BA 4B0OA 1IZ9A 2FJPA 3F4KA 4FFMA 2OBBA 1JLRA 3BA6A 3ML1A 2C29D 1KE1A 4Z1OA 3LECA 4UMEA 1U9CA 5AVUA 4EHDA 7REQA 1EX9A 5AXCA 1IL0A 2EFGA 4EHNA 3U39A 5HIAA 3KKLA 4X3PA 5FHRA 2HU5A 2G6BA 1W4LA 3G2HA 4DGSA 4X45A 3DZBA 1JG6A 4D3SA 2F1IA 2AR0A 3ZKAA 4EENA 2IU0A 1USGA 5KYTA 1G4UR 3DBHB 2XJ4A 1U6KA 1ZNQO 1BU8A 4FMCB 2WP8J 1C3XA 3H5NA 5AW1A 3LWZA 1C9JA 2WYVA 3RADC 2O2XA 2X15A 3Q15C 4J0HA 2ZDQA 5L3VA 3H3XA 1GZ4A 3BXPA 1FXWA 1Z5NA 2FPGA 2MJLA 5CVDA 2YS6A 3AXSA 3FW1A 4LSZA 3T9FA 3ZWKA 2IV2X 3J7TA 2Q1SA 4FBMA 4KQEA 2ECPA 3VX3A 4N54A 2PUAA 3K9LA 4QT4A 4TYQA 4CDNA 1G5PA 1TCAA 3MA0A 1VM6A 2GI4A 1WUJS 1OI3A 1X86B 4FNAA 4HEHA 5T4BA 3TZEA 3DAFA 3K6JA 4UMVA 1KVQA 4C0AC 2ZRHA 3ER6A 2VUIB 5FBZA 2ZRMA 3NI2A 1YR7A 2BE9A 3P1JA 3W9YA 4LMPA 2VVTA 1GPMA 2H4HA 4NZYA 3FKJA 1P2GA 5JNSA 3JVUA 2Q5OA 1NT2A 3KZNA 3HL0A 4X95A 3TG8A 1ATIA 1KYXA 4QYSA 3O47A 4OXKA 3G0HA 1YASA 4DT1B 2OSBA 1OXTA 1T1IA 1Z7BA 4IF6A 3H7IA 4MR9A 1PSDA 1YRWA 1UOQA 2A78A 3AESB 2VP6A 3ND6A 4XVQA 5CG1A 1PEAA 1CVLA 3QWFA 3CW2A 4JH0A 3NGLA 4HDSB 2POQX 1W73A 5MN5A 1RXVA 4KQHA 1EGAA 5JNTA 4ZXFA 2CLFB 2GXQA 2Q07A 2Q3DA 4RE6A 4M0PA 4TXHA 3RG8A 2OD7A 3FPJA 1K3UB 1GU0A 1WUHS 4D99A 5FOQA 1OLSA 2YMPA 1A1SA 1J0DA 4IIJB 4N3CA 3RI3A 2XIQA 4OQFA 2HJ9A 2NXJA 3RD5A 4X66B 5CCEA 1GARA 5AXAA 4UQOA 4QVKA 1H0HA 4K81B 4X1IA 4FXOA 3STUA 5PNTA 1EDOA 4DJEC 4NABA 5LLTA 4ENPA 1Z0IA 3M33A 1P7YA 5K7SA 1FFHA 5L6LB 1D1PA 4ENQA 5KUTA 5HOQA 3HYLA 3L4KA 3ZCTA 2VP5A 3K9CA 4OGKA 3QVGB 4RTPA 1SBHA 2OBNA 3GP3A 3Q7IA 1A8UA 4JLWA 5HKBA 3CRQA 2R8BA 1STOA 1YD7A 2P1ZA 1Z8NA 2Y0CA 4TN1A 2PKEA 4H3HB 2EC5A 2AH5A 4L15A 2HPZA 2JAQA 1LLCA 2R4UA 3T54A 3GPCA 2Z4SA 4R9UC 2M9MA 3I30X 4PO9A 3OM8A 4I8XA 3LUFA 3PA8A 4C0LA 5ALJA 2R7NA 5IC4A 1SC3A 4RXMA 1CQJA 2P78A 3EZ7A 3W90A 4INJA 1UC4B 4UREA 2W2PA 2WJYA 3MUOA 2XRZA 3L8FA 2CEKA 3IKVA 2ZTUA 5IZCC 1BEEA 3R9XB 1L4NA 4HN2A 2PGAA 3IRVA 4MWCA 5DNAA 4DS3A 2NO0A 1E3QA 4QVIA 1Z5OA 3FBWA 3U9TA 1NVEA 4EFNA 2GA9A 5D51S 2GZ3A 1CEXA 2ZR7A 1YZVA 3OIYA 3PDHA 5C46F 4R05A 1GSHA 1GR0A 3F4LA 3PLRA 3BB4A 5ILGA 4TXMA 4G0UA 1TK2A 2JPDA 1D9XA 5FOTA 5DK4A 5JD3A 4FC7A 4O33A 3F47A 3D5QA 4WK4B 3N7TA 3OEWA 1KVSA 2VK2A 3K0KA 3LA8A 1Y9JA 8ATCA 3B3JA 1Z8HA 3L79A 2XLBA 5FTJA 4D41A 1E8DA 2F48A 2HT6A 3FVWA 5AVKA 1KH1A 1YFKA 2Y1XA 2Q1TA 4Q82A 3LCRA 3QYAA 1I7DA 1O6CA 2XUJA 3FDZB 4MB6A 2FDCA 2ODBA 3RTCA 4RQBA 2QZ4A 3ILVA 3UT0A 2PT6A 1VFNA 2ASVA 3VNRA 2P27A 3VH1A 5B1DA 2XODA 1XAJA 2WOOA 4ZREA 1CRPA 4Q3DA 5K8UA 2W8BB 1VB3A 4RZUA 3DT8A 1FNMA 2IIBA 4JKYA 1CT9A 1JJFA 3GX1A 4KLAA 4MS1A 5GGYA 4CQMB 2FQYA 3WSTA 5FUVA 3GLGB 4G1VA 2H1LA 1E0SA 4B9EA 4WLEA 2GBLA 3E6AA 5LLSA 3DEJA 1HLGA 4OHPA 1V37A 5EJAA 4DNPA 2ZUEA 3E53A 4M7RA 4IDCA 2VJMB 1ULTA 2FPIB 3ZK8A 2NW6A 4JQSA 2CXTA 2DT8A 1ZM7A 3AEQA 2RJOA 1DPGA 3LDUA 4U5QA 4V0RA 3SHTA 3ZGXA 4BB5A 3R6DA 1QDEA 4ALLA 3GFOA 2P9JA 3DE6X 3LDAA 4G0QA 3CLHA 2OLEA 1QVWA 1Y7TA 1SK8A 4BBZA 1WB9A 1N9KA 1DBVO 4D9IA 4CM4A 1SKQA 2VZ0A 3HBAA 4ZKDA 2EAUA 5J47A 5JO0A 3LX4A 1ZK4A 3T7KA 2PUVA 4WJZA 1GG2A 2A92A 4RSGA 3VMMA 3WYNA 5K05A 4DQKA 4G25A 1RQNA 3MGKA 4Z49A 5AH0A 3FBTA 3VHXB 5JSUA 2BMJA 2PKCA 1JLSA 1IG3A 2D1FA 4F5YA 4PYNA 5G0SA 4ZK6A 1YCFA 1L5VA 2BEWB 4RA9B 3A4VA 4BLPA 5CNKA 4FS8A 4ROSA 4NENA 1E32A 2GJKA 4LXYA 4PLTA 3FDJA 3ZZUA 4FE3A 2GR9A 4M1TA 3FN4A 3ZN2A 4ALNA 5H81A 1BDHA 3OF5A 4MR7B 1HOXA 4LGCA 3MWGA 1ORHA 3UUEA 4UUQA 5F77A 3KLPX 2VDMB 4EYGA 1JYSA 2Y1FA 4C7OB 4GI5A 3LK6A 4DARA 1VFPA 2QN1A 4ZI7F 5F98A 1T4BA 2IYPA 1N6KA 2VAPA 2WHPA 5AUQA 2VHQA 3HFSA 2CMDA 3PFWO 1E2KA 1K06A 5MGNA 1G21E 1GG9A 2GZHA 1G8MA 2YWRA 3S7ZA 1UK6A 3IXMA 5TJ9A 1YRBA 2LCIA 3ZXXA 1FVFA 2C9BA 2ALJA 3UOGA 4PO8A 4WHMA 5JRZA 4EO4A 2ZUUA 2WA2A 3OUUA 4TPKA 5HBGA 3SWWA 4TWZA 5BSUA 2BY4A 2GYUA 2OHXA 1N3IA 1R18A 2W11A 4M3NA 4ND5A 3WK9A 4IVRA 4F8EA 4U7FA 4UQLA 3SHQA 5KWEA 1VLJA 1SXJC 3FNFA 2D7DA 2PE5A 1GV1A 5LB4A 3TSYA 3WWZA 2F3TA 5I7FA 1PZFA 1A8QA 3NPMA 3FSRA 4GOJA 4EECA 1I2MA 3AEUB 2RCNA 1DIAA 4NFSA 4ZCRA 1BH2A 2C2WA 1SC1A 3OZRA 2Y76A 3RAEC 3UKOA 3H17A 3GROA 3GT0A 1N34B 5JXJA 1KARA 1PWEA 2R6DA 4R69A 2R5WA 3WFJA 2ZIXB 1G6HA 4FYIA 4C6HA 1ZEMA 5IXSA 2REQA 2YHIB 3NB0A 5M7EA 5DZSA 3HCRA 3DV0A 3FG9A 4LIPD 2AC7A 1N9GB 3ACBA 2OA0A 4ZAZA 2R1VA 1UJ2A 1M54A 3EIOA 5L4SA 4X60A 2VP4A 2QX9A 2CDNA 3ID6C 4RVDA 3N2KB 4ZAFA 3H5AA 3Q0IA 1MO2A 3RS7A 3BPSA 4HYTA 1Y4DE 1Z4PX 5HCUA 3QYPA 2WSLA 3EVAA 3V9AA 1K5HA 3L3BA 3UOAB 5HNKA 4C4OA 1NMQA 4Q3NA 2D1YA 1DC3A 3I8XA 3HO8A 3ZE8A 4ARBA 1LH0A 3E61A 4KE6A 1MN6A 2R8XA 4R9NA 4UU7A 1R3DA 1HFKA 3MK31 5BQ5A 1WHTB 1XEXA 1YBAA 2GM9A 2JZCA 3BF7A 3K09C 3L8GA 4H1TA 3RJ5A 1I24A 2JCVA 4ZJZA 2V7VA 2D0PB 1QRSA 1XNQB 3QBJA 1MG5A 4Q34A 4TKVA 1ODLA 4OH7A 3TXYA 3EVEA 2I6UA 3VV2A 4BPBA 3HJCA 5EG5A 2IUFA 1U1FA 5EGNA 2F8LA 5EXDA 3FGNA 1Q7TA 1BKDR 4Y7CA 1Z2NX 2QAGC 1A0OA 3GFFA 5DV9A 2P4UA 4EUHA 1OA1A 4MR9B 4EUSA 4C30A 3IPXA 2JB9A 1GZHB 3LO5A 1N4DA 4HATA 1LRKA 2R5FA 3NWBA 1ULHA 3OPVA 3PHGA 3NHLA 3SYLA 3OJXA 4BHTA 3M5PA 2FSSA 1GKLA 4HDNA 1M5RA 4NR0A 3K6RA 1ZHFA 3L43A 4MQ5A 2REOA 1QNFA 1NLFA 1XHEA 2BV3A 4E2ZA 9GPBA 1O95C 2OP1A 4TT3A 5MN4A 2IYTA 3GYBA 4XIFA 1QOZA 1GUZA 4FYYA 5U4QA 1DIHA 1G20B 5C32A 1TLFA 1QQTA 3F9IA 2WD9A 1HDXA 5G0TA 5JAQA 3NX4A 3ER8A 4LNAA 1MMFB 4L76A 2QXYA 1KBQA 3EEIA 4JOQA 1CP3A 5K20A 1IH8A 2O7RA 3KKQA 5BMVF 4IRMA 4BFYA 4X85A 2PR7A 3I73A 4UNNA 3T9BA 2EGHA 4KLNA 3S1LA 2R66A 1LNZA 2G9UA 5J23A 4MRAA 1HLFA 2YCBA 5HQTA 5IUNC 2EL7A 4JT4A 2XQKA 3ZWBA 3HGTA 4PZ9A 4FIZA 3WIUA 2CY0A 4MVCA 4QPZA 1SU7A 2CNOA 3CXUA 3FNBA 4YMUA 1PNTA 4BO1A 1YQWA 5HYVA 1P3DA 1U8AA 1VI5A 3UENA 5FWYB 1ESNA 2PRIA 4KYUA 4UXIA 4KFCA 1RJWA 5AVRA 3NHFA 4FYMA 2O8FA 3SE0A 3JVDA 4B4UA 3PD1A 3HB5X 3PUWA 4DLLA 1NWCA 4R1QA 3RBAA 1R8XA 2C7PA 2GYYA 2EJBA 4JFRA 4X41A 2BJVA 1VJDA 1YBFA 1VBFA 5CIQA 1OAAA 4DA4A 4L8FA 3NS7A 5DO9A 1G3QA 1VL8A 2PVCA 2RIRA 3LUGA 3JQ8B 4KR0A 5EIBC 1A5BB 1GZDA 4ZHQA 4DV2B 2CLHB 2Z2YA 4FT2A 2J85A 3EXG1 3M5CA 4MPDA 4RNCA 1S4QA 1XUOA 4X92A 1CEEA 4BLSA 1QNLA 4OP1A 5AI8A 3O90A 3T5BA 1OLUA 3GEBA 2GZDA 1XTRA 4ZOLF 5CX4A 2WUGA 5AK6A 1EXWA 2VSXA 4F97A 1P5RA 4G07A 3KEOA 1P33A 1G3UA 2XQFA 3SOZA 3CNNA 2DUWA 1NYRA 1AB5A 1TCBA 3RROA 2CLSA 3GWGA 1Z82A 9ABPA 2GKGA 3ORHA 2VRNA 4JLVA 2PBRA 2J7PD 2PMWB 3BG5A 4HGOA 4E4YA 4RH0A 3ZWDA 3ZXUB 4D9HA 3CF0A 2EV9A 3O8BA 3KSBC 3E0QA 2Q4OA 1HE8B 1ZK3A 4MTCA 4WUVA 1PQWA 1QYIA 1B8OA 2I71A 3D6HA 2WTBA 1THGA 3SHFA 3AI7A 4UCFA 4PHHA 5KBYA 3RC8A 2MSKA 2EL9A 2QYTA 1RMYA 1RAHA 3JQGB 4QOSA 4BXOB 5JS1A 2YBEA 4PFQA 3WWPA 3VDNB 4C06A 1WV0A 3OURA 1O58A 5I9IA 1PEKE 2VNJA 4IUCS 1X3LA 4RANA 3M1AA 3ZHOA 3QEBZ 1R8SA 2HA7A 5EWJA 2D3WA 3HB4X 5KU7A 1GKKA 4IVNA 3BL5A 2IUYA 3VPHA 3OSZA 1LLQA 1M0WA 2GRAA 3HB9A 3MTDA 1KQGA 2X0DA 2VI5A 5HF6A 5JCJD 2HX1A 3RAGA 3H86A 4RIGA 3ZEAA 1M7GA 2KM1A 2WNIA 3AUUA 1Z7YA 4DF3A 3D8SA 3BRSA 2FW1A 2OMEA 3I2HA 3BMOB 1K0UA 4MRVA 3MB8A 4RH1A 3ROXA 4AJIA 5F1YA 3PQ5A 3UAXA 1N33B 4AMYA 4YCCA 4MKFA 3HFGA 4YRMA 3QXXA 4PIPA 1GGNA 1LJLA 2RGDA 2QLNA 1ZSYA 2ANCA 2HSEA 3R20A 4MV9A 4NEGA 2Q1YA 3DFFA 3AIKA 4ZVRA 3SS7X 4ENWA 4DABA 2FW7A 4MQUA 4ZMRA 3BTVA 3QVXA 5AHRA 3ZTTA 1G9XA 5EIXA 3BICA 4RZHA 3EVFA 3FE2A 2OVFA 3NYRA 4II3A 4RBNA 5K03A 5C8YB 3BWDD 1F2TA 4WSOA 4ARUA 1OAOA 1I3OA 2G8LA 1HOTA 1QE3A 3F7MA 3PVSA 4J7CA 4X1YB 5DLYA 5HJEA 1KQOA 4P3KA 4CQNA 2I1WA 3TKLA 4JLNA 1W52X 1UKVY 3LKDA 3P71T 3GJRA 4HQ0A 5JEEA 5TPZD 5ADUS 5DRYA 1ECLA 2HF8A 2IOFA 2X1HA 4N7BA 4F45A 4R7GA 2O8CA 1NNSA 2BGTA 2ILTA 3B6EA 1NVVQ 4ZEWA 3KZ1E 1G42A 3PC3A 4HBGA 5DXJA 4IEEA 1DUVG 4Y6QA 1JDTA 3NHRA 3HCBA 3ZDBA 4BTEA 1TYBE 3AI1A 3MHPA 4TLMB 3ZV4A 2VAWA 4I9GA 3W6PA 5L95A 4DV5B 4P4NA 3A9SA 1QIMA 4WZAB 3UJBA 4EWLA 5CFPA 1CG6A 3HJBA 2OL4A 2HQSA 4YIHA 1E3IA 2DWUA 2Z8ZA 4PC3A 1HMPA 3U13A 3A4LA 1FP6A 4LF4B 4KIWA 1UADA 3D0QA 2DH6A 4GDMA 4Q4JB 5DWVA 3HB0A 2C8JA 3AERA 3K6SB 2QTLA 1EXDA 1J8FA 3D7NA 1ECGA 3WMFA 4U7DA 4LNUA 2XNKA 3U44A 4RKWA 4MVJD 1MOQA 2HH9A 4OOEA 3F8WA 4KUGA 1UMCB 2ZB7A 1ZVQA 2NADA 3F78A 1SU4A 5CDYA 4QOHA 3X44A 1T6BY 1XZKA 2BKAA 4GD3Q 4DUPA 2WB2A 5DCLA 5FPPA 3RYIB 1PFGA 3G79A 2I1QA 2GAAA 4CIDA 2WSBA 3LWDA 1HZJA 2DTEA 1JJAA 5IVPA 3UMMA 4UE2A 5EE1A 4ALKA 2BEKA 1PR0A 2OPHA 4K26A 2PZMA 2KYRA 4HAOA 4BLUA 5CTAA 4FR0A 1R6BX 3U31A 2FSIA 4IIYA 1Y8QB 2C3MA 4LWPA 4OJNA 4DDUA 3UV3A 1TIKA 2QA5A 1E9CA 1TJPB 3FUCA 1NI4A 1W6UA 5TQJA 1JX6A 3M6VA 1DBSA 3ABRB 3DKVA 5J43A 3T4XA 2EX4A 1D2AA 5FOXA 3VOBA 2GCGA 4TX1A 4CG3A 5FI1B 5EKXA 1HQDA 1PG0A 1PR9A 1E5DA 1WABA 1EEHA 2I87A 1ISFA 1SG6A 2NIPA 2Y92A 4I08A 4O4LB 5ALRA 3A2MA 5DN9A 5EMMA 2MYTA 3GA5A 5DGTA 2BEUA 1V5WA 5B58C 4IUDS 2DFNA 1IM2A 2OK7A 3UWMA 2AG5A 2C3PA 2ZWMA 4OQPA 1KSGA 2ZTLA 3DCIA 4YAIA 4K6MA 3TKYA 1Z4OA 2ODEA 1OUMA 1XE3A 2LE0A 5EXXA 1THZA 1EFHA 1OZFA 1KP3A 2COKA 2ZB4A 1GG8A 3FNHA 4KXWA 1XDSA 4YJGA 1W5TA 5JS2A 2X0KA 2VF8A 2A7QA 2NN3C 3OQHA 1RQXA 1FUKA 3AY0A 3AY6A 3IDFA 4TV8B 1WDWB 3TUZC 4PWYA 3EFOA 4Z53A 2O8DB 1IHUA 1O9HA 2I0FA 1DWOA 2JKVA 1IBSA 4CF7A 2ZYSA 1JT9A 1A9XA 1VPEA 4A2PA 3K0AB 1U98A 2YIMA 3PGMA 1YC5A 4JYBA 3F5DA 4BUCA 1A71A 1DDIA 3OY2A 2D13A 2WIGA 2YZMA 2X1LA 4C3ZA 2VBIA 3EXHC 3LNTA 3A4MA 4Q03A 1B8VA 2GK4A 2EEZA 4U63A 3KZMA 3K20A 1Q0SA 3JYNA 4L57A 1AQIA 4P7BA 2QIPA 3V4ZA 4ACAA 1UQUA 4Q12A 3H84A 1ELOA 2DJIA 2L19A 4WLVA 3KKKA 1E2EA 1M34B 2DP4E 3UC5A 4MW4A 5BWOA 3N0RA 3TRKA 1UC9A 1T5OA 2ZI6A 3WSVA 4E5YA 5HKAA 2JLWA 4F9GA 3JTMA 2GYWA 3VJKA 4B2YA 1TUEA 2FLWA 2YUTA 5K8JB 3W3AA 2JDID 3D6JA 1X13A 4HF7A 4BOYA 3N8HA 3H99A 1Z18A 4Q4AA 5ALUA 4XCQA 8MHTA 2H1HA 4QKQA 1KY4A 4I66A 3C8MA 3H3FA 1JKJB 4PWZA 5GONA 3O8CA 3CVOA 2VPQA 1ZEJA 2WHQA 2ZQYA 4WVFA 4QBIA 3QOFA 1RLMA 5DMHA 4KZKA 4RTQA 3WSWA 3SQNA 4A0FA 3HRHA 1VE5A 1QQBA 5AW9A 3BD7A 3IX7A 5CFZA 1OASA 2AG8A 4JGIA 2QP4A 3ITKA 3L5OA 3MOSA 4HI0E 2VP9A 1A4XA 2GWRA 4MLDA 2P2CA 2R11A 1A8HA 3BDIA 4RY9A 3U2QA 4O2AB 3F6BX 3MVEA 2BKVA 3VVCA 4BVKA 4KR6A 4H7HA 1Y5LA 3G2NA 2BH2A 2CFOA 2DM6A 3FMOB 4WCVA 1ZUWA 3EH1A 2XUHA 4GOXA 4BKRA 1IQPA 3RARA 1JU9A 4WBNB 1GPAA 3EZFA 3OZCA 1AGYA 2YUIA 3QNMA 4QBFA 2XMBA 3VU9A 4XYEA 1PJCA 3M9XA 2DKOA 4I46A 4HH3C 4X1OA 7ABPA 2FPLA 3R0XA 3KJHA 1QFZA 3ND7A 4ATNA 4BMPB 1NE7A 4AP9A 1QCDA 3GDGA 2QBYB 1O6FA 4EDFA 3QF4A 2A9OA 2Y4OA 4C21A 2XPCA 1Z7WA 5I7UA 3RTBA 3ZTYA 1ADFA 3ZVNA 1GGEA 3RPEA 1SELA 2GRJA 4TRNA 4AJ2A 4QVGA 4YAFA 5KAPA 4AX4A 5B4VA 2QTGA 5K8TA 4A27A 1IJBA 1D8AA 3GAFA 4MROA 3M34A 3HVJA 4G23A 4DV1B 2QI9F 5CHEA 2Y68A 1ISMA 3HCEA 3RT1A 1ZK0A 4JLMA 4WD3A 5F21A 4AD8A 4E2YA 3A1DA 3LP5A 2GN2A 5A5EA 1NR7A 1XWFA 2BT4A 1U1IA 2C7VA 3URMA 1VPLA 4C4PA 4EI7A 2A3NA 2WJGA 3LYAA 3PITA 2WWXA 2GVDC 2ZSJA 5T4HA 1XAGA 1JDBC 3B78A 4K46A 1Q7CA 4EI2A 1EXMA 1ULUA 2J31A 5FTLA 2OD2A 1TEZA 2RHWA 3CVUA 2G77B 3E7PA 2WILA 3T7RA 3WNBA 5DNEA 2HGZA 4E2FA 4GL2A 1T15A 1JHRA 4QPJC 3EC2A 4JBYA 1OTXA 3VJLA 5HSGA 4A0GA 2QRHA 4CBVA 4N0DA 1JHUA 2ISSD 2JIQA 3H11A 2XYQA 3KAPA 4AIIA 3A0RB 4HWKA 4DMLA 2XT0A 4FJ2A 3X3HA 4H2DA 1ECPA 3NUGA 4DXDA 2GARA 1R5JA 2QW8A 3BIFA 2A9KA 3W5HA 3VQTA 2JBHA 1KQPA 3OI7A 3HY6A 1JIKA 1WJGA 4NFLA 2AN4A 3FROA 3GL9A 2H00A 2JW5A 2BCEA 1SGWA 3U6KA 4RMHA 5DWQA 4EGSA 1I0LA 3M49A 4G1MB 5F76A 3N3AC 3BAFA 5AT1A 3RABA 1QZZA 1XDGA 1G5FA 1GZ7A 2G4LA 3IE2A 4OMCA 5E9JA 4CTOA 5CA1F 1EZZA 3LOPA 3CKKA 5ES3A 3GDOA 3OX2A 1E58A 1P2VA 4G89A 1NV8A 2WT4A 3RCBA 1HNXB 2Z5FA 1AF4A 1B41A 1TTHA 4DVGA 1C2TA 2ZANA 4QYIA 3B20A 3W2FA 4HVLA 1Z7GA 1Q7EA 1WHSB 1UPXA 3W6OA 3RC2A 1MW9X 1QH8A 4KMMA 4XFDA 3DZKA 1DXYA 4MV4A 3WQHA 4RFVA 4C05A 1DUIA 3F1KA 3R5KA 5HUHA 4MW5A 4CLXA 4MS4B 3BXHA 5JPIA 3OECA 3GJ0A 4I4CA 4M38A 3TMKA 5KOJB 5LQNA 3QVOA 2DR0A 4MKIA 1ORWA 5FKJA 2TSYB 2XYHA 4K40A 4FWIB 4Y8VA 3ZV6A 2LNDA 1Z08A 4M83A 4HRXA 1NWHA 2A94A 4Z4HA 4AXBA 3C6MA 1Z4JA 1K8YB 1XVAA 2VYFA 2P77A 1X19A 2OESA 3MC1A 5KDOA 2X2OA 4GECA 4QXRA 4D42A 3RLIA 1DTSA 1DCMA 4W9RA 4LV8B 1U99A 2RHJA 1JECA 1FUIA 3ZIAA 4NBRA 2D2XA 3IIEA 4QPNA 4WCFA 2GSWA 1FOEB 3G9ZA 1YRQA 4OU5A 3RS3A 4BUJA 4JJGA 3GJ5A 4KQWA 4GE3A 4RCZA 4Y18A 1JIVA 4U6QA 4L7VA 3OA0A 2QTVB 1ZK1A 3DO6A 4D4HA 2FOIA 1WMDA 3JQBA 1OXXK 4EY7A 4YJ3A 4DAOA 5JTTA 1K9VF 1ODIA 1JHAA 1W2WB 2WG0A 5HRUA 2EZ8A 3MBIA 5DM60 1EJ6A 1E63A 2CLDX 1Z17A 3SYNA 4HZUA 3CF4G 1DHTA 2ORIA 4M1WA 1MJ5A 3KRTA 4S2EA 1M2WA 3B2QA 3MCZA 2BFPA 2BKEA 4YBRA 5KNCH 1RCTE 3PNBA 1CD5A 1CJSA 2Y1KA 1JG4A 3C45A 5WRFA 4Z4EA 1IUNA 3CO5A 3PIRA 3E0XA 5F2EA 3BAZA 4YRPA 2ZIAA 3C70A 1WM1A 2VK1A 5KYVA 3E9MA 2A0XA 3RU9A 1XF9A 3TQIA 5BSRA 4IL5A 4A36A 4PX2A 3ZI7A 2J9XB 1L7VC 2VDVE 5LN1A 3IERA 2BMWA 4KXVA 4P36A 3VNVA 3LI2A 4FK8A 1GFSA 1K7XB 1Z3CA 2E4UA 4N8EA 4W8GA 3DKIA 2I2BA 5DIFA 4ETMA 3UMVA 1JEJA 4FDUA 3RYHB 5HDBB 3W9UA 4CCYB 1NQAO 5B6JA 1ESZA 3W8RA 1YV9A 1DCFA 1XNRB 4OJQA 4Z9FA 4MXDA 2VH1A 5ERXA 2HDWA 3AC0A 3CBGA 2JLZA 1XU9A 1EEXB 3VKVA 3WDMA 1BMFD 3NP7A 2ID4A 3NAGA 4LXXA 1RE0A 3BXGA 1YQ9A 3QKTA 1MQ8B 2LRHA 3VPAA 1I1QB 2CXPA 3GUCA 3UMFA 4DCJA 5LQDA 2D2IA 3OZWA 3T7DA 2JBAA 2H5JA 3GK3A 2M6SA 3QELB 3OHSX 4NTZA 4OBBA 1ZL0A 4LNHA 1NVAA 4YI5A 1RM0A 2PTGA 1TKAA 4W1RA 3SJCA 1Y4UA 4LZPA 4MGHA 2NV0A 1P5JA 3IUEA 2CNNA 2RSLA 1D4ZA 3NNDA 4CUKA 4UUMA 3Q8LA 1GNQA 4IICA 4BNDA 4I5GA 4JUBA 1XELA 1H1LB 2G9ZA 2R6ZA 2WINI 4RHFA 3S2GA 4IS3A 1R3UA 5G0WA 2W98A 1VLVA 3RRJA 5I01A 5JZVA 3AVXA 2GBLC 1GPNA 3NIFB 2JFFA 2PRSA 1AIPA 1W5BA 1GNSA 1S2DA 3MRTA 1Y98A 5LP6B 1E5TA 1A9YA 1M1NA 3GFVA 4HDMB 4O08A 4CKBA 4F9FA 2QUIA 3OLCX 4HDQB 3WRVA 1T91A 2EX0A 1RMTA 1AG9A 2PD4A 5EYPA 3GA7A 4KQ2A 4LI0A 2OQVA 3AJRA 3ROGA 4E2XA 4EGAA 1F48A 1GQQA 3R5HA 1A8PA 2QLMA 3Q3GE 3RIYA 1YZFA 5CYPA 4NECA 2DSTA 1E7SA 1QZXA 2G5PA 1MC1A 4I14A 4EG3A 3AL0C 1KZGB 2EWVA 4P4LA 2A8YA 1K6JA 3L0IB 5LWQA 1G5IA 3O8DA 4B34A 4ZQEA 3CEMA 2AF4C 3PQ8A 4BS9A 3HKDB 2BJWA 4E22A 4IHJF 3GJ7A 3EIHA 2VXBA 4M1YA 1DDGA 2RGGA 3H5IA 4B82A 1VYTA 2ZRNA 5T64A 3ANNA 1ZM3A 2OOKA 4DG8A 5G3ZA 2GHIA 4ZCMA 3FYUA 4JB2A 1Z75A 2AVNA 3BD8A 2DWPA 3PPXA 4PCAA 4PTYA 1JMKC 1N2CA 1XRJA 2W2XA 4HWOA 3QX9A 4TTRA 5FLYA 3CB2A 3MCAA 2ZXUA 5C52B 4EY5A 4YJ2B 1T9DA 1QIJA 3HCWA 4NG5A 1X2BA 4HAWA 3VX4A 1A88A 2W2NA 5EKDA 4DPKA 1PZNA 3OY7A 1W88A 2CFIA 3DZJA 4HMPA 3Q98A 2I6TA 3A6LA 4X71A 4BFXA 3I2JA 3N0XA 2BUBA 1ZJ4A 4O1IA 3VR3D 3FCEA 3OP4A 1T8TA 3NT5A 3JAKA 1NN5A 2B3DA 2D2VA 3KLOA 4H77A 2YDYA 2W70A 3ZDRA 1CRZA 3A6EA 3H2ZA 5T5QA 5AICA 1JVSA 2AK3A 2CYBA 1P61B 5EXTA 1CUFA 3MQFA 1TCCA 3DXYA 3LPCA 6NULA 2FMIA 3THOA 5F7OA 1NW9B 2FGKA 3ZU3A 2FPUA 3E9ZA 5CPBA 3P0RA 4ECEA 1WV1A 1MAVA 1W87A 2P6PA 1OKKA 4BNZA 1WW3A 2BAGA 3C74A 2YZKA 1KOLA 4BQSA 4CM6A 1UIMA 4D45A 4NF2A 2W4IA 2OV4A 1EGMB 5E2BA 4MVXA 4DBVO 3SYRA 3R5TA 2A0WA 2ZSFA 3DONA 4ASUD 1Z2EA 2CXNA 2G04A 5CB4F 3JQDA 3OF2A 5CVJA 3STWA 4RSRA 1ZGGA 3CR7A 4ALJA 2JJQA 2QM3A 3ZW8A 1SMKA 3EQ6A 2LXNA 3I01A 4W5OA 4C4RA 3HK2A 3ONFA 2W90A 3L4BA 1R6XA 4NCHA 1UCFA 1T9CA 3ZDYB 3WA6A 3ZWNA 2VOJA 1NFFA 3LZDA 1PTKA 2ZI5A 1N6IA 4M9RA 5TGTA 4FLEA 3TWOA 4BKQA 4DJFC 1XMVA 2BFCB 4PXSA 3IOMA 4HGQA 5EJ2A 5JG7A 4DTIA 5B7PA 4N12A 3CSUA 3TR5A 5B3JA 1M1YE 5BRJA 1TT5B 1M8GA 4OAQA 5LZ4A 4TVSA 3F8SA 5C5CA 4LS3A 2IKSA 1O94A 2V9PA 3VV3A 2JAXA 4I1IA 5HBRA 3LA6A 3HXQA 3HNPA 1FC0A 5EP4A 4CWAA 4ZIRA 2DEUA 3GRYA 5CFRA 3EY4A 3RK4A 1ZVMA 3I37X 4GX0A 1Z4LA 1A95A 3WL4A 4FI3F 3G0CA 3RU2A 3P0FA 3DLAA 2W6ZA 3Q2IA 1U4SA 4DRXB 1WX1A 2J6BA 4RFLA 2W4MA 5AVOA 5KTKA 5DT2A 2C0QA 1FS4A 2J9GA 2G25A 4PLWA 1PQPA 3IVGA 3SJ7A 1A8SA 4X3OA 1N5IA 3RVSA 1JF8A 2V55B 3GLHA 3W2GA 5ED4A 5DHRA 3K0FA 4E1VA 4CKZA 2XUIA 4JASB 2H51A 3FVRA 1ODTC 2C03A 1VIVA 3BOSA 1E4EA 5TQ0B 3R3VA 3BH6A 1FBNA 1SXJD 2DG2A 2X7JA 2O3JA 4JLSA 3FNQA 1D2GA 5CT8A 5IBCA 4EW6A 1Z13A 1HRKA 2GETA 1T3SA 4A0RA 3L7LA 1IN6A 4E08A 3D54D 5LD2B 4RWEA 2ZT8A 3DBIA 1C41A 1TUIA 3PDJA 1Z37A 3NGXA 3TEFA 1K9SA 1G2QA 2RHDA 3FMVA 4FC6A 2CWDA 4TLAA 4CL2A 4O4IA 1X8LA 2ZJBA 4X1KA 1P0PA 1EWQA 1EUDB 1Q1AA 4INZA 2WJ6A 1WZIA 4MRRA 4KE9A 4NBKA 4AY4A 3W2HA 5HGXA 3J7AC 4TYPA 2I78A 3W8NA 2ZRCA 3AVUA 3IQIX 2DCMA 3KAKA 1XQ6A 1OBFO 1QAQA 4EZBA 1QZUA 2AUTA 3KUDA 2AX3A 4DCCA 1RYZA 3HYNA 3DNFA 3T5MA 2Y4NA 1WEHA 2Y9MB 3EVZA 4OK5A 1Z0DA 2X5NA 3CUYA 2HHJA 3ZQKA 1RADA 2AMYA 3BERA 4NULA 4YRGA 4HNTA 2EFHB 1HQKA 3CF4A 2IEAA 3OQPA 4DV4B 1ZHOA 1Z74A 2PWPA 1RD4A 3LHSA 4JFAA 4WAUA 5H68A 4C6RA 4BASA 3P26A 1YDWA 2K2QB 3KYDB 4R7ZA 5FUXA 1YI1A 3O9ZA 4GQBA 4EA8A 2OM6A 1Z25A 4MLZA 1TU4A 4BIMA 2AOTB 2PBZA 1KRHA 3MS2A 5KTPA 3OFND 4TKMA 3W9SA 2E55A 2VBCA 4LC9A 4ZQGA 1LLFA 5FI0B 3TL6A 1YZ3A 2CXUA 2BFOA 1PZGA 2JC3A 2Q21A 3ZGOA 1JTEA 2R6FA 4RTJA 4MI6A 5CLJA 5E1MA 2DHEA 2IHNA 2O5CA 3H9CA 3G5TA 3RG2A 1EVEA 3NFYA 3BJIC 3NDPA 5DGHA 4GL4A 3QW2A 5ENZA 3B9QA 1AV6A 1ZQ9A 1U0HC 2ODPA 4L9SA 2GPBA 2MMGA 3IMGA 4HAYA 2QMZA 1C7JA 4JVNA 3UKDA 5KHAA 5C1BA 1U9YA 3AVWA 5B2FA 2UUBB 4TXNA 1DFGA 1JXQA 1O95D 4X20B 3T7CA 4MHSA 5BN4B 2WR8A 2ZTMA 3KR1A 1E1LA 4R1MA 5B2EA 1YACA 2EATA 5LU9A 2WLSA 5EY5B 3BQNB 4EUKA 3UPTA 2X4DA 2RMKA 4I9NA 2AN9A 4TV9B 4ZARA 3EGDA 3RFUA 4LTNA 2HMSA 4FMCF 4WMLA 5AJTA 3GNSA 3IUJA 4CKWB 4W9MC 2Y93A 3S68A 1LZKA 1W4AA 2FPKA 5BQXA 5ALGA 3WFIA 1ECCA 1KP2A 1NW4A 3JWGA 1EYZA 3QPDA 2EERA 2GJAA 3CUWA 4Q1BA 3ZBUA 4IJ6A 3UHJA 3KHKA 5AQ1A 2O3TA 4P22A 1N5JA 3G82C 1UK9A 3C16C 1GL9B 2OOSA 4INOA 4P92A 4FDVA 5EKTA 4BQNA 4E94A 5BMVA 5TY0A 4UBIA 5KSWB 1IJEA 2JLUA 4EG8A 2VZ8A 4YWJA 3TLJA 5LBTA 3MQ4A 3S27A 2PUHA 4MRNA 1I7PA 3VU8A 2OFPA 1XEAA 1T8SA 2C4NA 2UZ3A 3CLUC 3MILA 4JOBA 5DULA 3VISA 1J49A 2ZVJA 1QGUA 3ANYB 3IUNA 2P8JA 1IMOA 4OJTA 3O8OB 1L5SA 3VUEA 1U0BB 3BJEA 1SVNA 2JIMA 3B1ZA 2XCUA 3K9GA 1XPJA 1RXEA 1D2MA 2BFMA 3UJCA 3EZXA 2IP2A 3MJHA 4QARA 4RADA 4MEJA 1ZN2A 2OHJA 3UA4A 4M8SA 5KREA 1VXRA 1XSEA 2X5XA 4PLCA 4D3DA 1D2EA 1FUEA 2ACWA 2J5BA 1ZKDA 1M0SA 5KWSA 4I9FA 1PFKA 2F3UA 3T5DA 1Y37A 3EHEA 2AFHE 5EIBD 1MQ9A 2HJRA 1SPXA 4OY3A 4YAKA 3ZWXA 4R0NA 1JLLB 4TS1A 4MV5A 4KH0A 5JJLA 3LX5A 2XWQA 2IPNA 2IQ5A 2UZ1A 3M6AA 4LCBA 4R1LA 2QL6A 4OUKX 5C7OO 3QIAA 1XXLA 4BMYA 4G8DA 2XVXA 4CDRA 3SC2B 5LKRA 2D0DA 1ENYA 2LR0A 3TYXA 5LQKA 2WE8A 3EE6A 3FY4A 1EH5A 1NDQA 4NJEA 5SY4A 4IIJF 3NC1C 1E4YA 1FYWA 1SURA 4KVFA 2CLMB 4JVLA 4P4SB 4ZOLA 1DAEA 4OMFG 3U3KA 1Z63A 2ZXFA 1QB8A 3KKPA 2VRCA 4U0JA 3DCYA 3OPQA 5FA6A 4O02B 1R37A 2PBFA 4UNQA 1U63A 1AKVA 5A4JA 3E9CA 1XD2A 2H18A 1X1BA 1UANA 4LUCA 1DIGA 1TDJA 3VDMA 7AT1A 2QUBA 4CI0B 3OTOB 1ONBA 2B9EA 4R01A 5EEHA 4XLTA 2GNAA 4DC9A 1O6ZA 1OFHA 1QH9A