2C8FE

Structure of the artt motif e214n mutant c3bot1 exoenzyme (nad-bound state, crystal form iii)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
202
structure length
202
Chain Sequence
TYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPENIMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYIDPISAFAGQLNMLLPRHSTYHIDDMRLSSDGKQIIITATMMGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONO-ADP-RIBOSYLTRANSFERASE C3
publication title Structural Basis for the Nad-Hydrolysis Mechanism and the Artt-Loop Plasticity of C3 Exoenzymes.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Transferase
total genus 61
structure length 202
sequence length 202
chains with identical sequence F, G
ec nomenclature ec 2.4.2.-:
pdb deposition date 2005-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.176.10 Alpha Beta Alpha-Beta Complex Toxin ADP-ribosyltransferase; Chain A, domain 1 Toxin ADP-ribosyltransferase; Chain A, domain 1 2c8fE00
4XM8A 5GTTA 4PKWA 2A78B 1OG3A 1PWVA 2C8CA 2WN8A 4TR5A 4H0YA 2C8FE 1JKYA 2GWMA 4XM6A 2C8GA 2J3XA 5D1UA 2C8AA 2WN7A 1YQYA 4PKQA 2WN5A 4H0VA 4XM7A 1OG4A 4XSHB 1ZXVA 4ELNA 4PKTA 1GXZA 1QS1A 4H03A 1OJZA 5H03A 1GIRA 3U0JA 2BOVB 1R4BA 1PWPA 5BWMB 1GY0A 1QS2A 1GZFA 2C8EE 3NTSA 2C8DA 3BW8A 2C8BX 4PKVA 1R45A 2WN4A 5D1SA 5D1TA 1J7NA 4H0XA 4XSGB 2WN6A 2A9KB 1PWUA 4PKRA 3BUZA 2C8HA 4DV8A 1OG1A 4GF1A 4FXQA 4PKUA 2GWLA 4GY2A 4WF6A 2J3VA 1OJQA 1PWQA 5H04A 2C89A 5DZQA 1GZEA 1PWWA 2J3ZA 1UZIA 4FK7A 1G24A 4FMLA 1GIQA 4PKSA 1GXYA 4H0TA
chains in the Genus database with same CATH superfamily
4XM8A 5GTTA 4PKWA 2A78B 1OG3A 1PWVA 2C8CA 2WN8A 4TR5A 4H0YA 2C8FE 1JKYA 2GWMA 4XM6A 2C8GA 2J3XA 5D1UA 2C8AA 2WN7A 1YQYA 4PKQA 2WN5A 4H0VA 4XM7A 1OG4A 4XSHB 1ZXVA 4ELNA 4PKTA 1GXZA 1QS1A 4H03A 1OJZA 5H03A 1GIRA 3U0JA 2BOVB 1R4BA 1PWPA 5BWMB 1GY0A 1QS2A 1GZFA 2C8EE 3NTSA 2C8DA 3BW8A 2C8BX 4PKVA 1R45A 2WN4A 5D1SA 5D1TA 1J7NA 4H0XA 4XSGB 2WN6A 2A9KB 1PWUA 4PKRA 3BUZA 2C8HA 4DV8A 1OG1A 4GF1A 4FXQA 4PKUA 2GWLA 4GY2A 4WF6A 2J3VA 1OJQA 1PWQA 5H04A 2C89A 5DZQA 1GZEA 1PWWA 2J3ZA 1UZIA 4FK7A 1G24A 4FMLA 1GIQA 4PKSA 1GXYA 4H0TA
chains in the Genus database with same CATH topology
4XM8A 5GTTA 4PKWA 2A78B 1OG3A 1PWVA 2C8CA 2WN8A 4TR5A 4H0YA 2C8FE 1JKYA 2GWMA 4XM6A 2C8GA 2J3XA 5D1UA 2C8AA 2WN7A 1YQYA 4PKQA 2WN5A 4H0VA 4XM7A 1OG4A 4XSHB 1ZXVA 4ELNA 4PKTA 1GXZA 1QS1A 4H03A 1OJZA 5H03A 1GIRA 3U0JA 2BOVB 1R4BA 1PWPA 5BWMB 1GY0A 1QS2A 1GZFA 2C8EE 3NTSA 2C8DA 3BW8A 2C8BX 4PKVA 1R45A 2WN4A 5D1SA 5D1TA 1J7NA 4H0XA 4XSGB 2WN6A 2A9KB 1PWUA 4PKRA 3BUZA 2C8HA 4DV8A 1OG1A 4GF1A 4FXQA 4PKUA 2GWLA 4GY2A 4WF6A 2J3VA 1OJQA 1PWQA 5H04A 2C89A 5DZQA 1GZEA 1PWWA 2J3ZA 1UZIA 4FK7A 1G24A 4FMLA 1GIQA 4PKSA 1GXYA 4H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM8 A;  5GTT A;  4PKW A;  2A78 B;  1OG3 A;  1PWV A;  2C8C A;  2WN8 A;  4TR5 A;  4H0Y A;  2C8F E;  1JKY A;  2GWM A;  4XM6 A;  2C8G A;  2J3X A;  5D1U A;  2C8A A;  2WN7 A;  1YQY A;  4PKQ A;  2WN5 A;  4H0V A;  4XM7 A;  1OG4 A;  4XSH B;  1ZXV A;  4ELN A;  4PKT A;  1GXZ A;  1QS1 A;  4H03 A;  1OJZ A;  5H03 A;  1GIR A;  3U0J A;  2BOV B;  1R4B A;  1PWP A;  5BWM B;  1GY0 A;  1QS2 A;  1GZF A;  2C8E E;  3NTS A;  2C8D A;  3BW8 A;  2C8B X;  4PKV A;  1R45 A;  2WN4 A;  5D1S A;  5D1T A;  1J7N A;  4H0X A;  4XSG B;  2WN6 A;  2A9K B;  1PWU A;  4PKR A;  3BUZ A;  2C8H A;  4DV8 A;  1OG1 A;  4GF1 A;  4FXQ A;  4PKU A;  2GWL A;  4GY2 A;  4WF6 A;  2J3V A;  1OJQ A;  1PWQ A;  5H04 A;  2C89 A;  5DZQ A;  1GZE A;  1PWW A;  2J3Z A;  1UZI A;  4FK7 A;  1G24 A;  4FML A;  1GIQ A;  4PKS A;  1GXY A;  4H0T A; 
#chains in the Genus database with same CATH topology
 4XM8 A;  5GTT A;  4PKW A;  2A78 B;  1OG3 A;  1PWV A;  2C8C A;  2WN8 A;  4TR5 A;  4H0Y A;  2C8F E;  1JKY A;  2GWM A;  4XM6 A;  2C8G A;  2J3X A;  5D1U A;  2C8A A;  2WN7 A;  1YQY A;  4PKQ A;  2WN5 A;  4H0V A;  4XM7 A;  1OG4 A;  4XSH B;  1ZXV A;  4ELN A;  4PKT A;  1GXZ A;  1QS1 A;  4H03 A;  1OJZ A;  5H03 A;  1GIR A;  3U0J A;  2BOV B;  1R4B A;  1PWP A;  5BWM B;  1GY0 A;  1QS2 A;  1GZF A;  2C8E E;  3NTS A;  2C8D A;  3BW8 A;  2C8B X;  4PKV A;  1R45 A;  2WN4 A;  5D1S A;  5D1T A;  1J7N A;  4H0X A;  4XSG B;  2WN6 A;  2A9K B;  1PWU A;  4PKR A;  3BUZ A;  2C8H A;  4DV8 A;  1OG1 A;  4GF1 A;  4FXQ A;  4PKU A;  2GWL A;  4GY2 A;  4WF6 A;  2J3V A;  1OJQ A;  1PWQ A;  5H04 A;  2C89 A;  5DZQ A;  1GZE A;  1PWW A;  2J3Z A;  1UZI A;  4FK7 A;  1G24 A;  4FML A;  1GIQ A;  4PKS A;  1GXY A;  4H0T A; 
#chains in the Genus database with same CATH homology
 4XM8 A;  5GTT A;  4PKW A;  2A78 B;  1OG3 A;  1PWV A;  2C8C A;  2WN8 A;  4TR5 A;  4H0Y A;  2C8F E;  1JKY A;  2GWM A;  4XM6 A;  2C8G A;  2J3X A;  5D1U A;  2C8A A;  2WN7 A;  1YQY A;  4PKQ A;  2WN5 A;  4H0V A;  4XM7 A;  1OG4 A;  4XSH B;  1ZXV A;  4ELN A;  4PKT A;  1GXZ A;  1QS1 A;  4H03 A;  1OJZ A;  5H03 A;  1GIR A;  3U0J A;  2BOV B;  1R4B A;  1PWP A;  5BWM B;  1GY0 A;  1QS2 A;  1GZF A;  2C8E E;  3NTS A;  2C8D A;  3BW8 A;  2C8B X;  4PKV A;  1R45 A;  2WN4 A;  5D1S A;  5D1T A;  1J7N A;  4H0X A;  4XSG B;  2WN6 A;  2A9K B;  1PWU A;  4PKR A;  3BUZ A;  2C8H A;  4DV8 A;  1OG1 A;  4GF1 A;  4FXQ A;  4PKU A;  2GWL A;  4GY2 A;  4WF6 A;  2J3V A;  1OJQ A;  1PWQ A;  5H04 A;  2C89 A;  5DZQ A;  1GZE A;  1PWW A;  2J3Z A;  1UZI A;  4FK7 A;  1G24 A;  4FML A;  1GIQ A;  4PKS A;  1GXY A;  4H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...