2C8UA

Structure of r21q mutant of sh28gst
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
202
Chain Sequence
b'DHIKVIYFNGRGRAESIQMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE 28 KDA
publication title Probing the Mechanism of Gsh Activation in Schistosoma Haematobium Glutathione-S-Transferase by Site-Directed Mutagenesis and X-Ray Crystallography.
pubmed doi rcsb
source organism Schistosoma haematobium
molecule tags Transferase
total genus 68
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 2c8uA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2c8uA01
4FYCA 3J7Yk 3I6AA 2CX3A 4L0WA 1YDKA 4K2DA 2HNLA 2CZ2A 2OADA 2HI7A 3APQA 2OE0A 2V1MA 5B8AA 3LG6A 1JZRA 4KW6A 4KE3A 5IMVA 5DVBA 3LYKA 3I43A 2H73A 3EINA 5LNKe 4EVMA 4LMVA 4HU7A 3QFBC 4L5LA 1R4WA 4ML1A 4O7HA 4EDZA 1JZDA 1EP8A 2IIYA 2OBIA 5FHIA 1X9MB 3DGQA 1TP9A 2LSTA 4BVYB 4N10A 2DIZA 4Q5FA 4ISDA 4KF9A 4JEDA 4I97A 3FHKA 1MDKA 2BMXA 2PUKC 1UVZA 1GUHA 3LEFA 1A0RP 1X9SB 3F9UA 2JSZA 3F63A 4MABA 1FO5A 2YWMA 2O87A 2VCZA 2O8VB 3V1WA 1SJIA 4TN8A 5CRDA 4AJ7A 3FR9A 2I9HA 2F9SA 1ON4A 3VWXA 3RAZA 4ML6A 1RQMA 2DJ3A 3IPZA 4N0ZA 5IM9A 4NV5A 1V2AA 5IPGA 4PNGA 1S3AA 2JSYA 2HSNB 3SBCA 1PX7A 1SD9A 1VGLA 2C0FA 3H8QA 3EE2A 2PERA 2UZ8A 3VWVA 4QQ7A 4I2UA 2IMFA 4AJ8A 2HSMA 3KMNA 1MEKA 1M7TA 3MWHA 1A2MA 8GSSA 4JZQA 3D4TA 3G7IA 4KGIA 1GTAA 2C3TA 2LUSA 1Z9HA 3HZ8A 3EU4A 5GAPD 3GKKA 3RHCA 1E2YA 2CAIA 3VI5A 1QXHA 1QFNA 2A4VA 4IW9A 5D73A 1ILOA 3CMIA 3QMXA 4ID0A 2CAQA 1WP0A 5C04A 3WGEA 3ME8A 2DMMA 3GRXA 1GLPA 4XRDA 2MZCA 4FYBA 2AAWA 1GSEA 1FB6A 2H72A 3D5JA 2VL3A 1XPVA 2CV4A 3GMFA 5HFIA 2ON5A 4HI7A 1WWJA 2RUEA 4PGTA 2RLIA 4K0NA 3VPTA 4E8EA 4I8BA 5H5SA 2J23A 4HZ2A 2X8CA 4NHZA 3QFAC 1PD21 4L8EA 3UMAA 3HJMA 4TOPA 2DLXA 1LU4A 3AY8A 4LL1B 13GSA 3LXZA 4RI7A 4MJBA 2B5EA 2R2JA 1EGRA 4NV2A 5JCWA 2VL2C 4AF2A 3H93A 2YV9A 4TR1A 2LJKA 2B7KA 2AHEA 1O8XA 2LEGA 3QR6A 4IVFA 1X0RA 2YNXA 3F3RA 4HUAA 4KDUA 3DIEA 3RPNA 3KTLA 2IJYA 1SL2B 2Z9SA 2R6KA 3IC4A 3TKRA 4MDCA 1SKRB 1GSFA 4CW9A 1U6TA 2RM6A 1SK2A 1JZWA 1XCCA 1AW9A 2FWHA 3FR3A 4TW5A 1ML6A 1DSBA 4K6XA 1WIKA 2LV3A 4MF6A 3G9BA 2VD1A 5B6NA 3OR5A 2F8FA 1ZL9A 1SL1B 1X5EA 4L0UA 3Q74A 3CSHA 4POLA 1PGTA 1LBKA 1GULA 4TVEA 1PKWA 3UOMA 4TR0A 3UEMA 1T1VA 4KSMA 4KCEA 3TKSC 1ST9A 4MZBA 1BQ7A 2L6CA 2H6YA 2N5AA 1PA3A 4ZB8A 1X9WB 3VK9A 2K6VA 1JLVA 5GZZB 4TRXA 2DJJA 6GSVA 4GRFA 3GL5A 5EY6A 2GS3A 2MMOA 4KA0A 1A23A 3ZMKA 2IL3A 2B1LA 3FYGA 4IQAA 3UARA 5INYA 3M1GA 1OC9A 1G6YA 5DQYA 1TDIA 1EOGA 1SYRA 1QQ2A 2L5LA 5D9VA 4H86A 3WGXA 1NHYA 4QL9A 2L57A 1GSSA 4JRRA 1O73A 4EF0A 2B7JA 4HEA2 3O3TA 1EWXA 2RM5A 4YQMA 3LSZA 1NSWA 1GNWA 4HJMA 3IK9A 2WFCA 1F6MC 5F07A 1GP1A 1TRWA 3TGZA 1ZMAA 1U3IA 3HKRA 1DUGA 4G19A 5F05A 4XHMA 3E0UA 1GTBA 4NHWA 3WT1A 3ERFA 2V41A 3FZ9A 4K1FA 3F0IA 1MDJA 1AQXA 3GL3A 2HSHA 5COHA 1Z7RA 3FZAA 2YPMA 2E0QA 3M8NA 3M9KA 3JCML 1GSQA 5AIVA 2B6MA 4D73A 2F51A 2G2QA 2M46A 4K7NA 1M9AA 1J9BA 3EC3A 3GSTA 3N5OA 4WBJA 4JE1A 3QAVA 2GSSA 2JZTA 2VLTA 1BEDA 2X64A 3VPQA 2L5OA 2VCXA 4GLTA 2TRCP 1EV9A 1N8JA 3EYTA 2V32A 3FRCA 5JCUA 4OFMA 4J56E 3KJYA 1WRYA 2XPEA 1PRXA 1K0NA 2FGXA 4I5QA 2B5YA 4MA9A 3TJGA 1S3CA 2C80A 5IO0A 1AQWA 3HJPA 2GSTA 5FT3A 14GSA 2CZ3A 4OWYA 3IV4A 4XS4B 2FWGA 1ZOFA 2C0EA 1K0OA 4MPGA 1WPIA 1HYUA 3QOUA 4O32A 1F3AA 3W8JA 4BVXA 1OVNA 1T4YA 5ECKB 4EC0A 5A4WA 1E6BA 1Q98A 1NW2A 1K3LA 3ZFLA 2YV7A 1G0TA 20GSA 2GDRA 2C0GA 3A3TA 1TU7A 4NWYA 2MMAA 4L5OA 1K3OA 1FG4A 1XOAA 2YWIA 5JWQB 5ECQB 1X5DA 3KD0A 2GQMA 1AQVA 2GZZA 3GKNA 11GSA 3L9UA 4ECJA 1XBSA 1RW1A 5DCGA 3L0HA 1G7OA 3IXRA 1KBNA 3C1SA 3H79A 4MZWA 4D73B 5J3RA 5IMZA 5ABRA 4X1UA 3QCPA 1PX6A 1F3BA 2B1KA 2IMKA 3VFIA 3KMOA 2H1DA 4KB3A 1MD4A 2YWNA 2H1AA 1PSQA 1YZXA 3U5RE 3IK7A 3TRPA 4YAPA 1R7HA 1V40A 5KN2A 4MP4A 2K18A 1UA5A 4FYUA 3TUEA 1A2JA 2OJLA 3TCOA 1U3AA 2H6ZA 2PGTA 4PTSA 1H4OA 4FO5A 3UL3A 1XXUA 4OD7A 4ZILA 3DKSA 3CSIA 2HT9A 1EEJA 5ID2A 6GSUA 1ZYQB 3TRQA 4MJEA 5JWRB 1NHOA 4ZBBA 3LYPA 2NPBA 4G2EA 4J2FA 4ZL9A 1NM3A 3ERGA 2E2MA 4LMWA 2FUG2 1R5PA 5DJLA 4MJAA 3ZLPA 2FD3A 2LNTA 3KXOA 2IWTA 3VWUA 4BVXB 1QK8A 3KGKA 4FIWA 3P90A 4BWQA 1O6JA 3M0FA 4WBRD 4AJ6A 3C71A 1GTUA 3VI7A 1LJRA 3LQ7A 1ERUA 4Q5QA 1GRXA 5H5RA 4MF7A 2VL9A 1B48A 2J9HA 3D22A 1CQHA 5IMCA 5FWGA 4PXOA 2GSQA 1FW1A 2YZUA 2VLUA 4LLRA 3CXGA 4BL7B 2KP2A 3FKFA 2H70A 3KZQA 5CYYA 2GT5A 1GWCA 5AISA 3F8UA 3D0ZA 4YQVA 4F82A 4PUFC 3M3MA 3VWWA 3KM6A 2CVBA 3R2QA 1EOHA 2WCIA 4TR3A 2JL4A 2V6OA 4HJ2A 1YJ6A 1BJXA 3GH9A 4TKYA 4KSOA 5IOWA 5G30A 2HSYA 2C3NA 2TIRA 5EL8A 3I9V2 3G7JA 1ERWA 4GWRA 3KEBA 4G0KA 2YWOA 3HHVA 4ULXA 4OMVA 1I9DA 2IFQB 3ZIVA 2KUCA 3L4NA 2EIOA 2FWFA 3FZ4A 2HZFA 2V6KA 4N0VA 5ID2B 5CREA 2N5FA 2VCQA 2MYGA 1VF4A 4MH3A 3HDCA 3GNJA 2LQOA 1TU8A 1AAZA 1YY7A 3LJRA 2GSRA 5G1KA 2IMEA 3SWLA 2K8SA 5EVOA 2H0IA 2ZUPA 1PN9A 5BMUA 4GF0A 3FEUA 1XW9A 2YP6A 3IRAA 2F3MA 1A8YA 1B9XC 3HVXA 1WMJA 5B6MA 3E3EA 3CSJA 1Z7PA 2LQQA 17GSA 1GTIA 3L9SA 1XWGA 4ZB9A 2WDUA 1JFUA 4WR5A 3ZFBA 2LRNA 4DSRA 3GUSA 2D2ZA 2M72A 5HFGA 1GSDA 4F0BA 4WR4A 2XC2A 1ABAA 1YKCA 1DBYA 2WZ9A 2VM2A 4I2TA 4JR4A 6GSXA 4RI6A 2H01A 4V1Ag 4WF5A 2A2SA 1J08A 4K8MA 4JR6A 1F9MA 5E4WA 1A8LA 3APOA 5F0GA 2VD0A 4XTSA 3UBLA 1SL0B 3F6DA 2O89A 2B3SA 5D9WA 3C1RA 4XCSA 3HYPA 4IJ3A 3KH9A 5IO2A 5LCZA 3A2XA 3DWVA 1TK8B 2HQTA 2PWJA 1WE0A 2HRFA 1K0AA 1OC8A 1R26A 4HOJA 1OKDA 3VLNA 4J57E 4V2MA 1XWCA 2CVDA 4HU9A 5HR0A 4RQXA 4WETA 2E7PA 2H0GA 4F2IA 1F2EA 2KHPA 2C8UA 1B9YC 4IQ1A 5CRHA 1URMA 4G0LA 4DSQA 4MK3A 2H19A 4QL7A 3MAKA 3IDVA 2GT6A 4IHUA 3ERWA 3RBTA 3GH6A 3C8EA 4NMUA 2VL2A 2YN1A 3LWAA 3GHAA 3EWLA 1GH2A 2LTKA 5DQSA 5DJMA 4G0IA 1XW5A 2JZRA 2DBCA 2H1BA 2HZEB 5CRWA 3L9VA 5D96A 4XS4A 2HFDA 3FR6A 1BG5A 3C7MA 1K3YA 3RPPA 4LL4B 2BJXA 5GAND 2YCDA 2EC4A 1FAAA 2JU5A 3DD3A 3BOAA 1VF1A 1DE2A 4K9ZA 3APSA 4ECCA 1OC3A 2KOKA 1SJZA 1CQGA 2IN3A 2LNSA 3DVWA 4MJCA 1TRVA 2H75A 1GNEA 4X0XA 1XWBA 1T00A 1RK4A 3I69A 2I1UA 1B4QA 3UBKA 4PNFA 4IGJA 3PR8A 4PQHA 2JACA 5DBQA 3UVTA 5G2ZA 3TKSA 1OAZA 3DRNA 1Z3EA 5B8BA 1BAYA 4PQIA 4ZBAA 3CRTA 1PL2A 1MDIA 4F0CA 3GX0A 2AB6A 4E8HA 1V58A 3IHQA 2GTUA 1M9BA 1Q4JA 3A2VA 3M9JA 3QPMA 1ZCPA 1JHBA 4OO4A 3W6GA 1YF0A 2HRKA 1YEPA 4IELA 1K0DA 4YAVA 4N30A 1O7UA 3CYNA 2FY6A 4MPFA 2XBIA 3ZL5A 5ECMB 2H66A 1M0UA 4V2NA 4ZL7A 3PINA 3N9JA 1ZZYA 1SJ6A 5G1LA 1XW6A 3E9JB 3IE3A 4GCIA 5G5EA 5AIXA 2QSIA 4WF4A 5J9CA 1SU9A 3HZ4A 1BX9A 3IOSA 3BBYA 3H4KA 1XVQA 3ZTLA 3ME7A 2XHFA 3LGCA 1OKTA 1Y6EA 1H75A 3DXBA 5ECNB 3WGDA 5AGYA 1M2AA 2YOIA 2E2GA 4IKHA 3F4TA 1HNBA 1USBA 1PMTA 2VCWA 2HLSA 5G5FA 3KCMA 2GZPA 2NBSA 1OE8A 2OA7A 5A4UA 1XOBA 4K0GA 3QDNA 1XWKA 4XRAA 1PKZA 3NZNA 3DVXA 3O6TA 2WB9A 3MDKA 2VM1A 1VF2A 4OCFA 4DSSA 1ERTA 3ZREA 3DMLA 3GN3A 2YANA 4MLYA 5ENUA 3J7Yb 1O8WA 4WEYA 3PH9A 5GSTA 1K0CA 2P0GA 4BA7A 3HY2A 1EEMA 1TTZA 2VOCA 4BL7A 1KNGA 1OE7A 3F3QA 4MF5A 2X8GA 1MD3A 2FHEA 5HFKA 3TJFA 5G31A 3KIJA 3WT2A 4XIHA 2NTOA 1Z6NA 4TXVA 5DALA 2RIIA 2JADA 2X99A 4G9HA 4IP1A 1U87A 3HCZA 4TR4A 1VF3A 22GSA 2B5XA 3GKXA 2HRKB 3KTBA 2AYTA 1FHEA 3GTUB 5ECSA 5IOXA 3PPUA 2FNOA 5JCGA 2C0DA 1ZGNA 1M2BA 2EIQA 2C4JA 2DJ0A 2IMIA 3FZ5A 5J41A 4MMMA 2IFQA 4POMA 4YH2A 3LORA 5ECRB 4ECIA 2ON7A 3ZYWA 5EPFA 2PBJA 1TW9A 4FH8A 2XPDA 2FCHA 3DYRA 2ZNMA 4HQZA 1THOA 2P5QA 5KN3A 5ECPB 2H30A 4V1Ap 3TRXA 4HQSA 2WRTA 1W4VA 2P5RA 3FW2A 4FQUA 3HVVA 2VUPA 2KP1A 1WOUA 2DSAA 2L4CA 1G6WA 4IJIA 3BJ5A 1YQ1A 3IC8A 1J0FA 2L6DA 1OYJA 4DEJA 4EO3A 1T4ZA 2DJ2A 2FA8A 3MNGA 5D8IA 2H0HA 1QMVA 1SK0A 2DJKA 3PGTA 3UVHA 4DSSB 3MSZA 3C73A 3TJBA 2O7KA 4TXOB 1JLWA 1GLQA 3NOFA 2VO4A 1ERVA 3TDGA 2H74A 3TOUA 2GGTA 3ZRDA 3EU3A 4KUNA 4HDEA 2MMZA 2QGVA 2GQLA 5IPHA 1VRSD 3IBHA 1THXA 3IAS2 2QC7A 3CTGA 2CT6A 1B8XA 2DMLA 5KN0A 1I5GA 5DALB 2JZSA 1TJDA 5IQYA 10GSA 4G10A 3QAWA 1M99A 1UN2A 4ZXGA 2H1GA 3FY7A 1V98A 1W89A 4ZBDA 1HNCA 2LRCA 2VIMA 4KDXA 3ZVJD 2H71A 3S9FA 1EP7A 1YEXA 2G0FA 5D9XA 6GSWA 4IN0A 2DJ1A 2F8AA 5A4VA 3R3EA 2NDOA 1IYHA 4P3YB 1SYXA 2L59A 16GSA 5CRGA 2R4VA 1IYIA 3P8WA 5ECLB 3US3A 1TRUA 2R37A 4KDYA 6GSSA 4GSTA 4PQ1A 5D9TA 1AC1A 1HQOA 4OO5A 1TXXA 2MMNA 1GUKA 2XBQA 2MBSA 3UAPA 2ES7A 4KCAA 5E59A 9GSSA 3GA4A 4Z7XA 3BCKA 4EKZA 5F06A 1AXDA 4GQCA 2KLXA 1TK5B 3HJOA 5DDLA 3EMPA 2P31A 4K7IA 1HNAA 4CDOA 7GSSA 1FOVA 4JBBA 3A5WA 2FLSA 2HZEA 3GURA 1XVWA 3F4SA 4ZB6A 2BTOT 2OBKA 2H76A 1C72A 1N2AA 3TJKA 2PVOC 4EXJA 2I4AA 5C00A 2LKUA 4PUAA 4LA1A 4MH2A 3HA9A 1EGOA 2WGRA 4PURA 4USSA 2ALBA 5IMDA 3KP9A 1AUCA 1XWAA 2A2RA 1QGVA 2R5GA 4WXTA 5J4UA 2IPAA 19GSA 4GTUA 4XS1A 2VCVA 1TKDB 3P2AA 4JU5A 4K7OA 2YJHA 1FVJA 2VCTA 3P7XA 3FK8A 1EV4A 1A24A 2HSMB 3ZITA 4EL1A 2CVKA 1GL8A 1O81A 4KAEA 1HD2A 5GSSA 4MCUA 4F9ZA 1Z6MA 5HR2A 5KN1A 3D6IA 4OCEA 4ECBA 1SKSB 3ZIJA 1R5AA 3TB2A 2PPTA 2WS2A 4F03A 2HE3A 3BD2A 3HD5A 3CBUA 5B7CA 3K8NA 1K0MA 1X5CA 3LXTA 2CX4A 3EVIA 1JZOA 2PU9C 1KTEA 3ED3A 5DAKA 1GUMA 2NVLA 3GX8A 1T3BA 1TK0B 1FB0A 3TKPA 1FVKA 3QAGA 1KEBA 4O5RA 1T8EB 2H6XA 3IAM2 4OFTA 5ELGA 4RUVA 5DCHA 5J9BA 3QD9A 5HR3A 1TI3A 4GSNA 1S3DA 1G7EA 2AUVA 3GSSA 5ECIB 2L4QA 1MTCA 1UC7A 4DVCA 5CO3A 3TOTA 4GXZA 4ACSA 2PMTA 3F4RA 4ZIJA 2REMA 3NIVA 1PL1A 5H5QA 2OACA 3DEXA 1ACVA 5IMFA 3WD6A 2OKAA 2I3YA 4MZCA 3HXSA 4TR1B 5CNWA 4RQRA 2HYXA 1TRSA 2DIYA 3GYKA 2RUFA 2GZYA 1K0BA 2OE1A 2H8LA 2X8HA 4N11A 3A2WA 1M2DA 3IR4A 3W8SA 3O76A 1WJKA 4KNDA 2WJUA 1ZYEA 4OFNA 3G7YA 2LRTA 1A0FA 4NAXA 2DC5A 2GVPA 3UIWA 2CA8A 2K9FA 1GSYA 5A5KA 2C3QA 3Q19A 3CRUA 4EDYA 4IBPA 3F6FA 5ECOB 4YQUA 1TOFA 3EMXA 5F8BA 3HVSA 3H1NA 3Q6OA 5HQPA 2YJ7A 5J5NA 3ZVJA 3GTUA 4GQFA 4NXIA 5L71A 2LS5A 5IIZA 4POBA 3U6VA 3BCIA 1QUWA 12GSA 1F37A 3GKMA 1TI1A 4HS1A 1XIYA 2OE3A 1V57A 1EZKA 3D4MA 5DAKB 2VLVA 1SK1A 4KH7A 3EURA 4AGSA 1YF1A 18GSA 4KX4A 1T7PB 4IS0A 5ELAA 2LJRA 1PQNA 1SD8A 3TKQA 1DE1A 2IMDA 4BWSA 5CP1A 5LD0A 4ILFA 4EE0A 5CAXA 5AN1A 2M80A 4Q5RA 1U88A 2LJAA 3ZZXA 4Q5NA 4HZ4A 1XFLA 2C1YA 4I6XA 1OC9B 1V9WA 3LFLA 3KP8A 4CHSA 4WKWA 3ZMLA 6GSTA 4POKA 2O85A 3TJJA 2MBTA 2N5BA 4IP6A 4BVYA 1SKWB 5HR1A 2AJQB 3Q18A 1A2LA 2CQ9A 2PN8A 1Z5YE 2HXKA 4TXOA 4EUYA 5IMAA 5JWOB 1SENA 2GQKA 4NPBA 3GIXA 1Y25A 5KEJA 1AIUA 2WULA 2AV4A 3L78A 2V2GA 2I81A 3UJ1A 4XS6A 1GSUA 6GSYA 3ISOA 4PX1A 3GV1A 2ZCTA 3RHBA 2TRXA 4O92A 5ECHB 3KH7A 4BPYA 3VURA 1O85A 1BYEA 2HRAA 2FWEA 2PVQA 3IA1A 1B4PA 3RDWA 2YZHA 2GLRA 1XZOA 2EIRA 2VAFA 2FA4A 2HRNA 1YKAA 3CTFA 3TKSE 5D93A 2QKEA 3GFKA 4GSSA 4V2LA 3D21A 3WYWA 4X43A 2R3XA 2K8VA 4ZL8A
chains in the Genus database with same CATH superfamily
4FYCA 3J7Yk 3I6AA 2CX3A 4L0WA 1YDKA 4K2DA 2HNLA 2CZ2A 2OADA 2HI7A 1PN0A 3APQA 1YEWC 2OE0A 2V1MA 5B8AA 2WW1A 3LG6A 1JZRA 4KW6A 4KE3A 5IMVA 5DVBA 3LYKA 3I43A 2H73A 3EINA 5LNKe 4EVMA 4LMVA 4HU7A 3QFBC 4L5LA 1R4WA 4ML1A 4O7HA 4PHZC 4EDZA 1JZDA 1EP8A 2IIYA 2OBIA 5FHIA 1X9MB 3DGQA 1TP9A 2LSTA 4BVYB 4N10A 2DIZA 4Q5FA 4ISDA 4KF9A 4N3ZA 4JEDA 4I97A 3FHKA 1MDKA 2BMXA 2PUKC 1UVZA 1GUHA 3LEFA 1A0RP 1X9SB 3F9UA 2JSZA 3F63A 4MABA 1FO5A 4PI2C 2YWMA 2O87A 2VCZA 2O8VB 3V1WA 1SJIA 4TN8A 4X4JA 5CRDA 4AJ7A 3FR9A 2I9HA 4EIQA 2F9SA 1ON4A 3LW9A 3VWXA 3RAZA 4ML6A 1RQMA 2DJ3A 3IPZA 4N0ZA 4AKIA 5IM9A 4NV5A 1V2AA 5IPGA 4PNGA 1S3AA 2JSYA 2HSNB 3SBCA 1PX7A 1SD9A 1VGLA 2C0FA 2WW3A 3H8QA 3EE2A 2PERA 2UZ8A 3VWVA 4QQ7A 4I2UA 2IMFA 4AJ8A 2HSMA 3KMNA 1MEKA 1M7TA 3MWHA 2R0GA 1A2MA 8GSSA 4JZQA 3D4TA 3G7IA 4KGIA 1GTAA 2C3TA 2LUSA 1Z9HA 3HZ8A 3EU4A 5GAPD 3GKKA 3RHCA 1E2YA 2CAIA 3VI5A 1QXHA 1QFNA 2A4VA 4K5SA 4IW9A 5D73A 1ILOA 3CMIA 3QMXA 4ID0A 2CAQA 1WP0A 5C04A 3WGEA 3ME8A 2DMMA 3GRXA 1GLPA 4XRDA 2MZCA 4FYBA 2AAWA 1GSEA 1FB6A 2H72A 3D5JA 2VL3A 1XPVA 2CV4A 3GMFA 5HFIA 2ON5A 4HI7A 1WWJA 2RUEA 4PGTA 2RLIA 4K0NA 3VPTA 4E8EA 4I8BA 5H5SA 2J23A 4HZ2A 2X8CA 4NHZA 3QFAC 1PD21 4L8EA 3UMAA 3HJMA 4TOPA 2DLXA 1LU4A 3AY8A 4LL1B 13GSA 3LXZA 4RI7A 4MJBA 2B5EA 2R2JA 4YKFA 1EGRA 4NV2A 5JCWA 2VL2C 4AF2A 3H93A 2YV9A 4TR1A 2LJKA 2O3EA 2B7KA 2AHEA 1O8XA 2LEGA 3QR6A 4IVFA 1X0RA 2YNXA 3F3RA 2QA2A 4HUAA 4KDUA 3DIEA 3RPNA 3KTLA 2IJYA 1SL2B 2Z9SA 2R6KA 3IC4A 3TKRA 4MDCA 1SKRB 1GSFA 4CW9A 1U6TA 2RM6A 1SK2A 1JZWA 1XCCA 1AW9A 2FWHA 3FR3A 4TW5A 1ML6A 1DSBA 4K6XA 1WIKA 2LV3A 4ICYA 4MF6A 3G9BA 2VD1A 5B6NA 3OR5A 2F8FA 1ZL9A 1SL1B 1X5EA 2QA1A 5J47A 4MNNA 4L0UA 3Q74A 3CSHA 4POLA 1PGTA 1LBKA 1GULA 3RGBC 4TVEA 1PKWA 3UOMA 4TR0A 3UEMA 1T1VA 4KSMA 4KCEA 3TKSC 1ST9A 4MZBA 2WW0A 1BQ7A 3MIXA 2L6CA 1PFOA 2H6YA 2N5AA 1PA3A 4ZB8A 1X9WB 3VK9A 2K6VA 1JLVA 5GZZB 4TRXA 2DJJA 6GSVA 4GRFA 3GL5A 5EY6A 2GS3A 2MMOA 4KA0A 1A23A 3ZMKA 5BMUB 2IL3A 2B1LA 3FYGA 4IQAA 3UARA 5INYA 3M1GA 1OC9A 1G6YA 5DQYA 1TDIA 1EOGA 1SYRA 1QQ2A 2L5LA 5D9VA 4H86A 3WGXA 1NHYA 4QL9A 2L57A 5KOXA 1GSSA 4JRRA 1O73A 4EF0A 2B7JA 4HEA2 3O3TA 1EWXA 2RM5A 4YQMA 3LSZA 1NSWA 1GNWA 4HJMA 3IK9A 2WFCA 1F6MC 5F07A 1GP1A 1TRWA 3TGZA 1ZMAA 1U3IA 3HKRA 1DUGA 4G19A 5F05A 4XHMA 3E0UA 1GTBA 4NHWA 3WT1A 3ERFA 2V41A 3FZ9A 4K1FA 3F0IA 1MDJA 1AQXA 3GL3A 2HSHA 5COHA 1Z7RA 3FZAA 2YPMA 2E0QA 3M8NA 3M9KA 3JCML 1GSQA 5AIVA 2B6MA 4D73A 2F51A 2G2QA 2M46A 4K7NA 2WW2A 1M9AA 1J9BA 3EC3A 3GSTA 3N5OA 4WBJA 4JE1A 3QAVA 2GSSA 2JZTA 2VLTA 1BEDA 2X64A 3VPQA 2L5OA 2VCXA 4GLTA 2TRCP 1EV9A 1N8JA 3EYTA 2V32A 3FRCA 5JCUA 4OFMA 4J56E 3KJYA 1WRYA 2XPEA 1PRXA 1K0NA 2FGXA 4I5QA 2B5YA 4MA9A 3TJGA 1S3CA 2C80A 5IO0A 1AQWA 3HJPA 2GSTA 5FT3A 5A1NA 14GSA 2CZ3A 4OWYA 3CWGA 3A5IA 3IV4A 4XS4B 2FWGA 1ZOFA 1N25A 2C0EA 1K0OA 4MPGA 1WPIA 1HYUA 3QOUA 4O32A 1F3AA 3W8JA 4BVXA 1OVNA 1T4YA 5ECKB 4EC0A 5A4WA 1E6BA 1Q98A 2O36A 1NW2A 1K3LA 3ZFLA 2YV7A 1G0TA 20GSA 2GDRA 2C0GA 3A3TA 1TU7A 4NWYA 2MMAA 4L5OA 1K3OA 1FG4A 1XOAA 2YWIA 5JWQB 5ECQB 1X5DA 3KD0A 2EFEA 2GQMA 1AQVA 2GZZA 5J40A 3GKNA 11GSA 3L9UA 4ECJA 1XBSA 1RW1A 5DCGA 3L0HA 2EFCA 1G7OA 3IXRA 1KBNA 3C1SA 3H79A 4MZWA 4D73B 5J3RA 5IMZA 5ABRA 4X1UA 3QCPA 3TU3B 1PX6A 1F3BA 2B1KA 2IMKA 3VFIA 4BIKA 3KMOA 2H1DA 4KB3A 1MD4A 2YWNA 2H1AA 1PSQA 1YZXA 3U5RE 3IK7A 3TRPA 4YAPA 1R7HA 1V40A 5KN2A 4MP4A 2K18A 2R0PA 1UA5A 4FYUA 2A2PA 3TUEA 1A2JA 2OJLA 3TCOA 1U3AA 2H6ZA 2PGTA 4PTSA 1H4OA 4FO5A 3UL3A 1XXUA 4OD7A 4ZILA 3DKSA 3CSIA 2HT9A 1EEJA 5ID2A 6GSUA 1ZYQB 3TRQA 4MJEA 5JWRB 1NHOA 4ZBBA 3LYPA 2NPBA 4G2EA 5A1NB 4J2FA 4ZL9A 1NM3A 3ERGA 2E2MA 4LMWA 2FUG2 1R5PA 5DJLA 4MJAA 3ZLPA 2FD3A 2LNTA 3KXOA 2IWTA 3VWUA 4BVXB 1QK8A 3KGKA 4FIWA 3P90A 4BWQA 1O6JA 3M0FA 4WBRD 4AJ6A 3C71A 1GTUA 3VI7A 3HMJG 1LJRA 3LQ7A 1ERUA 4Q5QA 1GRXA 5H5RA 4MF7A 2VL9A 1B48A 2J9HA 1M3JA 3D22A 1CQHA 5IMCA 5FWGA 1ZYNA 4PXOA 2GSQA 1FW1A 2YZUA 1YVLA 2VLUA 4LLRA 3CXGA 4BL7B 2KP2A 3FKFA 2H70A 3KZQA 5CYYA 2GT5A 1GWCA 3IHGA 2DKIA 5AISA 3F8UA 1S4BP 3D0ZA 4YQVA 4F82A 4PUFC 3M3MA 3VWWA 3RFRC 3KM6A 2CVBA 3R2QA 1EOHA 2WCIA 4TR3A 2JL4A 2V6OA 4HJ2A 1YJ6A 1BJXA 3GH9A 4TKYA 4KSOA 5IOWA 5G30A 2HSYA 2C3NA 2TIRA 5EL8A 3I9V2 3G7JA 1ERWA 4GWRA 3KEBA 4G0KA 2YWOA 3HHVA 4ULXA 4OMVA 1I9DA 2IFQB 3ZIVA 2KUCA 3L4NA 1SVMA 2EIOA 2X4AA 2FWFA 3FZ4A 2HZFA 2V6KA 4N0VA 5ID2B 5CREA 2N5FA 2VCQA 2MYGA 1VF4A 4MH3A 3HDCA 3GNJA 2OT3A 2LQOA 1TU8A 1AAZA 1YY7A 3LJRA 2GSRA 5G1KA 2IMEA 3SWLA 4AKHA 2K8SA 5EVOA 2H0IA 2ZUPA 1PN9A 5BMUA 4GF0A 3FEUA 1XW9A 2YP6A 3IRAA 2F3MA 1A8YA 1B9XC 4YKGA 3HVXA 1WMJA 5J4YA 5B6MA 3E3EA 3CSJA 2VKZG 1Z7PA 2LQQA 17GSA 1GTIA 3L9SA 1XWGA 2WVZA 4ZB9A 2WDUA 1JFUA 4WR5A 5A5HA 3ZFBA 2LRNA 4DSRA 3GUSA 2D2ZA 2M72A 5HFGA 1GSDA 4F0BA 4WR4A 2XC2A 4G01A 1ABAA 1YKCA 1DBYA 2WZ9A 2VM2A 4I2TA 4JR4A 6GSXA 4RI6A 2H01A 4V1Ag 4WF5A 2A2SA 1J08A 2WVXB 4K8MA 4JR6A 1F9MA 5E4WA 1A8LA 3APOA 5F0GA 2VD0A 4XTSA 3UBLA 1SL0B 3F6DA 2O89A 2B3SA 5D9WA 3C1RA 4XCSA 4FXYP 3HYPA 4IJ3A 3KH9A 5IO2A 5LCZA 3A2XA 3DWVA 1TK8B 2HQTA 2PWJA 1WE0A 2HRFA 1K0AA 1OC8A 1R26A 4HOJA 1OKDA 3VLNA 4HSCX 4J57E 4V2MA 1XWCA 2CVDA 4HU9A 5HR0A 4RQXA 4WETA 4ZB7A 2E7PA 2H0GA 4F2IA 1F2EA 2KHPA 2C8UA 1B9YC 4Z2TA 4IQ1A 5CRHA 1URMA 4G0LA 4DSQA 4MK3A 2H19A 4QL7A 3MAKA 3IDVA 2GT6A 4IHUA 3ERWA 3RBTA 3GH6A 3C8EA 4NMUA 2VL2A 2YN1A 3LWAA 4EIPA 3GHAA 3EWLA 1GH2A 2LTKA 5DQSA 5DJMA 4G0IA 1XW5A 2JZRA 2DBCA 2H1BA 2HZEB 5CRWA 3L9VA 5D96A 4XS4A 2HFDA 3FR6A 5A5HB 1BG5A 3C7MA 1K3YA 3RPPA 4LL4B 2BJXA 5GAND 2YCDA 2EC4A 1FAAA 2JU5A 3DD3A 3BOAA 1VF1A 1DE2A 4K9ZA 4QMKA 3APSA 4ECCA 1OC3A 2KOKA 4K2XA 1SJZA 1TXUA 1CQGA 2IN3A 2LNSA 3DVWA 4MJCA 1TRVA 2H75A 1GNEA 4X0XA 1XWBA 1T00A 1RK4A 3I69A 2I1UA 1B4QA 1BF5A 3UBKA 4PNFA 4IGJA 3PR8A 4PQHA 2JACA 5DBQA 3UVTA 5G2ZA 3TKSA 4AKGA 1OAZA 3DRNA 1Z3EA 5B8BA 1BAYA 4PQIA 4ZBAA 3CRTA 1PL2A 1MDIA 4F0CA 3GX0A 2AB6A 4E8HA 1V58A 3IHQA 2GTUA 1M9BA 1Q4JA 3A2VA 3M9JA 3QPMA 1ZCPA 1JHBA 4OO4A 3W6GA 1YF0A 2HRKA 1YEPA 4IELA 1K0DA 4YAVA 4N30A 1O7UA 3CYNA 2FY6A 1FOHA 3MYDA 4MPFA 2XBIA 3ZL5A 5ECMB 2H66A 1M0UA 4V2NA 4ZL7A 3PINA 3N9JA 1ZZYA 1SJ6A 5G1LA 1XW6A 3E9JB 4AKXB 3IE3A 4GCIA 5G5EA 5AIXA 2QSIA 4WF4A 5J9CA 1SU9A 3HZ4A 1BX9A 3IOSA 3BBYA 3H4KA 1XVQA 3ZTLA 3ME7A 2XHFA 3LGCA 1OKTA 1Y6EA 1H75A 3DXBA 5ECNB 3WGDA 5AGYA 1M2AA 2YOIA 2E2GA 4IKHA 3F4TA 1HNBA 1USBA 1PMTA 2VCWA 2HLSA 5G5FA 3KCMA 2GZPA 2NBSA 1OE8A 2OA7A 5A4UA 1XOBA 4K0GA 3QDNA 1XWKA 4XRAA 1PKZA 1ZYPA 3NZNA 3DVXA 3O6TA 2WB9A 3MDKA 2VM1A 1VF2A 5A34B 4OCFA 4DSSA 1ERTA 3ZREA 3DMLA 3GN3A 2YANA 4MLYA 5ENUA 3J7Yb 1O8WA 4WEYA 3PH9A 5GSTA 1K0CA 2P0GA 4BA7A 3HY2A 1EEMA 1TTZA 2VOCA 4BL7A 1KNGA 1OE7A 3F3QA 4MF5A 2X8GA 1MD3A 2FHEA 5HFKA 3TJFA 5G31A 3KIJA 3WT2A 4XIHA 2NTOA 1Z6NA 4TXVA 5DALA 2RIIA 2JADA 2X99A 4G9HA 4IP1A 1XG8A 1U87A 3HCZA 4TR4A 1VF3A 22GSA 2B5XA 3GKXA 2HRKB 3KTBA 2AYTA 1FHEA 3GTUB 5ECSA 5IOXA 3PPUA 2FNOA 5JCGA 2C0DA 1ZGNA 1M2BA 2EIQA 2C4JA 2EFDA 2IMIA 2DJ0A 3FZ5A 5J41A 4MMMA 2IFQA 4POMA 4YH2A 3LORA 5ECRB 4ECIA 2ON7A 3ZYWA 4GDFA 5EPFA 2PBJA 1TW9A 4FH8A 2XPDA 2FCHA 3DYRA 2ZNMA 4HQZA 1THOA 2P5QA 5KN3A 2A4HA 5ECPB 2H30A 4V1Ap 3TRXA 4HQSA 2WRTA 1W4VA 2P5RA 3FW2A 4FQUA 3HVVA 2VUPA 2KP1A 1WOUA 2DSAA 2L4CA 1G6WA 4IJIA 3BJ5A 1YQ1A 3IC8A 1J0FA 2O5VA 2L6DA 1OYJA 4DEJA 1Y1UA 4EO3A 1T4ZA 2DJ2A 2FA8A 3MNGA 1SVLA 5D8IA 2H0HA 1QMVA 1SK0A 2DJKA 3PGTA 3UVHA 4DSSB 3MSZA 3C73A 3TJBA 2O7KA 4TXOB 1JLWA 1GLQA 3NOFA 2VO4A 1ERVA 3TDGA 2H74A 4O5UA 3TOUA 1S3RA 2GGTA 3ZRDA 2DKHA 3EU3A 4KUNA 4HDEA 2MMZA 2QGVA 2GQLA 5IPHA 2WVYA 1VRSD 3IBHA 1THXA 3IAS2 2QC7A 3CTGA 2CT6A 1B8XA 2DMLA 2WVXA 5KN0A 1I5GA 5DALB 2JZSA 1TJDA 5IQYA 10GSA 4G10A 3QAWA 1M99A 1UN2A 4ZXGA 2H1GA 3FY7A 1V98A 1W89A 4ZBDA 1HNCA 2LRCA 2VIMA 5BRTA 4KDXA 3ZVJD 2H71A 3S9FA 1EP7A 4A5PA 1YEXA 2G0FA 5D9XA 6GSWA 4IN0A 2DJ1A 2F8AA 5A4VA 3R3EA 2UV8G 2NDOA 1IYHA 4P3YB 1SYXA 2L59A 16GSA 5CRGA 2R4VA 1IYIA 3P8WA 5ECLB 3US3A 1TRUA 2R37A 4KDYA 6GSSA 4GSTA 4PQ1A 5D9TA 1AC1A 1HQOA 4OO5A 1TXXA 2MMNA 1GUKA 2XBQA 2MBSA 3UAPA 2ES7A 4KCAA 5E59A 9GSSA 3GA4A 4K5RA 4Z7XA 3BCKA 4EKZA 5F06A 1AXDA 4GQCA 2KLXA 1TK5B 3HJOA 5DDLA 3EMPA 2P31A 4K7IA 1HNAA 4CDOA 3EPTA 7GSSA 1FOVA 4JBBA 3A5WA 2FLSA 2HZEA 3GURA 1XVWA 3F4SA 4ZB6A 2BTOT 2OBKA 2H76A 1C72A 1N2AA 3TJKA 2PVOC 4EXJA 2I4AA 4O5QA 5C00A 2LKUA 4W66A 4PUAA 4LA1A 4MH2A 3HA9A 1EGOA 2WGRA 4PURA 4USSA 2ALBA 5IMDA 3KP9A 1AUCA 1XWAA 2A2RA 1QGVA 2R5GA 4WXTA 5J4UA 2IPAA 3CQFA 19GSA 4GTUA 4XS1A 2VCVA 1TKDB 5J4VA 3P2AA 4JU5A 4K7OA 2YJHA 1FVJA 2VCTA 3P7XA 3FK8A 1EV4A 1A24A 2HSMB 3ZITA 4EL1A 2CVKA 1GL8A 1O81A 4KAEA 1HD2A 5GSSA 4MCUA 4F9ZA 1Z6MA 5HR2A 5KN1A 3D6IA 4OCEA 4ECBA 1SKSB 3ZIJA 1R5AA 3TB2A 2PPTA 2WS2A 4F03A 2HE3A 3BD2A 3HD5A 3CBUA 5B7CA 3K8NA 1K0MA 1X5CA 3LXTA 2CX4A 3EVIA 1JZOA 2PU9C 1KTEA 3ED3A 5DAKA 1GUMA 2NVLA 3GX8A 1T3BA 1TK0B 1FB0A 3TKPA 3CHXC 1FVKA 3QAGA 1KEBA 4O5RA 1T8EB 2H6XA 3IAM2 4OFTA 5ELGA 4RUVA 5DCHA 5J9BA 3QD9A 5HR3A 1TI3A 4GSNA 1S3DA 1G7EA 2AUVA 3GSSA 5ECIB 2L4QA 1MTCA 1UC7A 1M3IA 4DVCA 5CO3A 3TOTA 4GXZA 4ACSA 2PMTA 3F4RA 2X49A 4ZIJA 2REMA 3NIVA 1PL1A 5H5QA 2OACA 3DEXA 1ACVA 5IMFA 3WD6A 2OKAA 5A34A 2I3YA 4MZCA 3HXSA 4TR1B 5CNWA 4RQRA 2HYXA 1TRSA 2DIYA 2H1LA 3GYKA 2RUFA 2GZYA 1K0BA 2OE1A 2H8LA 2X8HA 4N11A 3A2WA 1M2DA 4CY6A 3IR4A 3W8SA 3O76A 1WJKA 4KNDA 2WJUA 1ZYEA 4OFNA 4E68A 3G7YA 2LRTA 1A0FA 4NAXA 2DC5A 2GVPA 3UIWA 2CA8A 2K9FA 1GSYA 5A5KA 2C3QA 1BG1A 3Q19A 3CRUA 4EDYA 4IBPA 3F6FA 5ECOB 4YQUA 1TOFA 3EMXA 5F8BA 3HVSA 3H1NA 3Q6OA 5HQPA 2YJ7A 5J5NA 3ZVJA 3GTUA 4GQFA 4NXIA 4AI6A 5L71A 2LS5A 5IIZA 4POBA 3U6VA 3BCIA 1QUWA 12GSA 1F37A 3GKMA 1TI1A 4HS1A 1XIYA 2OE3A 1V57A 3D4MA 1SVOA 1EZKA 5DAKB 2VLVA 1SK1A 4KH7A 3EURA 4AGSA 1YF1A 18GSA 4KX4A 4Z2UA 1T7PB 4IS0A 5ELAA 2LJRA 1PQNA 1SD8A 3TKQA 1DE1A 2IMDA 4BWSA 5CP1A 5LD0A 4ILFA 4EE0A 5CAXA 5AN1A 2M80A 4Q5RA 1U88A 2LJAA 3ZZXA 4Q5NA 4HZ4A 1XFLA 2C1YA 4Z2RA 4I6XA 1OC9B 1V9WA 3LFLA 3KP8A 4CHSA 4WKWA 3ZMLA 2R0CA 6GSTA 4POKA 2O85A 3TJJA 2MBTA 2N5BA 4IP6A 4BVYA 1SKWB 3FMWA 5HR1A 2AJQB 3Q18A 1A2LA 2WZSA 2CQ9A 2PN8A 1Z5YE 2HXKA 4TXOA 3HVNA 4EUYA 5IMAA 5JWOB 1SENA 2GQKA 4NPBA 3GIXA 1Y25A 5KEJA 1AIUA 2WULA 2AV4A 3L78A 2V2GA 2I81A 3UJ1A 4XS6A 1GSUA 6GSYA 3ISOA 4PX1A 3GV1A 2ZCTA 3RHBA 2TRXA 1I1IP 4O92A 5ECHB 3KH7A 2HSNA 3VURA 4BPYA 1O85A 1BYEA 2HRAA 2FWEA 2PVQA 3IA1A 1B4PA 3RDWA 2YZHA 2GLRA 1XZOA 2EFHA 2EIRA 4CY8A 2VAFA 2FA4A 2HRNA 1YKAA 3CTFA 5KOWA 3TKSE 5D93A 2QKEA 3GFKA 4GSSA 4V2LA 3D21A 3WYWA 4X43A 2R3XA 4PI0C 2K8VA 4ZL8A
chains in the Genus database with same CATH topology
4FYCA 3J7Yk 3I6AA 2CX3A 4L0WA 1YDKA 4K2DA 2HNLA 2CZ2A 2OADA 2HI7A 1PN0A 3APQA 2OE0A 2V1MA 5B8AA 3LG6A 1JZRA 4KW6A 4KE3A 5IMVA 5DVBA 3LYKA 3I43A 2H73A 3EINA 5LNKe 4EVMA 4LMVA 4HU7A 3QFBC 4L5LA 1R4WA 4ML1A 4O7HA 4EDZA 1JZDA 1EP8A 2IIYA 2OBIA 5FHIA 1X9MB 3DGQA 1TP9A 2LSTA 4BVYB 4N10A 2DIZA 4Q5FA 4ISDA 4KF9A 4N3ZA 4JEDA 4I97A 3FHKA 1MDKA 2BMXA 2PUKC 1UVZA 1GUHA 3LEFA 1A0RP 1X9SB 3F9UA 2JSZA 3F63A 4MABA 1FO5A 2YWMA 2O87A 2VCZA 2O8VB 3V1WA 1SJIA 4TN8A 4X4JA 5CRDA 4AJ7A 3FR9A 2I9HA 4EIQA 2F9SA 1ON4A 3LW9A 3VWXA 3RAZA 4ML6A 1RQMA 2DJ3A 3IPZA 4N0ZA 4AKIA 5IM9A 4NV5A 1V2AA 5IPGA 4PNGA 1S3AA 2JSYA 2HSNB 3SBCA 1PX7A 1SD9A 1VGLA 2C0FA 3H8QA 3EE2A 2PERA 2UZ8A 3VWVA 4QQ7A 4I2UA 2IMFA 4AJ8A 2HSMA 3KMNA 1MEKA 1M7TA 3MWHA 2R0GA 1A2MA 8GSSA 4JZQA 3D4TA 3G7IA 4KGIA 1GTAA 2C3TA 2LUSA 1Z9HA 3HZ8A 3EU4A 5GAPD 3GKKA 3RHCA 1E2YA 2CAIA 3VI5A 1QXHA 1QFNA 2A4VA 4K5SA 4IW9A 5D73A 1ILOA 3CMIA 3QMXA 4ID0A 2CAQA 1WP0A 5C04A 3WGEA 3ME8A 2DMMA 3GRXA 1GLPA 4XRDA 2MZCA 4FYBA 2AAWA 1GSEA 1FB6A 2H72A 3D5JA 2VL3A 1XPVA 2CV4A 3GMFA 5HFIA 2ON5A 4HI7A 1WWJA 2RUEA 4PGTA 2RLIA 4K0NA 3VPTA 4E8EA 4I8BA 5H5SA 2J23A 4HZ2A 2X8CA 4NHZA 3QFAC 1PD21 4L8EA 3UMAA 3HJMA 4TOPA 2DLXA 1LU4A 3AY8A 4LL1B 13GSA 3LXZA 4RI7A 4MJBA 2B5EA 2R2JA 4YKFA 1EGRA 4NV2A 5JCWA 2VL2C 4AF2A 3H93A 2YV9A 4TR1A 2LJKA 2B7KA 2AHEA 1O8XA 2LEGA 3QR6A 4IVFA 1X0RA 2YNXA 3F3RA 2QA2A 4HUAA 4KDUA 3DIEA 3RPNA 3KTLA 2IJYA 1SL2B 2Z9SA 2R6KA 3IC4A 3TKRA 4MDCA 1SKRB 1GSFA 4CW9A 1U6TA 2RM6A 1SK2A 1JZWA 1XCCA 1AW9A 2FWHA 3FR3A 4TW5A 1ML6A 1DSBA 4K6XA 1WIKA 2LV3A 4ICYA 4MF6A 3G9BA 2VD1A 5B6NA 3OR5A 2F8FA 1ZL9A 1SL1B 1X5EA 2QA1A 5J47A 4MNNA 4L0UA 3Q74A 3CSHA 4POLA 1PGTA 1LBKA 1GULA 4TVEA 1PKWA 3UOMA 4TR0A 3UEMA 1T1VA 4KSMA 4KCEA 3TKSC 1ST9A 4MZBA 1BQ7A 3MIXA 2L6CA 2H6YA 2N5AA 1PA3A 4ZB8A 1X9WB 3VK9A 2K6VA 1JLVA 5GZZB 4TRXA 2DJJA 6GSVA 4GRFA 3GL5A 5EY6A 2GS3A 2MMOA 4KA0A 1A23A 3ZMKA 5BMUB 2IL3A 2B1LA 3FYGA 4IQAA 3UARA 5INYA 3M1GA 1OC9A 1G6YA 5DQYA 1TDIA 1EOGA 1SYRA 1QQ2A 2L5LA 5D9VA 4H86A 3WGXA 1NHYA 4QL9A 2L57A 5KOXA 1GSSA 4JRRA 1O73A 4EF0A 2B7JA 4HEA2 3O3TA 1EWXA 2RM5A 4YQMA 3LSZA 1NSWA 1GNWA 4HJMA 3IK9A 2WFCA 1F6MC 5F07A 1GP1A 1TRWA 3TGZA 1ZMAA 1U3IA 3HKRA 1DUGA 4G19A 5F05A 4XHMA 3E0UA 1GTBA 4NHWA 3WT1A 3ERFA 2V41A 3FZ9A 4K1FA 3F0IA 1MDJA 1AQXA 3GL3A 2HSHA 5COHA 1Z7RA 3FZAA 2YPMA 2E0QA 3M8NA 3M9KA 3JCML 1GSQA 5AIVA 2B6MA 4D73A 2F51A 2G2QA 2M46A 4K7NA 1M9AA 1J9BA 3EC3A 3GSTA 3N5OA 4WBJA 4JE1A 3QAVA 2GSSA 2JZTA 2VLTA 1BEDA 2X64A 3VPQA 2L5OA 2VCXA 4GLTA 2TRCP 1EV9A 1N8JA 3EYTA 2V32A 3FRCA 5JCUA 4OFMA 4J56E 3KJYA 1WRYA 2XPEA 1PRXA 1K0NA 2FGXA 4I5QA 2B5YA 4MA9A 3TJGA 1S3CA 2C80A 5IO0A 1AQWA 3HJPA 2GSTA 5FT3A 5A1NA 14GSA 2CZ3A 4OWYA 3CWGA 3A5IA 3IV4A 4XS4B 2FWGA 1ZOFA 1N25A 2C0EA 1K0OA 4MPGA 1WPIA 1HYUA 3QOUA 4O32A 1F3AA 3W8JA 4BVXA 1OVNA 1T4YA 5ECKB 4EC0A 5A4WA 1E6BA 1Q98A 1NW2A 1K3LA 3ZFLA 2YV7A 1G0TA 20GSA 2GDRA 2C0GA 3A3TA 1TU7A 4NWYA 2MMAA 4L5OA 1K3OA 1FG4A 1XOAA 2YWIA 5JWQB 5ECQB 1X5DA 3KD0A 2EFEA 2GQMA 1AQVA 2GZZA 5J40A 3GKNA 11GSA 3L9UA 4ECJA 1XBSA 1RW1A 5DCGA 3L0HA 2EFCA 1G7OA 3IXRA 1KBNA 3C1SA 3H79A 4MZWA 4D73B 5J3RA 5IMZA 5ABRA 4X1UA 3QCPA 3TU3B 1PX6A 1F3BA 2B1KA 2IMKA 3VFIA 3KMOA 2H1DA 4KB3A 1MD4A 2YWNA 2H1AA 1PSQA 1YZXA 3U5RE 3IK7A 3TRPA 4YAPA 1R7HA 1V40A 5KN2A 4MP4A 2K18A 2R0PA 1UA5A 4FYUA 2A2PA 3TUEA 1A2JA 2OJLA 3TCOA 1U3AA 2H6ZA 2PGTA 4PTSA 1H4OA 4FO5A 3UL3A 1XXUA 4OD7A 4ZILA 3DKSA 3CSIA 2HT9A 1EEJA 5ID2A 6GSUA 1ZYQB 3TRQA 4MJEA 5JWRB 1NHOA 4ZBBA 3LYPA 2NPBA 4G2EA 5A1NB 4J2FA 4ZL9A 1NM3A 3ERGA 2E2MA 4LMWA 2FUG2 1R5PA 5DJLA 4MJAA 3ZLPA 2FD3A 2LNTA 3KXOA 2IWTA 3VWUA 4BVXB 1QK8A 3KGKA 4FIWA 3P90A 4BWQA 1O6JA 3M0FA 4WBRD 4AJ6A 3C71A 1GTUA 3VI7A 3HMJG 1LJRA 3LQ7A 1ERUA 4Q5QA 1GRXA 5H5RA 4MF7A 2VL9A 1B48A 2J9HA 3D22A 1CQHA 5IMCA 5FWGA 1ZYNA 4PXOA 2GSQA 1FW1A 2YZUA 1YVLA 2VLUA 4LLRA 3CXGA 4BL7B 2KP2A 3FKFA 2H70A 3KZQA 5CYYA 2GT5A 1GWCA 3IHGA 2DKIA 5AISA 3F8UA 3D0ZA 4YQVA 4F82A 4PUFC 3M3MA 3VWWA 3KM6A 2CVBA 3R2QA 1EOHA 2WCIA 4TR3A 2JL4A 2V6OA 4HJ2A 1YJ6A 1BJXA 3GH9A 4TKYA 4KSOA 5IOWA 5G30A 2HSYA 2C3NA 2TIRA 5EL8A 3I9V2 3G7JA 1ERWA 4GWRA 3KEBA 4G0KA 2YWOA 3HHVA 4ULXA 4OMVA 1I9DA 2IFQB 3ZIVA 2KUCA 3L4NA 1SVMA 2EIOA 2X4AA 2FWFA 3FZ4A 2HZFA 2V6KA 4N0VA 5ID2B 5CREA 2N5FA 2VCQA 2MYGA 1VF4A 4MH3A 3HDCA 3GNJA 2OT3A 2LQOA 1TU8A 1AAZA 1YY7A 3LJRA 2GSRA 5G1KA 2IMEA 3SWLA 4AKHA 2K8SA 5EVOA 2H0IA 2ZUPA 1PN9A 5BMUA 4GF0A 3FEUA 1XW9A 2YP6A 3IRAA 2F3MA 1A8YA 1B9XC 4YKGA 3HVXA 1WMJA 5J4YA 5B6MA 3E3EA 3CSJA 2VKZG 1Z7PA 2LQQA 17GSA 1GTIA 3L9SA 1XWGA 4ZB9A 2WDUA 1JFUA 4WR5A 5A5HA 3ZFBA 2LRNA 4DSRA 3GUSA 2D2ZA 2M72A 5HFGA 1GSDA 4F0BA 4WR4A 2XC2A 4G01A 1ABAA 1YKCA 1DBYA 2WZ9A 2VM2A 4I2TA 4JR4A 6GSXA 4RI6A 2H01A 4V1Ag 4WF5A 2A2SA 1J08A 4K8MA 4JR6A 1F9MA 5E4WA 1A8LA 3APOA 5F0GA 2VD0A 4XTSA 3UBLA 1SL0B 3F6DA 2O89A 2B3SA 5D9WA 3C1RA 4XCSA 3HYPA 4IJ3A 3KH9A 5IO2A 5LCZA 3A2XA 3DWVA 1TK8B 2HQTA 2PWJA 1WE0A 2HRFA 1K0AA 1OC8A 1R26A 4HOJA 1OKDA 3VLNA 4J57E 4V2MA 1XWCA 2CVDA 4HU9A 5HR0A 4RQXA 4WETA 4ZB7A 2E7PA 2H0GA 4F2IA 1F2EA 2KHPA 2C8UA 1B9YC 4Z2TA 4IQ1A 5CRHA 1URMA 4G0LA 4DSQA 4MK3A 2H19A 4QL7A 3MAKA 3IDVA 2GT6A 4IHUA 3ERWA 3RBTA 3GH6A 3C8EA 4NMUA 2VL2A 2YN1A 3LWAA 4EIPA 3GHAA 3EWLA 1GH2A 2LTKA 5DQSA 5DJMA 4G0IA 1XW5A 2JZRA 2DBCA 2H1BA 2HZEB 5CRWA 3L9VA 5D96A 4XS4A 2HFDA 3FR6A 5A5HB 1BG5A 3C7MA 1K3YA 3RPPA 4LL4B 2BJXA 5GAND 2YCDA 2EC4A 1FAAA 2JU5A 3DD3A 3BOAA 1VF1A 1DE2A 4K9ZA 4QMKA 3APSA 4ECCA 1OC3A 2KOKA 4K2XA 1SJZA 1TXUA 1CQGA 2IN3A 2LNSA 3DVWA 4MJCA 1TRVA 2H75A 1GNEA 4X0XA 1XWBA 1T00A 1RK4A 3I69A 2I1UA 1B4QA 1BF5A 3UBKA 4PNFA 4IGJA 3PR8A 4PQHA 2JACA 5DBQA 3UVTA 5G2ZA 3TKSA 4AKGA 1OAZA 3DRNA 1Z3EA 5B8BA 1BAYA 4PQIA 4ZBAA 3CRTA 1PL2A 1MDIA 4F0CA 3GX0A 2AB6A 4E8HA 1V58A 3IHQA 2GTUA 1M9BA 1Q4JA 3A2VA 3M9JA 3QPMA 1ZCPA 1JHBA 4OO4A 3W6GA 1YF0A 2HRKA 1YEPA 4IELA 1K0DA 4YAVA 4N30A 1O7UA 3CYNA 2FY6A 1FOHA 3MYDA 4MPFA 2XBIA 3ZL5A 5ECMB 2H66A 1M0UA 4V2NA 4ZL7A 3PINA 3N9JA 1ZZYA 1SJ6A 5G1LA 1XW6A 3E9JB 4AKXB 3IE3A 4GCIA 5G5EA 5AIXA 2QSIA 4WF4A 5J9CA 1SU9A 3HZ4A 1BX9A 3IOSA 3BBYA 3H4KA 1XVQA 3ZTLA 3ME7A 2XHFA 3LGCA 1OKTA 1Y6EA 1H75A 3DXBA 5ECNB 3WGDA 5AGYA 1M2AA 2YOIA 2E2GA 4IKHA 3F4TA 1HNBA 1USBA 1PMTA 2VCWA 2HLSA 5G5FA 3KCMA 2GZPA 2NBSA 1OE8A 2OA7A 5A4UA 1XOBA 4K0GA 3QDNA 1XWKA 4XRAA 1PKZA 1ZYPA 3NZNA 3DVXA 3O6TA 2WB9A 3MDKA 2VM1A 1VF2A 5A34B 4OCFA 4DSSA 1ERTA 3ZREA 3DMLA 3GN3A 2YANA 4MLYA 5ENUA 3J7Yb 1O8WA 4WEYA 3PH9A 5GSTA 1K0CA 2P0GA 4BA7A 3HY2A 1EEMA 1TTZA 2VOCA 4BL7A 1KNGA 1OE7A 3F3QA 4MF5A 2X8GA 1MD3A 2FHEA 5HFKA 3TJFA 5G31A 3KIJA 3WT2A 4XIHA 2NTOA 1Z6NA 4TXVA 5DALA 2RIIA 2JADA 2X99A 4G9HA 4IP1A 1U87A 3HCZA 4TR4A 1VF3A 22GSA 2B5XA 3GKXA 2HRKB 3KTBA 2AYTA 1FHEA 3GTUB 5ECSA 5IOXA 3PPUA 2FNOA 5JCGA 2C0DA 1ZGNA 1M2BA 2EIQA 2C4JA 2EFDA 2IMIA 2DJ0A 3FZ5A 5J41A 4MMMA 2IFQA 4POMA 4YH2A 3LORA 5ECRB 4ECIA 2ON7A 3ZYWA 4GDFA 5EPFA 2PBJA 1TW9A 4FH8A 2XPDA 2FCHA 3DYRA 2ZNMA 4HQZA 1THOA 2P5QA 5KN3A 2A4HA 5ECPB 2H30A 4V1Ap 3TRXA 4HQSA 2WRTA 1W4VA 2P5RA 3FW2A 4FQUA 3HVVA 2VUPA 2KP1A 1WOUA 2DSAA 2L4CA 1G6WA 4IJIA 3BJ5A 1YQ1A 3IC8A 1J0FA 2O5VA 2L6DA 1OYJA 4DEJA 1Y1UA 4EO3A 1T4ZA 2DJ2A 2FA8A 3MNGA 1SVLA 5D8IA 2H0HA 1QMVA 1SK0A 2DJKA 3PGTA 3UVHA 4DSSB 3MSZA 3C73A 3TJBA 2O7KA 4TXOB 1JLWA 1GLQA 3NOFA 2VO4A 1ERVA 3TDGA 2H74A 4O5UA 3TOUA 2GGTA 3ZRDA 2DKHA 3EU3A 4KUNA 4HDEA 2MMZA 2QGVA 2GQLA 5IPHA 1VRSD 3IBHA 1THXA 3IAS2 2QC7A 3CTGA 2CT6A 1B8XA 2DMLA 5KN0A 1I5GA 5DALB 2JZSA 1TJDA 5IQYA 10GSA 4G10A 3QAWA 1M99A 1UN2A 4ZXGA 2H1GA 3FY7A 1V98A 1W89A 4ZBDA 1HNCA 2LRCA 2VIMA 5BRTA 4KDXA 3ZVJD 2H71A 3S9FA 1EP7A 4A5PA 1YEXA 2G0FA 5D9XA 6GSWA 4IN0A 2DJ1A 2F8AA 5A4VA 3R3EA 2UV8G 2NDOA 1IYHA 4P3YB 1SYXA 2L59A 16GSA 5CRGA 2R4VA 1IYIA 3P8WA 5ECLB 3US3A 1TRUA 2R37A 4KDYA 6GSSA 4GSTA 4PQ1A 5D9TA 1AC1A 1HQOA 4OO5A 1TXXA 2MMNA 1GUKA 2XBQA 2MBSA 3UAPA 2ES7A 4KCAA 5E59A 9GSSA 3GA4A 4K5RA 4Z7XA 3BCKA 4EKZA 5F06A 1AXDA 4GQCA 2KLXA 1TK5B 3HJOA 5DDLA 3EMPA 2P31A 4K7IA 1HNAA 4CDOA 3EPTA 7GSSA 1FOVA 4JBBA 3A5WA 2FLSA 2HZEA 3GURA 1XVWA 3F4SA 4ZB6A 2BTOT 2OBKA 2H76A 1C72A 1N2AA 3TJKA 2PVOC 4EXJA 2I4AA 4O5QA 5C00A 2LKUA 4W66A 4PUAA 4LA1A 4MH2A 3HA9A 1EGOA 2WGRA 4PURA 4USSA 2ALBA 5IMDA 3KP9A 1AUCA 1XWAA 2A2RA 1QGVA 2R5GA 4WXTA 5J4UA 2IPAA 19GSA 4GTUA 4XS1A 2VCVA 1TKDB 5J4VA 3P2AA 4JU5A 4K7OA 2YJHA 1FVJA 2VCTA 3P7XA 3FK8A 1EV4A 1A24A 2HSMB 3ZITA 4EL1A 2CVKA 1GL8A 1O81A 4KAEA 1HD2A 5GSSA 4MCUA 4F9ZA 1Z6MA 5HR2A 5KN1A 3D6IA 4OCEA 4ECBA 1SKSB 3ZIJA 1R5AA 3TB2A 2PPTA 2WS2A 4F03A 2HE3A 3BD2A 3HD5A 3CBUA 5B7CA 3K8NA 1K0MA 1X5CA 3LXTA 2CX4A 3EVIA 1JZOA 2PU9C 1KTEA 3ED3A 5DAKA 1GUMA 2NVLA 3GX8A 1T3BA 1TK0B 1FB0A 3TKPA 1FVKA 3QAGA 1KEBA 4O5RA 1T8EB 2H6XA 3IAM2 4OFTA 5ELGA 4RUVA 5DCHA 5J9BA 3QD9A 5HR3A 1TI3A 4GSNA 1S3DA 1G7EA 2AUVA 3GSSA 5ECIB 2L4QA 1MTCA 1UC7A 4DVCA 5CO3A 3TOTA 4GXZA 4ACSA 2PMTA 3F4RA 2X49A 4ZIJA 2REMA 3NIVA 1PL1A 5H5QA 2OACA 3DEXA 1ACVA 5IMFA 3WD6A 2OKAA 5A34A 2I3YA 4MZCA 3HXSA 4TR1B 5CNWA 4RQRA 2HYXA 1TRSA 2DIYA 2H1LA 3GYKA 2RUFA 2GZYA 1K0BA 2OE1A 2H8LA 2X8HA 4N11A 3A2WA 1M2DA 4CY6A 3IR4A 3W8SA 3O76A 1WJKA 4KNDA 2WJUA 1ZYEA 4OFNA 4E68A 3G7YA 2LRTA 1A0FA 4NAXA 2DC5A 2GVPA 3UIWA 2CA8A 2K9FA 1GSYA 5A5KA 2C3QA 1BG1A 3Q19A 3CRUA 4EDYA 4IBPA 3F6FA 5ECOB 4YQUA 1TOFA 3EMXA 5F8BA 3HVSA 3H1NA 3Q6OA 5HQPA 2YJ7A 5J5NA 3ZVJA 3GTUA 4GQFA 4NXIA 4AI6A 5L71A 2LS5A 5IIZA 4POBA 3U6VA 3BCIA 1QUWA 12GSA 1F37A 3GKMA 1TI1A 4HS1A 1XIYA 2OE3A 1V57A 3D4MA 1SVOA 1EZKA 5DAKB 2VLVA 1SK1A 4KH7A 3EURA 4AGSA 1YF1A 18GSA 4KX4A 4Z2UA 1T7PB 4IS0A 5ELAA 2LJRA 1PQNA 1SD8A 3TKQA 1DE1A 2IMDA 4BWSA 5CP1A 5LD0A 4ILFA 4EE0A 5CAXA 5AN1A 2M80A 4Q5RA 1U88A 2LJAA 3ZZXA 4Q5NA 4HZ4A 1XFLA 2C1YA 4Z2RA 4I6XA 1OC9B 1V9WA 3LFLA 3KP8A 4CHSA 4WKWA 3ZMLA 2R0CA 6GSTA 4POKA 2O85A 3TJJA 2MBTA 2N5BA 4IP6A 4BVYA 1SKWB 3FMWA 5HR1A 2AJQB 3Q18A 1A2LA 2CQ9A 2PN8A 1Z5YE 2HXKA 4TXOA 4EUYA 5IMAA 5JWOB 1SENA 2GQKA 4NPBA 3GIXA 1Y25A 5KEJA 1AIUA 2WULA 2AV4A 3L78A 2V2GA 2I81A 3UJ1A 4XS6A 1GSUA 6GSYA 3ISOA 4PX1A 3GV1A 2ZCTA 3RHBA 2TRXA 4O92A 5ECHB 3KH7A 2HSNA 3VURA 4BPYA 1O85A 1BYEA 2HRAA 2FWEA 2PVQA 3IA1A 1B4PA 3RDWA 2YZHA 2GLRA 1XZOA 2EFHA 2EIRA 4CY8A 2VAFA 2FA4A 2HRNA 1YKAA 3CTFA 5KOWA 3TKSE 5D93A 2QKEA 3GFKA 4GSSA 4V2LA 3D21A 3WYWA 4X43A 2R3XA 2K8VA 4ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FYC A;  3J7Y k;  3I6A A;  2CX3 A;  4L0W A;  1YDK A;  4K2D A;  2HNL A;  2CZ2 A;  2OAD A;  2HI7 A;  3APQ A;  2OE0 A;  2V1M A;  5B8A A;  3LG6 A;  1JZR A;  4KW6 A;  4KE3 A;  5IMV A;  5DVB A;  3LYK A;  3I43 A;  2H73 A;  3EIN A;  5LNK e;  4EVM A;  4LMV A;  4HU7 A;  3QFB C;  4L5L A;  1R4W A;  4ML1 A;  4O7H A;  4EDZ A;  1JZD A;  1EP8 A;  2IIY A;  2OBI A;  5FHI A;  1X9M B;  3DGQ A;  1TP9 A;  2LST A;  4BVY B;  4N10 A;  2DIZ A;  4Q5F A;  4ISD A;  4KF9 A;  4JED A;  4I97 A;  3FHK A;  1MDK A;  2BMX A;  2PUK C;  1UVZ A;  1GUH A;  3LEF A;  1A0R P;  1X9S B;  3F9U A;  2JSZ A;  3F63 A;  4MAB A;  1FO5 A;  2YWM A;  2O87 A;  2VCZ A;  2O8V B;  3V1W A;  1SJI A;  4TN8 A;  5CRD A;  4AJ7 A;  3FR9 A;  2I9H A;  2F9S A;  1ON4 A;  3VWX A;  3RAZ A;  4ML6 A;  1RQM A;  2DJ3 A;  3IPZ A;  4N0Z A;  5IM9 A;  4NV5 A;  1V2A A;  5IPG A;  4PNG A;  1S3A A;  2JSY A;  2HSN B;  3SBC A;  1PX7 A;  1SD9 A;  1VGL A;  2C0F A;  3H8Q A;  3EE2 A;  2PER A;  2UZ8 A;  3VWV A;  4QQ7 A;  4I2U A;  2IMF A;  4AJ8 A;  2HSM A;  3KMN A;  1MEK A;  1M7T A;  3MWH A;  1A2M A;  8GSS A;  4JZQ A;  3D4T A;  3G7I A;  4KGI A;  1GTA A;  2C3T A;  2LUS A;  1Z9H A;  3HZ8 A;  3EU4 A;  5GAP D;  3GKK A;  3RHC A;  1E2Y A;  2CAI A;  3VI5 A;  1QXH A;  1QFN A;  2A4V A;  4IW9 A;  5D73 A;  1ILO A;  3CMI A;  3QMX A;  4ID0 A;  2CAQ A;  1WP0 A;  5C04 A;  3WGE A;  3ME8 A;  2DMM A;  3GRX A;  1GLP A;  4XRD A;  2MZC A;  4FYB A;  2AAW A;  1GSE A;  1FB6 A;  2H72 A;  3D5J A;  2VL3 A;  1XPV A;  2CV4 A;  3GMF A;  5HFI A;  2ON5 A;  4HI7 A;  1WWJ A;  2RUE A;  4PGT A;  2RLI A;  4K0N A;  3VPT A;  4E8E A;  4I8B A;  5H5S A;  2J23 A;  4HZ2 A;  2X8C A;  4NHZ A;  3QFA C;  1PD2 1;  4L8E A;  3UMA A;  3HJM A;  4TOP A;  2DLX A;  1LU4 A;  3AY8 A;  4LL1 B;  13GS A;  3LXZ A;  4RI7 A;  4MJB A;  2B5E A;  2R2J A;  1EGR A;  4NV2 A;  5JCW A;  2VL2 C;  4AF2 A;  3H93 A;  2YV9 A;  4TR1 A;  2LJK A;  2B7K A;  2AHE A;  1O8X A;  2LEG A;  3QR6 A;  4IVF A;  1X0R A;  2YNX A;  3F3R A;  4HUA A;  4KDU A;  3DIE A;  3RPN A;  3KTL A;  2IJY A;  1SL2 B;  2Z9S A;  2R6K A;  3IC4 A;  3TKR A;  4MDC A;  1SKR B;  1GSF A;  4CW9 A;  1U6T A;  2RM6 A;  1SK2 A;  1JZW A;  1XCC A;  1AW9 A;  2FWH A;  3FR3 A;  4TW5 A;  1ML6 A;  1DSB A;  4K6X A;  1WIK A;  2LV3 A;  4MF6 A;  3G9B A;  2VD1 A;  5B6N A;  3OR5 A;  2F8F A;  1ZL9 A;  1SL1 B;  1X5E A;  4L0U A;  3Q74 A;  3CSH A;  4POL A;  1PGT A;  1LBK A;  1GUL A;  4TVE A;  1PKW A;  3UOM A;  4TR0 A;  3UEM A;  1T1V A;  4KSM A;  4KCE A;  3TKS C;  1ST9 A;  4MZB A;  1BQ7 A;  2L6C A;  2H6Y A;  2N5A A;  1PA3 A;  4ZB8 A;  1X9W B;  3VK9 A;  2K6V A;  1JLV A;  5GZZ B;  4TRX A;  2DJJ A;  6GSV A;  4GRF A;  3GL5 A;  5EY6 A;  2GS3 A;  2MMO A;  4KA0 A;  1A23 A;  3ZMK A;  2IL3 A;  2B1L A;  3FYG A;  4IQA A;  3UAR A;  5INY A;  3M1G A;  1OC9 A;  1G6Y A;  5DQY A;  1TDI A;  1EOG A;  1SYR A;  1QQ2 A;  2L5L A;  5D9V A;  4H86 A;  3WGX A;  1NHY A;  4QL9 A;  2L57 A;  1GSS A;  4JRR A;  1O73 A;  4EF0 A;  2B7J A;  4HEA 2;  3O3T A;  1EWX A;  2RM5 A;  4YQM A;  3LSZ A;  1NSW A;  1GNW A;  4HJM A;  3IK9 A;  2WFC A;  1F6M C;  5F07 A;  1GP1 A;  1TRW A;  3TGZ A;  1ZMA A;  1U3I A;  3HKR A;  1DUG A;  4G19 A;  5F05 A;  4XHM A;  3E0U A;  1GTB A;  4NHW A;  3WT1 A;  3ERF A;  2V41 A;  3FZ9 A;  4K1F A;  3F0I A;  1MDJ A;  1AQX A;  3GL3 A;  2HSH A;  5COH A;  1Z7R A;  3FZA A;  2YPM A;  2E0Q A;  3M8N A;  3M9K A;  3JCM L;  1GSQ A;  5AIV A;  2B6M A;  4D73 A;  2F51 A;  2G2Q A;  2M46 A;  4K7N A;  1M9A A;  1J9B A;  3EC3 A;  3GST A;  3N5O A;  4WBJ A;  4JE1 A;  3QAV A;  2GSS A;  2JZT A;  2VLT A;  1BED A;  2X64 A;  3VPQ A;  2L5O A;  2VCX A;  4GLT A;  2TRC P;  1EV9 A;  1N8J A;  3EYT A;  2V32 A;  3FRC A;  5JCU A;  4OFM A;  4J56 E;  3KJY A;  1WRY A;  2XPE A;  1PRX A;  1K0N A;  2FGX A;  4I5Q A;  2B5Y A;  4MA9 A;  3TJG A;  1S3C A;  2C80 A;  5IO0 A;  1AQW A;  3HJP A;  2GST A;  5FT3 A;  14GS A;  2CZ3 A;  4OWY A;  3IV4 A;  4XS4 B;  2FWG A;  1ZOF A;  2C0E A;  1K0O A;  4MPG A;  1WPI A;  1HYU A;  3QOU A;  4O32 A;  1F3A A;  3W8J A;  4BVX A;  1OVN A;  1T4Y A;  5ECK B;  4EC0 A;  5A4W A;  1E6B A;  1Q98 A;  1NW2 A;  1K3L A;  3ZFL A;  2YV7 A;  1G0T A;  20GS A;  2GDR A;  2C0G A;  3A3T A;  1TU7 A;  4NWY A;  2MMA A;  4L5O A;  1K3O A;  1FG4 A;  1XOA A;  2YWI A;  5JWQ B;  5ECQ B;  1X5D A;  3KD0 A;  2GQM A;  1AQV A;  2GZZ A;  3GKN A;  11GS A;  3L9U A;  4ECJ A;  1XBS A;  1RW1 A;  5DCG A;  3L0H A;  1G7O A;  3IXR A;  1KBN A;  3C1S A;  3H79 A;  4MZW A;  4D73 B;  5J3R A;  5IMZ A;  5ABR A;  4X1U A;  3QCP A;  1PX6 A;  1F3B A;  2B1K A;  2IMK A;  3VFI A;  3KMO A;  2H1D A;  4KB3 A;  1MD4 A;  2YWN A;  2H1A A;  1PSQ A;  1YZX A;  3U5R E;  3IK7 A;  3TRP A;  4YAP A;  1R7H A;  1V40 A;  5KN2 A;  4MP4 A;  2K18 A;  1UA5 A;  4FYU A;  3TUE A;  1A2J A;  2OJL A;  3TCO A;  1U3A A;  2H6Z A;  2PGT A;  4PTS A;  1H4O A;  4FO5 A;  3UL3 A;  1XXU A;  4OD7 A;  4ZIL A;  3DKS A;  3CSI A;  2HT9 A;  1EEJ A;  5ID2 A;  6GSU A;  1ZYQ B;  3TRQ A;  4MJE A;  5JWR B;  1NHO A;  4ZBB A;  3LYP A;  2NPB A;  4G2E A;  4J2F A;  4ZL9 A;  1NM3 A;  3ERG A;  2E2M A;  4LMW A;  2FUG 2;  1R5P A;  5DJL A;  4MJA A;  3ZLP A;  2FD3 A;  2LNT A;  3KXO A;  2IWT A;  3VWU A;  4BVX B;  1QK8 A;  3KGK A;  4FIW A;  3P90 A;  4BWQ A;  1O6J A;  3M0F A;  4WBR D;  4AJ6 A;  3C71 A;  1GTU A;  3VI7 A;  1LJR A;  3LQ7 A;  1ERU A;  4Q5Q A;  1GRX A;  5H5R A;  4MF7 A;  2VL9 A;  1B48 A;  2J9H A;  3D22 A;  1CQH A;  5IMC A;  5FWG A;  4PXO A;  2GSQ A;  1FW1 A;  2YZU A;  2VLU A;  4LLR A;  3CXG A;  4BL7 B;  2KP2 A;  3FKF A;  2H70 A;  3KZQ A;  5CYY A;  2GT5 A;  1GWC A;  5AIS A;  3F8U A;  3D0Z A;  4YQV A;  4F82 A;  4PUF C;  3M3M A;  3VWW A;  3KM6 A;  2CVB A;  3R2Q A;  1EOH A;  2WCI A;  4TR3 A;  2JL4 A;  2V6O A;  4HJ2 A;  1YJ6 A;  1BJX A;  3GH9 A;  4TKY A;  4KSO A;  5IOW A;  5G30 A;  2HSY A;  2C3N A;  2TIR A;  5EL8 A;  3I9V 2;  3G7J A;  1ERW A;  4GWR A;  3KEB A;  4G0K A;  2YWO A;  3HHV A;  4ULX A;  4OMV A;  1I9D A;  2IFQ B;  3ZIV A;  2KUC A;  3L4N A;  2EIO A;  2FWF A;  3FZ4 A;  2HZF A;  2V6K A;  4N0V A;  5ID2 B;  5CRE A;  2N5F A;  2VCQ A;  2MYG A;  1VF4 A;  4MH3 A;  3HDC A;  3GNJ A;  2LQO A;  1TU8 A;  1AAZ A;  1YY7 A;  3LJR A;  2GSR A;  5G1K A;  2IME A;  3SWL A;  2K8S A;  5EVO A;  2H0I A;  2ZUP A;  1PN9 A;  5BMU A;  4GF0 A;  3FEU A;  1XW9 A;  2YP6 A;  3IRA A;  2F3M A;  1A8Y A;  1B9X C;  3HVX A;  1WMJ A;  5B6M A;  3E3E A;  3CSJ A;  1Z7P A;  2LQQ A;  17GS A;  1GTI A;  3L9S A;  1XWG A;  4ZB9 A;  2WDU A;  1JFU A;  4WR5 A;  3ZFB A;  2LRN A;  4DSR A;  3GUS A;  2D2Z A;  2M72 A;  5HFG A;  1GSD A;  4F0B A;  4WR4 A;  2XC2 A;  1ABA A;  1YKC A;  1DBY A;  2WZ9 A;  2VM2 A;  4I2T A;  4JR4 A;  6GSX A;  4RI6 A;  2H01 A;  4V1A g;  4WF5 A;  2A2S A;  1J08 A;  4K8M A;  4JR6 A;  1F9M A;  5E4W A;  1A8L A;  3APO A;  5F0G A;  2VD0 A;  4XTS A;  3UBL A;  1SL0 B;  3F6D A;  2O89 A;  2B3S A;  5D9W A;  3C1R A;  4XCS A;  3HYP A;  4IJ3 A;  3KH9 A;  5IO2 A;  5LCZ A;  3A2X A;  3DWV A;  1TK8 B;  2HQT A;  2PWJ A;  1WE0 A;  2HRF A;  1K0A A;  1OC8 A;  1R26 A;  4HOJ A;  1OKD A;  3VLN A;  4J57 E;  4V2M A;  1XWC A;  2CVD A;  4HU9 A;  5HR0 A;  4RQX A;  4WET A;  2E7P A;  2H0G A;  4F2I A;  1F2E A;  2KHP A;  2C8U A;  1B9Y C;  4IQ1 A;  5CRH A;  1URM A;  4G0L A;  4DSQ A;  4MK3 A;  2H19 A;  4QL7 A;  3MAK A;  3IDV A;  2GT6 A;  4IHU A;  3ERW A;  3RBT A;  3GH6 A;  3C8E A;  4NMU A;  2VL2 A;  2YN1 A;  3LWA A;  3GHA A;  3EWL A;  1GH2 A;  2LTK A;  5DQS A;  5DJM A;  4G0I A;  1XW5 A;  2JZR A;  2DBC A;  2H1B A;  2HZE B;  5CRW A;  3L9V A;  5D96 A;  4XS4 A;  2HFD A;  3FR6 A;  1BG5 A;  3C7M A;  1K3Y A;  3RPP A;  4LL4 B;  2BJX A;  5GAN D;  2YCD A;  2EC4 A;  1FAA A;  2JU5 A;  3DD3 A;  3BOA A;  1VF1 A;  1DE2 A;  4K9Z A;  3APS A;  4ECC A;  1OC3 A;  2KOK A;  1SJZ A;  1CQG A;  2IN3 A;  2LNS A;  3DVW A;  4MJC A;  1TRV A;  2H75 A;  1GNE A;  4X0X A;  1XWB A;  1T00 A;  1RK4 A;  3I69 A;  2I1U A;  1B4Q A;  3UBK A;  4PNF A;  4IGJ A;  3PR8 A;  4PQH A;  2JAC A;  5DBQ A;  3UVT A;  5G2Z A;  3TKS A;  1OAZ A;  3DRN A;  1Z3E A;  5B8B A;  1BAY A;  4PQI A;  4ZBA A;  3CRT A;  1PL2 A;  1MDI A;  4F0C A;  3GX0 A;  2AB6 A;  4E8H A;  1V58 A;  3IHQ A;  2GTU A;  1M9B A;  1Q4J A;  3A2V A;  3M9J A;  3QPM A;  1ZCP A;  1JHB A;  4OO4 A;  3W6G A;  1YF0 A;  2HRK A;  1YEP A;  4IEL A;  1K0D A;  4YAV A;  4N30 A;  1O7U A;  3CYN A;  2FY6 A;  4MPF A;  2XBI A;  3ZL5 A;  5ECM B;  2H66 A;  1M0U A;  4V2N A;  4ZL7 A;  3PIN A;  3N9J A;  1ZZY A;  1SJ6 A;  5G1L A;  1XW6 A;  3E9J B;  3IE3 A;  4GCI A;  5G5E A;  5AIX A;  2QSI A;  4WF4 A;  5J9C A;  1SU9 A;  3HZ4 A;  1BX9 A;  3IOS A;  3BBY A;  3H4K A;  1XVQ A;  3ZTL A;  3ME7 A;  2XHF A;  3LGC A;  1OKT A;  1Y6E A;  1H75 A;  3DXB A;  5ECN B;  3WGD A;  5AGY A;  1M2A A;  2YOI A;  2E2G A;  4IKH A;  3F4T A;  1HNB A;  1USB A;  1PMT A;  2VCW A;  2HLS A;  5G5F A;  3KCM A;  2GZP A;  2NBS A;  1OE8 A;  2OA7 A;  5A4U A;  1XOB A;  4K0G A;  3QDN A;  1XWK A;  4XRA A;  1PKZ A;  3NZN A;  3DVX A;  3O6T A;  2WB9 A;  3MDK A;  2VM1 A;  1VF2 A;  4OCF A;  4DSS A;  1ERT A;  3ZRE A;  3DML A;  3GN3 A;  2YAN A;  4MLY A;  5ENU A;  3J7Y b;  1O8W A;  4WEY A;  3PH9 A;  5GST A;  1K0C A;  2P0G A;  4BA7 A;  3HY2 A;  1EEM A;  1TTZ A;  2VOC A;  4BL7 A;  1KNG A;  1OE7 A;  3F3Q A;  4MF5 A;  2X8G A;  1MD3 A;  2FHE A;  5HFK A;  3TJF A;  5G31 A;  3KIJ A;  3WT2 A;  4XIH A;  2NTO A;  1Z6N A;  4TXV A;  5DAL A;  2RII A;  2JAD A;  2X99 A;  4G9H A;  4IP1 A;  1U87 A;  3HCZ A;  4TR4 A;  1VF3 A;  22GS A;  2B5X A;  3GKX A;  2HRK B;  3KTB A;  2AYT A;  1FHE A;  3GTU B;  5ECS A;  5IOX A;  3PPU A;  2FNO A;  5JCG A;  2C0D A;  1ZGN A;  1M2B A;  2EIQ A;  2C4J A;  2DJ0 A;  2IMI A;  3FZ5 A;  5J41 A;  4MMM A;  2IFQ A;  4POM A;  4YH2 A;  3LOR A;  5ECR B;  4ECI A;  2ON7 A;  3ZYW A;  5EPF A;  2PBJ A;  1TW9 A;  4FH8 A;  2XPD A;  2FCH A;  3DYR A;  2ZNM A;  4HQZ A;  1THO A;  2P5Q A;  5KN3 A;  5ECP B;  2H30 A;  4V1A p;  3TRX A;  4HQS A;  2WRT A;  1W4V A;  2P5R A;  3FW2 A;  4FQU A;  3HVV A;  2VUP A;  2KP1 A;  1WOU A;  2DSA A;  2L4C A;  1G6W A;  4IJI A;  3BJ5 A;  1YQ1 A;  3IC8 A;  1J0F A;  2L6D A;  1OYJ A;  4DEJ A;  4EO3 A;  1T4Z A;  2DJ2 A;  2FA8 A;  3MNG A;  5D8I A;  2H0H A;  1QMV A;  1SK0 A;  2DJK A;  3PGT A;  3UVH A;  4DSS B;  3MSZ A;  3C73 A;  3TJB A;  2O7K A;  4TXO B;  1JLW A;  1GLQ A;  3NOF A;  2VO4 A;  1ERV A;  3TDG A;  2H74 A;  3TOU A;  2GGT A;  3ZRD A;  3EU3 A;  4KUN A;  4HDE A;  2MMZ A;  2QGV A;  2GQL A;  5IPH A;  1VRS D;  3IBH A;  1THX A;  3IAS 2;  2QC7 A;  3CTG A;  2CT6 A;  1B8X A;  2DML A;  5KN0 A;  1I5G A;  5DAL B;  2JZS A;  1TJD A;  5IQY A;  10GS A;  4G10 A;  3QAW A;  1M99 A;  1UN2 A;  4ZXG A;  2H1G A;  3FY7 A;  1V98 A;  1W89 A;  4ZBD A;  1HNC A;  2LRC A;  2VIM A;  4KDX A;  3ZVJ D;  2H71 A;  3S9F A;  1EP7 A;  1YEX A;  2G0F A;  5D9X A;  6GSW A;  4IN0 A;  2DJ1 A;  2F8A A;  5A4V A;  3R3E A;  2NDO A;  1IYH A;  4P3Y B;  1SYX A;  2L59 A;  16GS A;  5CRG A;  2R4V A;  1IYI A;  3P8W A;  5ECL B;  3US3 A;  1TRU A;  2R37 A;  4KDY A;  6GSS A;  4GST A;  4PQ1 A;  5D9T A;  1AC1 A;  1HQO A;  4OO5 A;  1TXX A;  2MMN A;  1GUK A;  2XBQ A;  2MBS A;  3UAP A;  2ES7 A;  4KCA A;  5E59 A;  9GSS A;  3GA4 A;  4Z7X A;  3BCK A;  4EKZ A;  5F06 A;  1AXD A;  4GQC A;  2KLX A;  1TK5 B;  3HJO A;  5DDL A;  3EMP A;  2P31 A;  4K7I A;  1HNA A;  4CDO A;  7GSS A;  1FOV A;  4JBB A;  3A5W A;  2FLS A;  2HZE A;  3GUR A;  1XVW A;  3F4S A;  4ZB6 A;  2BTO T;  2OBK A;  2H76 A;  1C72 A;  1N2A A;  3TJK A;  2PVO C;  4EXJ A;  2I4A A;  5C00 A;  2LKU A;  4PUA A;  4LA1 A;  4MH2 A;  3HA9 A;  1EGO A;  2WGR A;  4PUR A;  4USS A;  2ALB A;  5IMD A;  3KP9 A;  1AUC A;  1XWA A;  2A2R A;  1QGV A;  2R5G A;  4WXT A;  5J4U A;  2IPA A;  19GS A;  4GTU A;  4XS1 A;  2VCV A;  1TKD B;  3P2A A;  4JU5 A;  4K7O A;  2YJH A;  1FVJ A;  2VCT A;  3P7X A;  3FK8 A;  1EV4 A;  1A24 A;  2HSM B;  3ZIT A;  4EL1 A;  2CVK A;  1GL8 A;  1O81 A;  4KAE A;  1HD2 A;  5GSS A;  4MCU A;  4F9Z A;  1Z6M A;  5HR2 A;  5KN1 A;  3D6I A;  4OCE A;  4ECB A;  1SKS B;  3ZIJ A;  1R5A A;  3TB2 A;  2PPT A;  2WS2 A;  4F03 A;  2HE3 A;  3BD2 A;  3HD5 A;  3CBU A;  5B7C A;  3K8N A;  1K0M A;  1X5C A;  3LXT A;  2CX4 A;  3EVI A;  1JZO A;  2PU9 C;  1KTE A;  3ED3 A;  5DAK A;  1GUM A;  2NVL A;  3GX8 A;  1T3B A;  1TK0 B;  1FB0 A;  3TKP A;  1FVK A;  3QAG A;  1KEB A;  4O5R A;  1T8E B;  2H6X A;  3IAM 2;  4OFT A;  5ELG A;  4RUV A;  5DCH A;  5J9B A;  3QD9 A;  5HR3 A;  1TI3 A;  4GSN A;  1S3D A;  1G7E A;  2AUV A;  3GSS A;  5ECI B;  2L4Q A;  1MTC A;  1UC7 A;  4DVC A;  5CO3 A;  3TOT A;  4GXZ A;  4ACS A;  2PMT A;  3F4R A;  4ZIJ A;  2REM A;  3NIV A;  1PL1 A;  5H5Q A;  2OAC A;  3DEX A;  1ACV A;  5IMF A;  3WD6 A;  2OKA A;  2I3Y A;  4MZC A;  3HXS A;  4TR1 B;  5CNW A;  4RQR A;  2HYX A;  1TRS A;  2DIY A;  3GYK A;  2RUF A;  2GZY A;  1K0B A;  2OE1 A;  2H8L A;  2X8H A;  4N11 A;  3A2W A;  1M2D A;  3IR4 A;  3W8S A;  3O76 A;  1WJK A;  4KND A;  2WJU A;  1ZYE A;  4OFN A;  3G7Y A;  2LRT A;  1A0F A;  4NAX A;  2DC5 A;  2GVP A;  3UIW A;  2CA8 A;  2K9F A;  1GSY A;  5A5K A;  2C3Q A;  3Q19 A;  3CRU A;  4EDY A;  4IBP A;  3F6F A;  5ECO B;  4YQU A;  1TOF A;  3EMX A;  5F8B A;  3HVS A;  3H1N A;  3Q6O A;  5HQP A;  2YJ7 A;  5J5N A;  3ZVJ A;  3GTU A;  4GQF A;  4NXI A;  5L71 A;  2LS5 A;  5IIZ A;  4POB A;  3U6V A;  3BCI A;  1QUW A;  12GS A;  1F37 A;  3GKM A;  1TI1 A;  4HS1 A;  1XIY A;  2OE3 A;  1V57 A;  1EZK A;  3D4M A;  5DAK B;  2VLV A;  1SK1 A;  4KH7 A;  3EUR A;  4AGS A;  1YF1 A;  18GS A;  4KX4 A;  1T7P B;  4IS0 A;  5ELA A;  2LJR A;  1PQN A;  1SD8 A;  3TKQ A;  1DE1 A;  2IMD A;  4BWS A;  5CP1 A;  5LD0 A;  4ILF A;  4EE0 A;  5CAX A;  5AN1 A;  2M80 A;  4Q5R A;  1U88 A;  2LJA A;  3ZZX A;  4Q5N A;  4HZ4 A;  1XFL A;  2C1Y A;  4I6X A;  1OC9 B;  1V9W A;  3LFL A;  3KP8 A;  4CHS A;  4WKW A;  3ZML A;  6GST A;  4POK A;  2O85 A;  3TJJ A;  2MBT A;  2N5B A;  4IP6 A;  4BVY A;  1SKW B;  5HR1 A;  2AJQ B;  3Q18 A;  1A2L A;  2CQ9 A;  2PN8 A;  1Z5Y E;  2HXK A;  4TXO A;  4EUY A;  5IMA A;  5JWO B;  1SEN A;  2GQK A;  4NPB A;  3GIX A;  1Y25 A;  5KEJ A;  1AIU A;  2WUL A;  2AV4 A;  3L78 A;  2V2G A;  2I81 A;  3UJ1 A;  4XS6 A;  1GSU A;  6GSY A;  3ISO A;  4PX1 A;  3GV1 A;  2ZCT A;  3RHB A;  2TRX A;  4O92 A;  5ECH B;  3KH7 A;  4BPY A;  3VUR A;  1O85 A;  1BYE A;  2HRA A;  2FWE A;  2PVQ A;  3IA1 A;  1B4P A;  3RDW A;  2YZH A;  2GLR A;  1XZO A;  2EIR A;  2VAF A;  2FA4 A;  2HRN A;  1YKA A;  3CTF A;  3TKS E;  5D93 A;  2QKE A;  3GFK A;  4GSS A;  4V2L A;  3D21 A;  3WYW A;  4X43 A;  2R3X A;  2K8V A;  4ZL8 A; 
#chains in the Genus database with same CATH topology
 4FYC A;  3J7Y k;  3I6A A;  2CX3 A;  4L0W A;  1YDK A;  4K2D A;  2HNL A;  2CZ2 A;  2OAD A;  2HI7 A;  1PN0 A;  3APQ A;  1YEW C;  2OE0 A;  2V1M A;  5B8A A;  2WW1 A;  3LG6 A;  1JZR A;  4KW6 A;  4KE3 A;  5IMV A;  5DVB A;  3LYK A;  3I43 A;  2H73 A;  3EIN A;  5LNK e;  4EVM A;  4LMV A;  4HU7 A;  3QFB C;  4L5L A;  1R4W A;  4ML1 A;  4O7H A;  4PHZ C;  4EDZ A;  1JZD A;  1EP8 A;  2IIY A;  2OBI A;  5FHI A;  1X9M B;  3DGQ A;  1TP9 A;  2LST A;  4BVY B;  4N10 A;  2DIZ A;  4Q5F A;  4ISD A;  4KF9 A;  4N3Z A;  4JED A;  4I97 A;  3FHK A;  1MDK A;  2BMX A;  2PUK C;  1UVZ A;  1GUH A;  3LEF A;  1A0R P;  1X9S B;  3F9U A;  2JSZ A;  3F63 A;  4MAB A;  1FO5 A;  4PI2 C;  2YWM A;  2O87 A;  2VCZ A;  2O8V B;  3V1W A;  1SJI A;  4TN8 A;  4X4J A;  5CRD A;  4AJ7 A;  3FR9 A;  2I9H A;  4EIQ A;  2F9S A;  1ON4 A;  3LW9 A;  3VWX A;  3RAZ A;  4ML6 A;  1RQM A;  2DJ3 A;  3IPZ A;  4N0Z A;  4AKI A;  5IM9 A;  4NV5 A;  1V2A A;  5IPG A;  4PNG A;  1S3A A;  2JSY A;  2HSN B;  3SBC A;  1PX7 A;  1SD9 A;  1VGL A;  2C0F A;  2WW3 A;  3H8Q A;  3EE2 A;  2PER A;  2UZ8 A;  3VWV A;  4QQ7 A;  4I2U A;  2IMF A;  4AJ8 A;  2HSM A;  3KMN A;  1MEK A;  1M7T A;  3MWH A;  2R0G A;  1A2M A;  8GSS A;  4JZQ A;  3D4T A;  3G7I A;  4KGI A;  1GTA A;  2C3T A;  2LUS A;  1Z9H A;  3HZ8 A;  3EU4 A;  5GAP D;  3GKK A;  3RHC A;  1E2Y A;  2CAI A;  3VI5 A;  1QXH A;  1QFN A;  2A4V A;  4K5S A;  4IW9 A;  5D73 A;  1ILO A;  3CMI A;  3QMX A;  4ID0 A;  2CAQ A;  1WP0 A;  5C04 A;  3WGE A;  3ME8 A;  2DMM A;  3GRX A;  1GLP A;  4XRD A;  2MZC A;  4FYB A;  2AAW A;  1GSE A;  1FB6 A;  2H72 A;  3D5J A;  2VL3 A;  1XPV A;  2CV4 A;  3GMF A;  5HFI A;  2ON5 A;  4HI7 A;  1WWJ A;  2RUE A;  4PGT A;  2RLI A;  4K0N A;  3VPT A;  4E8E A;  4I8B A;  5H5S A;  2J23 A;  4HZ2 A;  2X8C A;  4NHZ A;  3QFA C;  1PD2 1;  4L8E A;  3UMA A;  3HJM A;  4TOP A;  2DLX A;  1LU4 A;  3AY8 A;  4LL1 B;  13GS A;  3LXZ A;  4RI7 A;  4MJB A;  2B5E A;  2R2J A;  4YKF A;  1EGR A;  4NV2 A;  5JCW A;  2VL2 C;  4AF2 A;  3H93 A;  2YV9 A;  4TR1 A;  2LJK A;  2O3E A;  2B7K A;  2AHE A;  1O8X A;  2LEG A;  3QR6 A;  4IVF A;  1X0R A;  2YNX A;  3F3R A;  2QA2 A;  4HUA A;  4KDU A;  3DIE A;  3RPN A;  3KTL A;  2IJY A;  1SL2 B;  2Z9S A;  2R6K A;  3IC4 A;  3TKR A;  4MDC A;  1SKR B;  1GSF A;  4CW9 A;  1U6T A;  2RM6 A;  1SK2 A;  1JZW A;  1XCC A;  1AW9 A;  2FWH A;  3FR3 A;  4TW5 A;  1ML6 A;  1DSB A;  4K6X A;  1WIK A;  2LV3 A;  4ICY A;  4MF6 A;  3G9B A;  2VD1 A;  5B6N A;  3OR5 A;  2F8F A;  1ZL9 A;  1SL1 B;  1X5E A;  2QA1 A;  5J47 A;  4MNN A;  4L0U A;  3Q74 A;  3CSH A;  4POL A;  1PGT A;  1LBK A;  1GUL A;  3RGB C;  4TVE A;  1PKW A;  3UOM A;  4TR0 A;  3UEM A;  1T1V A;  4KSM A;  4KCE A;  3TKS C;  1ST9 A;  4MZB A;  2WW0 A;  1BQ7 A;  3MIX A;  2L6C A;  1PFO A;  2H6Y A;  2N5A A;  1PA3 A;  4ZB8 A;  1X9W B;  3VK9 A;  2K6V A;  1JLV A;  5GZZ B;  4TRX A;  2DJJ A;  6GSV A;  4GRF A;  3GL5 A;  5EY6 A;  2GS3 A;  2MMO A;  4KA0 A;  1A23 A;  3ZMK A;  5BMU B;  2IL3 A;  2B1L A;  3FYG A;  4IQA A;  3UAR A;  5INY A;  3M1G A;  1OC9 A;  1G6Y A;  5DQY A;  1TDI A;  1EOG A;  1SYR A;  1QQ2 A;  2L5L A;  5D9V A;  4H86 A;  3WGX A;  1NHY A;  4QL9 A;  2L57 A;  5KOX A;  1GSS A;  4JRR A;  1O73 A;  4EF0 A;  2B7J A;  4HEA 2;  3O3T A;  1EWX A;  2RM5 A;  4YQM A;  3LSZ A;  1NSW A;  1GNW A;  4HJM A;  3IK9 A;  2WFC A;  1F6M C;  5F07 A;  1GP1 A;  1TRW A;  3TGZ A;  1ZMA A;  1U3I A;  3HKR A;  1DUG A;  4G19 A;  5F05 A;  4XHM A;  3E0U A;  1GTB A;  4NHW A;  3WT1 A;  3ERF A;  2V41 A;  3FZ9 A;  4K1F A;  3F0I A;  1MDJ A;  1AQX A;  3GL3 A;  2HSH A;  5COH A;  1Z7R A;  3FZA A;  2YPM A;  2E0Q A;  3M8N A;  3M9K A;  3JCM L;  1GSQ A;  5AIV A;  2B6M A;  4D73 A;  2F51 A;  2G2Q A;  2M46 A;  4K7N A;  2WW2 A;  1M9A A;  1J9B A;  3EC3 A;  3GST A;  3N5O A;  4WBJ A;  4JE1 A;  3QAV A;  2GSS A;  2JZT A;  2VLT A;  1BED A;  2X64 A;  3VPQ A;  2L5O A;  2VCX A;  4GLT A;  2TRC P;  1EV9 A;  1N8J A;  3EYT A;  2V32 A;  3FRC A;  5JCU A;  4OFM A;  4J56 E;  3KJY A;  1WRY A;  2XPE A;  1PRX A;  1K0N A;  2FGX A;  4I5Q A;  2B5Y A;  4MA9 A;  3TJG A;  1S3C A;  2C80 A;  5IO0 A;  1AQW A;  3HJP A;  2GST A;  5FT3 A;  5A1N A;  14GS A;  2CZ3 A;  4OWY A;  3CWG A;  3A5I A;  3IV4 A;  4XS4 B;  2FWG A;  1ZOF A;  1N25 A;  2C0E A;  1K0O A;  4MPG A;  1WPI A;  1HYU A;  3QOU A;  4O32 A;  1F3A A;  3W8J A;  4BVX A;  1OVN A;  1T4Y A;  5ECK B;  4EC0 A;  5A4W A;  1E6B A;  1Q98 A;  2O36 A;  1NW2 A;  1K3L A;  3ZFL A;  2YV7 A;  1G0T A;  20GS A;  2GDR A;  2C0G A;  3A3T A;  1TU7 A;  4NWY A;  2MMA A;  4L5O A;  1K3O A;  1FG4 A;  1XOA A;  2YWI A;  5JWQ B;  5ECQ B;  1X5D A;  3KD0 A;  2EFE A;  2GQM A;  1AQV A;  2GZZ A;  5J40 A;  3GKN A;  11GS A;  3L9U A;  4ECJ A;  1XBS A;  1RW1 A;  5DCG A;  3L0H A;  2EFC A;  1G7O A;  3IXR A;  1KBN A;  3C1S A;  3H79 A;  4MZW A;  4D73 B;  5J3R A;  5IMZ A;  5ABR A;  4X1U A;  3QCP A;  3TU3 B;  1PX6 A;  1F3B A;  2B1K A;  2IMK A;  3VFI A;  4BIK A;  3KMO A;  2H1D A;  4KB3 A;  1MD4 A;  2YWN A;  2H1A A;  1PSQ A;  1YZX A;  3U5R E;  3IK7 A;  3TRP A;  4YAP A;  1R7H A;  1V40 A;  5KN2 A;  4MP4 A;  2K18 A;  2R0P A;  1UA5 A;  4FYU A;  2A2P A;  3TUE A;  1A2J A;  2OJL A;  3TCO A;  1U3A A;  2H6Z A;  2PGT A;  4PTS A;  1H4O A;  4FO5 A;  3UL3 A;  1XXU A;  4OD7 A;  4ZIL A;  3DKS A;  3CSI A;  2HT9 A;  1EEJ A;  5ID2 A;  6GSU A;  1ZYQ B;  3TRQ A;  4MJE A;  5JWR B;  1NHO A;  4ZBB A;  3LYP A;  2NPB A;  4G2E A;  5A1N B;  4J2F A;  4ZL9 A;  1NM3 A;  3ERG A;  2E2M A;  4LMW A;  2FUG 2;  1R5P A;  5DJL A;  4MJA A;  3ZLP A;  2FD3 A;  2LNT A;  3KXO A;  2IWT A;  3VWU A;  4BVX B;  1QK8 A;  3KGK A;  4FIW A;  3P90 A;  4BWQ A;  1O6J A;  3M0F A;  4WBR D;  4AJ6 A;  3C71 A;  1GTU A;  3VI7 A;  3HMJ G;  1LJR A;  3LQ7 A;  1ERU A;  4Q5Q A;  1GRX A;  5H5R A;  4MF7 A;  2VL9 A;  1B48 A;  2J9H A;  1M3J A;  3D22 A;  1CQH A;  5IMC A;  5FWG A;  1ZYN A;  4PXO A;  2GSQ A;  1FW1 A;  2YZU A;  1YVL A;  2VLU A;  4LLR A;  3CXG A;  4BL7 B;  2KP2 A;  3FKF A;  2H70 A;  3KZQ A;  5CYY A;  2GT5 A;  1GWC A;  3IHG A;  2DKI A;  5AIS A;  3F8U A;  1S4B P;  3D0Z A;  4YQV A;  4F82 A;  4PUF C;  3M3M A;  3VWW A;  3RFR C;  3KM6 A;  2CVB A;  3R2Q A;  1EOH A;  2WCI A;  4TR3 A;  2JL4 A;  2V6O A;  4HJ2 A;  1YJ6 A;  1BJX A;  3GH9 A;  4TKY A;  4KSO A;  5IOW A;  5G30 A;  2HSY A;  2C3N A;  2TIR A;  5EL8 A;  3I9V 2;  3G7J A;  1ERW A;  4GWR A;  3KEB A;  4G0K A;  2YWO A;  3HHV A;  4ULX A;  4OMV A;  1I9D A;  2IFQ B;  3ZIV A;  2KUC A;  3L4N A;  1SVM A;  2EIO A;  2X4A A;  2FWF A;  3FZ4 A;  2HZF A;  2V6K A;  4N0V A;  5ID2 B;  5CRE A;  2N5F A;  2VCQ A;  2MYG A;  1VF4 A;  4MH3 A;  3HDC A;  3GNJ A;  2OT3 A;  2LQO A;  1TU8 A;  1AAZ A;  1YY7 A;  3LJR A;  2GSR A;  5G1K A;  2IME A;  3SWL A;  4AKH A;  2K8S A;  5EVO A;  2H0I A;  2ZUP A;  1PN9 A;  5BMU A;  4GF0 A;  3FEU A;  1XW9 A;  2YP6 A;  3IRA A;  2F3M A;  1A8Y A;  1B9X C;  4YKG A;  3HVX A;  1WMJ A;  5J4Y A;  5B6M A;  3E3E A;  3CSJ A;  2VKZ G;  1Z7P A;  2LQQ A;  17GS A;  1GTI A;  3L9S A;  1XWG A;  2WVZ A;  4ZB9 A;  2WDU A;  1JFU A;  4WR5 A;  5A5H A;  3ZFB A;  2LRN A;  4DSR A;  3GUS A;  2D2Z A;  2M72 A;  5HFG A;  1GSD A;  4F0B A;  4WR4 A;  2XC2 A;  4G01 A;  1ABA A;  1YKC A;  1DBY A;  2WZ9 A;  2VM2 A;  4I2T A;  4JR4 A;  6GSX A;  4RI6 A;  2H01 A;  4V1A g;  4WF5 A;  2A2S A;  1J08 A;  2WVX B;  4K8M A;  4JR6 A;  1F9M A;  5E4W A;  1A8L A;  3APO A;  5F0G A;  2VD0 A;  4XTS A;  3UBL A;  1SL0 B;  3F6D A;  2O89 A;  2B3S A;  5D9W A;  3C1R A;  4XCS A;  4FXY P;  3HYP A;  4IJ3 A;  3KH9 A;  5IO2 A;  5LCZ A;  3A2X A;  3DWV A;  1TK8 B;  2HQT A;  2PWJ A;  1WE0 A;  2HRF A;  1K0A A;  1OC8 A;  1R26 A;  4HOJ A;  1OKD A;  3VLN A;  4HSC X;  4J57 E;  4V2M A;  1XWC A;  2CVD A;  4HU9 A;  5HR0 A;  4RQX A;  4WET A;  4ZB7 A;  2E7P A;  2H0G A;  4F2I A;  1F2E A;  2KHP A;  2C8U A;  1B9Y C;  4Z2T A;  4IQ1 A;  5CRH A;  1URM A;  4G0L A;  4DSQ A;  4MK3 A;  2H19 A;  4QL7 A;  3MAK A;  3IDV A;  2GT6 A;  4IHU A;  3ERW A;  3RBT A;  3GH6 A;  3C8E A;  4NMU A;  2VL2 A;  2YN1 A;  3LWA A;  4EIP A;  3GHA A;  3EWL A;  1GH2 A;  2LTK A;  5DQS A;  5DJM A;  4G0I A;  1XW5 A;  2JZR A;  2DBC A;  2H1B A;  2HZE B;  5CRW A;  3L9V A;  5D96 A;  4XS4 A;  2HFD A;  3FR6 A;  5A5H B;  1BG5 A;  3C7M A;  1K3Y A;  3RPP A;  4LL4 B;  2BJX A;  5GAN D;  2YCD A;  2EC4 A;  1FAA A;  2JU5 A;  3DD3 A;  3BOA A;  1VF1 A;  1DE2 A;  4K9Z A;  4QMK A;  3APS A;  4ECC A;  1OC3 A;  2KOK A;  4K2X A;  1SJZ A;  1TXU A;  1CQG A;  2IN3 A;  2LNS A;  3DVW A;  4MJC A;  1TRV A;  2H75 A;  1GNE A;  4X0X A;  1XWB A;  1T00 A;  1RK4 A;  3I69 A;  2I1U A;  1B4Q A;  1BF5 A;  3UBK A;  4PNF A;  4IGJ A;  3PR8 A;  4PQH A;  2JAC A;  5DBQ A;  3UVT A;  5G2Z A;  3TKS A;  4AKG A;  1OAZ A;  3DRN A;  1Z3E A;  5B8B A;  1BAY A;  4PQI A;  4ZBA A;  3CRT A;  1PL2 A;  1MDI A;  4F0C A;  3GX0 A;  2AB6 A;  4E8H A;  1V58 A;  3IHQ A;  2GTU A;  1M9B A;  1Q4J A;  3A2V A;  3M9J A;  3QPM A;  1ZCP A;  1JHB A;  4OO4 A;  3W6G A;  1YF0 A;  2HRK A;  1YEP A;  4IEL A;  1K0D A;  4YAV A;  4N30 A;  1O7U A;  3CYN A;  2FY6 A;  1FOH A;  3MYD A;  4MPF A;  2XBI A;  3ZL5 A;  5ECM B;  2H66 A;  1M0U A;  4V2N A;  4ZL7 A;  3PIN A;  3N9J A;  1ZZY A;  1SJ6 A;  5G1L A;  1XW6 A;  3E9J B;  4AKX B;  3IE3 A;  4GCI A;  5G5E A;  5AIX A;  2QSI A;  4WF4 A;  5J9C A;  1SU9 A;  3HZ4 A;  1BX9 A;  3IOS A;  3BBY A;  3H4K A;  1XVQ A;  3ZTL A;  3ME7 A;  2XHF A;  3LGC A;  1OKT A;  1Y6E A;  1H75 A;  3DXB A;  5ECN B;  3WGD A;  5AGY A;  1M2A A;  2YOI A;  2E2G A;  4IKH A;  3F4T A;  1HNB A;  1USB A;  1PMT A;  2VCW A;  2HLS A;  5G5F A;  3KCM A;  2GZP A;  2NBS A;  1OE8 A;  2OA7 A;  5A4U A;  1XOB A;  4K0G A;  3QDN A;  1XWK A;  4XRA A;  1PKZ A;  1ZYP A;  3NZN A;  3DVX A;  3O6T A;  2WB9 A;  3MDK A;  2VM1 A;  1VF2 A;  5A34 B;  4OCF A;  4DSS A;  1ERT A;  3ZRE A;  3DML A;  3GN3 A;  2YAN A;  4MLY A;  5ENU A;  3J7Y b;  1O8W A;  4WEY A;  3PH9 A;  5GST A;  1K0C A;  2P0G A;  4BA7 A;  3HY2 A;  1EEM A;  1TTZ A;  2VOC A;  4BL7 A;  1KNG A;  1OE7 A;  3F3Q A;  4MF5 A;  2X8G A;  1MD3 A;  2FHE A;  5HFK A;  3TJF A;  5G31 A;  3KIJ A;  3WT2 A;  4XIH A;  2NTO A;  1Z6N A;  4TXV A;  5DAL A;  2RII A;  2JAD A;  2X99 A;  4G9H A;  4IP1 A;  1XG8 A;  1U87 A;  3HCZ A;  4TR4 A;  1VF3 A;  22GS A;  2B5X A;  3GKX A;  2HRK B;  3KTB A;  2AYT A;  1FHE A;  3GTU B;  5ECS A;  5IOX A;  3PPU A;  2FNO A;  5JCG A;  2C0D A;  1ZGN A;  1M2B A;  2EIQ A;  2C4J A;  2EFD A;  2IMI A;  2DJ0 A;  3FZ5 A;  5J41 A;  4MMM A;  2IFQ A;  4POM A;  4YH2 A;  3LOR A;  5ECR B;  4ECI A;  2ON7 A;  3ZYW A;  4GDF A;  5EPF A;  2PBJ A;  1TW9 A;  4FH8 A;  2XPD A;  2FCH A;  3DYR A;  2ZNM A;  4HQZ A;  1THO A;  2P5Q A;  5KN3 A;  2A4H A;  5ECP B;  2H30 A;  4V1A p;  3TRX A;  4HQS A;  2WRT A;  1W4V A;  2P5R A;  3FW2 A;  4FQU A;  3HVV A;  2VUP A;  2KP1 A;  1WOU A;  2DSA A;  2L4C A;  1G6W A;  4IJI A;  3BJ5 A;  1YQ1 A;  3IC8 A;  1J0F A;  2O5V A;  2L6D A;  1OYJ A;  4DEJ A;  1Y1U A;  4EO3 A;  1T4Z A;  2DJ2 A;  2FA8 A;  3MNG A;  1SVL A;  5D8I A;  2H0H A;  1QMV A;  1SK0 A;  2DJK A;  3PGT A;  3UVH A;  4DSS B;  3MSZ A;  3C73 A;  3TJB A;  2O7K A;  4TXO B;  1JLW A;  1GLQ A;  3NOF A;  2VO4 A;  1ERV A;  3TDG A;  2H74 A;  4O5U A;  3TOU A;  1S3R A;  2GGT A;  3ZRD A;  2DKH A;  3EU3 A;  4KUN A;  4HDE A;  2MMZ A;  2QGV A;  2GQL A;  5IPH A;  2WVY A;  1VRS D;  3IBH A;  1THX A;  3IAS 2;  2QC7 A;  3CTG A;  2CT6 A;  1B8X A;  2DML A;  2WVX A;  5KN0 A;  1I5G A;  5DAL B;  2JZS A;  1TJD A;  5IQY A;  10GS A;  4G10 A;  3QAW A;  1M99 A;  1UN2 A;  4ZXG A;  2H1G A;  3FY7 A;  1V98 A;  1W89 A;  4ZBD A;  1HNC A;  2LRC A;  2VIM A;  5BRT A;  4KDX A;  3ZVJ D;  2H71 A;  3S9F A;  1EP7 A;  4A5P A;  1YEX A;  2G0F A;  5D9X A;  6GSW A;  4IN0 A;  2DJ1 A;  2F8A A;  5A4V A;  3R3E A;  2UV8 G;  2NDO A;  1IYH A;  4P3Y B;  1SYX A;  2L59 A;  16GS A;  5CRG A;  2R4V A;  1IYI A;  3P8W A;  5ECL B;  3US3 A;  1TRU A;  2R37 A;  4KDY A;  6GSS A;  4GST A;  4PQ1 A;  5D9T A;  1AC1 A;  1HQO A;  4OO5 A;  1TXX A;  2MMN A;  1GUK A;  2XBQ A;  2MBS A;  3UAP A;  2ES7 A;  4KCA A;  5E59 A;  9GSS A;  3GA4 A;  4K5R A;  4Z7X A;  3BCK A;  4EKZ A;  5F06 A;  1AXD A;  4GQC A;  2KLX A;  1TK5 B;  3HJO A;  5DDL A;  3EMP A;  2P31 A;  4K7I A;  1HNA A;  4CDO A;  3EPT A;  7GSS A;  1FOV A;  4JBB A;  3A5W A;  2FLS A;  2HZE A;  3GUR A;  1XVW A;  3F4S A;  4ZB6 A;  2BTO T;  2OBK A;  2H76 A;  1C72 A;  1N2A A;  3TJK A;  2PVO C;  4EXJ A;  2I4A A;  4O5Q A;  5C00 A;  2LKU A;  4W66 A;  4PUA A;  4LA1 A;  4MH2 A;  3HA9 A;  1EGO A;  2WGR A;  4PUR A;  4USS A;  2ALB A;  5IMD A;  3KP9 A;  1AUC A;  1XWA A;  2A2R A;  1QGV A;  2R5G A;  4WXT A;  5J4U A;  2IPA A;  3CQF A;  19GS A;  4GTU A;  4XS1 A;  2VCV A;  1TKD B;  5J4V A;  3P2A A;  4JU5 A;  4K7O A;  2YJH A;  1FVJ A;  2VCT A;  3P7X A;  3FK8 A;  1EV4 A;  1A24 A;  2HSM B;  3ZIT A;  4EL1 A;  2CVK A;  1GL8 A;  1O81 A;  4KAE A;  1HD2 A;  5GSS A;  4MCU A;  4F9Z A;  1Z6M A;  5HR2 A;  5KN1 A;  3D6I A;  4OCE A;  4ECB A;  1SKS B;  3ZIJ A;  1R5A A;  3TB2 A;  2PPT A;  2WS2 A;  4F03 A;  2HE3 A;  3BD2 A;  3HD5 A;  3CBU A;  5B7C A;  3K8N A;  1K0M A;  1X5C A;  3LXT A;  2CX4 A;  3EVI A;  1JZO A;  2PU9 C;  1KTE A;  3ED3 A;  5DAK A;  1GUM A;  2NVL A;  3GX8 A;  1T3B A;  1TK0 B;  1FB0 A;  3TKP A;  3CHX C;  1FVK A;  3QAG A;  1KEB A;  4O5R A;  1T8E B;  2H6X A;  3IAM 2;  4OFT A;  5ELG A;  4RUV A;  5DCH A;  5J9B A;  3QD9 A;  5HR3 A;  1TI3 A;  4GSN A;  1S3D A;  1G7E A;  2AUV A;  3GSS A;  5ECI B;  2L4Q A;  1MTC A;  1UC7 A;  1M3I A;  4DVC A;  5CO3 A;  3TOT A;  4GXZ A;  4ACS A;  2PMT A;  3F4R A;  2X49 A;  4ZIJ A;  2REM A;  3NIV A;  1PL1 A;  5H5Q A;  2OAC A;  3DEX A;  1ACV A;  5IMF A;  3WD6 A;  2OKA A;  5A34 A;  2I3Y A;  4MZC A;  3HXS A;  4TR1 B;  5CNW A;  4RQR A;  2HYX A;  1TRS A;  2DIY A;  2H1L A;  3GYK A;  2RUF A;  2GZY A;  1K0B A;  2OE1 A;  2H8L A;  2X8H A;  4N11 A;  3A2W A;  1M2D A;  4CY6 A;  3IR4 A;  3W8S A;  3O76 A;  1WJK A;  4KND A;  2WJU A;  1ZYE A;  4OFN A;  4E68 A;  3G7Y A;  2LRT A;  1A0F A;  4NAX A;  2DC5 A;  2GVP A;  3UIW A;  2CA8 A;  2K9F A;  1GSY A;  5A5K A;  2C3Q A;  1BG1 A;  3Q19 A;  3CRU A;  4EDY A;  4IBP A;  3F6F A;  5ECO B;  4YQU A;  1TOF A;  3EMX A;  5F8B A;  3HVS A;  3H1N A;  3Q6O A;  5HQP A;  2YJ7 A;  5J5N A;  3ZVJ A;  3GTU A;  4GQF A;  4NXI A;  4AI6 A;  5L71 A;  2LS5 A;  5IIZ A;  4POB A;  3U6V A;  3BCI A;  1QUW A;  12GS A;  1F37 A;  3GKM A;  1TI1 A;  4HS1 A;  1XIY A;  2OE3 A;  1V57 A;  3D4M A;  1SVO A;  1EZK A;  5DAK B;  2VLV A;  1SK1 A;  4KH7 A;  3EUR A;  4AGS A;  1YF1 A;  18GS A;  4KX4 A;  4Z2U A;  1T7P B;  4IS0 A;  5ELA A;  2LJR A;  1PQN A;  1SD8 A;  3TKQ A;  1DE1 A;  2IMD A;  4BWS A;  5CP1 A;  5LD0 A;  4ILF A;  4EE0 A;  5CAX A;  5AN1 A;  2M80 A;  4Q5R A;  1U88 A;  2LJA A;  3ZZX A;  4Q5N A;  4HZ4 A;  1XFL A;  2C1Y A;  4Z2R A;  4I6X A;  1OC9 B;  1V9W A;  3LFL A;  3KP8 A;  4CHS A;  4WKW A;  3ZML A;  2R0C A;  6GST A;  4POK A;  2O85 A;  3TJJ A;  2MBT A;  2N5B A;  4IP6 A;  4BVY A;  1SKW B;  3FMW A;  5HR1 A;  2AJQ B;  3Q18 A;  1A2L A;  2WZS A;  2CQ9 A;  2PN8 A;  1Z5Y E;  2HXK A;  4TXO A;  3HVN A;  4EUY A;  5IMA A;  5JWO B;  1SEN A;  2GQK A;  4NPB A;  3GIX A;  1Y25 A;  5KEJ A;  1AIU A;  2WUL A;  2AV4 A;  3L78 A;  2V2G A;  2I81 A;  3UJ1 A;  4XS6 A;  1GSU A;  6GSY A;  3ISO A;  4PX1 A;  3GV1 A;  2ZCT A;  3RHB A;  2TRX A;  1I1I P;  4O92 A;  5ECH B;  3KH7 A;  2HSN A;  3VUR A;  4BPY A;  1O85 A;  1BYE A;  2HRA A;  2FWE A;  2PVQ A;  3IA1 A;  1B4P A;  3RDW A;  2YZH A;  2GLR A;  1XZO A;  2EFH A;  2EIR A;  4CY8 A;  2VAF A;  2FA4 A;  2HRN A;  1YKA A;  3CTF A;  5KOW A;  3TKS E;  5D93 A;  2QKE A;  3GFK A;  4GSS A;  4V2L A;  3D21 A;  3WYW A;  4X43 A;  2R3X A;  4PI0 C;  2K8V A;  4ZL8 A; 
#chains in the Genus database with same CATH homology
 4FYC A;  3J7Y k;  3I6A A;  2CX3 A;  4L0W A;  1YDK A;  4K2D A;  2HNL A;  2CZ2 A;  2OAD A;  2HI7 A;  1PN0 A;  3APQ A;  2OE0 A;  2V1M A;  5B8A A;  3LG6 A;  1JZR A;  4KW6 A;  4KE3 A;  5IMV A;  5DVB A;  3LYK A;  3I43 A;  2H73 A;  3EIN A;  5LNK e;  4EVM A;  4LMV A;  4HU7 A;  3QFB C;  4L5L A;  1R4W A;  4ML1 A;  4O7H A;  4EDZ A;  1JZD A;  1EP8 A;  2IIY A;  2OBI A;  5FHI A;  1X9M B;  3DGQ A;  1TP9 A;  2LST A;  4BVY B;  4N10 A;  2DIZ A;  4Q5F A;  4ISD A;  4KF9 A;  4N3Z A;  4JED A;  4I97 A;  3FHK A;  1MDK A;  2BMX A;  2PUK C;  1UVZ A;  1GUH A;  3LEF A;  1A0R P;  1X9S B;  3F9U A;  2JSZ A;  3F63 A;  4MAB A;  1FO5 A;  2YWM A;  2O87 A;  2VCZ A;  2O8V B;  3V1W A;  1SJI A;  4TN8 A;  4X4J A;  5CRD A;  4AJ7 A;  3FR9 A;  2I9H A;  4EIQ A;  2F9S A;  1ON4 A;  3LW9 A;  3VWX A;  3RAZ A;  4ML6 A;  1RQM A;  2DJ3 A;  3IPZ A;  4N0Z A;  4AKI A;  5IM9 A;  4NV5 A;  1V2A A;  5IPG A;  4PNG A;  1S3A A;  2JSY A;  2HSN B;  3SBC A;  1PX7 A;  1SD9 A;  1VGL A;  2C0F A;  3H8Q A;  3EE2 A;  2PER A;  2UZ8 A;  3VWV A;  4QQ7 A;  4I2U A;  2IMF A;  4AJ8 A;  2HSM A;  3KMN A;  1MEK A;  1M7T A;  3MWH A;  2R0G A;  1A2M A;  8GSS A;  4JZQ A;  3D4T A;  3G7I A;  4KGI A;  1GTA A;  2C3T A;  2LUS A;  1Z9H A;  3HZ8 A;  3EU4 A;  5GAP D;  3GKK A;  3RHC A;  1E2Y A;  2CAI A;  3VI5 A;  1QXH A;  1QFN A;  2A4V A;  4K5S A;  4IW9 A;  5D73 A;  1ILO A;  3CMI A;  3QMX A;  4ID0 A;  2CAQ A;  1WP0 A;  5C04 A;  3WGE A;  3ME8 A;  2DMM A;  3GRX A;  1GLP A;  4XRD A;  2MZC A;  4FYB A;  2AAW A;  1GSE A;  1FB6 A;  2H72 A;  3D5J A;  2VL3 A;  1XPV A;  2CV4 A;  3GMF A;  5HFI A;  2ON5 A;  4HI7 A;  1WWJ A;  2RUE A;  4PGT A;  2RLI A;  4K0N A;  3VPT A;  4E8E A;  4I8B A;  5H5S A;  2J23 A;  4HZ2 A;  2X8C A;  4NHZ A;  3QFA C;  1PD2 1;  4L8E A;  3UMA A;  3HJM A;  4TOP A;  2DLX A;  1LU4 A;  3AY8 A;  4LL1 B;  13GS A;  3LXZ A;  4RI7 A;  4MJB A;  2B5E A;  2R2J A;  4YKF A;  1EGR A;  4NV2 A;  5JCW A;  2VL2 C;  4AF2 A;  3H93 A;  2YV9 A;  4TR1 A;  2LJK A;  2B7K A;  2AHE A;  1O8X A;  2LEG A;  3QR6 A;  4IVF A;  1X0R A;  2YNX A;  3F3R A;  2QA2 A;  4HUA A;  4KDU A;  3DIE A;  3RPN A;  3KTL A;  2IJY A;  1SL2 B;  2Z9S A;  2R6K A;  3IC4 A;  3TKR A;  4MDC A;  1SKR B;  1GSF A;  4CW9 A;  1U6T A;  2RM6 A;  1SK2 A;  1JZW A;  1XCC A;  1AW9 A;  2FWH A;  3FR3 A;  4TW5 A;  1ML6 A;  1DSB A;  4K6X A;  1WIK A;  2LV3 A;  4ICY A;  4MF6 A;  3G9B A;  2VD1 A;  5B6N A;  3OR5 A;  2F8F A;  1ZL9 A;  1SL1 B;  1X5E A;  2QA1 A;  5J47 A;  4MNN A;  4L0U A;  3Q74 A;  3CSH A;  4POL A;  1PGT A;  1LBK A;  1GUL A;  4TVE A;  1PKW A;  3UOM A;  4TR0 A;  3UEM A;  1T1V A;  4KSM A;  4KCE A;  3TKS C;  1ST9 A;  4MZB A;  1BQ7 A;  3MIX A;  2L6C A;  2H6Y A;  2N5A A;  1PA3 A;  4ZB8 A;  1X9W B;  3VK9 A;  2K6V A;  1JLV A;  5GZZ B;  4TRX A;  2DJJ A;  6GSV A;  4GRF A;  3GL5 A;  5EY6 A;  2GS3 A;  2MMO A;  4KA0 A;  1A23 A;  3ZMK A;  5BMU B;  2IL3 A;  2B1L A;  3FYG A;  4IQA A;  3UAR A;  5INY A;  3M1G A;  1OC9 A;  1G6Y A;  5DQY A;  1TDI A;  1EOG A;  1SYR A;  1QQ2 A;  2L5L A;  5D9V A;  4H86 A;  3WGX A;  1NHY A;  4QL9 A;  2L57 A;  5KOX A;  1GSS A;  4JRR A;  1O73 A;  4EF0 A;  2B7J A;  4HEA 2;  3O3T A;  1EWX A;  2RM5 A;  4YQM A;  3LSZ A;  1NSW A;  1GNW A;  4HJM A;  3IK9 A;  2WFC A;  1F6M C;  5F07 A;  1GP1 A;  1TRW A;  3TGZ A;  1ZMA A;  1U3I A;  3HKR A;  1DUG A;  4G19 A;  5F05 A;  4XHM A;  3E0U A;  1GTB A;  4NHW A;  3WT1 A;  3ERF A;  2V41 A;  3FZ9 A;  4K1F A;  3F0I A;  1MDJ A;  1AQX A;  3GL3 A;  2HSH A;  5COH A;  1Z7R A;  3FZA A;  2YPM A;  2E0Q A;  3M8N A;  3M9K A;  3JCM L;  1GSQ A;  5AIV A;  2B6M A;  4D73 A;  2F51 A;  2G2Q A;  2M46 A;  4K7N A;  1M9A A;  1J9B A;  3EC3 A;  3GST A;  3N5O A;  4WBJ A;  4JE1 A;  3QAV A;  2GSS A;  2JZT A;  2VLT A;  1BED A;  2X64 A;  3VPQ A;  2L5O A;  2VCX A;  4GLT A;  2TRC P;  1EV9 A;  1N8J A;  3EYT A;  2V32 A;  3FRC A;  5JCU A;  4OFM A;  4J56 E;  3KJY A;  1WRY A;  2XPE A;  1PRX A;  1K0N A;  2FGX A;  4I5Q A;  2B5Y A;  4MA9 A;  3TJG A;  1S3C A;  2C80 A;  5IO0 A;  1AQW A;  3HJP A;  2GST A;  5FT3 A;  5A1N A;  14GS A;  2CZ3 A;  4OWY A;  3CWG A;  3A5I A;  3IV4 A;  4XS4 B;  2FWG A;  1ZOF A;  1N25 A;  2C0E A;  1K0O A;  4MPG A;  1WPI A;  1HYU A;  3QOU A;  4O32 A;  1F3A A;  3W8J A;  4BVX A;  1OVN A;  1T4Y A;  5ECK B;  4EC0 A;  5A4W A;  1E6B A;  1Q98 A;  1NW2 A;  1K3L A;  3ZFL A;  2YV7 A;  1G0T A;  20GS A;  2GDR A;  2C0G A;  3A3T A;  1TU7 A;  4NWY A;  2MMA A;  4L5O A;  1K3O A;  1FG4 A;  1XOA A;  2YWI A;  5JWQ B;  5ECQ B;  1X5D A;  3KD0 A;  2EFE A;  2GQM A;  1AQV A;  2GZZ A;  5J40 A;  3GKN A;  11GS A;  3L9U A;  4ECJ A;  1XBS A;  1RW1 A;  5DCG A;  3L0H A;  2EFC A;  1G7O A;  3IXR A;  1KBN A;  3C1S A;  3H79 A;  4MZW A;  4D73 B;  5J3R A;  5IMZ A;  5ABR A;  4X1U A;  3QCP A;  3TU3 B;  1PX6 A;  1F3B A;  2B1K A;  2IMK A;  3VFI A;  3KMO A;  2H1D A;  4KB3 A;  1MD4 A;  2YWN A;  2H1A A;  1PSQ A;  1YZX A;  3U5R E;  3IK7 A;  3TRP A;  4YAP A;  1R7H A;  1V40 A;  5KN2 A;  4MP4 A;  2K18 A;  2R0P A;  1UA5 A;  4FYU A;  2A2P A;  3TUE A;  1A2J A;  2OJL A;  3TCO A;  1U3A A;  2H6Z A;  2PGT A;  4PTS A;  1H4O A;  4FO5 A;  3UL3 A;  1XXU A;  4OD7 A;  4ZIL A;  3DKS A;  3CSI A;  2HT9 A;  1EEJ A;  5ID2 A;  6GSU A;  1ZYQ B;  3TRQ A;  4MJE A;  5JWR B;  1NHO A;  4ZBB A;  3LYP A;  2NPB A;  4G2E A;  5A1N B;  4J2F A;  4ZL9 A;  1NM3 A;  3ERG A;  2E2M A;  4LMW A;  2FUG 2;  1R5P A;  5DJL A;  4MJA A;  3ZLP A;  2FD3 A;  2LNT A;  3KXO A;  2IWT A;  3VWU A;  4BVX B;  1QK8 A;  3KGK A;  4FIW A;  3P90 A;  4BWQ A;  1O6J A;  3M0F A;  4WBR D;  4AJ6 A;  3C71 A;  1GTU A;  3VI7 A;  3HMJ G;  1LJR A;  3LQ7 A;  1ERU A;  4Q5Q A;  1GRX A;  5H5R A;  4MF7 A;  2VL9 A;  1B48 A;  2J9H A;  3D22 A;  1CQH A;  5IMC A;  5FWG A;  1ZYN A;  4PXO A;  2GSQ A;  1FW1 A;  2YZU A;  1YVL A;  2VLU A;  4LLR A;  3CXG A;  4BL7 B;  2KP2 A;  3FKF A;  2H70 A;  3KZQ A;  5CYY A;  2GT5 A;  1GWC A;  3IHG A;  2DKI A;  5AIS A;  3F8U A;  3D0Z A;  4YQV A;  4F82 A;  4PUF C;  3M3M A;  3VWW A;  3KM6 A;  2CVB A;  3R2Q A;  1EOH A;  2WCI A;  4TR3 A;  2JL4 A;  2V6O A;  4HJ2 A;  1YJ6 A;  1BJX A;  3GH9 A;  4TKY A;  4KSO A;  5IOW A;  5G30 A;  2HSY A;  2C3N A;  2TIR A;  5EL8 A;  3I9V 2;  3G7J A;  1ERW A;  4GWR A;  3KEB A;  4G0K A;  2YWO A;  3HHV A;  4ULX A;  4OMV A;  1I9D A;  2IFQ B;  3ZIV A;  2KUC A;  3L4N A;  1SVM A;  2EIO A;  2X4A A;  2FWF A;  3FZ4 A;  2HZF A;  2V6K A;  4N0V A;  5ID2 B;  5CRE A;  2N5F A;  2VCQ A;  2MYG A;  1VF4 A;  4MH3 A;  3HDC A;  3GNJ A;  2OT3 A;  2LQO A;  1TU8 A;  1AAZ A;  1YY7 A;  3LJR A;  2GSR A;  5G1K A;  2IME A;  3SWL A;  4AKH A;  2K8S A;  5EVO A;  2H0I A;  2ZUP A;  1PN9 A;  5BMU A;  4GF0 A;  3FEU A;  1XW9 A;  2YP6 A;  3IRA A;  2F3M A;  1A8Y A;  1B9X C;  4YKG A;  3HVX A;  1WMJ A;  5J4Y A;  5B6M A;  3E3E A;  3CSJ A;  2VKZ G;  1Z7P A;  2LQQ A;  17GS A;  1GTI A;  3L9S A;  1XWG A;  4ZB9 A;  2WDU A;  1JFU A;  4WR5 A;  5A5H A;  3ZFB A;  2LRN A;  4DSR A;  3GUS A;  2D2Z A;  2M72 A;  5HFG A;  1GSD A;  4F0B A;  4WR4 A;  2XC2 A;  4G01 A;  1ABA A;  1YKC A;  1DBY A;  2WZ9 A;  2VM2 A;  4I2T A;  4JR4 A;  6GSX A;  4RI6 A;  2H01 A;  4V1A g;  4WF5 A;  2A2S A;  1J08 A;  4K8M A;  4JR6 A;  1F9M A;  5E4W A;  1A8L A;  3APO A;  5F0G A;  2VD0 A;  4XTS A;  3UBL A;  1SL0 B;  3F6D A;  2O89 A;  2B3S A;  5D9W A;  3C1R A;  4XCS A;  3HYP A;  4IJ3 A;  3KH9 A;  5IO2 A;  5LCZ A;  3A2X A;  3DWV A;  1TK8 B;  2HQT A;  2PWJ A;  1WE0 A;  2HRF A;  1K0A A;  1OC8 A;  1R26 A;  4HOJ A;  1OKD A;  3VLN A;  4J57 E;  4V2M A;  1XWC A;  2CVD A;  4HU9 A;  5HR0 A;  4RQX A;  4WET A;  4ZB7 A;  2E7P A;  2H0G A;  4F2I A;  1F2E A;  2KHP A;  2C8U A;  1B9Y C;  4Z2T A;  4IQ1 A;  5CRH A;  1URM A;  4G0L A;  4DSQ A;  4MK3 A;  2H19 A;  4QL7 A;  3MAK A;  3IDV A;  2GT6 A;  4IHU A;  3ERW A;  3RBT A;  3GH6 A;  3C8E A;  4NMU A;  2VL2 A;  2YN1 A;  3LWA A;  4EIP A;  3GHA A;  3EWL A;  1GH2 A;  2LTK A;  5DQS A;  5DJM A;  4G0I A;  1XW5 A;  2JZR A;  2DBC A;  2H1B A;  2HZE B;  5CRW A;  3L9V A;  5D96 A;  4XS4 A;  2HFD A;  3FR6 A;  5A5H B;  1BG5 A;  3C7M A;  1K3Y A;  3RPP A;  4LL4 B;  2BJX A;  5GAN D;  2YCD A;  2EC4 A;  1FAA A;  2JU5 A;  3DD3 A;  3BOA A;  1VF1 A;  1DE2 A;  4K9Z A;  4QMK A;  3APS A;  4ECC A;  1OC3 A;  2KOK A;  4K2X A;  1SJZ A;  1TXU A;  1CQG A;  2IN3 A;  2LNS A;  3DVW A;  4MJC A;  1TRV A;  2H75 A;  1GNE A;  4X0X A;  1XWB A;  1T00 A;  1RK4 A;  3I69 A;  2I1U A;  1B4Q A;  1BF5 A;  3UBK A;  4PNF A;  4IGJ A;  3PR8 A;  4PQH A;  2JAC A;  5DBQ A;  3UVT A;  5G2Z A;  3TKS A;  4AKG A;  1OAZ A;  3DRN A;  1Z3E A;  5B8B A;  1BAY A;  4PQI A;  4ZBA A;  3CRT A;  1PL2 A;  1MDI A;  4F0C A;  3GX0 A;  2AB6 A;  4E8H A;  1V58 A;  3IHQ A;  2GTU A;  1M9B A;  1Q4J A;  3A2V A;  3M9J A;  3QPM A;  1ZCP A;  1JHB A;  4OO4 A;  3W6G A;  1YF0 A;  2HRK A;  1YEP A;  4IEL A;  1K0D A;  4YAV A;  4N30 A;  1O7U A;  3CYN A;  2FY6 A;  1FOH A;  3MYD A;  4MPF A;  2XBI A;  3ZL5 A;  5ECM B;  2H66 A;  1M0U A;  4V2N A;  4ZL7 A;  3PIN A;  3N9J A;  1ZZY A;  1SJ6 A;  5G1L A;  1XW6 A;  3E9J B;  4AKX B;  3IE3 A;  4GCI A;  5G5E A;  5AIX A;  2QSI A;  4WF4 A;  5J9C A;  1SU9 A;  3HZ4 A;  1BX9 A;  3IOS A;  3BBY A;  3H4K A;  1XVQ A;  3ZTL A;  3ME7 A;  2XHF A;  3LGC A;  1OKT A;  1Y6E A;  1H75 A;  3DXB A;  5ECN B;  3WGD A;  5AGY A;  1M2A A;  2YOI A;  2E2G A;  4IKH A;  3F4T A;  1HNB A;  1USB A;  1PMT A;  2VCW A;  2HLS A;  5G5F A;  3KCM A;  2GZP A;  2NBS A;  1OE8 A;  2OA7 A;  5A4U A;  1XOB A;  4K0G A;  3QDN A;  1XWK A;  4XRA A;  1PKZ A;  1ZYP A;  3NZN A;  3DVX A;  3O6T A;  2WB9 A;  3MDK A;  2VM1 A;  1VF2 A;  5A34 B;  4OCF A;  4DSS A;  1ERT A;  3ZRE A;  3DML A;  3GN3 A;  2YAN A;  4MLY A;  5ENU A;  3J7Y b;  1O8W A;  4WEY A;  3PH9 A;  5GST A;  1K0C A;  2P0G A;  4BA7 A;  3HY2 A;  1EEM A;  1TTZ A;  2VOC A;  4BL7 A;  1KNG A;  1OE7 A;  3F3Q A;  4MF5 A;  2X8G A;  1MD3 A;  2FHE A;  5HFK A;  3TJF A;  5G31 A;  3KIJ A;  3WT2 A;  4XIH A;  2NTO A;  1Z6N A;  4TXV A;  5DAL A;  2RII A;  2JAD A;  2X99 A;  4G9H A;  4IP1 A;  1U87 A;  3HCZ A;  4TR4 A;  1VF3 A;  22GS A;  2B5X A;  3GKX A;  2HRK B;  3KTB A;  2AYT A;  1FHE A;  3GTU B;  5ECS A;  5IOX A;  3PPU A;  2FNO A;  5JCG A;  2C0D A;  1ZGN A;  1M2B A;  2EIQ A;  2C4J A;  2EFD A;  2IMI A;  2DJ0 A;  3FZ5 A;  5J41 A;  4MMM A;  2IFQ A;  4POM A;  4YH2 A;  3LOR A;  5ECR B;  4ECI A;  2ON7 A;  3ZYW A;  4GDF A;  5EPF A;  2PBJ A;  1TW9 A;  4FH8 A;  2XPD A;  2FCH A;  3DYR A;  2ZNM A;  4HQZ A;  1THO A;  2P5Q A;  5KN3 A;  2A4H A;  5ECP B;  2H30 A;  4V1A p;  3TRX A;  4HQS A;  2WRT A;  1W4V A;  2P5R A;  3FW2 A;  4FQU A;  3HVV A;  2VUP A;  2KP1 A;  1WOU A;  2DSA A;  2L4C A;  1G6W A;  4IJI A;  3BJ5 A;  1YQ1 A;  3IC8 A;  1J0F A;  2O5V A;  2L6D A;  1OYJ A;  4DEJ A;  1Y1U A;  4EO3 A;  1T4Z A;  2DJ2 A;  2FA8 A;  3MNG A;  1SVL A;  5D8I A;  2H0H A;  1QMV A;  1SK0 A;  2DJK A;  3PGT A;  3UVH A;  4DSS B;  3MSZ A;  3C73 A;  3TJB A;  2O7K A;  4TXO B;  1JLW A;  1GLQ A;  3NOF A;  2VO4 A;  1ERV A;  3TDG A;  2H74 A;  4O5U A;  3TOU A;  2GGT A;  3ZRD A;  2DKH A;  3EU3 A;  4KUN A;  4HDE A;  2MMZ A;  2QGV A;  2GQL A;  5IPH A;  1VRS D;  3IBH A;  1THX A;  3IAS 2;  2QC7 A;  3CTG A;  2CT6 A;  1B8X A;  2DML A;  5KN0 A;  1I5G A;  5DAL B;  2JZS A;  1TJD A;  5IQY A;  10GS A;  4G10 A;  3QAW A;  1M99 A;  1UN2 A;  4ZXG A;  2H1G A;  3FY7 A;  1V98 A;  1W89 A;  4ZBD A;  1HNC A;  2LRC A;  2VIM A;  5BRT A;  4KDX A;  3ZVJ D;  2H71 A;  3S9F A;  1EP7 A;  4A5P A;  1YEX A;  2G0F A;  5D9X A;  6GSW A;  4IN0 A;  2DJ1 A;  2F8A A;  5A4V A;  3R3E A;  2UV8 G;  2NDO A;  1IYH A;  4P3Y B;  1SYX A;  2L59 A;  16GS A;  5CRG A;  2R4V A;  1IYI A;  3P8W A;  5ECL B;  3US3 A;  1TRU A;  2R37 A;  4KDY A;  6GSS A;  4GST A;  4PQ1 A;  5D9T A;  1AC1 A;  1HQO A;  4OO5 A;  1TXX A;  2MMN A;  1GUK A;  2XBQ A;  2MBS A;  3UAP A;  2ES7 A;  4KCA A;  5E59 A;  9GSS A;  3GA4 A;  4K5R A;  4Z7X A;  3BCK A;  4EKZ A;  5F06 A;  1AXD A;  4GQC A;  2KLX A;  1TK5 B;  3HJO A;  5DDL A;  3EMP A;  2P31 A;  4K7I A;  1HNA A;  4CDO A;  3EPT A;  7GSS A;  1FOV A;  4JBB A;  3A5W A;  2FLS A;  2HZE A;  3GUR A;  1XVW A;  3F4S A;  4ZB6 A;  2BTO T;  2OBK A;  2H76 A;  1C72 A;  1N2A A;  3TJK A;  2PVO C;  4EXJ A;  2I4A A;  4O5Q A;  5C00 A;  2LKU A;  4W66 A;  4PUA A;  4LA1 A;  4MH2 A;  3HA9 A;  1EGO A;  2WGR A;  4PUR A;  4USS A;  2ALB A;  5IMD A;  3KP9 A;  1AUC A;  1XWA A;  2A2R A;  1QGV A;  2R5G A;  4WXT A;  5J4U A;  2IPA A;  19GS A;  4GTU A;  4XS1 A;  2VCV A;  1TKD B;  5J4V A;  3P2A A;  4JU5 A;  4K7O A;  2YJH A;  1FVJ A;  2VCT A;  3P7X A;  3FK8 A;  1EV4 A;  1A24 A;  2HSM B;  3ZIT A;  4EL1 A;  2CVK A;  1GL8 A;  1O81 A;  4KAE A;  1HD2 A;  5GSS A;  4MCU A;  4F9Z A;  1Z6M A;  5HR2 A;  5KN1 A;  3D6I A;  4OCE A;  4ECB A;  1SKS B;  3ZIJ A;  1R5A A;  3TB2 A;  2PPT A;  2WS2 A;  4F03 A;  2HE3 A;  3BD2 A;  3HD5 A;  3CBU A;  5B7C A;  3K8N A;  1K0M A;  1X5C A;  3LXT A;  2CX4 A;  3EVI A;  1JZO A;  2PU9 C;  1KTE A;  3ED3 A;  5DAK A;  1GUM A;  2NVL A;  3GX8 A;  1T3B A;  1TK0 B;  1FB0 A;  3TKP A;  1FVK A;  3QAG A;  1KEB A;  4O5R A;  1T8E B;  2H6X A;  3IAM 2;  4OFT A;  5ELG A;  4RUV A;  5DCH A;  5J9B A;  3QD9 A;  5HR3 A;  1TI3 A;  4GSN A;  1S3D A;  1G7E A;  2AUV A;  3GSS A;  5ECI B;  2L4Q A;  1MTC A;  1UC7 A;  4DVC A;  5CO3 A;  3TOT A;  4GXZ A;  4ACS A;  2PMT A;  3F4R A;  2X49 A;  4ZIJ A;  2REM A;  3NIV A;  1PL1 A;  5H5Q A;  2OAC A;  3DEX A;  1ACV A;  5IMF A;  3WD6 A;  2OKA A;  5A34 A;  2I3Y A;  4MZC A;  3HXS A;  4TR1 B;  5CNW A;  4RQR A;  2HYX A;  1TRS A;  2DIY A;  2H1L A;  3GYK A;  2RUF A;  2GZY A;  1K0B A;  2OE1 A;  2H8L A;  2X8H A;  4N11 A;  3A2W A;  1M2D A;  4CY6 A;  3IR4 A;  3W8S A;  3O76 A;  1WJK A;  4KND A;  2WJU A;  1ZYE A;  4OFN A;  4E68 A;  3G7Y A;  2LRT A;  1A0F A;  4NAX A;  2DC5 A;  2GVP A;  3UIW A;  2CA8 A;  2K9F A;  1GSY A;  5A5K A;  2C3Q A;  1BG1 A;  3Q19 A;  3CRU A;  4EDY A;  4IBP A;  3F6F A;  5ECO B;  4YQU A;  1TOF A;  3EMX A;  5F8B A;  3HVS A;  3H1N A;  3Q6O A;  5HQP A;  2YJ7 A;  5J5N A;  3ZVJ A;  3GTU A;  4GQF A;  4NXI A;  4AI6 A;  5L71 A;  2LS5 A;  5IIZ A;  4POB A;  3U6V A;  3BCI A;  1QUW A;  12GS A;  1F37 A;  3GKM A;  1TI1 A;  4HS1 A;  1XIY A;  2OE3 A;  1V57 A;  3D4M A;  1SVO A;  1EZK A;  5DAK B;  2VLV A;  1SK1 A;  4KH7 A;  3EUR A;  4AGS A;  1YF1 A;  18GS A;  4KX4 A;  4Z2U A;  1T7P B;  4IS0 A;  5ELA A;  2LJR A;  1PQN A;  1SD8 A;  3TKQ A;  1DE1 A;  2IMD A;  4BWS A;  5CP1 A;  5LD0 A;  4ILF A;  4EE0 A;  5CAX A;  5AN1 A;  2M80 A;  4Q5R A;  1U88 A;  2LJA A;  3ZZX A;  4Q5N A;  4HZ4 A;  1XFL A;  2C1Y A;  4Z2R A;  4I6X A;  1OC9 B;  1V9W A;  3LFL A;  3KP8 A;  4CHS A;  4WKW A;  3ZML A;  2R0C A;  6GST A;  4POK A;  2O85 A;  3TJJ A;  2MBT A;  2N5B A;  4IP6 A;  4BVY A;  1SKW B;  3FMW A;  5HR1 A;  2AJQ B;  3Q18 A;  1A2L A;  2CQ9 A;  2PN8 A;  1Z5Y E;  2HXK A;  4TXO A;  4EUY A;  5IMA A;  5JWO B;  1SEN A;  2GQK A;  4NPB A;  3GIX A;  1Y25 A;  5KEJ A;  1AIU A;  2WUL A;  2AV4 A;  3L78 A;  2V2G A;  2I81 A;  3UJ1 A;  4XS6 A;  1GSU A;  6GSY A;  3ISO A;  4PX1 A;  3GV1 A;  2ZCT A;  3RHB A;  2TRX A;  4O92 A;  5ECH B;  3KH7 A;  2HSN A;  3VUR A;  4BPY A;  1O85 A;  1BYE A;  2HRA A;  2FWE A;  2PVQ A;  3IA1 A;  1B4P A;  3RDW A;  2YZH A;  2GLR A;  1XZO A;  2EFH A;  2EIR A;  4CY8 A;  2VAF A;  2FA4 A;  2HRN A;  1YKA A;  3CTF A;  5KOW A;  3TKS E;  5D93 A;  2QKE A;  3GFK A;  4GSS A;  4V2L A;  3D21 A;  3WYW A;  4X43 A;  2R3X A;  2K8V A;  4ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...