2C9DA

Lumazine synthase from mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl)hexane 1-phosphate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
publication title Structural and Thermodynamic Insights Into the Binding Mode of Five Novel Inhibitors of Lumazine Synthase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2c9dA00
1KZ9A 2A57A 1ZISA 2I0FA 1DI0A 5IM5A 1NQUA 4KQ6A 2OBXA 3MK31 2B98A 2A59A 1RVV1 2C9BA 1T13A 2C92A 1NQVA 2C94A 1EJBA 1HQKA 1W29A 2C97A 2B99A 1KYXA 2O6HA 2JFBA 1W19A 1NQXA 1KZ6A 5IM4A 1C2YA 2A58A 2C9DA 3NQ41 1KYYA 1C41A 4J07A 1KYVA 2F59A 1KZ4A 1XN1A 1KZ1A 1NQWA 2VI5A
chains in the Genus database with same CATH superfamily
1R0WA 2VC2B 1SBHA 2F48A 4PTLA 3RWBA 1E3MA 2IU6A 1PJTA 3G5MA 3HGTA 4FHCA 1U6JA 5HKLA 5JD3A 1J7KA 1YS4A 3RS2A 3ZIAA 3PT5A 3SF8B 4JBGA 3UBTA 3UT5B 4UVDA 2GRUA 3KAPA 1K2VN 1JNYA 2Z56A 3MCAA 5ITWA 1P9NA 2P75A 4J76A 1G8GA 1ABEA 2FK7A 3TZCA 4NJEB 5EPUA 1RACA 3GZNB 4NOLA 3EXFA 3SSNA 1GRNA 1KDPA 4JP8A 1IFXA 2XGGA 2DFPA 5BSKA 4YONB 4D8XA 2GEKA 5HM8A 2LKCA 2G8NA 2MSLA 5E2BA 5ALOA 1GARA 2AFIB 2B6HA 3AUJB 3DOIA 3OUZA 3DDUA 5MGBA 5D3MB 3VU3A 3W2HA 1QH8A 3BCUA 3FF1A 1JQEA 3SIXA 1FX1A 2OHOA 2ZYWX 2O59A 4K2HA 3V8MA 3QH4A 5JAHA 1G19A 2VF4X 3QU4A 2WWRA 1KNXA 3ND9A 1L5LA 2UYGA 4B2LA 2I1VB 4EYQA 1TE2A 1PJ8A 4OATA 2WWHA 3R3WA 1H2WA 1PO7A 2R6AA 4MYCA 1PG5A 4FOSA 3IILA 4RD6A 3OFJA 5F73A 3SP1A 4ZZ1A 4G5QA 4C43A 5I9NA 3JRXA 3ZZUA 4B80A 1Q84A 4G09A 1X3SA 4OBXA 3CIFA 1WCWA 1VJ0A 1KQFA 2UXCB 3TI7A 4QDZA 1GCOA 3AKYA 2JEOA 1FDWA 1TM2A 2O05A 3CO0S 3QWIA 3U0BA 4BVKA 2O7RA 1QF7A 5J1SB 3TLAA 4KMRA 1XNJA 2UKDA 3IL2A 1ADJA 4PPFA 1VYVA 1OFUX 5JE8A 1JX6A 1M73E 3PJEA 3NAZA 5FOVA 2KM1A 2NU7B 3ED1A 4P4SB 4ZT6A 3KEFA 4FX5A 1TU3A 2P2LA 4QATA 1OU4A 2GKSA 4Z4EA 1JHAA 3K0AB 3W7VA 3ZWXA 4KGVA 2G0AA 3A1VA 3CA8A 2A5GA 3BA1A 1XO1A 4EHBA 1P45A 1JDVA 5HIAA 4DSOA 3H4VA 2OG1A 3C7CB 1HR0B 5T6BA 2H8GA 5JDCA 3K70D 3DMDA 3ZVNA 1XPJA 1Q7TA 1S2IA 2GBLC 4AF6A 5I8PA 5IULC 2WU3A 4BKUA 4QHYA 2WTNA 4PM4A 4IGEA 2EP5A 2XT0A 4N39A 2OHJA 3VVCA 3ZU6A 1POXA 2AE2A 1NVVR 4YVFA 1G7TA 1PRYA 5A6SB 4MVJI 2PA3A 1R6VA 2Q3DA 3HKBB 4ABYA 1IULA 1M2EA 1AHHA 3D7NA 3ZU3A 2FMFA 1IIBA 3KYIB 2XUJA 1JDBB 3LP6A 2DPGA 1C29B 4K1LA 3ZY6A 4F3YA 3AGPA 5J2TB 1KBOA 5C8VA 5TF0A 3LFTA 5FI1B 5B7GA 4EG5A 2HD4A 2VF5X 2XIQA 3E7XA 3DMFA 4JXZA 4CR8A 2VVTA 4FNGA 3EGXA 4UUNA 3RRMA 2HDWA 1CULC 1IZ0A 1W88B 1OLXB 3QU2A 2WZDA 1PR4A 3FLEA 4TGLA 4CV1A 5A7GA 5BWCA 2JVKA 4RGVA 5DO9A 2O5RA 2FW1A 4WSOA 2K2WA 1KIAA 3E2PA 2BFEA 2DMRA 1D8TA 1N92A 2WK1A 3GGOA 2C4VA 4OOEA 4PYNA 1KVUA 4AJNA 3F3SA 4PSVA 2PZMA 3OWXA 4BNZA 1RRPA 1TOAA 2PD6A 4KQJA 1QDEA 2Y67A 3UC5A 4L07A 1KDZA 2Q0SA 3CUWA 2BGWA 3WDLA 5B4TA 1ORWA 3K5WA 3OPYA 4UCFA 4TMZA 4IO1A 4U5XA 4Y9UA 1Q1AA 4OUDA 1RVV1 3UB2A 2VDQB 1PBTA 2ZIZA 4RPIA 1L7PA 2C92A 1JYFA 3HB9A 4NE9A 4R05A 1IHXA 4ID3A 5LUAA 4IH1A 4DG5A 4NHOA 4KTVE 4TLLB 1SBQA 4DT1A 4X8LA 1E98A 1MH1A 1PFGA 4H7KA 3KT0A 3EK2A 3FOAA 3EVBA 4C0HA 2L69A 1QGUB 4Y2VA 4EG3A 2ON6A 1G6OA 5EMMA 1HNWB 1K98A 5IBCA 3PRKE 2Q8PA 3KUXA 2GBFA 5A3QA 2CE2X 2H5LA 4WZBB 1XPUA 1A1SA 3KR1A 3X2EA 2NNWB 2OV3A 3FPLA 2KJQA 4Y2UA 1RYNA 2IP1A 1QWSA 5B55A 2QL6A 3STWA 3LJKA 1YBMA 4HATA 4Q1AA 1CX9B 1Y1LA 1JU3A 2RGUA 4M7WA 3MMPA 4Y6RA 4BLSA 2XD4A 4LJYA 4CQJA 2B99A 4Q3DA 2NLOA 1WW3A 2BUAA 2ODWA 2ZGVA 3E7FA 3RQSA 3ZU2A 4RA9B 4D0SA 2DQ4A 4EFKA 1XQXA 4TWZA 4RYLA 3RNLA 1GY8A 1RJFA 1XXLA 1H9CA 4KTTE 5MFZA 3F3YA 2I6SA 5JZSA 2EFEB 2H18A 4B3XA 3GFGA 2PX5A 4DUYB 4IJKA 2R2AA 4MQLA 5LD2B 2P90A 1GTG1 1XLTA 3JQBA 4GPTA 4NPCA 4Q21A 1W25A 5DT2A 1NF8A 3SXPA 1UBCA 1T1GA 3AEQB 3T3HA 3V6LA 2BE7A 1KGDA 1XTIA 1A8UA 1AF7A 5EAIA 3SI7A 2IYWA 4G1UC 1ZRHA 2B1QA 4L9WA 1DAGA 1XVVA 4TX1A 1SBYA 4Q4JA 1XQ1A 1ZEMA 1A04A 3PEUA 4UATA 3T5DA 1VYUA 1DXYA 3M3HA 3A1TA 3K5PA 2BI8A 1M72A 3REQB 2ECFA 3IALA 5AO9A 3E82A 1I0ZA 2UZ1B 1OAAA 5J5AA 1EPUA 3ANNA 2ZT5A 4PO1A 2IQ5A 1RQXA 4NECA 4NDAA 1A7JA 1SUSA 1VCHA 2JFWA 4M1TA 1KMHB 4N82A 4OB8A 3F8WA 3CN9A 3KXKA 1J0CA 1DIAA 4JNCA 6YASA 3HU2A 5AJXA 4P3NA 1HT0A 1Q20A 3JATA 4YAFA 3CW2A 5HGJA 3EXEB 4IILA 1RHRA 1E8DA 3ZTYA 1K5GA 1LY1A 2E4WA 1SOUA 5FBQB 3RK0A 1TMKA 3V2HA 5B1IA 4ATNA 4YRRA 3FGOA 2JFZA 3FOZA 4WV3A 1SUPA 4WIAA 1F8YA 1SJ9A 3MNFA 3CVYA 1EXWA 16PKA 2JIDA 2NUPB 3AR9A 3EZ9A 3I23A 3ZHOA 2OZEA 5IKEA 5D8DA 4MIOA 1Z4MA 1H1LB 4TSKA 5WRFA 5KI6A 2MINB 4D79A 5A06A 1AKVA 2PXHA 1L5KA 5KTTA 2I9KA 2CJYA 4CG1A 4RMNA 1GKIA 1NMQA 3NC4A 4YGYA 1XI2A 3W8NA 3ZI0A 1N1GA 4OUKX 421PA 4FGKA 5C3MA 1YJBA 3IA7A 1B4DA 2FPMA 4XX0B 5JWRA 1O3YA 2GEJA 2GEDA 3DE3X 4R31A 1KOJA 3HCBA 1ACMA 2VAMA 3NBKA 3NHJA 4IJ6A 4K9PA 5AXAA 1A9YA 4YMHA 2H52A 4DXAA 1NPYA 3UH1A 2G6TA 2QE6A 1V47A 5KYNA 3TB6A 1A95A 2P11A 2IUFA 3MS2A 4U6QA 3UFXA 3K9HA 2WIFA 2RB5A 4UULA 2WJHA 2VTVA 3ADKA 2HHCA 3GUVA 4WKGA 1WF3A 2ZYUX 3C7DB 4Z9XA 3EEOA 3NALA 3EN0A 1SUDA 2BGMA 4A27A 1VJCA 3W8EA 1Z0FA 3TTSA 1RQGA 2BFBA 2AF4C 1PN3A 4OXNA 2GZSA 3WJAA 2GHTA 3OMLA 2NAPA 3TXAA 2VTEA 2QN1A 3F7OA 2ZCUA 2A9VA 4I2NA 1TM3E 1DO2A 1TGVA 3MK31 4YT8A 3MGBA 2B5WA 2F1RA 2WD8A 2IYFA 4RZXA 4ZO4A 2CDBA 3QVTA 1M5UA 1OV4A 2VUTA 2F4NA 4X20A 5TARA 2BR4A 1Z39A 4K1XA 3B6EA 4GU5A 3I0ZA 5KTSA 1T5DX 2PX8A 1NQXA 2J9RA 1T24A 1DBRA 1KO5A 2QI9F 4GP6A 4KKVA 4TS9A 1YVUA 4TSRA 4I9NA 1E6MA 1Q7EA 2FPOA 3G49A 2OL4A 4TLBA 2QYSA 5BV8A 4H35A 1AKRA 5EZQA 1S2DA 3D3EA 1LJ8A 1A27A 1OC2A 3L0IB 3R40A 1V7PC 2YNMD 3HJCA 3HMKA 3JWGA 3K0CA 4H59A 3PCTA 4ZVQA 1K88A 5ECGC 1L5FA 1GZ6A 1XTKA 3A27A 2OE2A 1H0SA 4ILEA 1VG9B 3ZJ5A 3CTMA 2ZDHA 4JODA 1IZYA 4M60A 4DABA 1LRKA 3K05A 5B7QA 3UMMA 3SQLA 2JD0A 3TMKA 5HX7A 3A0RB 3KQKA 4BDSA 2YJ4A 2Q6LA 2OXIA 2JHCA 5MFPA 1Y81A 5K3CA 2Q3HA 2X42A 3A9RA 2W6NA 3I1JA 3OHMA 5HA5A 4CMCA 3UWKA 2IFTA 5KQPA 3JSXA 5A5GA 1U1CA 2VAPA 4NWIA 3DEFA 4ID9A 1ZX1A 4X6YA 1JAHA 5JMPA 3EVDA 4H7HA 1CB7A 1LVHA 1N5JA 3UMGA 3WZLA 1DAFA 4JK3A 2X1LA 4E07A 3PCXA 3QLJA 4LWQA 2IY9A 4UOQA 1TEHA 1FFWA 2PKXA 3N6VA 4GOOD 4OH1A 4V0NA 5IAJA 5ICSA 1I2DA 3H2IA 1JN0A 1Y7LA 2BTQA 5ENVA 3WK4A 3WL5A 1YAHA 3LTNC 4DV7B 4FM9A 4RE6A 4IDEA 1NVAA 1UM9B 1AS2A 2FGKA 4KREA 1XDGA 2GBIA 3L6CA 3LUDA 1IN7A 1E2JA 1VSVA 7GPBA 1L4EA 4IXDA 4YHBA 3L6RA 4R6XA 2ODEA 4G2TA 4PRLA 3VZRA 1VB3A 5DTJA 1W0JA 4MI1A 1ECBA 4CBVA 4G63A 1E1CB 3OLVA 4D8TA 2NV0A 2O8VA 2ZZMA 5L3VA 3MRSA 3A4LA 3WGUA 1BEZA 2Z2XA 3I9V6 5AHOA 4QLBA 3Q8WA 1QWOA 1IK6A 4KLZA 1QF9A 5KDDA 5KOHB 1YQXA 1Q19A 2V96A 1QFYA 1NKVA 3V7NA 1VJ1A 1OE0A 4UDNA 4WK2B 2O8DB 4QEKA 3ZBTA 5DNCA 3GA7A 1QQAA 4M0PA 3B60A 3K1ZA 4S1TA 5KINB 1E2GA 1IAVA 3D6MA 4JB2A 1JEYA 4DWOA 3IP3A 4LBVA 1NNSA 2NX2A 1Z18A 1NW8A 3BMQA 1TIKA 4UEOA 1QP4A 2Q7OE 3O26A 4IMIB 3BJEA 4FK8A 2ONYA 4FFBB 3ROZA 3RFUA 2ZBVA 4JL6A 5SICE 4FC7A 2HRQA 1WWKA 4ZWNA 1RKVA 3FZQA 4L6CA 1LW6E 1ZN7A 3FZGA 5BWLA 3LCJA 2CHGA 3D2BA 4UM9D 1W36B 5F35A 1NXSA 2JGAA 4OQZA 4DY4A 4I5FA 3WMXA 3DMNA 3VFDA 1ENOA 4MROA 3AJ9A 3IMCA 3RASA 1GZSA 3WGHA 1YQUA 4Y6OA 4ZIRA 5FJJA 4WESB 2I78A 3TSOA 3THXA 1HDZA 4AMZA 3P0HA 4OYHA 3TSAA 5LNK1 3A58B 5CA0F 4YGXB 2QVXX 5T5QA 2QSZA 5F9HA 1P4AA 3RSQA 3G88A 1UBRS 3ZE9A 4I3GA 4IWXA 4YXFA 1PK8A 3W6ZA 2ZWIA 1OH7A 1IPFA 2CNWD 1C4XA 1V2HE 2ZI5A 5D3QA 4CM8B 2IOQA 4TKVA 2IYYA 1MABA 5J4KA 4RD2A 4KG7A 4HP8A 4BY9E 4DV5B 3VPCA 4RVOA 1KP2A 1U2GA 1P1RA 4UU1A 1B00A 1NXVA 3OEED 4L27A 3SG0A 4BMXA 1SKUA 1ZVQA 3AJRA 3DE1X 2HUPA 3OE1A 4MGEA 4NBLA 4CZ2A 5DN6D 5JI2E 3HKDA 3K6SB 4KN5A 4ZPXA 4GYKA 1FW6A 4ZP1A 3ZUPA 1QHEA 2J6HA 4C3UA 4UPEA 4DC1A 1SCUA 5LDGA 4RM3A 3L7DA 1EM6A 3EG5A 1U5AA 1UXGA 4GOMD 3CPEA 5GMOA 4RK0A 3DDSA 3H11B 1AY0A 5I47A 1RQ7A 5HZKA 2PZBA 1K7YA 2JZOA 1G8KA 4LHEA 4AZWA 1YO6A 3ZW7A 3T7JA 4KIGA 2C07A 3SF8A 5ES3A 5CDGA 2YCLA 3UT5A 4A8HA 3MRXA 2C04A 2ZKIA 3V4PB 5JVDF 4Z9YA 4K87A 3T3DA 1IN4A 3VGJA 4NFSA 2UUBB 3VO2A 2AI3A 3QVLA 5IWCA 5FR1A 3NJ4A 4MLZA 2J7PA 1HL7A 4QWWA 1FMTA 1VSQA 3PI6A 4IDCA 1ORHA 2WG1A 4NJEA 3FVWA 3UHPA 4EI9A 3GZNA 1KDTA 1XLWA 3N75A 3V2IA 3AFMA 4LE1A 1I7SB 2HZBA 2HHAA 5EGSA 4C14A 2BTEA 2CLSA 1DE0A 2CLEB 3V1YA 5DCYA 5GJCA 3UMFA 3ZS9A 1ZWKA 4CQMD 3A9SA 5IJAA 2AFIA 1FP4B 1PEKE 3RRXA 3V1TC 5IJZA 4MHTA 3JW8A 3ZGYA 3KEMA 4MPRA 3MUOA 5D3MA 1TCUA 5BUSA 2X86A 3GR6A 3ND8A 1G291 4NESA 1Q0QA 2J85A 2FWRA 2XOEA 4WD3A 3LMKA 3U9SA 4EFLA 5E6UB 3NBUA 3PUZA 3I92A 3O7WA 4Q7JB 5MGNA 1B23P 4GS5A 2QMUA 4Z51A 3UAVA 4QYWA 1XZAA 4OXKA 4AG6A 1VRVA 3OQ1A 5FTLA 1P7CA 3ZV3A 5LR6A 3CF6R 1ZIXA 2FCAA 2BH2A 3QTBA 4G5RA 3G68A 1HKUA 4B0OA 2O0KA 4ZVVA 3IQXA 1VLZA 3K6KA 4KI0A 3KP1A 1IOVA 1Y1QA 2IOFK 4AQ7A 3UHOA 3SBEA 3QIAA 3D81A 3F6EX 3ZWPA 3U4HA 3LT1A 1U9IC 1OU0A 3QX9A 3IVMA 3T3EA 1IQRA 1D1TA 5LU8A 3IP5A 2PSDA 2YWBA 4URFA 3CTPA 4RENA 3HCEA 1WD5A 2NU7A 2PVCA 4P4SA 2R4QA 1CCWA 2QTAA 1JAZA 4OQYA 3VKGA 3OP1A 3K0AA 2EDAA 2ZQ5A 4IZIA 2OCXA 2WYVA 1C7EA 3EEIA 5AICA 3TNLA 3ETLA 4IUYA 2ERXA 5GJVC 4GMHA 2ZW9A 3PFNA 4GF5A 5A62A 3NM5A 2ORWA 2J6IA 3ZS8A 1JWBB 2HMYB 1DKOA 3RTBA 3T1OA 1FXWF 3UQYS 5G1OA 2DY1A 2LIVA 5F33A 1Z5UA 3DOUA 3S4YA 2Y6VA 1UC8A 3PNQA 3LX4A 3QJ5A 1BJKA 3A9UA 2NPFA 2ZITA 3X1MA 5A6SA 1U0FA 2ZRKA 2RGNC 3QU9A 1OAKA 1QAOA 3SS7X 3HKBA 4DYDA 3C5CA 1GA1A 4FHZA 1R5NA 3NHMA 1MC8A 1KAQA 3MRVA 4UU0A 1QK5A 1WZIA 1D7AA 2VA8A 2ZJ3A 5LJLA 5J2TA 3IAHA 1D4AA 1APBA 2BGJA 4A23A 3IERA 3QK7A 4I55F 2BFDB 4AY6A 1LU9A 3TNDA 4DNQA 3EZFA 2BMVA 3TN7A 4RD4A 5DLPA 1XPOA 1W88A 4V39A 1HEIA 1OLXA 3H87A 3VKWA 4BV8A 4D0GA 1H22A 5BV2P 1A69A 3IHTA 3GVHA 5I4KA 3QLEA 3NXSA 2PL3A 3PC7A 4O1MA 4RWEA 4YR9A 1IQ0A 2YTZA 4OL9A 5GGYA 1JAIA 1F6DA 3GV0A 3LPLA 3Q2KA 1NR1A 3TIXB 3UMJA 1KTIA 3RUPA 2C4HA 3H4MA 3NANA 1GJRA 2H1LA 2W2LD 5DBFA 5C0OE 1J8VA 3RVSA 1CK4A 2QLTA 3NDPA 3AJAA 3PUXA 4K7JA 3DLAA 2FHSA 1GKYA 3DGEC 4YCJA 3SHQA 3MSXA 4ZYUA 2GPNA 3C1TA 3GEIA 3P5SA 1VL2A 3CNOA 1CLEA 2FFHA 1WXFA 4RULA 1DLJA 1JA9A 5C1DA 4Z7JA 5LM3A 3KXPA 4FHEA 4GZ6A 2MHCA 2GTHA 2AYXA 4CF6A 4JS0A 2OFOA 4LJRA 1XIVA 3HL4A 2ZSFA 5FPQA 1SVUA 2HOQA 4OQDA 3ECCA 1QGUA 2AG1A 3DHVA 1GWNA 1B42A 3L02A 4JYCA 1YL6A 4IHAA 4DMCA 3OZRA 1MCZA 4ZAGA 1GIAA 2WD7B 2ZBPA 4G1CA 2G1KA 3TNYA 1N0UA 4WZBA 4G5OA 5BY2A 5ELMA 1V5FA 4LJ5A 4EL0A 2XJ4A 2PMFA 4B3MB 1E6EA 2PGNA 3OKPA 3OEWA 3DL7A 1GTMA 2D5CA 5LJIA 1PX0A 3HCAA 3K4PA 2HYDA 4ZK2A 1U11A 2H4XA 2ANCA 2BGIA 1J24A 3HXTA 1TECE 3M4YA 4L5CA 4DQXA 5E4FA 5EJ4A 4QU9A 1P17A 2R60A 1ZSVA 3VX4A 4FE3A 4F1JA 4WACA 5ERYA 4EUEA 2OHGA 1YVDA 4DB4A 2EKQA 3AU8A 2XGSA 4RA9A 5ALZA 1SKBA 3TGPA 3U4CA 1ENPA 3ZWWA 3EDRA 4L3OA 3ZHVA 1N3IA 5HXAA 2CT8A 1S8OA 1L4KA 3LHKA 1UXIA 1O96B 1O0CA 2WF7A 2FW0A 3SIWA 4ISBA 1M2OB 4M38A 5CT9A 1NBIA 4DIBA 4HD8A 5DGXA 2AJBA 3BIWA 1BKYA 4HOYA 3AEQA 3MOGA 5KPJA 1ILWA 1E1LA 2NQ8A 1SU4A 1HQYE 2AX3A 4P4GA 4XWOA 3BPSA 4XUCA 1YDHA 4Y2HA 3C4QA 1WMBA 4KGZA 5JT1A 4ZOAA 4DZTA 1CUEA 4MVXA 4F4CA 1OT5A 3B6KA 4MHSA 2W6PA 2ZUTA 1P9LA 2AVNA 1J0BA 3QVSA 2GFIA 1NNLA 3PUYA 1I6MA 1FLNA 1NXXA 2MR5A 3QVKA 3NFRA 5JY6A 5J4HA 3HUTA 2A5JA 5JVDA 5HKKD 3REQA 5F98A 1NRIA 3ZZTA 4GQIA 1JBKA 1L9XA 2UZ1A 1ZD5A 2ZDGA 3D8UA 1NJ8A 2G76A 3AJDA 3I2YX 4NG5A 2J1LA 1BWRA 2PGDA 3MWEB 2ZI4A 1HXHA 3COSA 1XD2B 5D5PA 3R76A 4W9NC 4JV5B 1QFXA 4EFMA 1KMHA 4NCKA 3TKLA 4OPMA 2YC2C 3TQOA 2WDPA 4HEJA 2Z2YA 4PFKA 4MB6A 3N8NA 4PXYA 4Z8XA 3VVMA 4Q6BA 1HG1A 4GVLA 1XR3A 3UUWA 3DP9A 3WOHA 3EXEA 3WK7A 2P9QA 3IE2A 1E8NA 2H31A 1R0ZA 5C1BA 5GPBA 3FSGA 4UTRA 1G3QA 1KPIA 5GVSA 3LLUA 1NJFA 1GG8A 4ETNA 2KE5A 3IEUA 2E5LB 3KQNA 2GO7A 1AGPA 1Y3CE 1A7AA 2J9ZB 2QT0A 4HWTA 2NUPA 3OZSA 1YR1A 2JZCA 2YVKA 4CIBA 1JR6A 4D3DA 1H1LA 1XHFA 2WSSA 2KWIA 2MINA 2Q0QA 3ZK8A 1RS0A 2W2MA 2IPMA 1GZ7A 2TECE 1JR2A 1YUBA 3TL3A 1FVHA 2V59A 5LLSA 1QHSA 3JVIA 2PKQO 2AWOA 3HRIA 1COWA 1LLCA 3UBMA 3DQPA 4G6ZA 4XX0A 4D4KA 5BR7A 1K1EA 3SOPA 4IKOA 1JA1A 5IVDA 5HOEA 2QTFA 2GPTA 1HLDA 3L7KA 1T6ZA 2RBGA 1O0BA 1KZ9A 1OXTA 2XAAA 2W6CX 1VE5A 4FSHA 4M7RA 4RD3A 2P2NA 5AJTA 1EHYA 5B1YA 2IE8A 1B6RA 1KFEB 1AHPA 4YRPA 3IOMA 5FJIA 2EBWA 1ADBA 2CKMA 5AI8A 3VTFA 1M6VB 4MH0R 4C5BA 2JFXA 1NBME 2FZ4A 5G3ZA 4V0OA 1A5BB 5IXYA 2LNDA 3F0TA 3OQVA 4JSRA 4NIMA 2XHEA 1P3DA 4WZZA 4BE4A 5JCZA 5EP2A 3NWBA 3Q85A 4ENWA 1YB2A 2DUMA 1BD4A 3RYHB 1I3CA 2QNRA 4R4JA 3TG2A 2MTBA 1QH9A 4QO7A 4OHKA 2A0UA 3WGZA 4UCQA 1FYVA 2X8BA 1R6UA 3KHTA 1OH5A 1AM4D 2M1ZA 4RMGA 4AJ2A 3MCUA 4KR6A 1GCAA 2Z43A 1PGJA 3JPYA 1E9AA 4C4AA 3D5EA 2N42A 5LZ8A 1Y5NA 4AO8A 5KC8A 3NATA 2X3UA 1JHUA 2IYNA 1ZM3A 2OHXA 2OM2A 3KWFA 4B7CA 1HLPA 2JI6A 3C48A 3GIWA 3EPHA 1H4QA 5F21A 2J67A 3IIIA 4S05A 1PG0A 3UGTA 1NBWB 4AQDA 3IESA 2V0CA 2MWMA 3NVMB 4IDDA 3NW9A 4ZI5A 1OQAA 2BUBA 1MV8A 4HVLA 5AWFC 4LRXA 4Q9HA 3BSWA 1QONA 4ETMA 1XRPA 4IJ5A 1H0RA 2VZ9A 1WXHA 1U2TA 1O95D 3CY6A 1W5AA 5I7SA 3HEMA 4CKEB 3CCCA 4O3MA 4V24A 3WHPA 1XMJA 4UBLA 3P52A 1GR0A 2XUHA 4M9CA 1JVSA 3A32A 2X6QA 1UXHA 2OO7A 4PANA 4UUBA 1Z26A 4L0DA 2XB2A 4UM5A 1KF0A 5LDHA 5GVRA 2XTJA 4CTNA 3W06A 3GJQA 1L5ZA 1DNPA 4PNEA 3CLHA 3R5XA 1Y9AA 2B5VA 3B5IA 1GGFA 2IXTA 4KPUB 2IF0A 4D26A 1X77A 2PNJA 3WK9A 3OLCX 4P53A 3P20A 1SC3A 1WULS 1KJJA 3SX2A 3RAGA 3VR5H 4XWYA 2NG1A 4PAMA 3ISVA 3F78A 3ZXUB 4URHA 2ZI3A 5TGDA 2ISQA 1DBIA 2WEKA 4R2HA 4ZZ0A 2Z58A 3C3AA 3OQNA 2CLKB 1TJYA 3PITA 4M86A 4NABA 4X0EA 4E32A 4I2VA 1ZAYA 5JAPA 1OHHD 1YRLA 1VXRA 1UM9A 1F8FA 1I13A 1RPNA 4IDQA 1U7XA 1XDWA 5F7XA 1M5TA 2VXCA 1BS1A 2XODA 2ZR7A 1GAXA 2YY6A 2DM6A 3QFHA 4M8IA 3MQ4A 4MWTA 4UUMA 3AUTA 1J2EA 1E1CA 3AR5A 5BNIA 5C37A 3LBYA 3L84A 4ZT7A 2X5KO 1KH2A 1P9WA 5ALIA 3IA2A 4I1VA 4J9VA 4DLAA 1AB5A 1XKLA 4LCBA 2ZREA 2CWDA 5HF9A 1A8IA 1PNTA 2I7CA 5C5IA 1PLLA 1FB5A 5TGZA 3TPFA 5KOHA 2ZUFA 4OU5A 3R09A 5HM6A 3H9CA 1MFZA 4P5DA 2HJWA 5LZ4A 1XVTA 5LIRA 3F6PA 3UENA 3L1VA 3EOBI 2I55A 3FF4A 2IC5A 2ZYRA 4K8RB 3FVRA 2ZSBA 2IDMA 3GAFA 2A5YB 3ESXA 4O29A 4UVIA 5ALMA 5JTTA 6ABPA 2G28A 1Z73A 1R5BA 3AHGA 1M2KA 1Q1GA 1YIAA 2FPUA 1NW9B 3PRJA 2X4IA 4HQ6A 3Q12A 2XT9A 4ZJYA 3TLJA 5LN1A 4FFBA 2HMSA 3H65A 1T5IA 2CNKA 3G1TA 1U2QA 1EUYA 1I33A 1ULBA 2XKBA 4AXXA 3IXQA 3H5WA 3WIBA 3LDUA 1P31A 4L85A 3W3AD 4KYIB 3AV0B 3ELBA 3DZCA 3HA2A 2E89A 2ZSUA 2NYRA 5C53B 2BJHA 4NICA 3ORHA 4LY9A 5CM2Z 3DOCA 4RNCA 2HDNB 1I4DD 3HWRA 4GP7A 4W1QA 3WGQA 1MHTA 4LF4B 4DA4A 1P60A 1NL3A 5JD6A 5TMEA 3JS5A 2HLNA 4QM7A 4HZUB 5EFZA 3PWSA 4PRYA 4WESA 5CPBA 3UV7A 1ODFA 2FUEA 2VP2A 3PL5A 1K08A 4PV7A 3SGLA 1CXZA 3P97A 5EZ5A 1P2BA 3IUBA 1EJ2A 1YC5A 5BWOA 1QV7A 4MVJF 2IUYA 4QU5A 5EN4A 5G0VA 4C0BA 1CG6A 1NR5A 4OX9B 4ZRDA 1NGSA 5B3LA 5JC8A 2Q5CA 3DL0A 4CM8A 1J0XO 1HPLA 4LVUA 1ESNA 5CW1A 3AP2A 5BMVF 2IUSA 2VDWB 3INYA 3IX7A 1JLRA 3NJRA 4C4TA 4RHTA 3I5MA 2IIVA 5MDHA 4RTJA 1JB1A 4C08A 1VBKA 3N53A 4MV6A 2COUA 2B36A 1GT6A 3BXXA 3SSMA 3TRDA 5HQTA 2ODAA 3H7AA 2NSYA 1E0KA 3H1AA 1CNEA 3KOYA 4PG4A 4OK3A 2CDCA 3IQIX 4TTIA 3H11A 4MDYA 4AN0A 4W1RA 1QO0A 3NVAA 1VP9A 1S7GA 4EARA 3WWDA 4GT1A 3EULA 1LF5A 4FUQA 4Y9RA 2OESA 2OOKA 2OR3A 2XY4A 1KH3A 3Q5EA 3SYTA 4MW1A 1Y9DA 1D2CA 1FDTA 5IJXA 3NJ8A 2QDKA 1ISHA 3UOAB 2CV1A 5B36A 4P84A 4TS1A 4L4XA 1G3UA 1U4OA 2FQWA 4J0HA 4NCNA 5ECWA 2WIJA 4PLHA 4GRDA 1I9CA 1P4RA 5G3YA 2DQSA 5C5EA 1L2TA 5SYAA 1FSSA 4YAWA 3HJTA 2GJAA 1EK0A 2DH5A 4CODB 2OV8A 1L4GA 1FP4A 1KO4A 3PQDA 3T9CA 3UG6A 4YUAA 4Z1MD 5T7BA 5GZ1A 1SXJC 2K2QB 3ZDFA 2Q45A 2B9VA 3RW9A 3A28A 1WE2A 4JP2A 4YACA 4OV6B 5DTRA 4D45A 3L7CA 2O7NA 1GAEO 4IJMA 4ML3A 5E6UA 2DTEA 1DO0A 1YSCA 5LZ5A 4FWTA 4MJXA 2IA5A 1YOVB 4BTLA 3M3PA 3EAFA 3UOWA 2YYSA 2REXB 5CRIA 3NM4A 4I9FA 4JR1A 1CJKC 4UZSA 2HRDA 3MIZA 4YCDA 4BO0A 2YBDA 4E22A 4L4ZA 3TW8B 2PTHA 4M88A 4UE6A 4OHXA 1E99A 3V97A 5EMLA 1GO2A 4UVGA 4EX7A 1XCLA 3OSUA 3C45A 2BHNA 1MXFA 3I4CA 3NGXA 1VOTA 1A2BA 2HIGA 3BX1A 4GBED 1IEXA 1UJNA 3PXGA 4B83A 2GPWA 13PKA 1Z4JA 3EQZA 4IDFA 3FMFA 4Y6SA 4JLPA 4KQ2A 3WV5A 2FR0A 2YL2A 2VWQA 4J16A 1KO7A 4MRSA 3AW9A 4DRXB 4J0QA 2CDAA 4E70A 4QAQA 4YIKA 4R0NA 3M2TA 5I7AA 2A5FA 2R8RA 4I50F 3IELA 3BK2A 2XRMA 1NIPA 4GPEA 5ECYA 2YWCA 3W8FA 1EGAA 2V5VA 1GPKA 5JC1A 4RWZA 1EK1A 3N3AC 2FEKA 4HDCA 4NEQA 1G4UR 3U81A 1KQPA 3KEQA 4KDCA 2M6KA 1X1EA 4XR4A 2ZJFA 4JI4B 1A9QA 2VSQA 4JLNA 1SD5A 1U3DA 1QE3A 3BBPA 4V0ME 5JRJA 1IHUA 2Z30A 5IP5A 2O54A 2BHTA 4TVBA 1KDRA 3QUTA 2A59A 2XDWA 1W46A 1UPUA 2IHUA 2NO7A 2DTDA 4DADA 1JR3E 4PCVA 5I7VA 3AUAA 1V4NA 2PVPA 2OFWA 4EGSA 1MRSA 5THQA 3F6RA 3WA6A 4Z1OA 5IKOA 1LBSA 1KBZA 3TTWA 1HM5A 2N9UA 4MO9A 3RR2A 2BFDA 3WGYA 1ZXLA 2QTCA 4EW3A 3IH5A 4P7JA 4BFUA 4DR2B 3GLHB 1U7ZA 4JYAB 3GUUA 3HXOA 2YRWA 1W75A 2Q3BA 3DTYA 2CMHA 3SS9X 4HNTA 3NKLA 1TC2A 1DINA 4FXOA 2ZS7A 4IO0A 2NU9B 2ZB2A 1CUDA 2QW0X 3D2CA 4XCVA 2C5GA 1WPQA 1N57A 4KV7A 4YV1A 5J58A 1GLVA 3U7RA 4B5LA 3E70C 4KRGA 5K3FB 3AY0A 2RCNA 1YKFA 1WZEA 1GEEA 3M1IA 2ZXEA 2QTBA 1YQEA 4KQ9A 3PNKA 1I0IA 1O7JA 4UZEA 2IPAB 4R3WA 4M9RA 4BVAA 2A8YA 3T12A 4XVUA 2VHVA 2CNBA 2MYUA 4Y6GB 3SBDA 1ARZA 3A6HA 3QEJA 1ZMOA 1UBJS 2DGDA 1W35A 1FP7A 4XCXA 3Q98A 1SXIA 2WYHA 4MP8A 2Y1CA 3C3PA 2GASA 3HI4A 2I6FA 1M66A 2B6NA 4L95C 1YVEI 4UUQA 1ZJ5A 3Q88A 2JGMA 3TRJA 5LOVF 2FOXA 4P3YA 1KDVA 1LLDA 1F5NA 1PK9A 1UWVA 2DWQA 2RG7A 4ETIA 3DO5A 4P32A 1VLVA 5KTNA 1B6SA 1BYIA 2WD7A 2WYWA 3PB3A 4YTEA 3NI2A 4WJLA 2XLCA 5IAKA 1G3RA 4UXJA 2D5LA 3ND6A 1Z22A 2XECA 2GCOB 3NZEA 3RTDA 5EE3A 4UHBA 4A8PA 3REFA 1ZMTA 2RKWA 1UPXA 2PRKA 4RSRA 1WVGA 3I9NA 3QFCA 1CERA 2AD5A 2XZTA 1EB9A 2Z3ZA 3GI1A 1G2PA 1F8UA 2XA1A 3QNMA 2AFHB 2NSJA 3OX2A 3ZHUA 2GARA 2CL6X 1R3DA 2GBLA 2NSLA 2WUGA 4OHFA 3R8FA 1IB0A 5LSAA 1F8GA 2FVYA 2DFLA 2QDXA 3JX9A 5IAGA 4LKOA 5HILA 2G9VA 4C7XA 4XWKA 5TS2A 1PR2A 3C6QA 3ND5A 1Z0AA 1P2UA 1MC1A 1O96A 4IS2A 2QZJA 2R8BA 4ITRC 4LTMA 3WSVA 1R0YA 5B6IA 1L4UA 1M2OA 1WA5A 3KK0A 4OYRA 2ILTA 3L82B 4WDQA 3PTLA 4QTYA 5A4FS 5FX2A 1JNXX 4JOQA 4I9GA 4R7ZA 4TSFA 5IJ9B 5LQCA 2A9RA 3SM3A 2YCBA 4FIZA 5PGMA 3WLTA 4PN3A 4WCFC 2XWQA 4BCBA 4ZQIA 1JR4A 2PZ8A 1NXTA 4RUKA 1Z4PX 4IGFA 4RFLA 4P4UA 1WW2A 3QPWA 4INAA 2A2ZA 3LUGA 3S7ZA 4G1BA 2C88A 2LCFA 2BGLA 4R2LA 4YAIA 1GGNA 2H16A 3PR1A 1WU7A 3KUDA 1XNHA 1OIVA 3O38A 4H60A 4LXHA 4E2WA 4YPVA 5CDUA 2X2PA 4D0RA 1CQPA 3O31A 4OOFA 3A2MA 5FTWA 4IGKA 2IEGA 2I0FA 4ZVUA 3I01A 1SC6A 2B2CA 4O25A 3MWEA 2R2GA 3ANMA 1NYLA 1E6WA 3QMWA 4J1QA 3VI4B 1XD2A 3LQQA 3B2QA 4DNXA 5T41A 1NJ5A 4ARIA 1BVHA 4EHJA 1T13A 3LSYA 2WYUA 2SICE 3LYHA 5TT1A 3H3JA 5E4TA 1PNRA 4X61A 4E5MA 3FYCA 2EKLA 2PWZA 4XEHA 1M2NA 1FZTA 4K2AA 1II0A 4V1CI 1ZUHA 2JIMA 1YUMA 3E9QA 3PD1A 2J33A 3QMVA 2HNBA 4P4LA 2P4SA 4JBLA 1TNDA 5A3VA 5TQVA 5ADWA 3MIIA 3KT8A 1P4HA 1E2PA 2OWDA 4MYTA 1HI9A 3T0GA 1U81A 1NA5A 1YZLA 3WLKX 4E5UA 3TBHA 2HLHA 6GPBA 1ZU4A 4XDYA 2B3DA 2GZ1A 1Y6ZA 2VAVA 1NFRA 3NTLA 3K31A 2QLMA 2I1QA 3KXIA 1E1QD 3ZWNA 1RLMA 3K96A 4ZRMA 1WXWA 2XZPA 2FZKA 4YP5A 3ZW8A 3Q0EA 3Q3HA 5ALPA 4ZGWA 2R25B 2QL9A 3SYLA 2X6TA 1QP0A 2EU8A 2G8LA 2HWXA 2XXJA 5FI3A 1NNI1 3RUHA 4AS3A 4I7EA 2RH8A 3ESRA 5IANA 3T6KA 1UH5A 2QJTA 3EQ2A 4LOJA 3F5MA 5HVNA 4EKGA 4UAUA 1XRQA 3KJNA 1UDAA 3A1WA 3BORA 1TTTA 3UAXA 3GQVA 4W4TA 3NUQA 4MYUA 4LE0A 5C32A 1Q7RA 4O4LF 5A5DA 1CUBA 3PQFA 2YH2A 1W5TA 1VIMA 1TYEB 3QKSB 2HJHA 4K6KA 5HUHA 1M6VA 1X2EA 5FPSA 1RZ3A 1YQTA 2D62A 2QT1A 3VYSB 3EARA 2RB4A 4M0LA 2FUG6 1KSHA 3DGFC 2F3UA 1T9ZA 2BDTA 3EXHC 3EYWA 5DX0A 1S0UA 5DV9A 5K3DA 3O2QB 5EXPA 3RS8A 821PA 5KSYA 1TKRA 2ZVJA 3MTIA 3B13B 2F3PA 1B74A 3TW6A 1Y89A 3RYHA 4YQFA 1Y6JA 3U1VA 4C7MA 5T4BA 2R65A 1M8FA 3OZWA 1TJ5A 3RCBA 3ZGNA 2C2GA 1UZMA 2CHQA 4EY4A 1PNOA 5A4JA 3DMRA 1NY6A 3T41A 1BA2A 4F56A 1YS9A 2W4IA 3ZDDA 4QOHA 3NC1C 2AF3C 2EHDA 4BUCA 1DBWA 5BYBA 1KZ1A 4AM8A 1USWA 3JQQA 3OEHD 5ALJA 5G0WA 3JAMA 1A82A 3ZOZA 4DANA 4EO4A 4F8JA 1IM5A 1N2ZA 1J39A 1HORA 3G1WA 1EKXA 1LCIA 4MPJA 4WXYB 1J20A 1TVEA 2Z6QA 4Q05A 1KSJA 1H42A 1SWVA 4OLFA 4YAEA 1O6FA 4EG0A 3O8BA 3H2KA 1R8XA 1TRKA 3CZAA 1M0SA 4MUJA 3OX1A 1KO1A 3JQAB 1CVIA 3S44A 2D1YA 3ACCA 1DBSA 3DOEA 3UK7A 4CKEA 4EG6A 2QENA 3R3XA 2YQ4A 4ER7A 3CR7A 1TLFA 1CVLA 4NENB 3OP4A 5ALXA 5CXQA 2ZIUB 3GGGA 4GFDA 3OM8A 4L57A 5CIYA 2Z8ZA 2C1ZA 4LE2A 4KPGA 3TZ6A 7ADHA 5BOVA 2WJ6A 1R2QA 3EG9B 4FW8A 1CKEA 8ABPA 4OJTA 5IT0A 1XLUA 2BBTA 4XB6B 1JF8A 4DR5B 3C3MA 4FD3A 4X3OA 3B70A 4ROSA 4MA4A 5G0SA 4MAMA 2QRZA 1GTRA 2IOFA 1T9BA 3K7EA 5LQSA 1EUQA 4A1OA 3TE6A 3WL6A 2R5WA 5SV2A 4KPUA 2EP7A 1WUHS 4MVJE 4PICA 3VR6A 3L1HA 3MYYA 4D99A 3VHRA 3GJ8A 1ZJYA 1R8QA 2PIDA 4REQB 4Z0PA 4DV4B 1GEGA 1Q74A 3FMVA 3KSUA 4CKBB 3E84A 4MDFA 1HYQA 4X6XA 3GG2A 4G4JA 1D0IA 5U9CA 4RIHA 1J2UA 1EK2A 4PLZA 5H9VA 1MU0A 1S01A 1XTRA 1XQ6A 3ETJA 3FUCA 3HDYA 4TTRA 3ZNQA 5AM2A 5JJKA 4QPNA 2I2CA 1MW8X 1S3FA 2CFIA 4COOA 1ZGCA 3DDNA 1NJGA 1PSWA 2EBUA 4RV9A 1ZSNA 3FHLA 4GI5A 4EMSA 1OKKA 2L2QA 3S1SA 1Y1TA 1GV0A 3H5LA 4R3UC 4WVLA 5GONF 4DPKA 5CH5A 1DQSA 2XSZD 4WXMA 5CT8A 4CM1A 1JEAA 2I71A 3USES 1GGJA 4GKBA 4JI6B 3UWDA 4BEWA 4YLYA 2GWRA 2P0YA 1OLOA 3O6VA 1XAHA 3BJZA 4L0QA 2MMCA 2UVQA 2CSXA 4E7PA 3CPSA 1NSTA 5DI3B 1SKQA 2CMGA 1K5DA 1ZU5A 4EJ0A 1ZMBA 1A9TA 3DQZA 3TRIA 3COJA 2BSQA 3WNZA 1L7AA 4H0FA 3QU5A 4Q37A 2HB6A 3WQSB 4DLLA 1PGOA 3MWJA 2CYBA 1GZVA 4NFLA 3KB8A 1SA0B 4I1UA 2PMBA 3GWGA 1V11B 2FX2A 2IVFA 2ZANA 2VP5A 3JRNA 4N3BA 4O63O 4KRYA 4RMHA 1G18A 1PLKA 4YJDA 4K9LA 3VTAA 1GQOA 4C6RA 4G5HA 1M2JA 2OENG 4OGWA 1NV8A 3K0HA 3SZRA 3VC7A 4C88A 2O2XA 2XKJE 1KYXA 2EF1A 2E3JA 3PJDA 5AIAA 2O8DA 5LCXA 1WS6A 3N8IA 4HZUA 1Q14A 5HZHA 1MOSA 3IO5A 1Q16A 2QAGC 2OHIA 2X5JO 3BHJA 4N7RA 1YK1A 2BGTA 5AM5A 3QENA 5THKA 3UAZA 2HK8A 4E12A 2O2IA 1KKUA 4LYHA 5K0NA 2CL5A 3GY0A 4ZJPA 3FY4A 4YK7A 3WWPA 1T0BA 4RKYA 3QXJA 2LDXA 1REQB 1ZZEA 1IM8A 2GZDA 3I9KA 4AKEA 4E5NA 1V26A 3O8CA 1L5WA 4OSEA 5HCIA 3D6HA 2VDWA 3I6ZA 1IN8A 3GPDG 1NBAA 3COPA 4JXJA 1UXKA 3JYPA 3DWGA 2G9NA 3EFBA 1JV2B 1N6RA 3DMGA 5CDTA 4P0PB 3HM2A 1DQPA 1MAUA 4M7OA 3LPCA 1RM5A 1T0IA 1S2OA 3EZLA 2V3WA 4P2BA 1BDBA 3WLSA 3ZHTA 3ZTTA 3VNUA 4Q3AA 4QQ8A 5H4HA 1L5GB 4B2YA 3TSYA 1ULAA 4RTPA 1RHQA 2R6JA 3KQVA 1SWWA 4M49A 1QB8A 1GNSA 3LO8A 2I76A 4IF4A 4UTOA 2J32A 2AYZA 3I5AA 2JHAA 5EJ6A 2Q9CA 2XWSA 4W8OA 3INNA 5DGHA 1HLGA 2P3SA 2JH9A 1XTPA 4DJDC 3AG5A 1OFTA 2PR7A 3CLSC 4A2QA 1T3ZA 1I5EA 3L4EA 4BIMA 5L4LA 1I2BA 2YHSA 3L5OA 3KKMA 3O1IC 4QIHA 3BXEA 3VSBA 2NTEA 1RJDA 2Q21A 4KFRA 4ZVLA 4WBNB 1G6KA 1R3UA 3GLUA 3KUCA 4FQ8A 4US0R 1YGPA 1EVLA 4R9RA 1YBAA 3F1LA 1X1DA 3UAOA 1L4LA 2VLBA 3NC0C 2NV6A 2XVYA 1ZKMA 4LC0A 1OTHA 4MO2A 3N2IA 2NU8B 2XA2A 3ZNOA 1M34B 4N12A 4PN7A 1T2FA 3V9PA 1RWOA 4N03A 1QXSA 1TZBA 1GCUA 3NTOA 3WHLA 1Z5GA 2WUFA 3H7IA 3RV3A 4IX1A 5AVSA 2D7DA 2IYTA 3I53A 4JHLA 1E3QA 1RM0A 2PKEA 3ULKA 1JR3D 3SQOA 1OILA 1YOVA 3V8PA 3VR2A 2AA3A 3L6DA 4RK4A 4OJMX 2JJ1A 1ESCA 1ZOOA 2GD0A 4DHWA 2R87A 5CDHA 1ZL2A 4KO2S 3W9UA 4ALNA 1T5BA 1EDZA 3TW8A 2FKAA 2IXAA 3PDIB 3W2FA 4KZKA 3WYBA 5BWMA 5IYZB 3CVVA 2GNAA 3CX7A 4MUEA 4XJSA 2RHMA 4MVCA 4FFMA 4RX1A 1JLMA 3TD6A 5A04A 5ALHA 1YCDA 1XJ5A 4US1R 5CBKA 4AVYA 3CH5A 4KWTA 4HWKA 4WTOA 3ZHXA 3AKZA 1B16A 1X9IA 2ZAIA 4DRXA 1FFDA 3OOEA 4ZVNA 2V7QD 3A2NA 4IDHA 3DV2A 4KE7A 2PT9A 3M7IA 3UG7A 4C5CA 1DKLA 5F1YA 5ICCA 4EO7A 4E2FA 1SOVA 3L9WA 3R44A 5EC8A 3AF2A 3RVRA 1C7ZA 2GPJA 4OEHA 1GPAA 1Y3BE 2WWXA 1Y8RB 2Q6TA 4G2NA 5AYVA 3TEMA 3VAAA 2DJIA 4PPYA 1F1BA 4GBGA 3U3DA 3BS4A 4ZKEA 4CHTA 1P62B 5KX5F 4GOKA 3I37X 1BCRB 2W5UA 5C1PA 4R01A 5HCNA 4D57A 3TD9A 1FYXA 5K6AC 2PE5A 3LQYA 1Y8CA 2Z9CA 4JKOA 5BNFA 3TKYA 1H0HA 1N2EA 5CK4A 5LQJA 4ZAZA 2OHHA 3B6IA 4BP3A 4A2WA 5JS8A 2JNWA 3A7EA 4PW0A 2OMKA 3GH3A 5JXHA 3VQTA 1F9AA 1QVZA 2W83A 1A97A 3BUSA 5EE1A 2BBWA 3MQFA 2PUVA 2J30A 2A0YA 4TKMA 5CLHA 2W9XA 1J00A 3TLGB 1VG8A 1MC4A 2ZBUA 1CQWA 3GLHA 3FW1A 4UNSA 1NRXA 5CFNA 3ME5A 3D4BA 1ZRNA 5A0FA 1YA4A 4RXTA 2XI4A 1K86A 4D9BA 3IXMA 2NU9A 4R84A 1TT5B 3MFYA 1PJRA 3DMHA 2VPIA 2ZSEA 4WWHA 4A7PA 2AOVA 2B8JA 2CCJA 2PWPA 3IUYA 3QMPA 3R4VA 4UVHA 1SXJB 3ZZNA 4EUNA 5JAOA 1PL8A 1YU6A 2WWIA 2IZ5A 1ZIDA 3GUZA 4RSMA 3Q8KA 4P3PA 5K3FA 2GPAA 4ENSA 2XIJA 4JBIA 1MVLA 1B14A 3WJ7A 3G9TA 4HQ0A 4Q3BA 4D9JA 1W85B 2IELA 2Y92A 1N2IA 1A8HA 1NBOA 4G81A 4ER3A 4U7HA 2LTAA 1P44A 2GCNA 3ABIA 1YQQA 4H7DA 3VH1A 4HQNA 4IOLA 4XIIA 3D6TB 1AMNA 2Y1WA 1PJ3A 5TV2A 4BFCA 2PWBA 4D7AA 4ENRA 5JALA 1BDIA 2OVFA 2P9BA 3PKJA 1R9GA 4KRXA 4MMXB 1PBNA 1U9IA 1O57A 1V5WA 4JP3A 5L45A 4LHSA 1QIFA 1HLFA 4MQUA 4I4TB 2Y4OA 1EWVA 4PU0A 4KNWA 2KBEA 3IAEA 1UOOA 4TUYF 1MT0A 4H7FA 4KO8A 4COKA 2BAGA 2F59A 2UUOA 1N9KA 1KFBB 3IGFA 4PQRA 1M67A 2FP4B 3CT6A 4B44A 2GCOA 3AO0B 3HUFA 2DSNA 4KC0A 3VHXB 1RZRA 2UU9B 3BTOA 3QVGB 1RWQA 2VRBA 1U7WA 2NZXA 4NEHB 5MN5A 4BNIA 1Q57A 1ZUIA 3N2NA 4G23A 2V7TA 2AFHA 1GFIA 1HYBA 1NSYA 4E5VA 3JWHA 4FLEA 1ODIA 4I1IA 2H06A 4FKBA 4BO4A 4MUGA 4TWRA 2RGNA 1E1MA 4ETWA 3ZY5A 3LC2O 1FFAA 3OJEA 5D85A 3WLQA 2A92A 3ZE8A 5KNDD 2GZAA 1ZCAA 5T8KC 4AMGA 3UGJA 2CF6A 1BHQ1 3HP1A 5IN4A 3PPXA 4CMKA 5IJ9A 3FFAA 3A6PC 5CLJA 4PLFA 1QVVA 1BX0A 1MX9A 3VPGA 3WBBA 1LC0A 4B82A 1FDSA 4HNVA 4ZZIA 2H4YA 4FDUA 4PYMA 4RZSA 5TDHA 2VATA 4KWCA 2BP7B 3CIOA 5JSKA 4BLTA 2ZI9A 1H23A 3VZDA 4ZDJA 4AZVA 2FMIA 1DC4A 5KHOC 4XSVA 4RHFA 1CUSA 3H9EO 1T1JA 1R4NB 4F2HA 3ER8A 4YRDA 4LHXA 5I4IA 3O7MA 1K0FA 3AQ4A 2M1XA 1NUTA 2K87A 4WVFA 4JI0B 2I4OA 1Y34E 3W5IA 3FPJA 1IVYA 3HR7A 3O83A 1TAUA 2I4MA 3ZXSA 5C7IO 1UZLA 1YDFA 3KOOA 5HCUA 3P0IA 4U7GA 1RQLA 2O1SA 3K71B 2HWYA 1WUTA 4DCUA 1T26A 2REQB 1XMOB 1MAWA 4P33A 3EEYA 2XDQB 2W90A 2AC7A 2O4UX 2VA9A 5ADHA 1P39A 3TLCA 1DO8A 1RXIA 3OE7D 1VL0A 4QDKA 2PYZA 3K1AB 1SUIA 3EY9A 2HTFA 4IUDS 4GXQA 1EWTA 3I2JA 3QKRB 2GN2A 2FTKE 4MXDA 4JVOA 4DKJA 4O2BF 2H9AA 4M3NA 3AF5A 4Q39A 3WLAA 3OCJA 2FN3A 3TYXA 1PHRA 3PRHA 5E4YA 4HUJA 3HBFA 1R6DA 3QG5A 5GQSA 4C6TB 3H2ZA 3VJMA 1E0AA 1KEWA 3WKEA 3G9QA 3NHRA 2NQ2C 3KWMA 1IHPA 4PYQA 5JG7A 4B4UA 2WU8A 4U1RA 5D87A 2Y0PA 4ZICA 2CJXA 2H1IA 1G7CA 2H2WA 5SY6A 4ZQGA 2NP7A 3VR4D 1IRXA 1PUIA 2YY7A 3ISTA 1FNCA 1ZA2A 2P2DA 5H82A 5EXEA 4PZZA 4RJIA 3WXBA 1PFQA 1R27A 3BZUA 1BVYF 1U8UA 3FCYA 1ATIA 1MD9A 3CNBA 1OJ7A 3M9LA 3EXIB 1YZNA 4EABA 1Q0SA 4BTEA 4X6UA 1ZHOA 3L1UA 1JL3A 3COZA 1UT6A 5FKJA 4DBLE 1JE0A 2FSFA 2RKOA 1O2DA 3QKSA 1VQ1A 4WCFB 1VPLA 4NBVA 3V32A 5KYGA 3VKHA 3O0DA 1WBDA 4UU7A 1G21B 4WFIA 1CRLA 1OYWA 3CWQA 1FXUA 4IZHA 1TZKA 2GZRA 2O0LA 4G8DA 4J7CA 5FOXA 3UICA 3R7WB 2JJMA 2ERYA 2F00A 3PFHA 4RV5A 2RHJA 4DV2B 4X7RA 4MVJD 2QX6A 4A91A 4LYYA 4XVCA 1M9NA 2HX1A 1P7VA 3V8EA 3R5JA 3F47A 1LV8A 1A4IA 1E63A 3EDQA 4JT8A 1G16A 2JLSA 4NCAA 1NVUQ 4JZYA 5CD9A 1GZDA 1PKXA 2YRXA 3P0FA 1VA5A 3KXDA 3DCJA 3FPCA 2FQXA 3DZKA 4W9NA 2BFNA 5CLGA 3GQBB 1OYVA 2BLLA 2DU8A 1FC0A 2R00C 3BWXA 3O8DA 1M83A 2O7QA 3TQSA 1C7RA 2ZP1A 2BKXA 3E81A 1JG3A 1TUEA 2ZK7A 1EVZA 4F6LA 2C3OA 5SY4A 3KVYA 5KCZA 4QQFA 3I5UA 1Y63A 3VDNB 4RZ2A 3LF2A 1JJVA 5EG5A 3JQAA 1SELA 2E6UX 2XEDA 2WIAA 4GR5A 2QAJA 3RVNA 3NRBA 1Z6PA 2BHRA 2DKNA 3HU5A 4I5EA 4QGBA 4DPMA 2EATA 3Q9LA 1FF9A 3AIKA 3HJBA 3I9V1 3IKJA 4L8LA 3WX0A 4NSNA 1HDYA 1T6XA 1P0MA 3EG9A 2ZT6A 3FFTA 4LMBA 2FG5A 2QPOA 3GRAA 1QRSA 4IIGA 1NT4A 3KQQA 4M37A 1BQ4A 1SCQA 1DUSA 4QJ5A 3WKDA 5C80A 2PKYX 1H4TA 4YAOA 2Z1MA 2DHEA 4FT4A 4MV4A 1JLHA 3M6MD 4ON9A 5CR9A 3SZMA 2INGX 4BFSA 2TMYA 2G77B 4JLVA 1KRXA 4KFCA 4P22A 2GR9A 5E38A 1KYWA 5DPMA 2ZULA 4QFCA 2Q5IA 3AHCA 2ZRDA 3EIQA 4HNGA 2CFRA 5AQEA 4H08A 4LZAA 2PJDA 3SAJA 4REQA 3HXKA 1NF9A 4I9HA 4DQKA 2JATA 4GIBA 4CKBA 4F9GA 1F38A 1GUBA 1YI8A 4JUCA 1T6BY 1GGMA 1ZCJA 1JVBA 4QTTB 1KY5A 2UZ3A 2XWJI 1AXGA 2NN3C 3JQDA 1Z7YA 3EQ8A 5FOTA 2MYNA 4H6XA 1CW2B 4BMNA 1AZLA 1X8KA 5EHGA 4AF7A 1CUZA 1CEXA 1I3LA 4KBYA 4HO1X 4GWLA 3VR3D 3KVNA 4A2PA 2O20A 4DIFA 2R8XA 3I39X 3EC2A 4IDNA 1EVKA 3HCRA 3LWBA 5K4AA 5IEJA 1G3IA 3BE8A 2BKVA 4OG2A 2ZI7A 3UJNA 4L8GA 2PJRA 2FUKA 2VHEA 3BCRA 4RF4A 8LDHA 3GYBA 1A3CA 4D80A 4WFKA 2PMEA 3CISA 3GEDA 4A15A 2P4UA 3IMEA 5KHAA 3JWEA 3CFYA 1CEQA 3GNQA 4FI3C 4V2UA 4Y6PA 5DI3A 1KAHA 4KITB 1Y5RA 3AC0A 1U8CB 2E4XA 2BFFB 1ZO8A 2P35A 3NHLA 3L2OB 1WB5A 1T29A 2XF2A 4JQCA 1O5OA 2ZFUA 3EIEA 4PCAA 4YCCA 3BWDD 2OAGA 1NATA 3AFIA 1Z9BA 4DC0A 4GI3A 2ZS8A 1GGHA 3FWPA 1W73A 1BE6A 1NYQA 1SA0A 2ZRQA 2ADMA 3DWEX 3IUEA 2HSGA 4X8MA 1DDIA 1V11A 2HSZA 4XZ3A 1DJMA 1HE4A 2G71A 3IUMA 1R5JA 2ETVA 4N0PA 2IEYA 2Q7DA 1KS2A 2FZEA 3OU7A 5BSVA 1V8ZA 4HDSB 4RGQA 2CBZA 4F8EA 4ZCMA 1ZGAA 1R18A 3UT0A 3WHIA 1VP3A 3TJRA 4FZ3A 4NV3A 4TYYA 2QP4A 1RBMA 3C6BA 5EJ5A 1L7QA 1HDCA 2HO4A 2Z3VA 2NNLD 3H42B 3GRKA 4L15A 5D01A 4AIIA 1YE3A 2A86A 4OGLA 2QX4A 3I9JA 3Q40A 4C4SA 4ZHQB 4HXYA 2C0QA 2AG0A 2QROA 4BEBA 4CGZA 4KKXB 3KUUA 2H1VA 5ALGA 4PAWA 1E4EB 5K03A 3DEHA 2QZPA 4L50A 3W5CA 1RP1A 5KQGA 521PA 1G8FA 2WE7A 1P61B 4PYJA 4QT4A 4GLOA 3ZD7A 1Y1RA 1REQA 4I8DA 2HJVA 5JMWA 1QNLA 2I2FA 1A7UA 1FQJA 1GDDA 1RKQA 1QFSA 2FSHA 3JAKB 1UQTA 2VYVD 1NE7A 1TQ4A 2PPLA 2P5SA 5I3ZA 3M6XA 3G23A 3FPFA 3D8SA 4S12A 4UE3S 3N86A 4AT1A 3RC7A 1HH4A 2JVIA 4KNVA 3TUZC 2ZCVA 3FSEA 3N0XA 1VI5A 1TD9A 1YR9A 1GPBA 4LTDA 4HLNA 2WW8A 2VK2A 1B8OA 2HPVA 4QFBA 4TMFA 4CL8A 1PVDA 1I14A 2DJ5A 4RFVA 1RRCA 1L5HB 1ORTA 4JLWA 1WXDA 4X3PA 2F6RA 1YA8A 2JGLA 2VBIA 3QY0A 4O0MA 4Q7MB 5FOQA 3BFJA 1WUKS 2HQSA 4Z7OB 3IJEB 3V46A 5T67A 2WICA 2WTEA 1BCSB 1YHNA 4WGFA 4CLXA 3PQEA 4KQMA 4TS4A 4DCTA 5A4DA 2QBYB 2FEAA 1K2WA 2Y27A 3H1PA 3ROMA 2DPLA 2IT1A 2WWGA 2ZIWB 5FPTA 4L1KA 4DUZB 2BN4A 4LOLA 5HBGA 4WBNA 3CX4A 4POAA 1R6AA 3GLKA 4QM6A 2KLHA 1TUBB 3IRUA 2V7GA 3L46A 3WO0A 1ZUNB 3A3NA 3LZCA 4L51A 1NOJA 3W2GA 1RMQA 1W9HA 1S8FA 4KCGA 1EBUA 1ZYUA 3L0DA 2NU8A 1CNFA 1ZNZA 2NZJA 4J0FA 4Z86A 1M34A 4UREA 3OZCA 4BGVA 3RIGA 1XCGB 2O7SA 2J3KA 2ZYGA 1DFHA 2PSJA 3GFBA 3PHIA 3AY6A 3H8VA 1XMQB 4U7TB 4I99A 2FX5A 3AVOA 2QNIA 1EFRD 1H8HA 1W0KD 2CWWA 3L7MA 2EG9A 3FWYA 2P9JA 3HCOA 3N8GA 3R5FA 1P5JA 4OO3A 1S89A 2X58A 3CMCO 3SM9A 1WDMA 3ZCQA 5CD1A 3FTCA 2QAGB 1MKYA 2FN9A 4OFWA 5LA6B 1NXOA 2C4KA 1ZK3A 2W6MA 5IKXA 3PDIA 5IYZA 1OXUA 4PYIA 4HYYA 4I6JA 3ZDEA 2IKSA 2YS6A 3JSAA 4JC0A 3SBOA 1BVRA 1BFKA 2EGHA 1NQAO 2P2SA 3QPUA 4L6IA 3R9IA 4BQFA 2UZ4A 1KI8A 3OQMA 2BFAA 2PCJA 1QPBA 5EQTA 5IAOA 1XMXA 3LYLA 4DMUB 3K32A 1RBYA 1W8DA 3EIFA 2FFRA 3Q3IA 4G67A 1ELOA 1XWFA 5AUOB 1Y5LA 1AMUA 2VT3A 2PWYA 4PO3X 4WNYA 3DAHA 3DLCA 4LSGA 1Y8QB 2ZUDA 3OQIB 1UEIA 1RLOA 2RDMA 3O47A 2A57A 2V7BA 3OTHA 4J3FA 1Y8RA 1NQUA 4H3KB 4PC1A 5AJZA 3QXHA 5JCJD 1V9LA 3DKRA 4O4JB 2Z8YM 1Z68A 2ZXFA 4HQRA 1E1YA 1BCRA 3K2EA 4U2DA 3VNQA 3ZN2A 2I6UA 5L9AA 4KIJA 1Y1SA 1MP0A 3U5TA 1GYRA 3H86A 4DR3B 1QIDA 3J7AC 2PAAA 4OLJA 1VRCA 4RPHA 2ET6A 3EF0A 4FHGA 4BFTA 3HM9A 1JJFA 1IBSA 3P7MA 4FCVA 4EZEA 1RC8A 4QUAA 3WLOA 3W3AH 1G0OA 1G20B 2A3RA 5F7OA 2VJNA 3H99A 2KQUA 2OC9A 3HY3A 1IZ9A 1XJCA 1CBUA 3Q7EA 4FXPA 3TLGA 4AICA 1U9JA 5KJ1A 1B43A 2DWUA 5IUKC 1IC6A 2PAFA 2Z9BA 2VSYA 1S2NA 5HS6A 2P62A 4EUFA 3GLRA 1QM5A 1QB7A 3LDAA 5ICEA 3RU3A 2YN4A 1E3SA 3TVTA 4I1RA 1JHVA 1O0SA 2J59A 1NMYA 2X41A 3HLTA 3OT1B 5B1SA 1TT5A 4BFVA 2HMVA 1OGIA 4C2TA 1U7HA 3CCBA 3DE7X 3LAWA 2GAOA 2CFCA 2J08A 3GOQA 3X3HA 1SXJA 1ESEA 4ENQA 1BTOA 5DX1A 5K6RA 3I3OA 2YIDA 4WKCA 2DT5A 2H2HA 1V5IA 4JEMA 3VO8A 4Z6KA 4LK3A 2B0CA 3RH0A 1ID8A 4BKMA 1ZD4A 1W85A 2ZWMA 4KSCA 2XHZA 1N7GA 5DASA 1GAJA 5EUQB 5L4NA 5L3QB 1YB6A 1N2CE 2XQJA 2B5OA 3U4IA 4GUDA 1YDWA 3COVA 4MWEA 1G8PA 2BH9A 1DCMA 1OVGA 1UBHS 4JGBA 3LKZA 4YAGA 3EWAA 1JPUA 3AFNA 4KUEA 4NARA 5B58T 4Z0TA 3S2FA 1R6TA 2DFTA 2ADOA 3B20A 3A3OA 3MS7A 3OA0A 4YMUA 4I4TA 4YY3B 1ZNWA 1PAUA 1SRRA 2GETA 3FDIA 3HN7A 4GWGA 3EIWA 4O8ZA 3UMSA 3U1BA 4DDUA 4F4JA 4LQCA 3HHEA 3TFQA 1B2RA 5DSXA 4BB5A 2CBGA 4Z4IA 3PPVA 3KPJA 2AQKA 2FP4A 4HRAA 3T3PB 4PQGA 1C1XB 4IQ4A 4FFNA 3VHXA 1JTVA 3BFVA 3A37A 3H19A 3PUIA 2HO5A 3QVGA 4I19A 4J2TA 4LJKA 2C82A 2A0KA 2AV6A 3H9BA 2O23A 3IP1A 1JDJA 1GCIA 4L8WB 5KTMA 4IFBA 1E5VA 4G8CA 4U2FA 2RH9B 2VQ3A 2VP6A 3K72B 4MQ4A 5EIBC 3P9RA 4AYXA 1IYZA 4C5AA 2AL7A 3CEAA 3DW1X 1XZHA 1FTQA 3OCVA 1B6TA 1P4JA 1XZQA 2QM3A 3OMXA 4MITA 4UZFA 2I34A 4PS0A 4B84A 5AXBA 4TZ0A 5AM1A 5DT9A 3W1WA 2WJWA 3WA7A 2Q8QA 1TZJA 3F1KA 4OBBA 5FLKA 4LBYA 4ZVMA 4B2PA 1RHUA 3OCYA 4Q4DA 2GK7A 4ZI7B 1C5KA 1WCIB 2VKTA 5ABPA 4ERXA 4G0NA 1DIRA 5TR9A 1GG9A 4JI1B 5J2TF 4I08A 4OAOA 2ZLBA 3T1TA 5CDSA 4GZ5A 2ZRLA 2BP7A 2CYAA 1NN3A 2G4CA 3GBSA 4TQ9A 5LYYA 3G8YA 2RONA 2UZIR 2B7CA 2W8ZA 3AESB 3CE9A 4MAFA 1DSSG 5C4GB 2PH1A 2JCBA 1R4NA 4C21A 1UOQA 5B57C 3KB1A 3DPUA 2JAUA 1HETA 2PKRA 2F1KA 3KB6A 1XMPA 4C06A 1ZD3A 3PNPA 5GGXA 4I66A 3B6ZA 1P6UA 3K9LA 4AMVA 4AN1A 4BJ5A 1SRQA 3MGAA 4J9UE 5HNKA 4XWGA 2ACWA 3VNBA 2ZYDA 2G83A 1L7RA 1NT2A 2P91A 1N3BA 5H81A 4EYOA 1T2VA 2REQA 3BIFA 3WL8A 2VK4A 1ZM9A 2XDQA 3L0OA 3RLIA 2NUTB 1GVHA 2I3ZA 1QCYA 2Y6UA 4KXQA 3VNAA 4A6PA 5JI3E 4G1FA 3GROA 5EZSA 1PW7A 4CFZA 2XOKD 1EVJA 1XTUA 3FTQA 1T36B 3K1AA 4UCWA 1SH7A 4HL6A 2HLPA 4Y2SA 3RYIB 4DBZA 5B3KA 2I7DA 5F7ZA 5I01A 3QKRA 4QNNA 1UKVY 1RYEA 1GTSA 2EW1A 5F3WB 2NVOA 3SNHA 4K9SA 2EJBA 1MAAA 4XQEA 2BGKA 1RWVA 3MTEA 4C6TA 2VQDA 3DLBA 1XG5A 2BKUA 3DF7A 4FR5A 1W4CA 3L8HA 3JXEA 1OIXA 4YJ3F 2IV2X 1Q0RA 3QEAZ 2Y1GA 1M8JA 4X7BA 5IDWA 2FHPA 4K0KB 1NX6A 2Y0BA 3R7LA 1EX9A 4E03A 1QQTA 1AGYA 4WECA 3G5AA 5E6SB 1V8PA 3F71A 1SHTX 2J3MA 2O8CB 1IQUA 3G02A 5DU2A 4AF8A 3LCRA 2PO7A 2ZAOA 1BRTA 4WI1A 1UIMA 3CSSA 1WOYA 3D31A 2WNHA 4GD3Q 2VJYA 4P9NA 5FBKA 4ZTZB 4WUVA 3NDRA 3EXIA 1G4AE 1QHYA 3MRTA 1NN5A 2QNBA 4YJFB 3I8OA 3TPZA 4X62B 2G7MC 1S4QA 4N3AA 5CTAA 3SLRA 1PD1A 3NNDA 4WCFA 4EB8A 2XWBF 4CM9D 2BDEA 3UCXA 4IL5A 1G21A 2ZBDA 1L7DA 4DUPA 3C14C 2WZCA 3LDGA 2W6JA 2XA9A 3F46A 4PRZA 1NUSA 1NOKA 1EM8B 4MUNA 5AVVA 2PZEA 2C29D 3SN6A 1LI4A 1Y5IA 3R7WA 4DCJA 4YRIA 1KZ6A 3KLNA 3G6WA 2X8LA 2P65A 1VG1A 4EGQA 5ULLA 1F48A 2QB5A 4MEAA 3KETA 1H8ED 3CN7A 3D7LA 5BSHA 1SG0A 2D4HA 5JJCA 3D54D 3SC4A 2JIZA 3R3ZA 2DUNA 2C4TA 4JBYA 3UW1A 4AY5A 3ICWA 4HGPA 3K9GA 1KEVA 3QE4A 4IOMA 3GQBA 3NHBA 4KO4S 4A6XA 4U63A 3IR5A 2ZETA 4J94A 1KSFX 4MRNA 3ICCA 1VCMA 3ENVA 3OZTA 4FYXA 2OCLA 3FVVA 3HL0A 3LDHA 2JJ2D 2WPDD 4AZTA 4CHGA 3RC1A 3ORRA 3VOTA 4MTLA 3DW3X 4MR8B 5I9MA 4BNFA 2I9PA 3P9XA 4R1MA 1P1JA 2C84A 1G3MA 2GBGA 3C97A 5C4MA 2QKYA 1RKXA 2ZRHA 3IODA 3IULA 3L7LA 3BSSA 3W7AA 3CZMA 3HBAA 3LNCA 3D2LA 4G0UA 1AE1A 1WZ2A 4JQYA 2CLFB 3VR5A 3V7UA 3F4BA 4PZ0A 4IBOA 4TTAA 4HNUA 4XR9A 1P8JA 4HB0A 1JDZA 2MSWA 1N75A 4GMFA 3DM9B 5IHXA 3QFFA 1GVNB 1MDBA 1RWPA 5FLEX 2CY0A 3RSOA 3GLIB 2DUUA 3A7DA 3W5JA 4GI1A 3EGDB 3M5DA 3Q3EA 2XUOA 1Z2PX 1ID1A 1TA9A 3Q87B 2YICA 1H5QA 2BDUA 1CJVC 1DB3A 3QV1A 1II8B 4ZAXA 1PFKA 2AGVA 2A58A 2H0AA 2HR1A 3MLAA 4MUKA 2BI7A 4Y6QA 4JJ8A 2O8BB 4MUIA 4EFNA 4X95A 5KPDA 1BGVA 1KJ9A 3ESAA 4YX9A 4Q03A 1HKHA 3KR9A 4B74A 4IIJB 4EZIA 1AZSC 3II6X 2OBXA 3LA8A 1QTNA 1D5CA 1USKA 2HEIA 4EKNB 3NHYA 1IL0A 1DUVG 2A67A 2JI4A 3LC1O 4U9IS 3RFFA 5AVXA 3OQ6A 3F8TA 4ZYYA 2JARA 1OAOC 3K9NA 4GO1A 3E8MA 4Z0NA 5DMXA 1OI2A 4ZEWA 2IK8A 2VDOB 3TLYA 2CD7A 5JSZB 2CLHB 4AKHA 2J5XA 1CQZA 5AKYA 4RS4A 4CMGA 3BGOS 4PBSA 4OFZA 4FOLA 1KIMA 3NUZA 4YN3A 3UANA 1KYYA 3OAAD 2JLRA 4XGQA 3FPHA 1VYHA 3IBTA 1U6IA 4B8WA 1W8IA 4JP1A 5IASA 3TAUA 2V65A 2BFFA 1IY9A 4FYVA 1M0EA 3ER9A 5KJFA 2YWFA 4L3VA 4ARZB 5DEIA 2J45A 3MMXA 1FPQA 1JP7A 4RIIA 4B31A 4HK4A 1U98A 3ENQA 4IINA 4AXBA 4OLHA 1E3JA 2ODBA 1XKTA 4HDNB 5BSWA 1OBOA 5K0LA 4EHNA 5AK5A 4ASUD 2H4JA 4Z3OA 1M1YE 4HDSA 4J1TC 2H7VA 3I58A 1J23A 2PZJA 1VGQA 3IURA 1SVIA 4X60A 4PIPA 2F8LA 2QW1A 4Z9FA 6NULA 3AOGA 5HYVA 3AHIA 3KOUA 4HI0E 4PYOA 3ZIAD 3NWJA 2JGJA 3N2KB 4ZHQA 3M6LA 1K6JA 2QS9A 5FV4A 3PQ5A 2CVZA 3IP9A 1NXWA 5K3BA 2A9JA 1K7CA 2V1XA 1MJFA 3SX4A 2FSSA 2P7IA 4FR0A 1QVRA 1WXEA 3ZE1B 3EZ2A 4JMPA 1H2EA 1DWUA 1QHGA 4FGZA 2Z3WA 2RMKA 4G0OA 3T0IA 2WY2D 4XDHA 3JAKA 5G41A 4YRCA 4E11A 1VHDA 1SB9A 4LK2A 1C3LA 3B7WA 2RHHA 5CITA 3I09A 3FH0A 2C9YA 4KH0A 5CEEA 4P92A 2YJ6A 3QEOA 3DO8A 4LC9A 2H11A 4QEZA 4OQFA 2W11A 2B37A 1F5SA 5AVZA 1PR5A 2ZE8A 2W00A 4BYGA 1DELA 5K7SA 1PQWA 4GX5A 4N18A 4BJHB 2QAIA 4J0JA 1L5HA 1KEZA 4DLNA 3AVWA 2D0OB 1O6CA 1NP6A 1RLIA 2CZCA 3WSWA 4BFZA 4O33A 5KYYB 4F96A 1POWA 1S5PA 1UQUA 4L5YA 1PLJA 5IT4A 3FCXA 4OF4A 1TEVA 1VE9A 4MKZA 2GF9A 1H3FA 3KNZA 2IWRA 1BCSA 2QBYA 2OECA 3FYDA 1U2DC 1PHPA 3R20A 4J4HA 1O94C 1Q3KA 4L9SA 2J4DA 2P41A 4W82A 2I99A 1DC7A 2V7UA 3GFVA 5DBOA 3EA0A 1LBEA 1U1FA 3O3OB 4A5OA 1C9DB 1NVKA 1TUBA 3VSDA 1ZUNA 3GEGA 3D5TA 3E3LA 4GSYA 4N1AA 3OWOA 1A2KC 4WK4B 2VF2A 2DXIA 2FVXA 3M83A 4PSUA 2PEZA 3V1UA 2PZLA 3FDXA 5KTOA 2X2EA 1K7EB 6CHYA 5AI0A 1CRPA 5I3CA 3TLZA 5HRAA 1IB6A 2OPBA 4PNHA 1SC9A 5JUWA 2YWXA 2H00A 2OZVA 1HUQA 2X8WA 3WKAA 4E14A 1W29A 2NV2B 3C4JA 5A3JA 2VZLA 2PKWA 2EQBA 2BEVB 2HBYA 1I24A 3AP1A 5EKSA 1UAGA 4YXWA 2QLJA 3VHQA 5JHGB 1SY7A 1WB9A 1NM5C 1WXGA 3KQLA 4WOCA 4XASA 4BBJA 2YHBA 1XTBA 5BN4B 3CSDA 3F9RA 3OOWA 3OTIA 5BW6B 1IUKA 4QXRA 3KWLA 2QAGA 4EUHA 2VHWA 4BV2A 3PE4A 4K6OA 4MVJP 5CHYA 4EWLA 1Q7GA 5LA6A 2ZRIA 1BN7A 4Y0VA 1KSGA 3DAOA 1FU7A 1KJIA 3O8OB 4FE4A 1XROA 3RS9A 3D4LA 3JD0A 3TPCA 1LFDB 1YZ3A 3THSA 1FQKA 2JAQA 3KVVA 1BKDR 1H2AS 3BXZA 2R96A 1O87A 5DW3A 4A36A 3U1TA 4WPGA 1OFHA 5KIAA 4PVDA 3O3MB 2OORC 4PLVA 1TJ4A 1ANKA 4ICIA 4L16A 5IC4A 5TPZD 3NBZC 4EF5A 4LPKA 4EZBA 4FGSA 1IM2A 2HIHA 2QD5A 5E95A 3QX3A 1V5GA 3FKJA 5ESWA 3FROA 4IEEA 1RRKA 1Y8QA 2M98A 4J0EA 2ZAYA 1U0JA 2DPYA 2H2DA 2Z8YA 4NFYA 3OQIA 3RG2A 1VKJA 2FW7A 4X90A 5DXAA 5TJ9A 2DERA 1BMQA 1YZQA 1K8YB 4Q3CA 4RTNA 4RY0A 5F5XA 3FR8A 1YB1A 3IVRA 2QP3A 1MMFB 3QKUA 4O4JA 2QEQA 4TQGA 5ICGA 4M46A 1J33A 2HBRA 3OZUA 3FM9A 4LVCA 2ZKLA 2GAFA 1RXYA 1FTYA 3WP1B 4B6PA 2PS1A 1E7RA 2VRCA 1GNPA 3SK0A 2H07A 5IT5A 1O54A 1JJ7A 1XDBA 2EZ4A 2VJLA 3DVAB 3PUHA 1T34A 1OBHA 1QHFA 4AC9A 1H3NA 1KDYA 2QR2A 1X94A 3Q9NA 2CBXA 5FORA 5AW0A 1KETA 1KR5A 1UC9A 1EK5A 2W48A 1G20A 2H57A 2P5YA 4UBMA 1N5RA 4IF6A 4M22A 3R3VA 4D6PA 2J3DA 2RH5A 4K3UA 4WY2A 3EZGA 3YASA 2O5EA 3SJZA 1C3EA 3MJTA 5B58C 1KRHA 2J0VA 5FAXA 3RD5A 1P7ZA 1SVNA 1LDNA 4BNWA 4NTZA 4X66B 3O2JA 1VBNA 3GUYA 3OT1A 4KFUA 4MGHA 4ZPJA 2YZKA 3AINA 2H17A 3AK4A 2PX3A 3NDIA 3LVQE 1OBCA 1R4MB 2WM9B 2XWPA 3DDOA 4PGMA 1XZEA 4UHCA 1XTZA 3PD0A 4F45A 1F2VA 2AG8A 2IYVA 4DA7A 4DLSA 2ZSKA 3KDAA 4YCNA 4RC9A 3EH1A 2VYND 1PEAA 4D2IA 2FQYA 2OVBA 2ZROA 1GUFA 4CU5A 1J5PA 2GF0A 2OXTA 3V34A 5CNIA 4BB6A 5L3QA 3RSFA 4Y1RB 4FNMA 5IFKA 3DZHA 2XCTB 1A5TA 3OLXA 5AHRA 1OD6A 1LJUA 2G40A 1Q15A 5CNMA 4ZOEA 2XE7A 3LKBA 3NHFA 3ILVA 2CK3D 3LQ4A 3OQPA 4Y0NA 3ROPA 1JA0A 4NCXA 3E35A 3W77A 4QGFA 1GPNA 1KY2A 1SCIA 3ZE0B 3LRTA 4NZ9A 3GB9A 1L8OA 2B1GA 1C7JA 1GKLA 3H0EA 3HCFA 1CUXA 2Q0HA 4JQOA 3ZYCA 5BSFA 4LHYA 3G17A 2OV2A 2WT4A 1JFRA 4N3CA 2DP4E 1XQWA 1YZHA 2Z83A 3Q5GA 3QFSA 5K8LA 2PUHA 2F8TA 3QWFA 4OXYA 3RBVA 2C78A 4CQMB 3KWJA 1A9OA 1C1XA 5CB0A 2QRHA 3EOZA 2JBHA 1KGSA 1EZ4A 1GXSB 1M1UA 2ALJA 3LL7A 1RXEA 1Y3HA 3M6IA 3RYCB 1LW7A 1QBKC 4JC8A 1U8AA 2P9HA 3ANSA 3Q6NA 4LRTB 1KH1A 1LSJA 3RS4A 3WWZA 4TV8B 1TYZA 2Q5OA 4QOGA 3TGLA 4JJ4A 1S02A 4QD3A 5B5SA 5IM4A 1C7IA 3BD8A 1EINA 2QIOA 3FNHA 1LC3A 1MA0A 4MZXA 1BRMA 2WILA 4NKRA 3N6RA 1UMKA 5SZIA 3MUNA 4EY8A 2YDXA 1CD5A 3QI7A 3Q9UA 3FRHA 4BQRA 1THMA 2NXJA 1KZ7B 3O73A 5G1PA 4LNUB 2ONJA 5EFOA 4Q3OA 2D2EA 4O08A 2FPSA 4I6GA 4OK5A 1I4EB 4UM8B 2W37A 2TRSB 3RWOA 1FIUA 5JWOA 2F1JA 2FN4A 1I3OA 4NP6A 9ATCA 5LFAA 5C8DA 3QUQA 1U3UA 4ZI7A 1WCIA 2G4VA 2VSFA 3OESA 3AJ8A 3ABSB 2MSNA 4RIGA 4JLOA 3WLHA 4LMPA 1ND5A 1WZNA 2JLZA 1ODSA 1YHZA 1Z88A 2OY0A 3HBMA 4KIFA 1KMCA 3BDVA 4JJFA 1AGNA 2J41A 3W90A 4TXMA 4OQ4A 1L3BA 3K9QO 4PFSA 1CP3A 2ZJ8A 3AESA 5JR3A 5AVYA 4UEJA 3TQCA 4ZVRA 4UHEA 1ULUA 4NNPA 1MNQA 4R1PA 4LNAA 1RWBA 3CZCA 3EGIA 3QEKA 4MRPA 5U4QA 2DHRA 1USIA 4IICA 2C2MA 4S1WA 3V4FA 4UU8A 3C24A 4RQAA 1KP3A 3GUCA 2EJWA 3GGDA 1G42A 3C3YA 2F4VB 3P9YA 3ZBUA 3DC2A 4EKIA 3JAWB 4H4CA 1U94A 2WHQA 1G5TA 4MTCA 2FWPA 4YP7A 1FZQA 4MX8A 3D8HA 2NUTA 4CQLB 3B36A 1XA0A 1OFGA 4F8YA 1PJBA 2O2JA 2VFAA 5IFLA 3GL9A 4H7JA 5BP7A 5EIEA 5K5EA 3VXKA 1XUOA 3N2LA 3ILHA 3TAXA 1T36A 1SC1A 2FUG1 5H4GA 3RYIA 3SX0A 4O4IB 4RCVA 5DF1A 3RUAA 3U7GA 2YUTA 1Y3DE 2A94A 3GJ6A 1C41A 3PFKA 2WB2A 4TOIA 4JKIA 3H6KA 3WLMA 3NOOA 5KEIA 1VM6A 2V1UA 3PHGA 2HT1A 2UZAA 2J5RA 1C4WA 4ALMA 3ID6C 2I2XB 3T34A 3KAKA 2EEPA 3M81A 5CXSA 5A7HA 1YS7A 4MKIA 4QRHA 4MQFB 2WV9A 5AVWA 2IS1A 2ST1A 3UCFA 3ZWYA 1XOIA 3EFOB 5LYJB 4RKRA 1GQSA 4RZ3A 1Y6QA 2WJAA 5E6SA 4PLPA 1ZM7A 4UC0A 1T2DA 2O8CA 3LQ2A 1ICEA 3IIMA 1R8YA 1RYDA 4A5SA 4RADA 1LKZA 2LBPA 3KQWA 4WBXC 1ZM2A 1O4WA 5T8KA 3EGEA 4B6QA 4YYZA 3GRUA 1ISMA 4YJFA 5AUQA 4ZDWA 3OLQA 4G07A 2FYTA 5KQRA 3HSYA 2RIPA 1CT9A 2AFVA 1YKGA 1G8AA 1NJSA 2D1TA 4BNLA 1JIVA 2YJ3A 3MUFA 2JAOA 5CJJA 5JQGB 4AIRA 1EM8A 2E4AA 2P6OA 2O07A 3AFOA 2CXQA 2ZBEA 1XDDA 3AUFA 3TCKA 3RT1A 3QOFA 3R6LA 3AMVA 5B37A 4ZCIA 3THWB 1L5MA 1ZNQO 2ATCA 3EUWA 1FNNA 3HVHA 5GINE 4NFHA 3WDMA 4BO2A 2K7ZA 4JC4A 4NU0A 4RK7A 4PZ9A 1WQ1R 5DFAA 5ESRA 4EX6A 5GOZA 3N6XA 5I6DA 2X6RA 3WL3A 2V3CC 2J6CA 1XK7A 1JKFA 3QE0A 5DISB 5EINA 3L6UA 2DWCA 2XZDA 1LXCA 3E61A 3RLFA 1KZYC 4D8YA 4Y1GA 3OZ7A 3PNBA 1BMTA 2C8JA 3B38A 2FW9A 3ZDCA 4MW0A 1IJFA 3RVPA 5H5JA 1B2LA 3CH7A 1NN0A 5U4XA 3PLRA 3IBSA 1CS4C 3B51X 3A6DA 3CLTD 2SBTA 3DCNA 3FKQA 3HA5A 4FILA 1U28C 1OB5A 4DEVA 2DG2A 2XCRB 3QLTA 4GDMA 4MR8A 5C46F 3MCZA 3P9KA 2JFUA 2F43B 3WLNA 3TLKA 4ZJUA 1SMKA 2VSXA 1Y0BA 4E51A 4IS3A 1I5OA 1WBJB 1J6UA 1SULA 2WUWE 1EBBA 1VG0B 1NUQA 1W0JD 2YQ5A 3L0SA 1DKQA 2R7AA 1D2NA 2H3HA 2E82A 3PK0A 2O5CA