2C9DA

Lumazine synthase from mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl)hexane 1-phosphate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
publication title Structural and Thermodynamic Insights Into the Binding Mode of Five Novel Inhibitors of Lumazine Synthase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2c9dA00
1HQKA 5IM4A 2C92A 1W29A 2O6HA 2C9DA 1KYXA 2I0FA 2A57A 1KZ4A 1KYVA 1KYYA 2B98A 1W19A 1NQUA 1T13A 2A59A 1KZ9A 1ZISA 1NQWA 1NQVA 1C2YA 2B99A 1C41A 5IM5A 2JFBA 3NQ41 2C9BA 4J07A 1DI0A 1EJBA 2F59A 1XN1A 2VI5A 1KZ1A 2A58A 2C97A 3MK31 1NQXA 1KZ6A 2C94A 1RVV1 2OBXA 4KQ6A
chains in the Genus database with same CATH superfamily
1M76A 4ND6A 4EFNA 2PFGA 2OBYA 4PHTA 1CRPA 5HK9A 4FGLA 2WYUA 1JVNA 1BS9A 1DRUA 2INGX 3P9CA 4B0PA 3ZCTA 4DUZB 4DA6A 3HTXA 1F3LA 1QIDA 3K9QO 5L8VA 4KK3A 4PX5A 5AKGA 5DM1A 1BOOA 3GF4A 3PDJA 1XF9A 1KWKA 5TPWA 2EKLA 1DQZA 5FIUA 1YVPA 5H68A 2LKCA 4JI7B 4XAQA 3TECE 5I8PA 4K6FA 1OXTA 1UJNA 2PGIA 2QKYA 1SVMA 1M0SA 5ICFA 1V2GA 1AG9A 3S1AA 5KEIA 4HFMA 1S7CA 2ID4A 2RBKA 3MXOA 4MLDA 4YJ3B 2F1HA 2RKWA 1GKUB 1U94A 1SD1A 2FWBA 4YRBA 1UFKA 1S3SA 1F8XA 4GNKA 1QBKC 1R37A 5FEMA 3GLGB 4YPFA 2XR1A 4DCGA 4GLJA 4GMGA 4EGJA 5K6RA 4DIKA 4FFLA 6YASA 5D7BA 5EWLB 4TTVA 5AOBA 1CUGA 2BJWA 2GQ0A 2PGAA 4YP1A 5AW2A 1X7DA 4D3SA 2XUPA 3AKCA 4GM4A 2VHZA 1RYBA 2OB2A 3FHJA 3PJEA 4KDRA 1NVXQ 2AZXA 2QX9A 4EB6B 1FB5A 1CB7A 3ZD9A 4ND2A 3RSFA 3M4JA 1KFKB 1VE9A 3BB1A 2GYYA 1CVLA 2Y2UA 4UC0A 4BV9A 4C3ZA 4UUMA 3UAVA 4OFZA 1W36C 3QU4A 3ZOZA 1WCIB 2C5LA 2QG9A 3D8HA 4IW3B 4D4IA 2G40A 2GEVA 2I99A 3I53A 1Z88A 4YRCA 2VDVE 5KVAA 3K2EA 3ONVA 5TJHA 5CFLA 1P62B 1SKAA 5D3ZA 3WNCA 4FB5A 1BXGA 1T10A 2JGKA 4MS4A 4QHYA 3W5IA 3PVCA 4F1KA 5KX5A 4HVTA 1AHIA 4BNXA 1QHFA 2JC3A 2ZJ2A 2R6AA 3JQFC 5DE3A 2H11A 1BOFA 3ONEA 3KUCA 3O94A 3B8HA 4UHFA 4CV0A 3P4UA 5B58T 4AY5A 4RYLA 2B4RO 3HXKA 5ALDA 3ODGA 2X9QA 5EAIA 3N6RA 3ZZTA 4DQLA 2Y1DA 3N2ZB 2ORED 3OZIA 4GP9A 1TEHA 4RTOA 4C76A 2WHQA 2PL5A 3L40A 4X84A 1G21A 2PUEA 2MYNA 3MCUA 4B7AA 2IZZA 4R1OA 3NHAA 3DP7A 4YIHA 5BPHA 4AKHA 4JLOA 1MP0A 1MU0A 2IS2A 1ZNWA 1D04A 4KBYA 5CXUA 1XA4A 3BWXA 2DFNA 3BXXA 3IIJA 4IDEA 1TJ3A 3X44A 5AI4A 2FKNA 3IMGA 4HAVA 2J9FA 1MC5A 3FJ1A 4MROA 4NR0A 3UAOA 5B7GA 2CSXA 1ZOIA 2I34A 3A14A 3B53X 3WIDA 2W70A 3ZKAA 4E5MA 2NX2A 3TLJA 4C0BA 3HKBB 3U3ZA 1CUYA 1QZZA 1UPFA 5JXWA 4DY4A 5EGSA 3VU8A 3N86A 2WAAA 2WHRA 3M6FA 1H42A 3OTWA 4Q24A 1NXWA 4IH9A 2GEDA 5U4XA 1R5JA 2Z8YM 3BOSA 3BX1A 3ROXA 1FFYA 3GGGA 4ZTBA 1NUSA 1XEXA 3BMNA 3IUEA 3Q0TA 2R25B 4M9QA 2CVPA 1BNCA 9LDTA 3G23A 3U1VA 4JOCA 3ZGZA 2C2XA 2RMKA 2Q21A 3CLRD 1SOAA 3U3XA 4MV7A 4H3VA 4EKYA 5JUWA 1HQYE 1IEXA 2NXEA 1UQTA 4QUKA 4U00A 3KV3O 4JT8A 1P2TA 3DVLA 4Y2RA 1IQPA 1YRWA 4F56A 1PLJA 3K9CA 3ZNPA 1CY6A 1G19A 1H0RA 2GA8A 4IHJF 4KR6A 1SUBA 1E2GA 2VH5R 4PANA 5DU2A 2GAFA 2JKZA 2PBZA 1SVWA 4UBKA 1MABA 3WGIA 4M8LA 4FYHA 4LI0A 4KUEA 1S2IA 4YP6A 2ZCUA 2IYVA 1BFUA 3R3ZA 1V11B 2CLMB 2YKGA 4AMGA 4XRRA 1QZ3A 1QRDA 4M2LA 2PZEA 4P2GA 1X7WA 4R2XA 4YJ2A 1VPVA 2CGEA 3ZWNA 1I4TD 1WF6A 2IDKA 2LV8A 1SG0A 4XCVA 5FLEX 3X2EA 4RTJA 1CJKC 4YA6A 2WWGA 2Z1MA 4IS2A 4LKOA 5DN6A 3TSAA 4I3HA 1JIVA 3VV3A 1W8DA 2JGEA 5JXGA 4A15A 3FUWA 1A96A 2GMWA 3WHLA 3VDNB 2QORA 1KZ6A 5CVDA 3FI0A 2XYRA 3HFSA 3QX7A 5FFMA 4AY3A 4R3NA 4QEZA 1Y1PA 1IAQA 2R96A 1P3DA 3ZK9A 2VT3A 3L43A 5AMXA 2UUAB 4UNQA 1PZNA 1W1WA 1TQ6A 2C1EA 2FHSA 4BNDA 1NG9A 3BWMA 2WTBA 5KOJA 1RBMA 2ZOSA 4BGIA 2HHHB 2W11A 1A72A 1NNUA 3AEKB 3MT9A 3H2BA 2RDMA 4HCJA 1QUEA 2RHDA 2VFAA 2Y76A 4KXMA 4WLVA 5H81A 5LN1A 1G9SA 1K6XA 1OXSC 1S2DA 4Y9TA 1E0SA 3UGTA 4WBNF 3ZWMA 5EESA 4CGYA 4NCHA 4B2YA 2V6IA 3DEHA 3EY4A 3WISA 1Y6ZA 4NE9A 2BM1A 5K3FB 4B45A 2W0SA 1UKVY 3HN2A 4JCOA 4GWGA 1JAIA 3VHRA 4ZOEA 3DOCA 3WDKA 2Q4EA 4URUR 1E5VA 1WZCA 3WK8A 3KX2A 4ILEA 4ENPA 4NMMA 1LA2A 3ADPA 5CB8A 3TLYA 1NRIA 3NXKA 4IOMA 4PO3X 4UEOA 3BCSA 3G2JA 1AH2A 3W8RA 3HNPA 1PCXA 2Q3CA 4JBWA 5YASA 1TZBA 2WJPA 1VTKA 3CRW1 4PAOA 3UGJA 3F6BX 1YUBA 3FVRA 4TLLB 2Y9MB 3HCFA 1FTWA 3RTGA 1KZ9A 2AVDA 3AUFA 3KZXA 4HX5A 5HG0A 2LKDA 4A8JC 1NI4A 3PNOA 5C7OO 3BAFA 1E0AA 4AURA 2AXEA 2CXSA 3PF9A 1BGXT 1QWOA 5D85A 4NYJQ 4LBVA 1YA4A 2VYVA 4TV9A 2YNMD 1VI5A 3WOHA 3B3AA 3MLAA 2EW1A 2HRCA 3IVMA 2RD2A 1GITA 3T9AA 2OCKA 3U39A 4GX0A 3FWPA 5FOVA 3UTDA 3FOEC 4EA8A 1Q57A 5I7EA 2LGJA 2QRVB 2R6HA 2QRMA 1RPZA 4ZI2A 5CB4A 5IJZA 3H1PA 3K53A 1ILWA 4N47A 5AVOA 3SNKA 3CU5A 2AKEA 4BX9A 5L6LB 2EFEB 2ONCA 2PKQP 3D7KA 4QQKA 4I0WB 4TZ0A 4L4RA 2PD3A 3EXEB 4XOIA 2VPXA 3BJRA 4IIHA 3B1XA 1KGDA 1B3RA 1LCIA 2JGRA 4FYKA 4FIZA 4UM5A 3C6QA 2BMDA 3RJMA 3RVSA 4RTMA 3RS4A 3JVUA 2A9OA 3EMBA 3K5PA 2WIDA 2CLHB 3CCFA 4Y2YA 3RIGA 3CVVA 3HEMA 3VOSA 4MVJI 3WAKA 2DSNA 4OOEA 1P5JA 2ZR7A 3DNPA 1RDFA 1W76A 2I1QA 4UTVA 2AG5A 4DILA 5H5JA 3ICCA 4MIEA 2H00A 4Q7QA 3RRXA 3SF8A 3AVWA 1C0LA 1YB2A 1YJXA 1QQAA 3QIVA 3NKFA 4ZT6A 3E48A 5BSGA 3NDJA 4B9EA 4C4OA 4FFOA 1P72A 2UYQA 3WNDA 4J29A 2AK3A 3UJ7A 4B33A 4J75A 4YUVA 4RIHA 3U9LA 4EEXA 5C32A 2LD4A 1N2IA 4BKQA 4PN7A 3VVMA 3G79A 1PEKE 1QIJA 2HHAA 4EABA 3KYDB 4PNZA 3ZTYA 2NSYA 4KI0A 3WYAA 5E8RA 3U9TA 1QVVA 1GAEO 3N8IA 5TMDA 5CA1F 2A58A 5K51A 2GN1A 3AR5A 5CGZA 3GELA 4XB6B 3RFVA 3K70B 3WLIA 2JEOA 3C7DB 3DE6X 3EW9A 2Q28A 4UAUA 3OIGA 3CUVA 4U3JA 4A92A 2G0NA 4ZYUA 5BT8A 5EIBC 1J8MF 3DMFA 1X1SA 2R00A 5JFGA 1B43A 4TM8A 2WQ7A 1TO1E 1WW2A 2MINA 4EX7A 3CW2A 1CKEA 4IWXA 4RQAA 5COBA 4BFXA 1H5NA 2JFWA 4CMHA 2K4MA 3A06A 4AO6A 3DAOA 5HIMA 3SC2B 1XU9A 4G3XA 1RWKA 2CUZA 3QFFA 3T61A 3H4IA 4P35A 1H0KA 3B6IA 3P2MA 5DGDA 1CUCA 2IH5A 1RCTE 1CJVC 3OHPA 1CERA 3PQCA 4D8TA 1SKBA 3LCCA 5LL6P 4B6RA 2RC5A 1SOWA 2HV8A 1WEKA 1Q95A 1YS2X 3KOOA 3LUAA 4IRXA 2B20A 3DEIA 4JXJA 3GFTA 5AW9A 2JFQA 2I8LA 4R2WA 4HV4A 3DC7A 1ZH0A 4HZUA 1GKLA 2PVCA 5CTAA 3ZCUA 4GE3A 1YULA 2CV1A 1XHEA 2VH1A 4ND4A 3FMOB 4PTZA 2Z8ZA 2R48A 4HWPA 5ITZA 2KX7A 4DDMA 1LV7A 3BM5A 4HRAA 3P7MA 2FRVA 3MG9A 4M7OA 4TL9A 1OXXK 2GK7A 4YJDA 3USCS 3ZD6A 4OMUA 2QVYX 5BYJA 4ZHSA 3BGSA 1HZZC 1PHRA 2D59A 2QTGA 2SBTA 2VAWA 1EM8B 2WTXA 4KFTA 4RY2A 3SY8A 3EEIA 5G3YA 3DOHA 2PMFA 1CRZA 4YXWA 3PJGA 1Z2CA 1GZUA 4MQUA 2C82A 1ZNYA 2IF2A 1XJCA 1H66A 1GSOA 3P96A 4OQFA 1PSDA 1MKYA 1UBJS 5U9CA 4LF8B 2C92A 5DF1A 4J4TA 1VCHA 2Q99A 4UUQA 2OZLB 1L8XA 1YU9A 1G4HA 1W6UA 1Y3AA 2H8GA 3EAGA 4NZNA 1DDIA 1N1EA 4YJ3F 2FPWA 5JPDA 3BSWA 3L7JA 1DJMA 3I73A 4ZOCA 2IP4A 3WL8A 3O8OB 2FSGA 2B4KA 2WJGA 3KDSE 4FMCF 2XMDA 5LZ4A 1I2BA 1C7QA 2UUOA 2A94A 4D9BA 4CL2A 1C3JA 3VUFA 1MJ5A 1OIVA 1U1IA 4DJTA 4TTTS 2ZR8A 2X0JA 3O8BA 4L9RA 1HFWA 2QMUA 4YAUA 3NT4A 3ZHQA 5E0KB 2CJWB 1USUA 1UH5A 4UPDA 1L5SA 4K2AA 2FN3A 5KTRA 1ML3A 3M2PA 2F17A 3H5LA 4H6VA 1HRKA 4J91A 4D97A 4FCWA 3TZBA 2ZSUA 4WBNA 1I6MA 4LE2A 1R5NA 4DTIA 2GPJA 2C2BA 3ONWA 2FF7A 4M8SA 5EY5B 1QU2A 4IFBA 4KU4A 2EWVA 4RPKA 4ZC8A 5LBUA 2VNHA 5IVIA 4BVEA 4N7MA 1NPTO 4UE6A 4M60A 5G4KA 3ZGNA 5TQ0B 4EARA 1A3CA 4XEUA 4ZRNA 1L2TA 2OEPA 3JQFA 4CQMB 1BEUB 3HB5X 4MLPA 2HR1A 4JXXA 1QH0A 2IK8A 2QUHA 3RANA 4JU9A 3C4QA 3ZY5A 5IVDA 5AUPB 4IIGA 2Q5QA 5T64A 4ZKDA 4X1YA 3UAYA 1F1JA 2AG0A 3OO0A 4S1TA 1YKFA 3IAM1 2BOVA 3WKCA 3DQPA 5EE9A 1VMIA 2O3RA 4A27A 1AY0A 1TA0A 1KDZA 1CJMA 1P7YA 4CEHA 2O8FA 4QBKA 1W8IA 5K20A 4TROA 3HXLA 1NF3A 3O95A 5D5PA 3CG4A 3OPYA 7ABPA 1PIWA 3WDLA 1RAIA 2JJQA 1L0BA 4LJRA 1Y89A 1Y98A 4V0NA 4DKJA 5D2CA 3ZKWA 3QVVA 3OETA 3H11A 5ADUS 4P53A 3J7AC 2OFXA 5A05A 4EW2A 2F62A 4RK5A 2G9NA 2C9BA 2XE6A 4DJAA 2UUPA 3NBZC 3ZQJA 3PNSA 1YRYE 1XV5A 4MI1A 3VPSA 1R0LA 2CUNA 1KS9A 4X85A 3AX6A 3MTDA 3SMQA 4IVPA 1GGJA 5JAQA 1DWOA 3DZGA 4G5FA 4U63A 4E2FA 3GEMA 1IUOA 1T9GS 4I5GA 2O19A 3MYYA 4KFSA 3D5TA 1XMQB 2R7AA 3NBAA 3UCXA 3UK2A 3HKDA 4A0QA 4NONA 1SXQA 1BH6A 1S8NA 2P9ZA 3MOSA 3AF1A 2E4VA 3GGDA 5FH9A 4KVZA 1DFHA 2BJHA 2C98A 2RHOA 3H2HA 4ENTA 1VYTA 3W5DA 4RGYA 4D81A 5BVGB 1GA1A 2XSZD 1ISSA 1C3EA 3A9CA 2QZ9A 1OIWA 3KEGA 5K0LA 2H52A 2YXPX 2ZYAA 4BFTA 2R4QA 3A9WA 4Q12A 3V55A 3DCJA 4PX9A 2C77A 1PR5A 3QPVA 3VTZA 3MTJA 3TUZC 5BV0A 3DP9A 1Y4UA 3PA6A 1ZZGA 2OXFA 3PQ3A 3QLTA 2ZQYA 3N2LA 1JR3D 3LIPA 4CQLB 4RHFA 1WKVA 3D6MA 1OX6A 2AK2A 4ND7A 2WY2D 4N3GA 1ZFNA 5FJJA 1DC3A 2H3EA 4CN8A 3ZU3A 1VA4A 1TQ8A 2WWWA 1T5DX 4GZ3A 3VH2A 4LK3A 4X5OA 4YN3A 1SZPA 4OMDA 2G5TA 3HUFA 4MS1A 3FLAA 4PSAA 4EWLA 3FOZA 5K0EA 1YRAA 1YCHA 2C2KA 2P4QA 3HG7A 4U9IS 4CYMA 4YJGA 1C4WA 2NU9A 3CIFA 4YV1A 2WP8J 5SYMA 3L8HA 1ZJ6A 4M36A 4RXUA 2J9XB 1YCGA 5IXYA 3U44A 2ADOA 3NHFA 1F5NA 1M5TA 3EZ6A 5FTWA 1KDTA 4BJHB 1BE1A 4AM8A 3TPFA 1X6VA 3WO1A 3RABA 1EFPB 2X8LA 5JNRA 1A5BB 1NKVA 4ID3A 3IR7A 1JGTA 1FLDA 4GYJA 3RYCB 1FTQA 1RRVA 2IUTA 1PEYA 3WQBA 5KNBH 1P7VA 3MMNA 3K2IA 3UC9A 3VJMA 1N1GA 1WSWA 1SXPA 1X7XA 1EX6A 5EE1A 1VPLA 3KQSA 4G07A 2RGGA 3T3IA 1NF8A 1O54A 2V9ZA 4AJLA 1YHZA 1Z34A 2XWJI 3B3FA 3EODA 1EZ4A 5IG2A 3ZU5A 3A0RB 1WKBA 3IXLA 4W8GA 3F4LA 1Y81A 1S8OA 4LVCA 1JQ5A 1YV9A 2AFIB 3HBAA 3ZVNA 4YCLA 2D6FA 3RSCA 2VRCA 3N8NA 5BOSA 4I9HA 4MEAA 1SXJD 2PX6A 5ELMA 1CVIA 1KDRA 3G2NA 4GEKA 3WL4A 1NULA 3KQOA 4A8JA 3A2MA 4YV0A 3ES9A 3MD0A 4B3TB 3SIXA 4ZEXA 5E6UA 4PZDA 1FP6A 1Z0SA 4P81A 3P71T 4RD1A 5BOSB 1NDHA 1L5HB 3GD7A 3WK6A 5AESA 2OCBA 2H2DA 3OJFA 1IOWA 1UOQA 3F6RA 5KJCA 4NZZA 5FQNA 1JIJA 1G8AA 4X1KB 4XWYA 3KJHA 2C83A 1R5OA 4WCDA 3DYIA 2XX3A 3CX4A 3GHHA 4MR9A 3VPBA 2UZ4A 4Z7JA 1F12A 4K81B 1U7DA 4KR2A 1EXDA 4WK0B 1ZH2A 2YY6A 4MWGA 4XE5A 1LBIA 2YTZA 3OLVA 4LKRA 3TRKA 1KHHA 3E84A 4MVCA 2PBRA 3EY9A 1TT5B 3CUTA 1Z0DA 2JDID 3G7NA 1FLVA 3GYBA 3JQPA 4XJTA 2B5VA 5HF6A 3SDSA 3DBLB 1PNQA 2K2WA 2YWRA 5BUSA 3SQLA 1MB2A 2W6MA 4MV1A 2YH2A 1M1NA 2ODWA 2ZCVA 3I5AA 4W7SA 4OJYA 3UICA 3FBGA 2IP2A 1J0BA 2HJSA 4R68A 4J7UA 1OYVA 4RAOA 5BWCA 4LX0A 1E1YA 5FHQA 3QE0A 1D8TA 3QXSA 3QEKA 3VKVA 5K8TA 1J25A 3P8ZA 4EJFA 2W6QA 3BFPA 1EDEA 5L45A 2ZU0C 3A6FA 2WJWA 2AJLI 2IYZA 3LYHA 4IDOA 1FFDA 2XNDD 3H5NA 1GYRA 4HUQB 4QGGA 4ZO4A 2X3YA 1DXOA 4GPBA 4COKA 3RARA 1M10A 1T9KA 4MLZA 4KPEC 3UUEA 1U2TA 2WU3A 5DWQA 4RV5A 2IY8A 3W5BA 3ZWKA 1GNLA 1Q6ZA 2HBRA 1RMQA 3G6WA 1P4SA 4MGEA 4A0HA 5JO0A 4C7OA 3EIEA 3CLUC 2WMDA 1M73E 3JWJA 3TZEA 1V8ZA 4IDGA 2XDQB 3QUSA 3CG0A 1TCVA 1Q0RA 2ZDHA 3PHHA 3TVDA 3GLIA 3EG9A 2PLWA 4LXGA 2PS3A 5ULLA 1S02A 3LDUA 2XD4A 1K6IA 2ZRJA 2G77B 4O5AA 3F7NA 5CBKA 3A6PC 1J1UA 2YYSA 5L6MB 2PV0A 3FF4A 4U0JA 3E9CA 4C4ZA 4DMRA 4AB1A 2Z6AA 4XJVA 1KHTA 1E9SA 2XXBA 2YW9A 2PZGA 1MIHA 4GH5A 4URVR 3VJRA 2ZSKA 2FF5A 2EKBA 3CKKA 2JFHA 2RGXA 3A04A 4TSKA 5BN3B 1BJKA 3D1JA 2SKEA 3IUPA 1ZX1A 1BO6A 4WLNA 4NDAA 3TD2A 3W5UA 3CJQA 2V65A 3MGCA 4NZYA 3MGBA 1OWMA 1JA0A 3AEZA 1P61B 2HCFA 3OCVA 4XYMA 3UMCA 3HN6A 4A6EA 2ZSDA 3E2IA 2NG1A 2VWQA 4ARIA 3TIIA 4C2AA 2IZOA 1XEAA 2O07A 3OJ0A 2PWYA 5FCDA 3O93A 4BRUA 3OQJA 2RAVA 2VJCA 3MPOA 4QFMA 4TXNA 5AVSA 1HF3A 1VL5A 1QXSA 3L9XA 1RAAA 4NF2A 1Q7BA 4LHWA 2DX7A 2OFFA 3PC7A 1EFRD 1NXSA 5TMEA 4E7PA 5AJXA 4A0FA 4AK9A 1HK7A 3S1LA 2O20A 1Y6RA 3T4EA 4CKCA 1M5UA 1O9BA 2V8BA 1H9AA 1MVLA 3PQ2A 1VE5A 2LIPA 4DQ0A 4CLEA 2PGOA 4TOIA 3UANA 4QTYA 3R24A 2D4AA 3X43A 2FMTA 4P0QB 1XZBA 4FDUA 3U6BA 2J5XA 2JGDB 4IV0A 5JAOA 3AM3A 3OOHA 4R1TA 1KORA 5AO9A 2ZIVB 4DR5B 2GHRA 2OUIA 3JATA 4NYIR 3QX8A 4KIGA 4WT7A 2ECKA 3LSYA 1KYXA 4KAJA 3KJQA 4IICA 1QC5B 1Z5NA 1K5GA 1TI7A 3IV7A 4MV3A 4QO7A 4ZRMA 1P3JA 3TLGB 2VKTA 2EFDB 3B7WA 1Y5IA 4MPRA 4UBJA 4UOEA 2R7KA 3DC2A 5IULC 2ZJYA 2PGNA 3KQPA 1V5IA 2YJ3A 3WB0A 1U9ZA 1MGPA 3K9LA 4YQZA 3FVQA 5EIOA 4BFWA 2H16A 3NHLA 4DLWA 1NBMD 4R4JA 2XCRB 5DNEA 1KNQA 2QJTA 5ADHA 1SJ9A 4Q6WA 1WG8A 3AFOA 4FX2A 3R41A 1C7IA 1I3NA 5DNVA 2VJAA 3GVXA 4ZT7A 4F2HA 1FP2A 2VTBA 2RG1A 2H31A 4DIEA 3UA3A 1SD2A 2XDWA 4AWBA 3VR6H 4BMOB 4DWJA 3B70A 4U2EA 4F21A 1G6OA 3LQQA 5HE8A 1U2ZA 5KYUA 1JR4A 3USES 4D0SA 5ALWA 5KNCD 1UAGA 4LZLA 1CY0A 2VZLA 4M0KA 3SSAA 3TLKA 1NTRA 2HSDA 4G4SP 1J42A 4L7QA 4OXYA 4DQVA 1BDHA 4IXNA 3VVCA 1RXIA 4V1CI 4ITUA 3UT5B 4ZCMA 3PX3A 4X7MA 2DFTA 2NU7A 1BCRB 2ZE6A 2BELA 1PJLA 2ZI9A 4UHCA 1RJ9B 3I45A 4PIVA 1XWFA 4JI2B 1TYZA 1EWVA 4X1OA 5DXJA 3BL6A 3RYFB 5A2QA 1DO2A 2VIIA 4ANFA 5HZHA 3ENVA 3O8DA 2GHQA 3O2QB 4R0VA 1YFJA 4N5HX 4BN5A 4XTCS 1KBOA 1U9YA 2YJ5A 2B1GA 4DBLE 3UFBA 4CTOA 1XU4A 2V74B 4B6EA 3PDHA 2QSZA 4JI4B 3ORQA 4RFSB 1FUKA 3M4ZA 1WCXA 3CO0S 1K1EA 1GDDA 1NYTA 1WMBA 4HNTA 3BPSA 2F59A 4CIVA 5CB6A 5JTUA 5CFPA 3UJ6A 1OZFA 1OE0A 2GYVA 2R7NA 2JK1A 4LGVA 4YGYA 3U0VA 4W5HA 4TKUA 5KVVA 1ZEMA 4J3FA 5D3MB 3IHWA 3D1VA 4H16A 3C7TA 3HYSA 1ILEA 4I66A 2J3HA 3LV8A 4S35A 4AZ3B 2AOUA 1K92A 4L85A 2OZPA 3BUSA 4F60A 3UJAA 3HLKA 2FZWA 4UZFA 1XQ1A 3HUEA 3RBVA 2WJZB 3OP4A 1W19A 4RY8A 1KP3A 1F7VA 3EQ8A 2VZ8A 1KVUA 3ETDA 3EQ7A 3RH0A 3AM5A 1EK0A 4MUEA 3MCWA 4WZAA 4UTPA 3SVLA 1NW9B 2J7KA 4JZYA 4XUEA 2IW1A 3H13A 4GMKA 2OLJA 3H9UA 4BUZA 1OGIA 4II3A 3K16A 1PR3A 2WJ4A 4DMCA 3HFGA 2OCYC 3TLAA 3V6MA 4BO0A 1Z62A 2SCUB 1GRVA 1FDIA 5IJ9A 1B6GA 4Q3AA 2ZVPX 2NOAA 2C94A 3PIDA 4FT2A 1TK9A 3PHLA 3HNOA 4RVOA 2XT0A 3FMPB 1KOLA 2Q1UA 4NFLA 5KOIA 4DR4B 3ZZ0A 3S2YA 3AEYA 4PBSA 4RBNA 4IGFA 4Q02A 1WDKA 2QM3A 2QVLA 1Y4DE 4J1TC 1WTAA 3BTOA 4ARSA 1Z0ZA 3P2IA 4KACA 5GV8A 1M34A 4E6EA 2PRJA 3PFNA 4UNSA 3T5CA 1C7FA 1DV1A 3ELDA 1FS6A 4HTFA 8LDHA 3CSSA 2ZRIA 1IZ8A 1OI7A 4FHZA 4C7MA 3OPQA 3KVVA 4IEFB 2QZ4A 1E4EA 1R8SA 2GS9A 4JL8A 3W9YA 2H3HA 4LV8B 3WOVA 1E2NA 1EGMB 3B2QA 4HEA6 4MW0A 4OB7A 4ZODA 5JADA 1XP8A 4BATA 4JYZA 4Y9DA 3HKEB 1ESZA 2VYCA 4RD0A 2I54A 5DK4A 2IIQA 4PO1A 1QIHA 4KQJA 3KKEA 1QLHA 1Y3HA 3L1IA 5A1TA 3THWA 1L4EA 3AMVA 1YAJA 2NVWA 1CS0B 2QXTA 3KXKA 3NIBA 3P9RA 4PGFA 3ZI4A 3C43A 3HDYA 1LY1A 2HXYA 3W2IA 5HUJA 1E7QA 3GGCA 4RZ2A 4ZARA 2VPTA 3H5WA 4ZEVA 3KYCB 1O9HA 4ARZA 4HGZA 1SCQA 1COWA 2PRZA 3REOA 4D56A 2DH6A 3B6JA 3L6DA 4HI0E 4JBLA 1P2UA 1TCCA 1XROA 2JG3A 2P6PA 5DV9A 5B1HA 4FK8A 1R0ZA 2GZ2A 4WSOA 1MXFA 4AN1A 4MGKR 2HA0A 2Q9BA 1H5UA 1V5FA 4GOOD 4WN3A 5JAIA 1Y3DE 2DQZA 3FDZB 3HV0A 1IJFA 1BU8A 1AU9A 1TRHA 1OPXA 3OSZA 3NRCA 4FJ1A 4LYJA 3I5YA 4IFEA 4OV6B 3WMEA 3ZJUA 2OBFA 2PKXA 4I4IA 4KN8A 4Y2XA 1AN9A 2YWFA 5SY9A 721PA 3NALA 5EI5A 1GXSB 2VWHA 1USVA 2EL9A 2AWNA 4KAXA 1AE1A 4MUMA 5DJ5A 2B30A 2X0FA 1ZIYA 4IG4A 1UBKS 4IIUA 4C4PA 2CV0A 5DGTA 1YF3A 4QXAA 1HMPA 3AL0C 2RHBA 1Y9AA 5EXTA 1M6VB 3R7WB 3GLQA 2Z5VA 2X9NA 2RGAA 3L8MA 3UFXA 4DCSA 4Z51A 3ZGLA 3WYDA 5KTOA 2A9JA 3KR9A 2OKCA 3HADA 2A5FA 4NBNA 4HWTA 5ICCA 3KQNA 2FW0A 5KHLB 3GDOA 2P2CA 1IN4A 2QJOA 2ZTLA 4Y6QA 5IYZA 4L3WA 2P8SA 3PUHA 5ALYA 1FZTA 2REOA 3NX4A 3GRUA 4H35A 4YX9A 1Y5RA 5THKA 2HK8A 3R7SA 1K8RA 3ZY6A 3ZW9A 1ZGGA 3THYA 1KJJA 1PKEA 3A3NA 4MUYA 4C3UA 4OLAA 2AHRA 1CT9A 1DC4A 3DDNA 3IPYA 4TKMA 4MW7A 5HOEA 2WA1A 3P52A 2XBUA 2AOTB 3KHTA 3OFNA 2QZSA 1W9HA 1B1CA 1BKYA 3MFQA 3ORFA 1SUWA 5TT0A 3GEIA 1J39A 4EPTA 4UTOA 2HHLA 2XNSA 1YGPA 3PZBA 3GRRA 2PKYX 5EKDA 2PWPA 1HDXA 4AYWA 4C0QC 5E95A 5L4LA 2A57A 1XFAA 3FGOA 2QNIA 1NBIA 1AXEA 4EYEA 1MT0A 1PZEA 1RCUA 2WPNA 3CE9A 5JROA 2G9UA 4FW9A 4D8WA 1IXRC 4OIFA 4B3RB 2BTQA 1QMPA 1MENA 2VNSA 1O95D 3UBTA 4NDNE 4EG1A 3GVPA 4I8IA 4OGGA 3NAGA 4JKYA 3OMWA 1BMDA 3F0TA 3T0IA 3OFVA 5TXGA 4NXMB 1OFIA 2Z1DA 2P75A 3DBHB 3NIFB 3VSBA 2B83A 1QP0A 1EP2B 3I9MA 4YRZA 3NGXA 2R8ZA 4CZ2A 4DT1A 4LV5B 3TTTA 4M6WB 3W4IA 2Q5HA 4UVHA 4HN9A 4X45A 3TR6A 2ZYSA 2FQQA 4W1QA 1GN9A 5EUQB 2HHJA 1W85B 3HS3A 2YVLA 3MWJA 2E5WA 4DAOA 5FUXA 4RPHA 2N46A 2DKFA 3EIUA 1O1YA 4JWTA 3E2PA 2Z2ZA 4PAMA 4FMDB 4GLFA 3A6DA 1HWYA 1LTQA 1TIBA 4ND8B 3ZDYB 4ZCTA 5KQPA 1S1CA 2C7RA 2H17A 1D9XA 2WMOB 1PHPA 3G0BA 5L40A 5DBFA 4BV2A 1Z33A 5DBOA 1MA3A 3PFIA 4N9WA 4KRXA 2A3NA 2BFFA 2W6JD 3A1VA 4JOBA 3WLSA 4K9MA 1QJCA 1T25A 4BLTA 2FUKA 4X8HA 3FTNA 4EFMA 5LOVB 1GA6A 4OVKA 4ROTA 3QE3A 5BSTA 3CGGA 1NQTA 1V37A 2ZBDA 3NCTA 2MSNA 3SLGA 1IDN1 2D7JA 4AF6A 1RVDA 4C06A 1GQFA 1I4OA 3BDVA 1LC0A 2CCGA 1KDOA 1U5BB 5ERXA 3JYLA 3TIGA 2I7XA 2PPLA 4ZPXA 4LJ9A 1RZUA 4GR4A 1U65A 1UJBA 4DABA 3LZ6A 2GK6A 3KLPX 3JVVA 4A2CA 2LRHA 3N76A 3QG5A 3ZCVA 2OV1A 3E1KA 2R751 3WZLA 3OAAD 2D5CA 4BB0A 1TMGE 4WBXC 1DHRA 2EGGA 3WIVA 5E2AA 4AMUA 4UOZA 4MUHA 3VVLA 1PFVA 4OK5A 2NU8B 2VRNA 3SYMA 1I7NA 1RLMA 3ESZA 4QLBA 3VJLA 1H2AS 1W29A 4TSFD 5IKXA 4B5KA 1FW8A 5LDGA 2YV4A 4GMDA 3WLOA 1XXHE 2Y1CA 4YR7A 2DEUA 5CM8B 1M75A 1G5IA 3ENZA 4QFBA 4EITA 3E9DA 1P4RA 2JEZA 1L4MA 1PLLA 2L19A 5CBPA 4JJ4A 2AEMA 1DX4A 4X66B 1LQ2A 1VCOA 3QVGA 1V8BA 2H18A 4MMZB 4RMIA 1M7BA 1JFTA 1LDEA 3WQSB 1U3WA 1XZIA 4DTCA 3EZFA 1DXYA 2Q4TA 821PA 4KIUA 2YJ6A 5LLSA 4NYMQ 3F67A 2C7PA 3HXMA 2CSUA 1XZLA 1KMQA 1YWGO 2IBMA 2VHQA 3JQ6A 2QUZA 4YXFA 2HK7A 5TLSA 3GARA 1ATZA 3OZRA 4XQGA 3K0AA 5HKBA 5FPYA 3W3AH 4Q9NA 3RKSA 4DLNA 1K4YA 4KR9A 3FNGA 4M0DA 3WV5A 2QU7A 3HWSA 3SZOA 5LQCA 1DWQA 1Y6GA 2QYTA 2GN4A 3IIMA 3QFSA 1RAFA 1L5LA 2HRRA 4JGGA 3HSKA 1QAOA 3L6EA 3I9FA 3B85A 4MKHA 3TVYA 3VPFA 1MX3A 4A0SA 1ZUIA 4EZIA 4FP9A 5IRCD 3TOSA 2FU5C 1OPRA 2JJ8A 3F1KA 1UK9A 1IOLA 2I6QA 3DMTC 4LBWA 4CM8B 4NOMA 1M2KA 2CDRA 121PA 1RHMA 2OSBA 3PTLA 4FUTA 4YMSA 5H3LA 1SVSA 3R7FA 3V1KA 4AZ0B 3RRMA 3THSA 2H9YA 2RGRA 4QVIA 1CLUA 2NUTB 3HBMA 3EJ6A 3I8SA 1U8TA 2D2XA 1P1KA 4XUDA 2X76A 4CM5A 4TYNA 2FWMX 2ONYA 2R11A 3CLKA 3C1TA 3PWTA 4F38A 1OH5A 3AFHA 5KSWB 1WPGA 3EXHC 5EYPB 1DIHA 2Y4NA 4AWAA 1BKDR 5A9SB 5LLTA 1BA3A 3G2HA 3LX5A 4Q4AA 2CL7X 3GRAA 1R64A 4MO9A 1MRZA 3EXFA 2BCEA 1TAQA 4EAAA 1OQAA 5IF9A 3OICA 1I01A 3D9QX 4HNVA 1P9OA 1U1DA 1UXJA 4C4SA 4HB2A 3O2JA 5IK2A 1K2WA 1T36B 2FPGB 3R4VA 2AG1A 4TS1A 3ETEA 3PEUA 1FTSA 3OM9A 1WV0A 2X6RA 3GFVA 5T6BA 5ECDA 3V8VA 1W7AA 4EI9A 1JP7A 5JEDA 4JHLA 4DJFC 3HMQA 4D4KA 3W6UA 2VKQA 1Z06A 5JD6A 2L69A 2UV8A 2OLEA 3NPAA 2C58A 4I9FA 5DZSA 1GZ4A 1RQRA 2H92A 3OPVA 4QOJA 4D92A 5CT5A 2D1FA 5K0BA 1NRJB 1VYVA 2I2FA 3JD3A 4MWCA 4RHEA 2ZVDA 4J6FA 3H5TA 2NYUA 4F6RB 4W1SA 1T8WA 3KB8A 3HLYA 4GYKA 3JALB 4KPUA 3I6QA 1UZLA 3A9RA 4QQ8A 1H93A 1HO3A 3OO1A 3ZUPA 4C0HA 2EZUA 3KQQA 1QP7A 3IQFA 1E2BA 4HS4A 5CX1B 1JMKC 4Q48A 5CYGA 1R00A 2YN2A 4GMHA 3GQBB 3T7DA 3R3XA 2WUEA 3G82C 3FPCA 3WMRA 1A8SA 1WVMA 3EIHA 1F0PA 1UPXA 4J1TA 1SXJB 1ZWKA 3ZGYA 1IG3A 1QGYA 1Y7PA 2CK3A 2EX0A 4P4UA 3IQGX 3VZCA 3CZQA 2WJ6A 4WOPA 3TINA 2AJDA 3VZDA 4CM9D 2PGLA 1UMBB 3EZYA 3AUAA 2DKOA 3AHFA 3BSYA 3CRZA 5K3CA 3LKDA 5AK0A 3CSUA 2VLIA 3OT4A 1HL3A 2JFUA 1P4HA 1E3TA 4JQSA 4PRYA 1TTQB 1Z5WA 1Q1NA 2AFVA 4L4XA 3F9IA 1UBOS 3ESAA 3ZDAA 5BMVF 4UHDA 4KQEA 1EIZA 1MAUA 4PTLA 1NRXA 4UTXA 2P7HA 1XI2A 3LGSA 1Z3IX 3VGPA 2IYWA 4EOGA 5JBIA 5CP8A 1EDOA 3AXSA 4M55A 5JNLA 3GDFA 3OX3A 3SLKA 4MRRA 4KG7A 1UEIA 1RVV1 4GOMD 5B30A 3D7LA 4FONA 4HDNA 4OGWA 2J6HA 3GXBA 3IAUA 1ZPDA 1UFRA 3PC3A 3QOYA 3CTMA 1YU6A 5LUAA 1QP8A 3HBLA 1IXSB 1YOVB 4BPRA 4D4JA 1N6NA 3JY6A 1JHDA 1F5SA 4F12A 1T13A 4PC3A 4AW9A 1F20A 3QUCA 2FJ0A 2GZAA 1JEYA 4PBRA 2BI4A 1VKNA 1AOXA 4MRMB 1P73A 5LZ9A 3NBYC 3UB2A 3UH0A 3IC5A 2IEIA 1O7JA 5IANA 1IHOA 5E1DA 4JLPA 5AK3A 1IEWA 1RYHA 2IXDA 3EIFA 3FKJA 4JA0A 4K6KA 1MUUA 3EYWA 4Y9UA 4LDAA 4PIMA 3W7BA 4MMXB 5CLJA 1ND6A 4R9VA 2DBZA 3SZUA 1SC4A 1YIDA 3QTLA 1NI3A 5CDFA 4MPTA 4BX3A 1JFLA 5JS6A 2Z0MA 3PEEA 1YRHA 2FW8A 1VLQA 5GOTA 4L0DA 2XZDA 2M6KA 1JTEA 1PK7A 1ECPA 2QN9A 1RRKA 2VTEA 1DIGA 5C3UA 2ZUWA 3K35A 5T8KC 4R7ZA 4EJMA 3PTAA 4WLOA 2VT7A 5CVEA 4RK4A 5JYCA 3QU2A 1MH1A 3E5MA 1TUBB 1A8UA 1LPSA 4YCNA 2Y2VA 1RQGA 1FYFA 1GYPA 1BW9B 5E6RA 1R0XA 4FOSA 3KWLA 2Q5IA 2P9JA 3NU1A 2OLKA 4M38A 4X6UA 1M2JA 4GVPA 4NAVA 5E1OA 3GJXC 2O0LA 3X2FA 5DGCA 1JLMA 3G85A 2AJTA 1KP2A 2RE8A 4S1WA 1LI4A 2JHCA 3F5DA 5GMOA 1RWXA 2OC9A 1VKZA 4J3JA 2VF5X 3D8RA 4KXYA 1X8KA 2OHIA 4KVAA 4Y2VA 4TX1A 3C98A 3JQ8B 5I7RA 1HM5A 2A33A 2G83A 2XKJE 5KYXA 1KYWA 3C1UA 2G4CA 2PUAA 1EHIA 1G5FA 4Q39A 1V7ZA 1XDUA 5DSXA 1UIRA 2HJ9A 4PU0A 1ECBA 1AQ6A 2C8JA 2K7FA 3BJZA 5AP9A 5F78A 2NYVA 3ND8A 2P40A 3MJCA 4TMXA 3MPUA 1O5IA 4DCPA 1SVNA 4HB4A 4Q19A 4HSGA 4YPVA 1L4HA 2A9QA 1MNAA 3OPNA 3WO0A 4B3HA 1RU3A 2QLMA 4EUEA 2EL7A 4GBGA 1IBLB 2PUBA 4KYUA 4ZDWA 3DYBA 2Q1YA 3G8YA 4QNMA 1T5HX 1VE7A 4H59A 1EBBA 1NXQA 2E3JA 3FNQA 3ZX4A 1Q0UA 2F90A 1U2SA 2OAQ1 4GZMA 1R0YA 1V1JA 1J2YA 2HSJA 2PO7A 4L5AA 2BH2A 3RT1A 1IK4A 5KU1A 2V1XA 3MN1A 3Q6IA 4KQ1A 1Q1BA 3WWEA 4UJ3A 3S2SA 5KB3A 4G5QA 2WSYB 1IYZA 3QKWA 3BA6A 3FLBA 4QWWA 4TTAA 2E9SA 1JF8A 3H05A 3DCIA 3O26A 3O91A 3T4UA 2O8CA 3CUYA 5AOAA 2G4VA 2H59A 3FYUC 2Z09A 3A1CA 3R1IA 1TD9A 5DBIA 3DONA 3VO9A 1OLUA 1V7PC 4EATA 3NHJA 4ZREA 2ERYA 4JQZA 4MQEA 2Y1XA 3WLRA 1QFYA 2H5EA 1XCMA 2GEJA 3CW8X 4KPYA 1EQ2A 1LQUA 4BOYA 5CPBA 2WJAA 2ECOA 3STTA 2XE4A 2D2IA 3BRQA 3IBTA 2XYPA 2XGOA 4HXGA 1YR8A 4I14A 1ZCAA 3KEMA 1GA4A 3QTTA 4IRMA 4OK6A 2OXTA 1P81A 5DB4A 4NKRA 1H2FA 4FI3F 1T2AA 5KDDA 3PWZA 4CTKA 3WLPA 4F3KA 1XMOB 1UJCA 3L46A 3ZCQA 3Q7PA 1WZIA 4Q93A 1NJGA 2C8LA 2Q4BA 3KPUA 1QDEA 2I2XB 4HWRA 5LCXA 5ALVA 1ZC3A 2DR0A 4H60A 3A9UA 4FE4A 4NWIA 4WEOA 4BDSA 4O4LF 2JLAA 2VBCA 4F8JA 1YVEI 1NG1A 1ONPA 3OBBA 3QWFA 5JXJA 3DL2A 3B52X 2B7BA 2ZRLA 4XIJA 3GRCA 1VMDA 1W0KA 4KSYA 4MV4A 4QOGA 4ENQA 4G1EB 3IBYA 5LP6F 6CHYA 3FB4A 3GV0A 2G4LA 1DAEA 4MWOA 4UE2A 3DDWA 1ABEA 2Q1TA 3RWBA 3SBOA 2Z3WA 4S3MA 4ZMBA 1ZN7A 5ECGC 2WPDA 4F06A 1N32B 3U60B 1JQLB 4QARA 5KVSA 1V6AA 5ALJA 3LTNC 3Q9NA 4BCCA 1ZAYA 3OKCA 4MA0A 1IY0A 1I24A 3RAPR 1I4LD 1PJ4A 3ZZUA 1ZGAA 3N2YA 4BKMA 2CMKA 1P1IA 1OGYA 3A9VA 3U3DA 3KTAA 5JBNA 2WOJA 1I3KA 2HU5A 3LCMA 1ZSVA 2LTAA 3ELWA 3RSQA 4C2UA 4D26A 1RSZA 3WWOA 4YRJA 2F8LA 2HD4A 2I6GA 3M1IA 1JILA 2UYYA 1BMFA 2EX4A 3HJNA 3HXPA 4JUAA 4PY2A 3AEXA 4TVKA 1SBIA 1KFJB 3JR7A 3SQOA 4A1FA 4LYGA 1KO1A 2Q7XA 4ALIA 3DD1A 1YS6A 5J4HA 3PVZA 4IRUB 3GA5A 4RKYA 1VP3A 3AIKA 4U8GA 1XZKA 4LNUA 4C22A 1P74A 1X7YB 3BN3A 2R85A 3EMVA 3RHTA 2QBYB 1UWVA 1XTTA 2OECA 4UNPA 3WGNA 1BSVA 1JDBC 1WHTA 5G3ZA 2J85A 1BG6A 2OWEA 2V54A 3BE4A 4IZIA 4BMXA 2WTAA 4NK5A 1WXWA 1NTOA 2XF8A 4GPTA 2AZ4A 2J46A 2JCSA 5EG5A 3UKJA 3U7GA 2PX0A 3KS9A 1R4AA 4I4LA 5AVXA 3FF1A 3DMTA 2GPNA 4MW5A 3FXAA 4CI9A 1IBKB 2I4OA 1BCSB 4CFYA 2Y67A 4QAQA 1VBMA 1XTKA 2J0VA 2PN1A 4TWZA 3SOZA 3CVXA 4WKBA 3QG1A 1O94C 2D4HA 2DR2A 4I7EA 1XRQA 4ZYWA 1NYQA 4PPGA 4EY7A 3PNPA 4J0HA 1F0YA 3JAWA 4TPKA 1NJSA 4MHTA 3KB6A 3VPDA 1WXGA 3RBXA 2XV1A 4J0CA 5J2TB 3EK2A 3K0SA 1N0HA 3FZYA 4J76A 1U0SY 4QODA 4D8VA 3OBIA 5BQXA 3PNQA 4PNHA 3SP1A 4BMYA 3MGAA 1NLFA 4J0FA 1QV7A 4HUJA 1BJTA 2ZETA 2J4FA 2PH5A 2O8BB 3OZEA 1ECFA 3SHVA 3WK9A 5ANRB 1JN0A 3ORHA 1F48A 5F2EA 2HPVA 2O2IA 3A11A 4G6ZA 1P2DA 2ZWOA 3EUFA 3X1XA 1YXMA 2J0UA 1IN8A 4IMJB 4LSMA 3ZI0A 3NDIA 4FOPA 2N3ZA 2GF9A 5EHIA 3V4VB 2PRIA 4H17A 5FPKA 3M4NA 2VS1A 5JNVA 3C5VA 3Q0EA 4QQRA 1TA9A 2AL7A 4Q5IA 1IVYA 2HPZA 4ITRC 1JTVA 2IYPA 5D84A 5T3UA 2WTUA 1D07A 1KEEB 5EUBA 4NV1A 3JVIA 4G36A 1H94A 1K66A 1ZXXA 1EJBA 2Z83A 3C6MA 1C1YA 5FLXA 4X1IA 3IPCA 5JO9A 5DLEA 1K8XB 3LO5A 4HX9A 4CFZA 4NU5A 2Q6KA 4IUCS 3HJGA 3D7RA 4W5WA 4YRNA 3STWA 3R20A 4E2ZA 5CH8A 1MEEA 4WJLA 3GFFA 1G8MA 1XVVA 1L5KA 3TKLA 2DPGA 4ZT5A 2CVFA 3D6TB 3OE7A 1R6DA 2VR1A 2JANA 2HCBA 1ZA2A 2A0XA 4DQDA 2ZBPA 4D74A 3DAFA 1MEOA 1M6HA 3NPMA 5TF0A 1CF4A 3B13B 3H1TA 1LZLA 1OLXA 5EWMB 4JSRA 3DVRX 1WQ4A 3ZYCA 1QWSA 2Z6VA 3HACA 4OQ4A 2BHNA 5I7FA 5J3JA 2IHUA 3VDMA 4AN0A 1P3Y1 4WN9B 4X95A 1UM9A 4QNNA 1KH3A 1GZ3A 1VRCA 1Z26A 3GJ3A 1KC3A 2GHIA 4NMHA 4BB6A 1SN7A 1NUQA 2GZSA 4QUDA 3HRIA 1GCGA 3EDQA 3KG2A 3PXDA 1YQWA 3OUZA 4IJUA 1GQSA 4L28A 1IM5A 4IGIA 3FFAA 1UDWA 1V6CA 5DI3A 4ZXFA 1T6BY 5LLDA 3IX7A 1RBQA 1RLOA 4Z0PA 3U13A 5ICMA 4D96A 2YYAA 1AUQA 4EG0A 1E3LA 5B1DA 2BHTA 4A4DA 6NULA 2NZ8A 3DF9A 4UUAA 6AT1A 2R5FA 2ZEJA 3C3DA 2HQBA 1QYRA 2BGJA 3HRHA 5HXAA 1ZL0A 5LWQA 1JEJA 1W4BA 2W6CX 4UEKA 1JU4A 2ADFA 3PI6A 2QP4A 1UADA 4FR5A 5ERGB 3TOCA 4DMLA 3ACDA 4IDHA 5BQOA 1QOZA 1QRRA 4W5TA 2R1TA 3E70C 3G2IA 3L49A 4OHVA 3FOAA 3OZWA 3H0CA 2CKDA 3CF0A 1XEFA 4MRSA 4CKXA 5AW0A 1IU9A 4KQWA 2V7PA 1EVZA 1EVIA 2Q4DA 1N7IA 1CQJB 3QFTA 3LHIA 4RIGA 4WOBA 1Q3KA 1GQQA 2DSTA 2JD0A 4PRZA 3WSVA 3TZ6A 4A1OA 1U90A 2PT7A 2QE6A 3DTNA 4L8FA 1XZJA 1F4LA 1W87A 2GUWA 4LY0A 3AUYA 3H8SA 3NUGA 4LJYA 4MARA 5EE5B 4DA4A 1KAQA 3E3LA 4NG5A 2ZS7A 5JDCC 1K3UB 5C8XA 4OL0A 3HGQA 1MIOB 1W88B 2PPVA 4FILA 4JJ8A 2JBAB 1JIQA 1CC1S 4NBUA 4DC9A 4EHJA 1ONNA 3NWBA 1E0DA 1JA1A 1E98A 5I51A 2X5XA 1NR7A 3ZQ4A 1UKCA 3I5UA 4YRKA 1G2IA 2WWTA 1QANA 1TK3A 2HM7A 5T8KA 3PXCX 3WR5A 1DIAA 2BLNA 2I80A 3O1IC 3S4YA 1F0NA 3DLHA 4MULA 3RWMB 2HRQA 4RSHA 3C4JA 1FYXA 3BSSA 2FLWA 1J1ZA 1YHNA 1W1IA 3BTSA 1O03A 4F8EA 4ENSA 1RXWA 1JMVA 1R9MA 1VCIA 2YHAA 4M8KA 1EP9A 4EW6A 3NHKA 1Y8RA 4Q66C 4FLMA 4HVAA 2AZTA 4HDMA 2OD9A 1AKEA 2EQ5A 3ZLJA 1IRXA 1QAQA 1EA5A 4MZXA 4Y2JA 1RKUA 1UT5A 2B82A 4XJXA 4D4GA 2DJ5A 3M6LA 1YUMA 3TRDA 4F0JA 4B6FA 3RFFA 5IVKA 3GPCA 1DT5A 3O9ZA 3NBMA 4IUYA 4J2TA 4EGSA 3RI3A 2E87A 4EEKA 1BC5A 4J16C 3VBEA 1HORA 3GPIA 4ZANA 3HV2A 5F1PA 3F46A 1ZIXA 4PFSA 3O9MA 1CUXA 1GM5A 1PGNA 3NHBA 1Q1QA 2QP9X 4HGNA 2NSJA 1JE0A 2W5UA 2WZCA 3FFBA 3KNZA 4G8BA 4M1OA 5FF9A 4ZU3A 3ZHRA 5DMXA 1K89A 3ZY4A 3G2QA 3NHWA 2JVKA 5FWXA 2FPPB 4C04A 5KMGB 3QBEA 4FFRA 1V8DA 1WNTA 1ZK4A 1WUTA 5JVDA 3DAYA 1ULTA 2VUUA 4JASB 5CCBA 3GLFE 1IHXA 3ZCXA 4J07A 2QQGA 1YB1A 1CF9A 1G3RA 5HCUA 1P4GA 1KJZA 1EVJA 2QTHA 4BNTA 4F1JA 5J4YA 3QNMA 3EIWA 1JEEA 2ZPTX 5ARCA 2XVYA 5KNBA 4EMBA 4Q7JB 2IYLD 2IKQA 1QS0B 3KB2A 4MR7A 5J63A 3DEZA 3PUZA 2A0YA 3OOEA 4MQFA 2SECE 5AWFC 5KTYA 3GJ8A 3KSUA 5J2UF 4I2NA 1D8AA 3HRKA 2ZT6A 5IBCA 3RFXA 5AW3A 5TS2A 1BQEA 3OTHA 2RH9B 3FYUA 2BEKA 1ZBDA 2C7QA 4KE6A 5JMPA 4F4CA 4BX8A 3MMZA 3K92A 4XTRA 3GCXA 2HUPA 2X2EA 4YQEA 5HIKA 3DG9A 5DYTA 4TQGA 1WOYA 1JNYA 2WG0A 1ORHA 3ZU4A 4R51A 1Y48E 1BE0A 4HEHA 2GO1A 4OHPA 1A5TA 5BR8B 1TVEA 2AI3A 2I3GA 1MHTA 1EE1A 4MS3B 4FFMA 4BP3A 3BXZA 3N9IA 2P9QA 1RFLA 1K97A 1WR8A 2J1LA 2CNKA 2P2DA 2EQBA 1B6RA 3VZSA 5FUQA 1QF7A 1XTVA 1Y7LA 2HKIA 1I3CA 2YVAA 1J22A 1GPUA 3PGMA 1SQFA 1JI0A 2BJVA 4HWSA 3HFRA 4MV5A 3Q87B 5IXSA 2LXNA 2IS6A 4FE3A 5E2IA 1QOPB 2ODPA 1G66A 4ILKA 3C7KA 4DIOA 1VPTA 2JB9A 4FDVA 4G67A 4Z99A 1XDGA 2BGUA 4E14A 5L3QB 1E1CB 1M72A 1E61A 3V1LA 5DM2A 5LXTB 4O4HB 1NN1A 3IUJA 2QT0A 4FYXA 1QRUA 2F1KA 1KSFX 2W2KA 1CCWA 3U3RA 2C4HA 3F7OA 1G1AA 2H85A 2BMFA 3I72A 4JZKA 2K2QB 2PZ8A 2VQ3A 2PRSA 4W9MC 5DYIA 1Z0JA 1RYNA 2I7VA 2I6XA 3I01A 4LC9A 5FDFA 1KP9A 3FNIA 4HSEA 3WK4A 1XZEA 2ZWMA 2CUKA 4X3CA 1BRMA 1BD3A 1AX9A 1ITZA 4DUGA 1JAHA 4EB3A 1A9PA 4MEJA 5I9IA 5ERYA 5F7XA 2QRUA 2O8VA 4N3NA 4PGAA 3V97A 1TYCA 2OENG 1XBTA 2DFLA 5F35A 5DXAA 1M2WA 2IIBA 3QUTA 1E9CA 2FFBA 4RHTA 1W35A 3PGXA 3LF2A 1II0A 4MV9A 3GUUA 3O3MB 2FZ5A 4KWHA 4LXTA 4IF6A 5CR9A 2J0SA 1GGHA 1XZGA 4ENVA 3OQPA 1QTRA 2YRFA 3QV2A 2RGWA 1NASA 4HAZA 4FNOA 1X3LA 4MUAA 3RU3A 3VFDA 1FDWA 2ZBFA 4PGGA 3BD6A 1E69A 1I1HA 4RD3A 3DAGA 5CLIA 3SZLA 2ZKIA 4U39A 4ACAA 1T8UA 1SHKA 1YDHA 3EAQA 2JFNA 3WMWA 4S1PA 2WSBA 2HK6A 3H5IA 3O1HB 5DULA 3UHAA 4FKMA 4CT5A 2FA9A 1KERA 5C2JB 3SQDA 1ZJ5A 1QGDA 2LE0A 4P58A 3P4XA 5CPFA 5HDBB 1NBEA 4IXMA 1O96A 1THTA 4GICA 4OJNA 4UAJA 5JS1A 1O94A 3DMDA 5KOHB 1AB5A 1R4MB 1G20E 4CG0A 1DARA 2YOHA 5KKNB 3T3HA 2DR3A 2GEKA 1TDJA 4HDRB 2A59A 1X92A 3VISA 3LIIA 1U3UA 4AF8A 4AFNA 5GQSA 4BBJA 1M6EX 2FSPA 3SJZA 4EB0A 2H1LA 4YRLA 3AHIA 4L6IA 1FNNA 2XUGA 3IIEA 1GP2A 1TFRA 1SUSA 4O59O 1A4RA 1XXHA 1FSSA 1PJRA 2OR3A 4DIFA 4DV3B 2XB8A 2AQHA 2R8XA 3NM5A 5JW6A 5FA8A 3B78A 4E33A 1VFNA 2OGSA 2EW8A 3CTPA 3ROEA 3AHHA 3UENA 2DYKA 4LWPA 3RC3A 1AA9A 4TVOA 1D03A 4G4JA 1CLEA 4RCYA 1RFGE 1FNDA 1NZDA 1P5HA 3O8LA 4NRDA 4UFOA 2C4KA 1HE5A 2E18A 1LPOA 4OHMA 3ZHTA 5M2QA 4ZXPA 2UVPA 3HA7A 4LHZA 3BMQB 2Q5LA 2BVNA 4GGOA 4C2TA 3W5JA 3ZGXA 3RS8A 3K8ZA 1T6NA 3ICPA 4Y7CA 2GK3A 3S2GA 4C14A 5IF3A 1GLGA 4BBAA 3WS7A 4BIMA 4ZDIA 2UVDA 3KT0A 4BWFB 4CV1A 3GLFB 5DTRA 3P5BA 4WBSA 3G2LA 4CLXA 1GZ7A 1CUEA 1IQRA 3OKPA 4V2IA 2Y27A 3HO8A 4AMZA 5MN5A 1N9GB 3C74A 1KE2A 5KJ1A 5LQAA 3NVKI 4FFSA 4MI9A 2ZRCA 1LS1A 2WAOA 3GZNB 3LD9A 2MIIA 2EX1A 1XCJA 2YIJA 3HC7A 2P7IA 2C2MA 3F5FA 3HU5A 3MEQA 4RNCA 3M1YA 1GCIA 2NUAA 4L75A 1XIVA 4LF4B 2HRBA 1XRJA 4MUNA 4TUYB 1PVVA 1L5OA 2QI9F 4O4JF 3ADBA 2H7VA 2XWBF 1XWWA 1CY4A 2DE0X 3VR6A 1W0JD 5F1OA 1Z35A 1DEAA 2YWCA 1M2FA 5L7YA 3BGVA 5IJ0B 3THXB 2GCEA 4K5QA 1WB6A 2A5LA 4BFLA 5EHQA 4JI0B 1F2TA 1VBNA 3GLHA 1A9XA 1FQWA 1TQDA 3D3JA 4WXEA 4I8DA 1UPTA 1KL7A 1BTOA 3H9JA 4MYDA 3M89A 5FA6A 5JPIA 3ZV6A 1A9SA 4CM4B 3FYHA 3JTMA 4ZAFA 5C5EA 1FFWA 4E5NA 1U6IA 4Y1FA 2KQUA 3EGXB 5JNTA 2R6R1 5KTPA 1W2HA 1X86B 4ZALA 3OP1A 1KO8A 2WKSA 1PW5A 3D7SA 4Q0MA 3B3GA 4QRDA 3JWHA 3RTAA 1CU1A 4E15A 3K70C 1OLSA 3KP1A 4CKEA 3R7AA 4XWGA 2QDKA 5BSHA 2II6A 3D6VA 4EW3A 3DBVO 5K4HA 3F7MA 1FDTA 3GDWA 3W7VA 1LV8A 1AURA 3V6LA 3LBIA 1T2UA 1XVUA 1EWRA 2HMYB 2WDZA 5DBEX 5JU6A 4IDFA 4N8DA 3GFRA 4DHEA 2QUIA 3LYLA 4V2UA 4YCCA 1P2BA 1A04A 5CFZA 4RXMA 4I9GA 4WGFA 2PLRA 3IAS1 2GN0A 3Q9SA 3SICE 1SBZA 2VJDA 2WIGA 2H1FA 5ENZA 4UM9B 5I5EA 1W25A 8MHTA 2Q5FA 1ZD3A 2ZAOA 5ISMA 1P91A 4MINA 4CKWA 1WB9A 1C30A 1TAHA 3FY4A 3HJAA 3PKJA 1GFWA 3FAKA 4F71A 5JDCA 3BGIA 1DJQA 3IP8A 4C1NA 4YCSA 4NNOA 5HRUA 2QW0X 2O6LA 4B7ZA 2CL6X 2I03A 4KBFA 4EDHA 3L04A 1ZJ4A 3GRFA 4YALA 1K4KA 3GAZA 1FNSA 1YIOA 4XLZA 1NQOA 5D01A 1IZZA 3TDMA 3R44A 3WLQA 5T5QA 2WI8A 4C5BA 1TX4B 4KAAA 1D09A 2NW6A 4D9NA 4UKDA 1PR0A 1BRTA 1E5XA 1OMOA 4YMGA 1S4MA 4I1OA 3P2JA 4IJKA 4PG7A 3ZWAA 2DHDA 2E21A 4ZO6A 3RNOA 1YZKA 1NVVR 1XK6A 1CDZA 2P4SA 3I12A 5EZYB 2QN8A 4RJLA 4LMPA 5ICEA 4RL6A 1QFJA 1ZJJA 1YBAA 3N3BC 5JSFA 2HIMA 4BNHA 3DTVD 4G01B 3F6EX 3DT6A 5HQTA 5LYJB 1QX4A 4P3PA 4WDQA 1VRWA 2JLRA 2B5OA 4B3DA 2GVNA 1UDCA 1SB8A 2XCUA 1TF7A 4FN4A 4BZPA 4B3IA 1ZOOA 2DLNA 1OH6A 3CC8A 1G8PA 3B20A 1E1QD 1IUPA 2FW9A 3ZD7A 2CLLB 3GLGA 3KU4A 2QMHA 1Z4KA 3JQGA 3V7UA 1Z39A 2BFDA 4P6VF 1JXMA 5FNVB 5K09A 3UV6A 1Y9EA 2FPMA 3O2NA 4LOAA 3VI4B 3G1WA 1CP3A 3PSAA 3JYOA 3N2KB 2PLAA 4EAQA 1TM1E 3HCAA 2DBRA 4DIUA 4QJ5A 5CAEB 1OASA 3ZDBA 2Z6QA 1C50A 1E5QA 3L79A 3RKRA 4E08A 3KAJA 2JFZA 1MBZA 5K3OA 3D3WB 1YQTA 3U7QA 2VDOB 4I36A 1EEHA 1RKQA 4DXAA 5BSVA 5JY6A 1VZ2A 1V4BA 3PC4A 3R3WA 5GWXA 4QGHA 1ZW6A 3MERA 4MAMA 4MRAA 3HJUA 2ZRBA 2CF5A 3W1VA 2PX4A 2YZ7A 3QRWA 2B3DA 1Y1SA 1YNSA 4QELA 1X13A 3DO8A 3STHA 5IUNC 4EI7A 5IHXA 4LF6B 4BV8A 1YL5A 4GECA 3FWNA 2XF2A 3B7PA 3DPSA 4M9SA 3T6KA 4QULA 5BW5A 4ZGBA 1GSAA 3MXTA 1FUEA 3A1SA 1KI4A 5E9WA 2C4WA 4RVSA 1OH8A 2FK7A 4H7HA 4II7A 3G02A 4CXMA 3FFWA 3PITA 4LS3A 3SFVA 3FGNA 4GX1A 5IT4A 4TTIA 2YWGA 1TAUA 5EXSA 2FZLA 4U7PB 1R6VA 1SFRA 3SR3A 4BLUA 5DLPA 4BVKA 3ABQB 5CFMA 2XEDA 2FG6C 2I4IA 2VNJA 4NH4A 3RV3A 1AS0A 1YO6A 1JDVA 1Q44A 2CDAA 2IYNA 2HEGA 1ZLXA 3K0FB 3IOEA 1N5DA 2YHSA 3LWZA 2H1VA 4XR9A 4PZYA 3SNHA 5BW8A 5JI3E 3AM1A 3H7AA 3O73A 4NOJA 3HKBA 1XD2B 2I29A 1Y8ZA 1W47A 3NDRA 5L7TA 1QK3A 4KL8S 4G9EA 2VDLB 1F17A 3NONA 3N8GA 1CB0A 1KFBB 4GXRA 2DWCA 2C3MA 4K9LA 4OBXA 4MPDA 3DBOB 2PJZA 3DHVA 3OJEA 1R12A 4Q21A 4RD6A 3ZWPA 2QY9A 1N3LA 3IESA 5C7YA 3OEWA 1IZ7A 4OKNA 3ZY2A 3EMDA 5EJIA 1ZD1A 3AUJB 5TGZA 3ZWVA 3ZXSA 2WWHA 5C52B 4WUVA 3H75A 4EFKA 3MINA 2JPDA 1HEYA 1GPJA 2O3SA 3DOOA 1MB3A 3EARA 3P9IA 3PNLA 1WW3A 1OYWA 2F64A 2I71A 1G98A 1CQZA 1PFUA 2OG1A 2R8YA 3A3KA 4JFRA 2W90A 4QASA 4Y2SA 5HTKA 3RYIB 4KPFC 1H69A 3LGAA 4YRGA 2WICA 4YT2A 4O4JA 1SM4A 1GRQA 3I1YA 2NIPA 4RE5A 2F8TA 1PZGA 1VHWA 2IPAB 4I50F 2EKZA 3J7TA 1EESA 1ZMXA 2Q1SA 4EI2A 1DG1G 4AYTA 2QP3A 3KEQA 5IAJA 4ZCQA 3VBCA 4YT8A 1JHPA 3ELYA 4QYIA 3OCZA 4QUBA 3JQ7A 3WNBA 1SZCA 2FGKA 2RHGB 1SU4A 4RVGA 4AUKA 4OX9B 2DPHA 2NPOA 2AQIA 2SHKA 2W8BA 3BYZA 3RS3A 1QSGA 2LDXA 3FFXA 1VE6A 2ACEA 4EQZA 1JAZA 3TIFA 4LZZA 3AIOA 1GPWB 1WP4A 4CIXA 1KMMA 2WE8A 2ONZA 2HIAA 3JRWA 4K87A 3UHJA 3R5HA 5DNWA 3OJWA 4QPDA 2XQVA 4FEYA 4W6QA 3HM9A 3TBKA 5FUYA 3VMMA 2QUKA 3AEKA 4GVLA 5IU6A 2BFAA 3RRYA 1LRLA 2X7HA 3LBHA 1ZKMA 1QNLA 2HW8A 3MWLA 2VXBA 4FD3A 4K6OA 4R2JA 1VJCA 3UPUA 3NHYA 1W94A 2A7XA 2P3SA 2V4ZA 3EWNA 5H83A 1OC4A 1RXEA 3QZUA 4HDOB 5B53A 5FAXA 2I9KA 4BQOA 1XJ5A 1R27A 1E79A 3A32A 4XUCA 4Y2UA 4U4AA 5CNJA 2CHVA 1D6NA 4ABTA 1W9MA 5EIAA 2XCIA 2WWYA 4JJGA 1KO7A 1O3YA 3MIIA 3BCHA 5EPUA 1SY7A 1ADCA 1Z6TA 1PWYE 2H1RA 3L7IA 1YFZA 4JI6B 4DE5A 4URZR 4BKUA 4BQEA 1BEZA 2V97A 4MH0R 1HYQA 2Q6TA 1EKXA 1YZTA 1EBFA 3I9LA 4QEKA 3CX7A 3HDHA 3FNHA 3A58B 3KR2A 4EK9A 2BHLA 4U2FA 1YQUA 5EJ5A 2TRSB 2V7VA 3BWYA 5I4IA 1MGOA 1VXRA 2P4EA 4QOHA 3HR4A 3JQRA 2WQZA 4C0LA 4DBVO 4DY6A 2IIPA 3CSDA 3GFSA 4R8LA 4AXBA 5KNCH 1XA0A 2O3UA 4U2KA 1JG6A 3TBFA 2KLHA 3IBFA 4HDSA 3X1MA 3IVGA 3OY7A 4DR1B 3SMVA 3LJKA 2LCFA 2V4UA 4TZKA 4DCCA 2P1ZA 4Q9LA 1L5GB 2VLBA 1F3OA 2ZJFA 3CH4B 3LBFA 1NJ5A 3ZBTA 3PR3A 3ZHSA 4ZQIA 4Z1MA 1OYYA 4BNNA 3LY5A 3DQZA 5H70A 2XPCA 4H08A 2XEXA 5DTJA 2Y0PA 4F3RA 2IELA 3FR8A 5TDHA 5AW7A 4X8MA 3OZGA 1ZKDA 2I67A 3FW1A 5DLYA 3ECAA 2XNHA 3A2LA 3LX6A 4EKDA 2AI2A 3PX7A 3GJSA 3LQKA 4HLDA 2XZLA 5L4NA 2X41A 1BKSB 2DP4E 1B0AA 2FPRA 3VO1A 1A69A 1KK2A 2CFIA 2YZ2A 3OZ7A 2FPLA 4MIYA 4NOKA 4QICA 3QLEA 3UV7A 3F74A 3GZTB 4D9GA 5EJ2A 2DECA 1HQCA 4WNAA 4D9EA 2GZDA 4KIWA 4AG5A 3DH0A 4P80A 3RM3A 1SG6A 2N47A 2E82A 1LF0A 5KI6A 4KQKA 1WXIA 5EKSA 1SCKA 4AP6A 1T43A 5BWNA 2AQ8A 2Q3MA 3P0FA 2VUTA 1TVCA 2YZNA 1NMEA 4TXHA 3GJ5A 3W3AA 3HVHA 1TM3E 3T5MA 4TVSA 2IU0A 2OT3B 3ITKA 3Q3CA 5TR9A 4LGMA 3C1AA 1KE1A 3KOXA 1NSTA 2XGSA 2YMQA 3HU2A 3KYDA 1DEXA 3AG5A 4QDJA 2ACVA 1PWZA 2Q41A 1NX9A 3VH4A 1O4VA 4D79A 2GVZC 4LWOA 2PU5A 3AB3A 4N7RA 1H8HD 2AG8A 4Q1BA 3RR2A 5MN6A 3EPKA 4X62B 2A5YB 1M0WA 3D8NA 9LDBA 3QVXA 3KKZA 1HSOA 4KYIB 2FEKA 2WW8A 3RJ9A 2QAIA 2K5UA 4PYJA 5KPJA 5HJ2A 4WUTA 1EP3B 3DT8A 1JBQA 4E5VA 3ZWYA 1TZMA 3IAM6 4NBKA 3UJ3X 3T5PA 2RK6A 4QGSA 2JI8A 5HJEA 2CBZA 3K0HA 3M81A 5FFFA 1HNWB 3LE8A 5K8VA 4XARA 1RM4A 2IXAA 1P9NA 4IIJB 1QQTA 4HPXB 1WQ3A 5JC8A 1V96A 2ZJ3A 1N6RA 3EFHA 4W99A 4BFZA 3H4MA 1YQEA 4YK7A 4XWTA 2Q2QA 1T35A 3LUBA 1ZUD1 2H1IA 5BWLA 1NBWB 5J40A 3E8XA 2Z9DA 1OZHA 4DNOA 3QPAA 4UXJA 5LZ2A 2ZYRA 3CH6A 3HWX1 3DV0A 3PE4A 3JQDA 3LX4A 1BFKA 2ZUUA 5DVZA 1DHTA 3LQ2A 4MWTA 3WVNA 1OJ7A 1MX5A 2O4CA 4IMRA 2D7DA 1ZITA 5EZ5A 2WVAA 1UODA 4PO8A 2GAOA 4DCNA 4ZOLB 4W8OA 2MSDB 1IY1A 2AUTA 4IMIB 1E7RA 3D6FA 2YINC 2HIHA 3P0RA 3HO1A 1D5CA 2HGZA 3E61A 3H3XA 4HP8A 1USIA 7REQA 3AVQA 3WSWA 4ENUA 4ICIA 1ESDA 1H8ED 2JLBA 2P90A 4OF4A 4CNBA 4YMTA 3A0UA 4RH1A 5IKOA 1OILA 5IBPA 4AO8A 2HJHA 2PH1A 3MCZA 2OAEA 4GPIB 3KE9A 2BFOA 3LLSA 1LX6A 3RTBA 3TKAA 1KO5A 4AECA 2AXQA 4RJKA 4HMOA 4I50A 3L6BA 3CNBA 2GKGA 4JBIA 3LCJA 2C31A 1AJEA 5EZYF 2CXXA 3M3DA 1HYEA 3T5TA 2GPSA 1S4QA 4PRKA 4IGKA 4RZ3A 2G09A 2H4XA 4R1PA 4KLZA 4RZHA 4OIMA 4XWOA 5EOVA 1U1CA 2B5WA 3F6SA 1J5XA 1DEOA 4YAKA 1YR6A 2PX2A 1V3QE 4L08A 1EG2A 1ORRA 3MT7A 4JKOA 4C88A 1SHJA 1I0IA 1TW2A 3FPLA 4BKPA 4DIDA 1DZ3A 4ZO9A 4RJJA 4PCUA 3QUAA 5FPPA 1QBGA 1NVMB 1T15A 3DXYA 2G08A 3GAAA 1Z3CA 5FNVF 3EQZA 3NHUA 1APBA 3C3KA 2XI4A 5J4VA 2QIPA 2VPQA 5CA0F 4RULA 4ZTZB 3FBWA 1WBBA 3A2KA 3TXAA 1Z5OA 1KMIY 5HWSA 2O1XA 2IH2A 2DB3A 3VO8A 2ODTX 3JAKA 3PC8C 3WGVA 1RADA 1NQAO 4ARAA 4INOA 2HT1A 2H48A 2A4MA 4JBGA 3M5CA 1EWKA 3CLRC 3PCXA 4BZXA 5FADA 2IV2X 3OFSA 1K3TA 5ABPA 4BNYA 5F33A 4H1VA 5FRDA 2AMYA 4YMWA 4JI5B 3R7DA 3P9PA 1H0SA 2EJCA 4FZ3A 3GLTA 4CKZA 2XGJA 1EUCA 1FFGA 2ZI7A 4NCXA 5TQ0A 3V8PA 1OWPA 5I7AA 3S2IA 3NDBB 2O5CA 2VWGA 1N7GA 4EBFA 1NA5A 1XVTA 2XUAA 1Z17A 4L50A 1GSIA 3LK7A 1AKWA 1DTWB 1KMHB 3I58A 5I8ZA 3PWKA 1YC5A 4KJZA 1JW9B 4H6PA 4BVFA 1Z6GA 3C24A 3IILA 2H1OA 1TQ4A 3BE5A 2B2CA 2HLHA 1KFEB 4UBIA 1UF9A 4X3PA 3RDPA 1XP5A 3E5RA 4GBJA 3VQTA 2A5JA 3TCXB 3RS9A 4MRNA 3KXLA 4QYXA 2FSUA 2IOFK 3KT3A 2Z1NA 3T0GA 3VZQA 1TC2A 1XKLA 2UZAA 3LW7A 2J6CA 3LLMA 4F9GA 1KR2A 4N0PA 5DPMA 3D59A 2VYQA 4CMBA 5JT1A 3ID6C 4DNPA 2H2WA 2YC2C 1K9VF 2HBQA 4M8IA 5EWJB 3RLIA 1Z8FA 2X19A 4ER7A 2I91A 3OE4A 4CV2A 3DUFB 1GQ2A 3NVAA 3FNEA 4I8XA 1SC6A 2J45A 3RBAA 3V3TA 3RUCA 2NUBA 2AHOA 2VK1A 3URMA 5G0SA 1EVEA 5F4BA 3T5AA 2PWBA 1JWBB 4X92A 5JS2A 1OF1A 1MLDA 1STOA 3P2OA 3BMOB 3MRVA 1T8SA 2B1RA 4AC9A 2QTMA 4DXHA 1KI6A 4ZZIA 2C3UA 1CNFA 3UGQA 3W5CA 2FQXA 4GT1A 3SXUB 3FTFA 4BEJA 3OQVA 3Q4GA 1FNCA 1QB8A 3IQEA 1XDZA 4DR6B 4BJ1A 1YB6A 3G7SA 2Q8QA 1H3NA 2XJ4A 5AJVB 1LBHA 1U98A 5IUKC 4D0RA 1PT5A 3R6WA 1JHUA 3TLXA 4DDKA 5EIWA 2IWRA 1WUKS 3N70A 2MTBA 2PZKA 4DR2B 2PA0A 3W05A 4H6WA 4AY6A 2GO7A 4GXTA 4RGBA 1A4XA 1W59A 3RRFA 3W8DA 1Z4JA 4D2IA 1P4JA 3BHMA 3MMSA 1Q0SA 3OE1A 3VA7A 4JWKA 3LC7O 4C6SA 5I7VA 1EXWA 4NPCA 4E11A 5F3DA 5KAMA 1N8TA 1O2DA 1OD6A 2GLUA 3VNAA 3ILVA 1YQGA 2PK3A 5CYFA 2Q3LA 1E2EA 1FRVA 2VJKA 4QGFA 4QOEA 3ZV4A 3IQWA 4CQLA 3U7JA 5JJKA 1PJAA 1F6DA 2EDCA 4BLPA 3AJEA 3DZBA 2HYIC 2QW1A 3TQQA 3HZZA 4PZPA 4OU4A 1HDCA 4ERXA 3AOEC 3GLRA 2R1ZA 3I4LA 5C8DA 3IDOA 1G7TA 2YNMC 4Y8VA 4D9MA 4Y2GA 1GKIA 3BXEA 3VTKA 3DFUA 2XKKA 3KVNA 3L7AA 5F77A 3IPXA 4JFAA 4D6YA 3E1SA 1D2MA 1A95A 2PUHA 5K8IA 2G1KA 4L5YA 1M0EA 1KVTA 4GO1A 1QCYA 2JAQA 4U7TB 2MOKA 1IBSA 3G0DA 3K8QA 4P9NA 5GPBA 5T3YA 4Y0AA 3LRTA 3WRYA 3Q9UA 2FNAA 4C6HA 5H16A 2PEZA 3CZ5A 1FP4A 5IM4F 1FE8A 3RAFC 1T4BA 4OLBA 5HS4A 3RYCA 1U8UA 3FFTA 4AKSA 4BO5A 1CFZA 5A9TA 4F93B 1L6RA 2BFNA 2XRFA 3U1BA 2CNNA 4IJMA 1W4RA 4KDCA 4DL9A 4OGFA 3O3NB 4OREX 1VIDA 1SKMA 1J9GA 2WBLC 4MPJA 4EVRA 4Z9BA 4DSUA 1L7QA 1LPNA 5BWOA 2IQ5A 2IH4A 3JS5A 3ZW7A 1FFXB 3ZQ6A 3DMGA 1P6UA 2JJYA 1V1MA 3R8FA 1UC9A 4F1WA 2AR9A 3QGMA 1LFAA 3D0RA 1L7AA 3EBOA 3TDKA 1Y8QA 2AFIA 2HLNA 3FPJA 3ZE2B 2D8AA 1FQKA 2ILTA 4MA4A 3WADA 1KC1A 1LDNA 4BNWA 2QUJA 3N53A 2X9GA 2Z58A 4GPEA 1X15A 5FPHA 5CVUA 4FUQA 8GPBA 1GNPA 4AMVA 1I4EB 2CZGA 1E9BA 4BECA 2WZDA 3LO8A 2W22A 5DM70 4UE3S 1HG0A 4WHMA 2NVBA 1MTOA 3NH6A 5AVTA 4DCVA 2MWMA 4UFNA 3IIKA 3KSMA 2B94A 3MAJA 5ALOA 1Z28A 4YPOA 3HK2A 4AP9A 4V0OA 1SBYA 1KY3A 4NTZA 2FKAA 1V7CA 3Q15C 4N65A 2PXAA 4UCFA 5IAKA 5F64A 3EF0A 3B48A 4MQMA 3T7AA 3M49A 3N6VA 1TT5A 1N8SA 4KNYA 5G53C 3C8DA 3AR8A 4Z3DA 3LF1A 4F6CA 1L1EA 3EZLA 4MKGA 4YJFB 3AY3A 3PUKA 4B3CA 1Q22A 2WNIA 4R9RA 3QEMA 3HYLA 2A8YA 5AKLA 4XDZA 1J2EA 4DZRA 3M6XA 3GJZA 1X8LA 3L4KA 3IERA 2P9HA 1KZYC 3TW6A 2P6OA 4DG5A 4N6NA 2BFWA 1YI0A 3NM6B 1FYWA 1M6WA 1WZUA 5TNXA 1LH0A 2VDPB 4DZTA 2Z56A 4HUQA 3D81A 4L95C 1ZVJA 4KR0A 4XUGB 2J3QA 1KK0A 2GN8A 2CLOB 4OPMA 4K6GA 1X42A 2BKXA 4EUHA 3Q8KA 4R5HA 3TUIC 5BUQA 4RABA 2VT2A 4G1CA 3R5TA 1D1TA 1JR2A 4B6QA 5AVUA 4R31A 3ESRA 3FKSD 5JDIA 2PLNA 1D4OA 1GUDA 1II9A 1U0FA 1N5OX 1JLLA 1N57A 4UTNA 3RROA 3HA5A 4OEHA 2R6DA 4B7CA 3IJ5A 5DT2A 3ZDDA 2DT8A 1A98A 4KLCA 4LJ4A 4QLAA 2WOOA 3VU9B 2IEDA 4M1SA 5IVHA 3PHCA 1F60A 1MO3A 3FRJA 4WY2A 1V3UA 3PYLA 1J0DA 2O2JA 3GVCA 3IEXA 2Q0XA 4LVOA 4X41A 1M1YA 5E0OA 3RVQA 1TA4A 3LPDA 3H2GA 1IL0A 4PZCA 4DHWA 5ED4A 3DTVB 3KPWA 2JVIA 3VNUA 1P6XA 2BMJA 4QTZA 4M0CA 1L8AA 3I3OA 4Q9JA 4GL2A 1XCOA 1C14A 3NJ8A 2O8EA 1P1BA 3IB6A 3PEFA 1TPYA 5CD9A 4BYGA 3RKUA 2HTFA 1OX4A 3HKCB 3LL7A 1E6EA 1X1DA 2QPOA 3SR4A 5F52A 2JAUA 1E3WB 2HB6A 4TV8A 3GR6A 4DEXA 2ZUSA 3LOQA 5ALKA 1HFJA 3QFRA 4IIJF 4MW6A 4WY5A 2P9YA 5C37A 2QMOA 1GNSA 3QMMA 1E7WA 1TGVA 3FWYA 3RU7A 4YDHB 4Z53A 3BQNB 1XYVA 2V8OA 4TT3D 1VPEA 4LFBB 2F3SA 3LLCA 4D9IA 3I1IA 4LCJA 2HBYA 5KJFA 3LUGA 4JT4A 1OXKB 3N28A 4AZTA 2IVFA 1IOVA 1O0SA 3HXTA 1B2RA 2BBTA 2GZHA 2QOEA 1F38A 1NI5A 4ZZ1A 4AJEA 1N2CE 3Q0IA 4I9UA 3AQIA 3BE6A 4K0KB 3ND6A 3FA2A 4HPWA 4PFQA 2A1IA 3B1JA 1A97A 3AHGA 4HAXA 5A0FA 2IIVA 1SCUB 3RRNA 4FHFA 4BJ3A 4M21A 3ZZNA 5BVHB 1I1NA 3ZGVA 1Z2PX 3BWDD 4JVLA 3OLYA 1GLVA 3R6DA 1QC5A 3Q7RA 3CCCA 4N82A 3ZVLA 1UWCA 3AJDA 4D0LB 4AJPA 5IZCC 5AM4A 3FMVA 1NW3A 2WRZA 3DMHA 4TTRA 1PD1A 1UFOA 1QX3A 4QO8A 4DLTA 3A9SA 4O4IB 1XELA 1E4VA 4XYBA 2BHSA 1USWA 1XR3A 2CJYA 2HPHA 2WUGA 3UCEA 3LTEA 1G8SA 4RWZA 3C5HA 2IXEA 2C2HA 1SNYA 3DDHA 3PE3A 1SUAA 2FUCA 1PW7A 2D62A 4YRPA 1NIPA 3TB6A 3NC1C 1TJNA 3EXAA 4EFLA 1X9IA 3R6LA 1DS6A 4P7FA 4BMPB 4C4RA 1W5TA 4LDZA 2E55A 3NHSA 3GP5A 3HA3A 5BYBA 5ALTA 5ALQA 2OXCA 1DIRA 3WHKA 4AZVA 4V0KA 4R8VA 4NYMR 3RW9A 2EJBA 4XQCA 3R8XA 3W77A 2BM9A 1NWHA 4KRGA 2QMQA 5L3RA 5M04A 4IS3A 1EWQA 5E8JA 1XZHA 4R9SA 4B4WA 2RGEA 5E6SB 3AF6A 1HT0A 2F9LA 4UXHA 3IMFA 4O1MA 3K0CC 2XDYA 1XRPA 3KLOA 5DLDA 5DWDA 3ZIDA 3TBHA 1ZIPA 2J07A 1ZN2A 3D8UA 1VIVA 3I2YX 3PC8A 1EM6A 1G16A 4LCBA 1RLTA 2VOJA 2WD7B 1QVRA 3UT5A 3W5SA 1RAEA 1E6MA 3OLWA 2CXTA 3NBKA 1ZCFA 2GEUA 3LKBA 4RO0A 3JV7A 1BCRA 3P9QA 4TWJA 1AV6A 1XQ6A 2Z2XA 4F9EA 5F9MA 1XTPA 1EE9A 4WCFB 1WCWA 4DDWA 1EIWA 5ALMA 1RJ9A 2WR8A 1DO0A 1KY2A 3ZQUA 1SUPA 1SVLA 1XJQA 3FYDA 3OWHA 4LC0A 4PPNA 3ZHYA 1TQHA 1E1LA 3L77A 1TU4A 4FFWA 5CGQB 4ZCRA 4BQPA 2F3RA 5JZBA 4FFBA 4KFRA 1N5MA 1L5NA 2V45A 5KPDA 2AC4A 2HSEA 1N2JA 2HBZA 3MWEB 4G8CA 4H7JA 4KWIA 4M1QA 5ALRA 3SHTA 1K86A 3OCCA 4HH0A 4OATA 3QHPA 2QW8A 4UBMA 4RFSA 4Q9HA 1HFEL 3ZE9A 4A03A 3SJCA 2BEWB 3GFBA 1XU7A 4HAIA 4UMEA 5B3KA 1A8PA 2FJPA 2ZTHA 2OA0A 1MB4A 2KPOA 1RXVA 4FX5A 5EN4A 3O90A 5F7JA 5ADWA 1BN7A 5HSGA 4I4TB 1LVHA 1OT5A 4WZZA 3KCQA 5REQA 1B26A 6REQB 1MOQA 2M2IA 2H7XA 3ETLA 2D0DA 3G59A 4Q4HB 5F98A 2JLYA 1RI2A 1UAAA 2G07A 3GO4A 4CCYA 4RW0A 1MV5A 2G6BA 4U8HA 2Q27A 2WKWA 3H7IA 2ERXA 2IC5A 2CHEA 3OMLA 1DELA 1NP6A 3IPAA 3GIWA 3E58A 4RQUA 1DKQA 1LK0A 4RIEA 5C8YF 2ZRAA 3LCRA 5EJAA 2PL9A 3UCFA 2RH8A 4YRIA 2GPWA 1AK1A 1V43A 4ROSA 5K01A 4RDXA 5ALSA 3WZMA 2Q3BA 4G5GA 4XEHA 5JISA 4RLQA 3H2IA 3UTCA 3FTEA 2GD0A 1E58A 3CF4A 2OSVA 4DNXA 3RGGA