2C9DA

Lumazine synthase from mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl)hexane 1-phosphate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
147
structure length
147
Chain Sequence
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
publication title Structural and Thermodynamic Insights Into the Binding Mode of Five Novel Inhibitors of Lumazine Synthase from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 49
structure length 147
sequence length 147
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 2c9dA00
3NQ41 2C92A 1KZ9A 1HQKA 1W19A 1XN1A 2B98A 2A58A 4J07A 1DI0A 2A57A 1NQWA 1EJBA 2B99A 2F59A 1NQXA 2C97A 1KZ6A 2OBXA 1KZ4A 1C41A 2VI5A 1KYXA 1KZ1A 2C94A 1KYYA 2O6HA 1NQVA 1RVV1 4KQ6A 3MK31 5IM5A 2C9BA 1KYVA 2C9DA 1T13A 1C2YA 2JFBA 2I0FA 1NQUA 1ZISA 2A59A 5IM4A 1W29A
chains in the Genus database with same CATH superfamily
1P80A 5H0IA 3UWDA 3FX2A 2P8SA 1EFVA 4XEUA 5LVAA 4DHWA 3V9AA 3SF8A 1U1IA 4BNZA 2CXPA 3MMPA 4FE7A 2ZP1A 2OEPA 4I14A 3LCRA 5FORA 1M72A 3EWSA 3EQ8A 1E3WA 5K3DA 3GDWA 1YR3A 3ILHA 3PKJA 3R5TA 4MUHA 4O2BB 2GXSA 3G1TA 4UQOA 4YRRA 2V3WA 2HNAA 5BV8A 3SJUA 2Y93A 2OCGA 1AJEA 1F60A 4OFWA 2W42A 1FQKA 2E89A 4I3GA 3OHMA 1BW9A 4GMXA 2PWBA 2YH2A 3TUIC 4EMTA 4US1R 3V6LA 4MDYA 4MI3A 5GOZA 2Q4TA 3ZU4A 3WWCA 1ZUNA 3JAWB 2OQ2A 5JJIA 3SYTA 2B8TA 1E6LA 5DU2A 2VAVA 5IZCA 2GPBA 4DDTA 4YV1A 3L06A 1ZJZA 5BSHA 3WNVA 4YUWA 4Z8XA 4QDXA 4UBJA 3ESAA 3JALB 4DPKA 5EIHA 2YWXA 1TZCA 1KAHA 5AI0A 1EBBA 4FR5A 3WA6A 5IJXA 1RAHA 2XCIA 4PPNA 5B3JA 5EIEA 1GCUA 4QU5A 4ENSA 4RY9A 4RZ3A 1ZUWA 1XPJA 1EFUA 3O91A 3AUXA 1OFIA 2Q29A 3LDUA 4OO3A 4BQFA 2C9BA 1JQ5A 3AR5A 3BMOA 1NN0A 4YRJA 2F55A 3AM5A 1OUMA 3EG9A 1LLFA 3GRZA 4K9RA 1IWBB 4JL5A 1KNQA 4RIIA 3ZCTA 1N3YA 3VO8A 2GN0A 2QN7A 4U39A 4CF6A 3W2TA 4QRIA 2CHEA 1ZJ5A 1NSYA 4G36A 4B2LA 1ENZA 4ZT6A 2O19A 2Z0MA 3HO6A 4ZV9A 3DMHA 3LNCA 3M5DA 4BNTA 1Z5GA 4DBLC 4EL5A 2X8AA 2FUCA 1SCJA 1SN7A 5C0OE 3QMMA 3C6MA 4QYIB 1L4MA 4JI6B 1QLJA 1XD2A 1DZIA 1US8B 5IVHA 3WLPA 1PG0A 3KYCB 1KO8A 1QF6A 4BQNA 1OX5A 4KR3A 2Z5LA 5LJIA 3ETHA 3AEYA 4O0MA 1P4AA 3G5MA 4I46A 3IAUA 1DX6A 4JLBA 3ZY3A 8AT1A 1GCOA 3TNLA 3ZVRA 1VBFA 2AXPA 4KZKA 3DP7A 1PK7A 1J00A 3QX8A 4ZOLF 4ZCRA 3P9YA 2PANA 5HCUA 1QPZA 4NJEA 4EENA 1EE1A 4XD2A 2X3YA 2QL5A 6CHYA 5FJJA 1GQRA 1OB2A 1ATIA 2FJ0A 1MH9A 1P4HA 4JELA 5L8VA 1FU4A 1CZKA 2HJVA 3GA5A 3HBJA 3VVLA 2PBLA 1U3DA 4LGMA 2GHRA 3M0EA 1KETA 2NZYA 3CZQA 3JRNA 5LC1A 4KVAA 5LWQA 1M2NA 1U8YA 1APBA 3KZMA 4PFSA 4C7OB 2J4DA 3KWMA 2VDRB 1D6MA 3PUYA 4EK9A 1ORVA 2HV9A 1FUKA 3D2BA 1JH8A 3I1JA 4ESOA 3I9JA 2NVUA 3FHTA 5LUAA 2IP2A 2QRJA 2XYPA 4J0KA 3U3RA 3GLGA 5L3RA 1E63A 4OL9A 1WEKA 5A6SB 5LN1A 1T3TA 1SU7A 2AL7A 4JLAA 4YDSA 3RCBA 1Q7CA 2XMPA 3LC0A 5AP9A 5KOJB 2IITA 4ZIRB 1DBVO 2CVFA 3K32A 1OIXA 1Q83A 1FY2A 1QTIA 1EXMA 2F8MA 2VNKA 1Y5NA 2YV5A 3A4IA 4M98A 4MOWA 4BE7B 1QBKC 3L8EA 1E7QA 5CAEB 1WE2A 1SC9A 3OPMA 2C1ZA 2OKCA 2Z2KA 3FOBA 3NP7A 2W6JD 2X8BA 3I4LA 4QODA 2YVUA 5H9WA 2P4QA 4HDSB 4Y6GB 1Q7BA 4XVQA 4MQLA 4DCTA 4BQQA 2ZSBA 2R1TB 3MPUA 1SXGA 1WSWA 2ABWA 3WQRA 4D3ZA 4V1CB 4ZT2A 1F5NA 4RPCA 1P1CA 3I12A 2ZRNA 3R0ZA 2V7UA 4H2DA 4EYQA 3GT7A 3WBKA 5KVAA 1L3BA 4OSEA 1FPQA 1QAMA 1PQ4A 3A1CA 4L6IA 2QW0X 4K2HA 1PT9A 4R2KA 5DHAA 5IDYA 4CM8A 1WMSA 1KI7A 2CE7A 4DGSA 2C7RA 3KKZA 5K8IA 3OLQA 1Y5IA 1NPYA 1I24A 1TM5E 2HFKA 2WJAA 1H93A 3K8QA 3BJEA 3L9XA 3N53A 4YQZA 2PUHA 2AQ8A 1G8JA 1NZDA 1ST3A 1VLLA 3PE3A 3E6AA 4I9HA 4LAFA 2O7RA 4M7WA 1JLKA 4H1TA 2LV8A 2XA9A 2JASA 4TOIA 3HYNA 4B3BA 1JIIA 1A98A 1R6UA 5JS7A 3ZG6A 4P38A 1NDQA 4E1BA 1Z7GA 2C2BA 6LDHA 1EM6A 2OSVA 5CNJA 3R9WA 1WHTB 2FPGA 5BN4A 1EJ6A 1F8UA 1W1IA 3EAGA 3KCQA 4TTPA 4YQFA 1Q0UA 2W2LA 1L1EA 5JMWA 3BOSA 2MINA 4N9QA 4Y2SA 3QVJA 4K9MA 3L8FA 1GGMA 2IPLA 5DWDA 1JFFA 1R0KA 1O95C 1BMTA 3BICA 3EA5A 2ZRAA 1IN5A 5JR3A 1FBTA 1O94C 4UZSA 3R3SA 2VUTA 3UK7A 4Y6LA 3UW1A 3IAS6 3WIEA 4YROA 5T3UA 3WS7A 1P3JA 5KHLB 3OH8A 4J16C 4L07A 5HTOA 3W4KA 4UC0A 5BN3A 1EUDA 5AVYA 1BQEA 1XVVA 2XSZD 3SYMA 1I36A 4PR3A 3EVTA 3GHHA 3CUUA 2EZ8A 1JI0A 4AZSA 2AZTA 3X1ZA 3K0BA 1M9NA 2CHGA 4KOEC 2D7CA 1RCFA 3W4JA 4DBZA 5LZ8A 4HAIA 2HA2A 3KZ1E 2H9AA 2WUDA 4GZ6A 4HX2A 5E9AA 1OWOA 3RS5A 5K3EA 1QQAA 3IQWA 3KZOA 2QU8A 3ZEAA 3ZZ0A 4N7JA 4KXLA 2A1TS 3NTVA 3M3DA 5AK5A 3DMRA 1FYEA 4IJ6A 4HDOB 1ZWKA 1XPRA 2PLRA 4NAUA 4PN7A 1U0JA 4A36A 3E82A 4DEXA 2O54A 4WN9B 1KPIA 1OAOA 4K6FA 1M34E 5MN6A 2OTCA 1HT1E 1OTXA 1GGKA 2V97A 3K94A 3NHRA 2X4IA 4PRYA 6ABPA 3HMKA 4HNVA 1L8XA 4IM7A 5GV8A 3AKEA 2EJUA 4CKEA 1ADBA 1P1FA 3FCEA 4EUFA 1IMOA 4PSDA 3WRVA 4HL6A 4LDQA 3NTQA 1VB5A 5LDGA 2RHRA 4GECA 1XZIA 1O0BA 4JI3B 2P6PA 3JWEA 4OYRA 5GWXA 2WMNB 5KYWB 3KKMA 2OG2A 3GJ0A 1AXEA 1WBJB 5D6OA 3GF4A 3VZDA 3CJQA 3DOJA 4RF4A 1MTZA 4CLRB 5ALWA 2X8LA 1GAEO 1LWNA 1RYZA 1VCOA 2E7ZA 2O2EA 4Q9DA 2HEIA 1KYIA 1Y6FA 4X64B 1HPLA 1AMUA 1JVSA 4ZXPA 3HNPA 4CTOA 4NY1A 4O3MA 4INAA 5FPPA 1BS9A 1QHSA 3WBJA 2WR8A 1S9DA 2ZUWA 4AXXA 3RVMA 1MAHA 2XX3A 2F9LA 4DLBA 1DG3A 4KRXA 5T64A 4QVGA 4ATNA 4M8IA 1P61B 3Q2KA 4LF4B 2BLNA 4MEJA 1EUQA 2PS9A 2P4HX 2QF7A 3HB9A 5A0VA 1JSRA 3MCUA 1IYZA 1L4UA 3NOVA 4NK4A 4AM8A 3FFXA 3IT3A 1U0RA 4ZMSA 4XSHA 2QI9F 3CVJA 5IFLA 1WMEA 1U9YA 3R7FA 3Q8MA 3LFTA 1GZVA 4OQYA 5ILOA 4G09A 4UMEA 4Y0AA 2QRHA 5BVHA 2R6R1 3HXKA 2JJ1D 2VPZA 3ZOZA 2OVFA 4ZZ3A 3KHUA 1OCEA 1PJAA 1AQJA 2A9OA 1EFRD 4B40A 3ZWAA 2YY6A 4HAXA 2VK8A 3DZJA 3ETNA 4TLLB 4PG6A 4D80A 2FX2A 1U2PA 4E30A 3OJEA 1H5UA 2WDZA 2IDZA 3RV3A 3TR6A 4RA9A 5AI9A 1K0UA 3HJCA 3QE0A 1PFKA 1JR2A 2ZBPA 1O2DA 2G40A 3QOFA 3EFBA 3ZW9A 4MWZA 4QT4A 5KJFA 1OLXB 4RM2A 1N77A 2O05A 1FS6A 1F4VA 4HPXB 3GJ6A 4UU0A 1RM5A 1K6IA 1SZJG 1UJ4A 4TRNA 2XGJA 3WMWA 2PO5A 2WHQA 2W6JA 4KUEA 3AY7A 5AXDA 1RC1A 1FRQA 1W0KD 1XQWA 2A3NA 2EJCA 4YJ3F 4ZZIA 1I33A 2X1VA 5H68A 4M88A 1YACA 4BWVA 3H9UA 4PIVA 1R4NA 1K4YA 4O4JB 3VDNB 3WLOA 4HT3B 1DIHA 3BSWA 3PDIA 1I7LA 1EFCA 1PEYA 2A0XA 3HA3A 4Z0PA 2UYHA 5CA1F 1HORA 1W46A 5BR1A 2IIPA 1PJ4A 2ACEA 3H17A 1H8HA 3IBSA 2WT8A 2E48A 4HGYA 4N03A 4CQMB 2OORA 5C31A 4FXOA 4WERA 3CLHA 5HBGA 1R9NA 3YASA 1NM5C 1CS0A 1UMBB 1G8FA 2LCIA 2ZE8A 4P3NA 3ZHQA 4IOKA 2UAGA 3R7BA 1G21A 4I5FA 3URMA 3AESA 4JOBA 1YS7A 1BA3A 2P3LA 2VDOB 2P2NA 5KDLA 2VZ0A 1L5NA 4ZCTA 2N42A 2UV8A 3LW7A 2WB2A 1FLVA 2ZIVB 1JYEA 1HNXB 4NTZA 2HSJA 1L4GA 1A88A 5H5JA 1YQTA 2UXBB 2EL7A 3CGWA 5D87A 3RR2A 4BNKA 3V1NA 1MX5A 2OHOA 3OUUA 3QWBA 4RGQA 4DWOA 4EIWA 4MDHA 5CIQA 3M82A 2Q46A 2Y76A 3SNKA 3ORSA 4PQGA 2A1IA 4X8HA 3FUXA 4ZGGA 2PZKA 1N2GA 2NAFA 1NKVA 2HZBA 3CH6A 2WSYB 1RYFA 3OSUA 1Q0QA 1F38A 4LDRA 1ZXBA 4O1HA 2VUHB 3OVMA 4I81A 3REGA 1I3KA 3IPYA 3JTMA 5B5SA 3BJZA 1RJFA 2BP7B 3ANYB 4C14A 1TMYA 1J8DA 1EFAA 1E1NA 2XSZA 2IPOA 2XODA 1GZ5A 3RT9A 1U2DA 2P4SA 4XE5A 4OQDA 3SJ7A 5JADA 2VYQA 3O8NA 4OHKA 3A9TA 2BGWA 3TJMA 1XTVA 1OASA 2B94A 2FA9A 1GZSA 2FPMA 2PD6A 3IAS1 4Y2VA 4KN5A 4LDNA 2OO3A 3EA0A 4JMLA 4HUTA 5TT1A 2NZ8A 1PGNA 1TRKA 1VDMA 2R4UA 4DLRA 1V39A 4NP6A 3VR4H 1X77A 4ZK6A 2CL0X 5A1JA 2YINC 1V1JA 3JQ7A 4MUJA 2OVBA 1BKSB 3GAFA 3JALA 3KM0A 3ND8A 2DXIA 2WG0A 4X60A 4BVKA 4K1LA 1QGED 3GIDA 2C92A 4DG8A 2GA8A 2FSUA 5CK5A 3M1YA 1EB9A 1L4FA 2XMZA 5B7QA 4DREA 3DWEX 4L15A 1KYZA 1CETA 1HTBA 3AW9A 3SSMA 2C5GA 1ABFA 3I73A 3OPYA 4C4ZA 4CDRA 3I32A 3KQNA 1WO8A 3JQAD 2DHCA 1RKBA 1GGHA 4ZU6X 5EMLA 3WI7A 4Y2QA 1UBUS 5CITA 5ITVA 3EDRA 4F1KA 4EHFA 4TTRA 4A03A 4YP6A 2EW1A 1LBHA 2J31A 5LYJF 2YHSA 3G23A 1UQUA 1C80A 2PU7A 3K7EA 5EZYB 3SC2B 3GEMA 1A9SA 3T4UA 1VTKA 4DJTA 5JNSA 3IMGA 1U94A 3DQZA 4TXHA 2Y27A 1YQUA 3QFHA 4LRXA 1XQ6A 4ZI3A 1TA4A 4TVOA 4EPTA 1G3QA 5EIAA 1L7VC 1S5PA 4F85A 1C4OA 1DQPA 2P9BA 3GWGA 3ESDA 2KQUA 4B4UA 3GCGA 3N5KA 5B1IA 4HNTA 3EIFA 3HWRA 3KYCA 3UCFA 1XPUA 2MSKA 2WA2A 4NABA 2GJ8A 1W4ZA 1OWMA 4FKZA 2AF3C 4LPSA 3UKOA 1YDMA 4F5WA 4HNRA 1E1RD 3C7CB 5B55A 1OYYA 3ELBA 3LQKA 3CNQS 1IB0A 3KEGA 4EG6A 2O59A 3EC7A 2JJ1A 2X6QA 3H1BA 3IVRA 3KUUA 2R8PA 2P0EA 4OGKA 2C0CA 1QTRA 1NLUA 2XYRA 2JIZD 2O1SA 5FKJA 1EFRA 3HADA 5JDCC 3ZUPA 2FCAA 3AUAA 5JRZA 3F5FA 2VO1A 2VJCA 3ENZA 3OPVA 3WKAA 4C7OA 1HKUA 2PKQO 3D0RA 3MWGA 4JVMA 1J2UA 2EYQA 2QPLA 2ZXFA 3ZV3A 4LYEA 2WUEA 2FXIA 3DEZA 1XO1A 2J9GA 3C0KA 2EZTA 1PG2A 4HUJA 4AG6A 1OB5A 3Q87B 4FCCA 4YT5A 2HMSA 4TRJA 1R8YA 1JKFA 3QVOA 4P3PA 1ISHA 3PB3A 4BFYA 3JCZA 1KVRA 3OZXA 4B4VA 5IDQA 1RRMA 2FEPA 4AUEA 5T4HA 1P77A 2R6GA 3AL2A 5PGMA 4B3XA 1C3EA 4CU5A 2CFSA 1SU8A 2GN9A 4FBMA 4F12A 1GTZA 2B8NA 2HCJB 2GPWA 3B48A 3A3YA 4MVJG 4V0OA 4DSAA 2O0LA 4ZIRA 5KOJA 2OC4A 1W0KA 3AR3A 3D8BA 3TKAA 2Z3VA 5M2QA 4MUYA 3RWBA 2OC9A 5G0WA 2P2ZA 1SUIA 3CNLA 3S8YA 3ETLA 2X8WA 5K01A 3VR6H 2RHOA 2P9JA 4KBGA 4L5IA 3UMGA 5KOHA 2XB2A 4PAWA 1NF2A 2EKQA 3L4SO 4IG9A 3W8RA 1QU2A 2W2PA 4BVHA 2ZE6A 2BFNA 2E6KA 3ZUGA 3CV3A 3G88A 3LQYA 4WNYA 4NMMA 2ZW9A 4RC9A 1L5OA 5HG0A 4H1WA 5AW6A 3O83A 4BVBA 2GCEA 4E12A 1DDOA 2GEJA 4V1CA 3BULA 2JGLA 2TS1A 2DR0A 3E8SA 3EMBA 1Q5PA 2VDNB 3FUVA 4LA4A 2FCRA 2ZR7A 2UYGA 3MIZA 3C6ZA 2OV2A 2AA3A 3S7TA 4RVUA 4QRDA 2WQZA 1C30A 3A2LA 2AZ4A 1UCFA 3F6CA 4QUIA 5AKZA 4AZTA 4ARBA 3G79A 4JEMA 4ITVA 2X4DA 5HFJA 1JMVA 3DJFA 4Q19A 3B1XA 3O4GA 3B60A 1OWNA 3OHPA 4RA6A 3V1UA 3J81k 1RAGA 1YGPA 2JB9A 3H11A 1ND5A 1Z4JA 3QI2A 4A27A 1YZNA 1CQPA 1S3GA 2RGUA 1QONA 1UBGA 2NZVG 2YJ5A 3QSGA 4BNXA 5A4MS 1WHTA 2BFBA 2VP3A 1R8XA 5E6RB 3LY7A 2AOTB 4B6OA 4CQNA 1II8B 3R6WA 4E13A 5EJ9A 4B3MB 4P34A 4ZO4A 1S8NA 2C2ZA 2VDJA 1R74A 2C5BA 3CLUC 2Q41A 3GLQA 3FYUC 2I33A 1PYGA 3BREA 2WZBA 5IUKC 4E2XA 5ICCA 1P3Y1 5CH5A 3KFXA 4DMLA 4YUYA 4BRWA 4RXTA 3I5YA 1Y8CA 5I9BA 3U7GA 2J46A 2WABA 4M9UA 5FV4A 1D6NA 2OV4A 2NU6B 3NFRA 3PZRA 4XARA 3L77A 4F2GA 1FP4A 2CNNA 3L7AA 4GMKA 5AYVA 3I04M 3ZD7A 1FQOA 3EEQA 4RJKA 1V4BA 1QIKA 2VJKA 3UMSA 5KOYA 2Y0BA 3K0SA 2UZ4A 3DLHA 3PX7A 1I7SB 1JDVA 4FFLA 3EVZA 4S0ZA 2QUHA 1ZNQO 4N8DA 3AFGA 5EN4A 4P8RA 1CHNA 1B1CA 1XK6A 4N3CA 4CEJB 2UYCA 4IGFA 4J4TA 4NBWA 5HM6A 2F67A 1P1HA 3TZKA 2F8SA 1T1EA 1HA3A 2IY9A 3HBFA 3C6XA 1B43A 2VYFA 3U9TA 3LY5A 3NP9A 3WJAA 3BTSA 1K7FB 4ADSG 2ZIUB 4NPCA 1ECCA 2WFLB 5K0EA 1YVRA 1Q19A 5CG2A 1P5FA 5LU8A 2A9KA 1X1DA 5EIFA 2NYRA 3B5IA 2BTQB 1TJPB 3JQAA 3HJNA 3Q12A 4KH0A 3LS2A 1I01A 1TL7C 2RK6A 1TO1E 1M7GA 4R4JA 4WNAA 3OX3A 4TYNA 3HV2A 4E5KA 3MYYA 4Z2AA 2M32A 1AKEA 3EZ6A 4BVLA 4G0MA 5AOBA 3PCTA 5HIMA 2VBFA 1KY3A 1Y6JA 3LLSA 1O4WA 1XDSA 4AJNA 5KYWA 2FOXA 1MIOB 4OXIA 2P9YA 3NVMB 4BFLA 2ZAMA 3S2FA 5KC9A 5DRTA 4KQ9A 4EF5A 2YBDA 5GGYA 3ESYA 4KAJA 4Y1RA 3WLAA 1HOTA 3DDWA 3E9DA 3G2LA 4KXNA 3TLGB 3VPGA 1GO2A 4LF7B 3IRUA 1CQZA 4RQUA 1VL1A 1ZJ4A 1XZBA 3G8AA 1C29B 4JT4A 1QX4A 5HFAA 1EBUA 5EEGA 1EDDA 5EINA 5SY4A 4DC9A 4H7HA 1ZGAA 1P6QA 1KKLA 3A6FA 3GZNB 5AQEA 4LXXA 3LQ1A 3T5DA 1KEPA 4Z3OA 1X7ZA 3VSCA 2NU7B 3R2JA 1E1RA 1M66A 3NMUF 1PK8A 2FPXA 1ORIA 1SBZA 3OTQA 4JODA 4W7SA 5LLSA 1PT7A 5C32A 3CLTC 2V6FA 3UT6A 1PQYA 4IQ0A 4GMHA 3NEAA 3TUZC 4R83A 1KZHA 3LP8A 1ECPA 2YXNA 2ZYUX 3LFUA 4YR7A 2VF5X 3H1AA 4HRAA 4OFZA 2RI1A 3HB1A 3ZK9A 2HMUA 5FPKA 1EYZA 5MN4A 2B4RO 5D8DA 5CEFA 3TG8A 4U1RA 3PC8C 5HFNA 3CEPB 3P9NA 4ZU1X 5AHRA 5HILA 3SQXA 2JFZA 1F2VA 1LF0A 1H6DA 4CCAA 2UKDA 5EQDA 2FMHA 4MQFA 2J4FA 4A26A 4HGNA 1PNTA 1YCGA 2WKSA 3N7AA 4R8RA 1T15A 4S24A 5EEHA 4ZT4A 4ALIA 1IJEA 4Y2GA 3TR0A 3OCJA 3ZBTA 5FJIA 3TTUA 4A1OA 3RSQA 2BF7A 1YZYA 1V5EA 2TYSB 3I42A 4YMVA 3D2LA 1W1UA 4FWTA 1EJBA 3GT3A 2YTZA 3QMVA 4D8VA 3WMEA 5HMMA 1EP1B 2ZQZA 4X41A 2VTBB 2NO5A 5BXYA 4NVRA 1CB0A 1Y8RB 1C1XB 1ULTA 2X9VA 1OLXA 3NDBB 5ADUS 2EX1A 2QDXA 1J0CA 3CY6A 3EY4A 4FD3A 5L4LA 3MGGA 5DBOA 1V7ZA 3WRYC 3MSCA 5ULLA 4C7BA 3P9QA 3CX7A 2IZZA 2QN6A 3Q3EA 1P29A 3FVRA 2Q1SA 3DF7A 1KFJB 2DKNA 4G5QA 4YRGA 2FH5B 4BNDA 5BT8A 4MVJD 1W4RA 5DT2A 5FOUA 1Y5RA 2NTYC 4PZCA 3NG1A 2R6JA 3O4JA 2R7AA 2A1TR 2GTIA 1QHNA 3K6RA 3V48A 1WCXA 1X14A 4ERNA 1W2GA 5FUQA 2KX7A 1MUUA 1A1SA 4IDEA 1QFSA 1OJLA 2OBFA 2PR2A 3KNZA 1F6DA 4NNOA 1UZLA 2JAHA 4S05A 3H5IA 3TSZA 1NRJB 1NVMB 4G4IA 1L6IA 1UODA 3WGZA 5TC4A 4V0KA 1NY5A 3QVWA 1DIOB 5JPCA 1W52X 5IBPA 3QVVA 2DHQA 4RNCA 4HC4A 1FUUA 2C54A 2H59A 4AKHA 4JB8A 4YJFA 4DIBA 3D3JA 4MHSA 1ZONA 3H86A 1KERA 3TL6A 4EG0A 5KMGB 1QR6A 1XR3A 5ALGA 1BCSA 2P1ZA 1KWKA 5K4AA 2HQ1A 3U7IA 3PNQA 1EFDN 5FI5A 3EWAA 1IEXA 3O8BA 3S5UA 4RVSA 3FWHA 1HFEL 3PTLA 4B48A 2HJGA 1BX0A 1CB7A 1DB3A 2G9UA 3A9SA 4GBGA 1IEQA 3BC1A 3C4QA 1Z6ZA 2Q1WA 5IVDA 3UMBA 1J8VA 1F17A 1M6EX 4CKBA 1A69A 3OFVA 1PJ3A 2Z43A 4ZAFA 4OHVA 5K0JA 4AYXA 2YN4A 2DKOA 4FOSA 3PG5A 3P2JA 4J91A 2VHEA 4M1YA 1JN0A 5JI3E 4YQEA 1J8FA 4J8PA 4KQXA 4TLBA 3VPDA 4MW5A 3OY7A 4UU7A 5DVZA 4JC4A 3HDQA 4B6EA 5HTKA 1HR0B 2E5LB 3IHTA 5G1NA 5LA6B 2G9VA 3ZHVA 2IU6A 2Q1XA 1G5QA 1CDEA 2D1FA 4M55A 1JEJA 4YRFA 5LMUB 3O8QA 2C8LA 3VTAA 2C5AA 1LPOA 2E9SA 5FYDA 5KPJA 4RD6A 3QU2A 4IDNA 1Z4OA 2QZ4A 1THZA 2HA6A 2NYUA 3FF4A 1NKTA 5TXGA 4W7HA 1WU7A 4B6JA 1JFLA 1JZTA 1XHLA 2XUOA 1RKUA 3I0MA 2ASEA 5ES4B 5HRCA 1LLDA 4C06A 4JJGA 1CZNA 5CB4B 1VXRA 4A16A 3JPWA 1JHOA 5JAMA 2EBWA 5AUPB 2E4WA 3IS3A 4PTYA 2PLFA 3GJXC 1D2RA 4EBFA 1YZUA 1MZVA 1M6VA 4GIBA 5AKEA 1SVOA 4G8BA 4HRVA 4R31A 2FPWA 4W5WA 3WKDA 4FW9A 1CR2A 4OLJA 1YZTA 1RRKA 4G81A 4ZJYA 2UUAB 3U44A 4IF6A 4G4GA 2XE4A 1D9ZA 4C3VA 4E4TA 1QK3A 1XELA 3ED1A 4L8YA 3DEIA 4HAZA 2FKNA 1OQAA 2C5SA 3KXLA 1A9OA 3FJ1A 3PXAA 4H7PA 3CUTA 4HK4A 3FTNA 1BE6A 3DFUA 2FPIB 4PSUA 1NBME 2H5LA 1C8BA 4P2BA 5LKAA 2I91A 2H1WA 1Q1GA 2CVQA 3ESXA 4X63A 2RB5A 1KBOA 1Y42X 1GILA 4G97A 4KWTA 4QJ3A 2OE2A 4G41A 1C9NA 1FYFA 4L08A 3IP9A 1MO4A 3CB2A 2CLMB 5ILQA 5AW8A 3A1WA 1AZTA 1FNSA 3OOSA 3QUCA 5T4FA 5A3JA 2ONKA 2J6IA 4CBVA 3NCTA 3MJDA 4TLCA 3MGKA 3PWKA 5AH0A 3PWSA 1CULC 5D5PA 4AURA 4EQZA 2AD1A 3GFBA 3D4IA 4V0QA 1WXIA 4XW2A 1GKLA 2CLIB 3AP2A 5DGCA 2PGJA 3BRCA 5C7LO 2PUCA 2Q6KA 4GGPA 3I6BA 4G1CA 5FPHA 3L40A 3ZE2B 1DIBA 3QVUA 4TTAA 3K2QA 5ADWA 1NE2A 1LF5A 2I6UA 3FDZB 1JDPA 1Q91A 1ZOIA 3DMTA 3KSRA 4P93A 4TMTA 5KSWB 1U2GA 1GN8A 2RFLA 2XVZA 3OFNA 4L95C 1SZDA 2AOVA 4GL4A 4B2PA 1Z83A 1L4HA 3IR5A 2XE7A 1W93A 2X2EA 1JEAA 5AR1A 3A4NA 3U7QB 4JP8A 3LHDA 4CG2A 3NM5A 5ISMA 2AG6A 3EAFA 2OY0A 4DTIA 2YV3A 4LF6B 4TT3A 1KDTA 2Y0PA 3NYIA 1UBCA 1JKIA 4ZOAA 2RK4A 1J24A 4L9SA 3ZJ5A 4QAQA 2GBCA 4E7OA 5KTYA 4Q01A 1VL2A 1RXEA 4KXUA 4BGEA 3M8KA 1G8GA 2O50A 5K09A 1XA3A 1IG3A 5H3LA 5TVKA 3SEFA 3DP9A 4GVLA 2R85A 3DXFA 2R7MA 2H4XA 4LBVA 1M67A 1RP1A 3C15C 3IMCA 3GD7A 3OA0A 1OBVA 4UCWA 4EO9A 5CGZA 1ZJWA 3GFRA 3L6UA 3N0XA 1XBTA 4D57A 1GGNA 4ED9A 5KWEA 5CTJA 2XNJA 2OZEA 3DC2A 4ZQCB 1WETA 1HQYE 4E0BA 4IJQA 1GEEA 1Q0ZA 1UKCA 1ZZEA 3NJ4A 4K46A 3RSZA 1DRJA 2I9PA 4JIMA 2Q5HA 4L9WA 1TT5B 4WN3A 4F6RB 4YCNA 1PQUA 4EDHA 3P0JA 4M9CA 4MVJA 1NWHA 5JXJA 2A94A 3GY0A 4JL8A 5EGSA 1CUEA 3FN4A 2W43A 2R6FA 1WQ4A 2WJIA 4PPQA 1PE0A 1SKQA 2AQHA 3DG9A 2PL5A 4NRDA 1W85B 3W7BA 3GQBA 5MGNA 4Q3BA 1U0GA 3OCYA 1B6GA 3C39A 2B6NA 2I6GA 3UJ8A 3VV3A 1KF0A 4L5BA 4R1MA 1Q0PA 3V8QA 1JDTA 3LVBA 4TV8F 4CTKA 1X8KA 4B7ZA 1UBEA 5I7SA 2WAMA 4LNUA 4X61A 2IEAA 3ZCXA 3ICVA 5J23A 3ANNA 5JWOA 4ZAYA 4N18A 5FFNA 2XRZA 3DBRB 3P96A 1EDOA 1IVYA 1PEDA 3K0AB 5KQPA 2X13A 3A4VA 1GSHA 4INJA 4UHFA 3UB2A 1OT5A 2CCKA 2J5BA 4MLPA 2COEA 4Y1FA 1S4MA 1QRRA 2I3GA 4GR5A 3DM9B 3DB1A 3LCVB 4LRTB 1H4SA 3TZBA 2NXNA 4QHTA 2Z2YA 4RIEA 4TZTA 1CV2A 1VSBA 1ZH8A 2PUTA 3KQPA 1OI4A 3KCNA 2P5YA 4Q3DA 3WNQA 3HUDA 4DR4B 3GGGA 3H9GA 5EMJA 4D44A 1HDXA 2IOHA 2JIRA 2QMZA 2AOTA 2QR3A 3GFTA 3R0JA 3URKA 4CDGA 3JARB 5ANRB 2GCOA 1BE1A 2BKLA 3PWTA 2W6CX 3ND6A 2H4WA 3QEJA 3W79A 2WJ6A 4LWZA 4BLWA 1VOTA 2X14A 3VO1A 3RRXA 1HFJA 2C2GA 1BEZA 2C94A 2NXCA 3K5IA 2D62A 1JEDA 2PKWA 3AUUA 4MUMA 3W3AD 3RTCA 4DT1A 4ID9A 1D5CA 5C51B 4Z7JA 3LVFO 3V00A 3IOEA 3ANLA 1EH5A 3KG2A 2GRUA 1IZ0A 2A0YA 3MTGA 2O8FB 5GJVC 5TV2A 3GFPA 3W34A 3D7KA 2D0DA 4E5PA 1EVEA 1RT9A 1TFUA 1DJOA 3T1YB 1NG9A 3E9EA 1QCCA 2C9CA 1W4LA 1RMTA 2YMPA 1NQ5A 1PFGA 1E2PA 3QF4B 4KBYA 1PWYE 2CMGA 4CODB 5I7EA 2XDQB 2YMMA 2HJRA 1TAQA 3QPVA 2CXXA 4CL3A 2HF9A 2FZLA 4J0HA 2B2NA 4R1PA 5KNCH 2E1PA 3BGWA 1XU9A 2PT7A 3GC6A 4WPGA 4FHEA 1DSSG 5TF4A 3EPLA 3NDIA 5J4LA 2ZR0A 5AW5A 3PDHA 2E87A 5CLLA 2BTQA 4HWPA 2WFZA 2W6IA 1WDKA 4RD4A 5G4KB 1O97D 4MHOA 1F3OA 3FCYA 2C59A 3U80A 2IU0A 2B7LA 3U26A 2J07A 2QK4A 5BN5A 1ZRHA 2XHEA 4LWOA 4ZVLA 1Z13A 3D7RA 2WHPA 4DVGA 4EGSA 1MIOA 2PZJA 2R48A 2OQVA 2EWMA 3ZS8A 1Y4SA 4RD2A 1R18A 2VPQA 3T0IA 1T6XA 2ADFA 4J3FA 3TKYA 2AW5A 4OJNA 4KYTA 3T8YA 2W6NA 3SDZA 1OBCA 4DQ0A 2JEZA 1OA1A 1B93A 5TIIA 1PT5A 1UC9A 3V7WA 2GBLA 3P9ZA 2NQTA 3R5KA 4MW7A 4B6GA 5F1OA 2FFRA 1T5HX 2B5VA 1JQDA 1T2CA 4OAOA 1J06A 4H15A 1PNVA 2YHIB 3LK6A 5E95A 3PSAA 3F6PA 4URUR 2SKEA 1SKYE 1REQA 3DBIA 1GZHB 1V1RA 1KARA 1X7XB 2XVYA 2ZIXA 3A6ZA 4FINA 4ML3A 5GPBA 3T3DA 2YMLA 3GU3A 4MV9A 3NHJA 1NF3A 2IYOA 4DS3A 4BCDA 2WSSA 3GLFB 2H85A 1TQDA 1QCZA 4EPXA 2WFMA 5IWCA 1PT6A 2GBGA 1KZ6A 2Y68A 5CDSA 4DPMA 4OIMA 4DA6A 3L8ZA 1GFSA 4EZBA 1PWHA 1HYBA 2XD9A 2D1YA 5H7XA 3W1VA 3L0SA 1Z0SA 5EHGA 5CNKA 3X2FA 3HLKA 4FS3A 4R8VA 3P2EA 4I50B 3T7SA 1X0XA 4KYUA 1I0ZA 3OPQA 4NZOA 1NW7A 2R86A 3F1KA 2ZJ6A 1QSGA 3GEPA 5AXAA 4F7DA 4EHLA 3SMQA 1ABEA 2WAYA 4CV3A 3CWCA 3M6UA 1BXGB 4KDEA 2OV3A 3N2IA 4MYCA 1RSZA 5JI2E 1BDHA 4DV0B 2ZSEA 2F00A 4M83A 4D8UA 4M89A 1FC0A 4FFNA 1HYGA 1NJ2A 4N0DA 5IAGA 2FY8A 1LTQA 2CVPA 4IDGA 1T5TA 4GZ5A 4E5VA 3LKZA 3QP9A 1DARA 2LVBA 2ZJBA 3MUEA 3E0QA 3HJAA 3QEMA 1X70A 2RH9B 2XZPA 3F6EX 4LE2A 1CIVA 1HLGA 1EXWA 4M7OA 4YRMA 5JZMA 3GPLA 3I2IA 4G8CA 3HS3A 3ZLVA 4KC0A 1GSOA 1CEEA 1T8SA 3WGNA 1N57A 2NSHA 4RF2A 2QIOA 1E0SA 3NB0A 1J97A 1N6OA 2JGNA 2B1GA 2PCJA 5JSFA 4YUXA 1XQXA 1JHMA 4IUCS 2C31A 4ZPXA 3WV4A 1NQUA 1OIVA 1SVMA 2I71A 3E81A 4MS1B 4U9HS 4F3CA 5C18A 3LVRE 1KTIA 1K68A 4Y18A 3M3PA 3N7UA 2FSHA 1UWKA 2Y71A 5DV9A 2C7BA 1A9TA 3KAJA 3NUGA 4YDQA 1ZRNA 2YWHA 3DXYA 3JZDA 1XQYA 3MRTA 2BEUA 5K8CA 5TNXA 3VNRA 1MABB 4HMPA 1KBZA 1IQ0A 1PEAA 4DIUA 3TZEA 3BGIA 1R0YA 3ZJ4A 3LHFA 2WYOA 5CDGA 1WM1A 2OENG 2WJWA 2XUAA 3OPXA 4KI7A 5P8WA 1ODSA 2BJHA 2JBAB 1JB1A 1FRVA 1NUHA 2WWWA 2X1MA 2GERA 1FLNA 3GLUA 3KC2A 2OAGA 2ZSIA 3OLWA 3ZLTA 5CB0A 3BH6A 4O4HB 4RPKA 1N6KA 421PA 2XTZA 3I1IA 4PZLA 3E48A 1U8XX 2WIFA 3QLUA 4E32A 1MA0A 4LSGA 1Z0IA 3UG6A 2R5WA 1Z2CA 2GNPA 3C48A 3W7AA 3DR5A 4DYDA 3H2HA 3DOFA 3K2IA 4BE4A 3LUJA 1UDWA 3W3AA 1DCKA 1G3MA 1LJ8A 3DXXA 4N12A 1VE9A 1YRWA 3LWNA 3O7WA 4GSKA 5COAA 4ZANA 1H0HA 5FTNA 4J3NA 4FN5A 5KS2A 4IVRA 4DW8A 3EDQA 3BTUA 3ENQA 4LXQA 4ZVMA 4EY8A 1C1DA 1G59A 1FS4A 4W5JA 4M1KA 2PX4A 3EWNA 3OD1A 3VNUA 1PX0A 3FRHA 2VTKA 3PQDA 5LA6A 4UBOA 3UFXB 2KJQA 3I6YA 2PEZA 1PJBA 4OLFA 4ARAA 6YASA 3M1LA 1AIPA 1BDBA 1QM5A 3MWJA 4DRZA 1A8QA 3KUXA 5JVDF 2QMEA 2FFAA 2JFPA 4K88A 1IHUA 2VNIA 1FVXA 1BIFA 3QXXA 3ITDA 2JNWA 4RUKA 2BGLA 3QVTA 2QX8A 2PRZA 3H7AA 1QGZA 2D1RA 2G82A 3DULA 3MB5A 4IVPA 4XFDA 3OUTA 4DLSA 1E7WA 5CB4A 4URXR 3GVHA 5LQRA 2EJWA 1E8MA 5CPBA 5JV5A 2OBXA 1MAVA 5J47A 5EHQA 3T1TA 2GN1A 2RHWA 1UFOA 5ICGA 4MYTA 3B8HA 3RAEC 1N6IA 4Q24A 1B6SA 1NLFA 4E3WA 4V3BA 1O5TA 4CCSA 1OZAA 1PR5A 3OIGA 3OZUA 5I7AA 2JLUA 1W73A 4DB2A 3TW6A 2I29A 2H2IA 4F9EA 4N5DA 4Q05A 2XY4A 3PRHA 3U4AA 3RK1A 2QTGA 2Y6VA 1AZSC 4A5OA 3O4VA 2E4UA 3GG9A 1W76A 4XJVA 3SIWA 3PXBA 1XCMA 1Q84A 4TKMA 2YW9A 1WMDA 5I51A 2ZRLA 2D13A 3CX6A 1E0JA 5LMNB 3IDAA 1WR8A 3LC1O 5LXTF 2KE5A 1LS1A 4M9ZA 4CM5A 3A06A 5IT0A 5IJAA 2RK3A 1ZK3A 2TMGA 1U3VA 4V38A 3WICA 1IVSA 1NQVA 4EHHA 1AKYA 4FMPA 3LX4A 2BKXA 3JVUA 3AHEA 4H17A 1RMYA 1YXMA 2L69A 1WG8A 1QHXA 3OF5A 2WD9A 3DT8A 1VP9A 4MITA 4R54A 5C8DA 5JBQA 4Z1MD 1EX6A 2JIQA 4EF4A 3JQRA 2YX1A 4FVTA 2G67A 5IW8A 1SOWA 3DMNA 3K9CA 4B8WA 4D0LB 5JRJA 2B69A 4B33A 1FSGA 2OB2A 3IR6A 1Z75A 3L6RA 4BB5A 1ZJYA 1EGHA 2VPXA 4LBWA 4N8SA 4DRYA 1AM4D 1IY1A 1VKHA 3AHIA 1WXGA 1JEYA 5KKAA 1ZD5A 1U9IA 1GAXA 2H1CA 1M2WA 3LWDA 4R1QA 4QVIA 3MNFA 5BR4A 3C7TA 2LPMA 2L19A 3EVFA 2RAFA 5I3ZA 2G9NA 1OC4A 3BTVA 3KKPA 4WT7A 3PGA1 4JZYA 1U7UA 621PA 5IULC 1P9OA 4UFNA 3QZUA 4MV4A 1XHFA 1T9DA 2ZTUA 3GFSA 4G1VA 2Q7XA 3H9CA 3X1DA 4B5LA 1QG4A 1AE1A 1ZIXA 5LD2C 4QOGA 1VRWA 4YB8A 1EGMB 5G41A 3RRYA 4BJHB 4D9GA 3W8EA 2ZDHA 4LN1A 3CEJA 3UHAA 4D3XA 2HW8A 4Q3LA 3AF3A 3T3GA 3NV9A 1UDCA 1TT5A 3WLRA 4WHMA 1EK6A 3HDYA 1ZU5A 5FUWA 2P78A 1GUAA 4F60A 1M54A 3ABZA 1L7QA 5C1OA 1Z25A 2RBKA 1J20A 1P3DA 1YDFA 1JJ7A 2GAOA 1CE8A 1OWPA 3DD5A 1TTTA 3LT1A 4AKTA 4OATA 1TQ6A 1G17A 2BSXA 3R40A 3USZA 2I34A 1NG1A 4Q7EA 5HJEA 3GZJA 1IY2A 3ADCA 1CFZA 3WL3A 2HBZA 3MD9A 2H65A 2O5CA 3V8NA 4CCYB 1YA4A 1U6JA 4F4HA 2G70A 2HCBA 1JFRA 5J2TA 2ZYHA 4KLCA 3DBRA 4BVGA 1E5VA 5K0ZA 5IHPA 3VO9A 3K0AA 3O4FA 1R6VA 2J32A 3WJ1A 4GKBA 2J5QA 3QIAA 2XCRB 2H7YA 3SJZA 2I8AA 3QE9Y 5ERGB 2ZRBA 3SNHA 4BLSA 4P5PA 4ZRNA 1A2QA 5KUTA 2MMCA 5T67A 3WL8A 1N2BA 1UAAA 1T5IA 2YIJA 1I3LA 2C4NA 1AGNA 2GWRA 1UWCA 1VZ3A 4W9NA 2BMVA 2YY5A 4M86A 2FOIA 4AUNA 5C4IA 3DKPA 2QTLA 1QP4A 3JR7A 3EHEA 5SY9A 1IH8A 2DPXA 2DMRA 2ZTLA 1SULA 1AQIA 4JYMA 1R88A 2R8OA 3F96A 5F77A 2UYQA 2QD5A 2D1QA 3AFMA 3FI9A 3H0CA 3QF7A 4I55A 4OQMA 5DP2A 1L7NA 1PGPA 2OQRA 3HUUA 5I7UA 1KZ9A 4L6CA 1XN1A 2OSBA 2XRFA 4Q21A 1XJ5A 3WB9A 3GLGE 2QIPA 4N5MA 4FYMA 3F46A 2EKZA 3OCUA 3EGWA 2W2OA 3FZNA 5ALDA 2QQ0A 2E6UX 1AF4A 1KZ4A 1P0QA 3MT8A 4N9WA 1JZSA 4PNHA 4NMXB 4R05A 2O8FA 1RACA 2A5LA 2I6SA 3H3FA 3BXFA 4LOAA 1V9LA 3S3TA 1PZGA 3RC8A 2NV6A 2RI0A 4LNHA 4PBSA 3VYUB 3HNRA 2PXXA 2PH5A 1AF7A 1GPDG 2FI1A 4HHEA 4I2NA 2WUFA 3X2SA 5ENDA 3UJAA 1S3FA 2ZBDA 3N3BC 5CVDA 4C4TA 2H1IA 4J6EA 1NX6A 5AVUA 3KP1A 3WDMA 1DBQA 1UKAA 4RHXA 1C9YA 5FBRB 4IDDA 3CSDA 1RYDA 3GJ8A 3P4XA 1YAJA 4B2YA 5ITWA 2CEKA 5F51A 1G7CA 2X4LA 5E7MA 4EAQA 2C4TA 3E61A 2IOQA 2DQYA 2NU9A 3KYJB 3NDJA 1X9GA 2BZ0A 2IZ1A 1KEVA 1IBMB 1DVRA 4BL5A 1V96A 5ILGA 4JYBA 5M5BA 3JSXA 1UL1X 3UH1A 4CLXA 3JX9A 4FZ3A 3ENVA 2HRCA 2AGVA 2DWCA 2WOOA 5EJFA 4A0FA 4C0KA 4FX2A 3HG7A 4BTEA 2ZWIA 1XRRA 3FCAA 5LFAA 3QKSB 4ZI2A 1RU3A 3HRHA 2O7SA 1E98A 1HRKA 5NLLA 3RREA 5B64A 4EVQA 2OAP1 4HAWA 2Z58A 2Q3EA 2O23A 3JQGA 4FJ1A 5DSTA 4NNJA 3H75A 4PC1A 3DZHA 3NBQA 3GFGA 1DUIA 1EX9A 2D8MA 1QIGA 3AR2A 2V7PA 3E3AA 4QPNA 4Z1MA 4R9SA 2DEUA 1PU2A 1PV2A 2ZT6A 4I1IA 1U28A 2JCVA 1T0BA 2HD4A 2VS1A 3BPSA 3GUZA 1MGPA 2RSLA 3Q8LA 1T6NA 5CFQA 4TMXA 4MJ7A 4BFVA 5TX7A 3WGVA 2CL6X 3BJMA 1AU9A 3GLFA 3EGIA 2BHTA 4E6EA 4K26A 1VSUA 3QKRB 2BEWB 3FWZA 1T5LA 2PX5A 5FPSA 5DLEA 4A1FA 5B2FA 5HZKA 5LQKA 5FQOA 5L3VA 1RXVA 3NBMA 2GPSA 4CMIB 5K8JB 1SELA 3NC1C 4UFOA 4M1SA 3U56A 3LQ4A 3BXEA 2PKRA 1QOZA 4F3RA 3F97A 4BLPA 3LV8A 3AYXB 3Q85A 2RGAA 4CKXA 4CR8A 2I3DA 1YJCA 3S4YA 1E2EA 4RZQA 4UVHA 4Z3DA 2I65A 2IYRA 4NOKA 4OHUA 1LPBB 1A76A 3K09A 4K87A 1BXGA 3UOGA 1M0TA 3N6RA 3LUCA 5KKCA 4P86A 1NHWA 1TUIA 3LHSA 4I4IA 1DX4A 2DFDA 4NCHA 4J2TA 2J3QA 3QPUA 4WFIA 1QZ3A 4J6FA 5KDOA 2NV0A 3UXYA 2RD2A 1U1GA 3G2IA 3REFA 4DC0A 1IJBA 5CIYA 1N5MA 1W44A 5HIAA 1GG5A 5IJZA 1OH6A 1BTOA 1M1UA 3WQHA 4P1ZA 1QZXA 4CR6A 2BUCA 4MW2A 1GQQA 1WXQA 5C80A 2NO7A 3G89A 1G20B 1BX3A 4L8WB 3RK4A 2ZJ8A 1ZWLA 4BDSA 5IABA 1KO5A 1XD9A 3LGXA 3I4FA 1IZ8A 3V4ZA 4GZ3A 1DJPA 1UPFA 3LCJA 4WK4B 3O1HB 4FT2A 3QE4A 5DBEX 3RYHB 4QO8A 3CPSA 1H6AA 4RL6A 3W4IA 1VA4A 3NUQA 4MYDA 1JILA 5DM70 4ZT7A 3F5MA 5FL7D 1YTLA 2M98A 1B1AA 2QUBA 3HLTA 1FYWA 3IMFA 3KK0A 4KB5A 3WGTA 1VE3A 4EKEA 4QQ8A 1C7QA 2FXVA 3W2HA 2FN8A 2LKCA 1ECGA 4LSWA 4BS9A 3IGFA 3Q98A 4GAEA 4WL0A 3USCS 4DABA 4P80A 2IEIA 5ECGC 5AXCA 4YN3A 7REQA 5KNBD 1E4VA 4PEVA 2C3MA 5EPUA 3GMDA 3VZQA 4FB4A 1PJSA 4QTUB 2QP9X 5EP3A 2XCSB 1FTNA 2ZBVA 4JQZA 4O5AA 1AQ6A 5A3SA 2DETA 2EFJA 4WXRA 3WK7A 2A1UA 3G2PA 1RHQA 1FUIA 3G2JA 4KO3S 1JJIA 2WVAA 4R7ZA 5DI3B 4C76A 2OD7A 4DADA 2AFHB 2JF0A 2F62A 2O6LA 5JAPA 1RXCA 1YJ5A 5C8ZA 1MJNA 5F2KA 3EGXB 3NRJA 3VBEA 4RELA 5CHEA 3IXLA 1U4SA 3OO0A 4ENTA 2AK3A 1QVAA 3QFTA 5REQA 1WLSA 1G7SA 1EEHA 1Z56C 1ODIA 1OV4A 3AEZA 5A02A 3KJEA 2G0TA 4FMCF 4N5LA 4YV0A 3DD1A 3HDHA 5EIBC 3ZJYA 3Q41A 4TUYF 4Q9JA 5E9WA 2EXXA 3E23A 3H0EA 3H5VA 4JBHA 1XTRA 2BI7A 2V5VA 4I8DA 1FYVA 2IXTA 4MRSA 4QUHA 5IXYA 1L8OA 1OBFO 4B5KA 1E2GA 3EY9A 3RW9A 2CDCA 1U4NA 3AQ4A 1V1MB 1XTJA 3GJ4A 3AP1A 1EVIA 4TKLA 1C1HA 1MDBA 1YR1A 1M1XB 2EL9A 3L18A 3DM5A 1ONSA 1Q11A 2A8YA 4PCLA 1UPBA 5JAZA 3PEUA 5H16A 4FC6A 5C3UA 1JNYA 4RTQA 1RI5A 1F7VA 1M1NB 4XLZA 5DH9A 2PIAA 1DMRA 4GLFA 5JXGA 4IR7A 1F2TA 4GI1A 2P9GA 3SHWA 4BBZA 2QLMA 1N25A 3OTHA 5J5VA 3H2KA 1BGWA 3DZGA 3IPAA 3GR6A 4CFYA 4G56A 1V4VA 1XDBA 3KXKA 1UPCA 1LVUA 1RKVA 4BP8A 1T91A 2IUTA 5E4JA 3ZQ4A 1P2SA 2RHDA 2XZDA 3GGPA 3GCWA 3HDGA 1G21E 1WS6A 2PA3A 3A28A 4F2HA 5ARDA 1VKNA 3ZDZB 4WLEA 3IOCA 3L4BC 5DM1A 3TSYA 5BORA 4K86A 3RVBA 1JV2B 3KUDA 4DIFA 1TGVA 2P7IA 1UXOA 1WCIA 2XMDA 3DDSA 4C7XA 4M2LA 3TZCA 8GPBA 2J9XB 3G8BA 4G0YA 5DM60 2V4MA 4DA9A 3BGVA 1F2UA 3C3EA 3CCBA 1THTA 3JWPA 3O95A 3NONA 3Q7SA 5KCMA 3UATA 2HCFA 4NV0A 2IZ7A 1ORDA 4ACAA 1E4EB 2POQX 5P21A 3HKBB 2VI5A 3PNVA 4LV8B 3LDAA 5ALUA 4QYTA 3GFOA 4FEGA 1HDOA 3AJEA 4MWGA 5H1YA 3PC3A 4C1NA 5CG1A 5KYYB 5F64A 1TADA 4AO6A 2Z83A 4RO0A 4PLZA 2VQFB 1QYDA 3N8GA 3CSSA 4Z9AA 5TVGA 2B99A 3WYCA 1Y80A 4O2AF 1Z3IX 3LHIA 3RUDA 2AXQA 1J8MF 3ZQKA 3PPWA 3ZDRA 4BPRA 4JEHA 1XLWA 4D25A 4Z4EA 1NUAA 1YI0A 2G17A 5EE9A 4GU5A 2F1HA 4JGBA 4TTJA 1NW5A 3NVAA 3SCZA 1KI2A 3RYIA 3TTTA 3S2ZA 1T2EA 3CG4A 3OF2A 1HK7A 4BLQA 5I6DA 1OD6A 3FE2A 3RFVA 4NZMA 2AE1A 3OC6A 1GDTA 1HV8A 3FNGA 3WIUA 1HXHA 1JG7A 4OYYA 3JRXA 1NF8A 4GBJA 1EWRA 1L5YA 1VBKA 2I1WA 2QRKA 4JBWA 4NMLA 4G8DA 5TMEA 5DNCA 2XB6A 2VUIB 4BRZA 1PS0A 3M70A 4BLUA 5IUJC 3QU9A 1A9QA 1VJTA 3Q10A 2EF0A 4XX0A 1IXYA 4IWNA 1X42A 2Y4NA 4E51A 2BEKA 4IDPA 3BEDA 2NADA 1EB8A 3GGCA 3QWHA 3RS2A 5AJYA 2ZZMA 4QPPA 1N9GB 1WNTA 1RAAA 1RTKA 2XYHA 3NORA 2VJOA 3OFKA 3PQ2A 5ELLA 5K5EA 3PU6A 4WKCA 1C2YA 2W4QA 3HBAA 4CF5A 4E5MA 4EFNA 4V2UA 5JJBA 2NN3C 4MS3B 4CF7A 4DARA 1COWD 2HN9A 1J0EA 1JALA 5EQFA 3QG5A 3SS9X 1J7JA 2HU2A 2ZJZA 2AOXA 4S1TA 1GFZA 4EY5A 2NU8A 3BUSA 3WGQA 4BLOA 5JZSA 2CXHA 1ISGA 1RIFA 3CX3A 5DW3A 4EGQA 1MR3F 3FHJA 1Z68A 1GTL1 2DYKA 4RFSB 3RAJA 3F1LA 2NO1A 4I6GA 1UP7A 1Q0HA 4X7BA 3B53X 1JQEA 3GLTA 1V16B 1HNNA 5FL7A 3N0TA 4PSCA 3DAOA 2IHTA 4EY4A 1QBGA 3UK2A 3FWKA 1C3OA 1TKRA 4M1QA 4TMZA 4CCYA 1TF7A 2P5SA 2ZSDA 3A04A 5IYZF 5JDIA 3A4LA 4DLKA 1GPLA 3IAHA 3WB0A 3QITA 3E1SA 3MCAA 3WWYA 2OYRA 4BNJA 2EG9A 3QHQA 4DE5A 2YWGA 4COOA 1CP2A 3C1TA 1FVHA 2JH9A 4ILEA 5K4GA 2Q6OA 2VNHA 5KHOC 2QG9A 4PG5A 3SHFA 4R71A 5DPMA 4FZRA 1VHDA 3EIQA 4Y9SA 3W5IA 4PGGA 1JHRA 5HKLA 3KOUA 2COKA 4GI3A 3K5WA 3TLAA 1F0NA 2O8EA 3KOYA 2VQEB 1Z06A 4OLAA 1GPKA 3I9NA 2LP4Y 1LD3A 4HD8A 3TD9A 2C8JA 3GLIA 3P9KA 1RBMA 4LC0A 1WRBA 2CLKB 3E53A 4PYMA 4RVOA 3HB4X 4H7EA 3FH0A 4X7MA 4O4IA 5KAPA 1BKDR 1YU9A 4LMBA 5CVEA 4B3CA 2RC6A 3QVGB 4L8VA 3BXHA 3KHSA 3D5EA 4FK8A 1EK2A 4D5GA 1XDGA 1FSPA 1UC8A 1N9ZA 1KXZA 3N8DA 1JIQA 5F7XA 3ET4A 3X3HA 5LDDC 3NNSA 4LZNA 1TCVA 4KRFA 5IDXA 4KFCA 1XEXA 3NHKA 3PEVA 3PVSA 1XU4A 5AKGA 3MJTA 4YA6A 3RSCA 5IZCC 5JAUA 1W94A 3K15A 2LIPA 2DBRA 1RYBA 1JQLB 2PUVA 2R8XA 3LLCA 4OBBA 4AKGA 1PNQA 3T41A 1ECLA 2HHJA 5HR5A 3TBFA 5DHPA 3KB6A 2W70A 1JX6A 1A5ZA 4FI3C 1A2BA 4JVOA 5F1PA 1D1TA 5B3JC 3WHKA 1XFDA 1XTQA 1TK2A 2W48A 4ZYTA 3CR7A 1Z74A 5LCXA 4DLLA 1Q57A 4ZXFA 3F9IA 1TKCA 4DG9A 2VWPA 1LU9A 4D81A 3MXOA 3UXEA 5HXAA 3AG5A 4C0HA 1BG6A 3I2FA 1WW3A 1MW9X 8ATCA 3OZFA 1LGYA 2I3AA 4WWHA 1UM9B 1ZMXA 3D3NA 4UUNA 4ZCSA 4EB8A 1E6WA 1GZ7A 3CBGA 4PXSA 1A5TA 1SURA 1Y1RA 3W2GA 2YKGA 2O14A 3BWMA 3IFSA 2ZANA 2BI8A 2LTAA 3O84A 1ZM3A 4FZJA 5E1DA 2QTFA 1P74A 4MGHA 2OXIA 1XWIA 1QC5A 2AD5A 2IYLD 4UM8B 3ZE7A 4AN0A 1RTTA 4RZXA 1K1EA 4GQBA 1O5OA 3SC3A 1ZQ9A 2FRDA 3REQA 3W7VA 3NT5A 1YQDA 4GP6A 1KYYA 4UW9A 3ONWA 2I78A 4WESB 2P79A 3QKSA 4RK1A 2DFVA 3BB4A 4XGNA 5E3JA 3RFTA 2L18A 4C0WA 2ES4A 1ZOOA 1OAKA 3ETGA 4YJGB 4S1NA 5A4FS 1NI4A 2O3JA 4FJ2A 3HCBA 1NVUQ 1UFQA 1OGYA 4RCZA 3RYCB 1N6RA 3TAHA 2GESA 4RJJA 4AXBA 2OZVA 3TD6A 4BNYA 3K9FC 4BQRA 3T1VA 1XQ9A 5H81A 3FMOB 3P2YA 2ZQ5A 3RIXA 4ASUD 3O8RA 2NTEA 3C7DB 4UMFA 3OX4A 4JGGA 1JHAA 3NU1A 1T5OA 4JXJA 3OLZA 1F3LA 2B6HA 1CNMA 3RAPR 3PQ5A 4TX1A 3MT7A 1ZNWA 3P0RA 2GH1A 4YTEA 4BO6A 5IWAB 3DVQX 4MTLA 4X85A 4UHJA 4BO3A 4UOZA 1CUUA 5BUQA 3DVRX 2PDAA 4JITA 1U5CA 2QL7A 1R5BA 1HFKA 4RCYA 3H2YA 3LUFA 3TL3A 1GPAA 4PZYA 5DYIA 1E3JA 2QXYA 2Z8YA 5PNTA 3ZKWA 3KV3O 2EQBA 3MB8A 4WZBA 4U6QA 4D0GA 5FA8A 1QKKA 2ZROA 1U7HA 3DNPA 2V9PA 1E3QA 3MRSA 4HSEA 3RRZA 3IBTA 4L7VA 3KVNA 1JG6A 4U9UA 4INOA 2BBSA 2ET6A 1L7EA 3UMVA 1N5KA 1OXSC 3AVOA 2WKWA 1KBQA 4JDUA 1CUIA 2OGUA 1WLYA 3CZ5A 3VUEA 121PA 2DBZA 2O7QA 2WIGA 2DC1A 2ZI4A 2P11A 3EHDA 3MTAA 2JD1A 4QDUA 3PLAE 1IWOA 1OLSB 2YWEA 2IC5A 2K2WA 3PFHA 5ALMA 3IEVA 3I8XA 1QCDA 1UBLS 1VFPA 2OCAA 3B52X 4AG5A 2RH8A 3DE2X 1LRKA 1RHUA 5U4QA 1GFWA 1DC4A 2HQOA 3CM0A 3AI1A 3EGDA 4TYQA 3RWMB 3ZBUA 4UU1A 4ETWA 1VSVA 3LIIA 3L0CA 1P4RA 3IO5A 3H4IA 1NBOA 2PQ6A 2IOYA 3L7KA 2ZSUA 2ZUTA 4ROSA 4ZVTA 3HJUA 2V0NA 4N39A 3WV5A 5CK4A 2ZT7A 1TEHA 1K7SN 3C16C 2AEJA 1Z2EA 2FMFA 2EFYA 5DHSA 1IQRA 3W6ZA 4C6TB 2HADA 2I4LA 3D8UA 4MLZA 1N6PA 5B57C 3ZYZA 1TMOA 4KTVE 4FYJA 4UPDA 2J9FB 2Z30A 4OGLA 5C52B 2H11A 1QIFA 1P6UA 1WA5A 2JDID 4JROA 1GNTA 3RIEA 1STOA 5K6RA 2R00A 3ET5A 5DT9A 2C3OA 1T6YA 4FNAA 3E15A 1WKVA 3GJTA 3E70C 3OEEA 3W77A 4BNFA 3MCTA 1KOLA 3B9PA 5BWBA 2GUWA 6REQB 2KW5A 2IFTA 2RGCA 2HDNB 4EEXA 3HXOA 4DB4A 2CV1A 3MQ2A 1MOSA 4RYDA 5TPWB 3TKLA 3TTXA 3NRCA 4KFSA 1CZOA 4QGSA 2IW3A 1P1RA 3EGXA 4MW1A 1YR7A 2O8DB 4ALLA 3OZTA 1XA4A 4X1YA 4P7GA 4LDAA 1USIA 4WXHA 4AG3A 1P1BA 4FYXA 4BJ6A 3TE7A 4YRAA 2QRMA 1R66A 3IUQA 4IF4A 4AJ1A 3BXPA 1MLDA 3UT5A 1AVTA 1KJJA 2B82A 2J45A 2GVZC 5CU7A 4JYPA 3U3XA 4PW0A 1SA0B 2YDXA 1EUCB 1BXKA 5LPNA 3RU2A 2NPOA 4D6XA 2OHJA 4A73A 3UKDA 1BA2A 4CRWB 4DKXA 4ZT3A 1MRZA 1OC2A 3M4XA 3PXDA 4HF7A 1W34A 5DCUA 3NC4A 5HGXA 1OAOC 4N8EA 4Q02A 4X8LA 3CNEA 3BXZA 4B3SB 2JL1A 4LK3A 2BM0A 3VYTB 1NLZA 1UXIA 2L17A 1PTKA 4MV6A 4JQCA 1JLMA 2WT9A 4ZEVA 1T6BY 3SYRA 2IEYA 2A2ZA 4TWBA 4IEEA 4XAQA 5GONB 2RAVA 3LKVA 5DTJA 2RGRA 5JIBA 2VH5R 5DNWA 5TS2A 1R3DA 3PICA 2O57A 3KR2A 1ACMA 5EKXA 5JY6A 2QDKA 5C53B 1XZGA 4EG1A 5LLDA 1XF9A 2OO5A 1ZM4A 3HDTA 4KWCA 2P90A 3D6UA 1EG2A 4TM8A 3ASZA 3E5MA 2VSOA 4X3OA 3K2EA 5FUMA 3IEKA 2O48X 1U1EA 3SVZA 4HH3C 1NVTA 3FXAA 3L1KA 4OMUA 4X1IA 1DRKA 3DKIA 1YBHA 4KPUA 1IIBA 4DSOA 1E9SA 3CRQA 4JFAA 4RKYA 5LQDA 2CBZA 3D3KA 1YD7A 3DUFA 2J7PD 2X9QA 3FDXA 2YRXA 4KNWA 1E9RA 3UMCA 3FGZA 5DGTA 1N34B 1Z8HA 5FBZA 1BDIA 1E4EA 3ZGXA 4EM6A 3HKBA 1UC5B 4W6ZA 1YRYE 2WIBA 1YGYA 4YX9A 4TV9A 1W5BA 3DPUA 4NEHB 3BKWA 1MQSA 2J6BA 2WI8A 2V6GA 3EZYA 4RHFA 3OZGA 3FYUB 1RWBA 1FSZA 1RJDA 2PCLA 3JQBC 3NS7A 4GP9A 2GOYA 1ZXXA 4CVNA 3VVCA 1R8JA 4WVLA 3IJ5A 3WFZA 3ZNOA 3EUEA 4BNVA 4MQMA 3CKYA 4DZZA 4LVNA 4MVWA 4RBNA 1LVHA 2QNBA 4XR4A 4WBNB 4U7JA 1EGQA 3P2IA 1DTWA 1L4BA 3C5HA 3ELDA 1O9BA 4MI6A 5HOEA 1GA1A 1IU9A 1M2EA 3TSOA 4H1HA 2W6QA 3BZBA 2SCUB 5EYPA 1K6JA 1PJQA 1RVDA 3N87A 1A8HA 3O31A 4HGPA 4WZ6A 1QVZA 3AGQA 1BXRA 3DE5X 4NMWA 3UJ9A 3U6KA 1JSLA 4JI5B 4NQRA 3JZMA 5ALFA 3BIWA 5IAEA 3O82A 4PLGA 4XQCA 1JECA 3SSAA 3T7EA 2VFAA 2Y2UA 4CGZA 1K3FA 4M76B 1KYWA 1JVBA 4RAQA 4YDRA 1N6LA 3OZIA 5DOVA 3UTDA 3SHQA 4FMDB 1TEVA 1DTEA 4FCTA 2Z3ZA 1HE2A 2J5KA 1T1SA 5A7HA 1SBYA 5KSYA 3IQZA 1RJGA 3V4PB 2H9YA 3EUFA 5TMBA 4P4NA 1JE0A 2ORYA 1COZA 1T9HA 2CXQA 4U3JB 4UTXA 5EWJB 5J9FA 2QUJA 4FYPA 1BQ4A 4NYIQ 5DBIA 4EZIA 1NF9A 3IHKA 5GJBA 2WPNA 4CMJA 4Q3AA 3OECA 1RAFA 4GMFA 4QASA 5J2UA 2D59A 4N40A 3IQHX 2H00A 2HUPA 3GV0A 5BV2P 2OBBA 1Q7RA 4XB2A 4W5TA 1WTAA 2OORC 2FPKA 1ISFA 4ARZB 3AU8A 1M2GA 2ID8A 3MEQA 4FFOA 5DNAA 1V16A 3R5XA 4ITRC 4C3OB 3L0DA 1TX4B 2IRWA 2JLAA 2CLFB 3WYFA 1HX7A 3EOZA 3UMRA 2KLBA 3T9DA 5CB6A 3OKPA 5TPZA 1M8GA 5CFMA 3DCNA 2JDIA 2AN9A 3SBOA 3S8EA 2Q49A 4BYMA 4O4IF 3ZGVA 2Q3DA 1F12A 5BP7A 5C4GB 4C2BA 5CMLA 3EPJA 1XKXA 4U2KA 3UWSA 1K3TA 4KN8A 1MO6A 4LRSB 1LI7A 2V55B 2X2OA 4LE0A 4GD3Q 4KVGA 4U7HA 4Y6OA 5HCNA 4CLDA 2DOKA 2XAAA 3EW7A 1TUBA 3QLTA 4KO2S 3DFIA 3U4QB 4W1QA 4DLAA 5LOVA 4JSYA 1NWCA 1GPH1 2WYVA 3ANSA 3E9CA 5I9MA 1BCRB 1N5LA 1V8DA 1XT6A 1MX3A 2CUTA 4L0DA 4LS3A 1LK5A 1BS2A 1VBMA 3DKRA 4FSXA 4JJ8A 3I05A 4KR2A 5EWMA 3LYUA 4G85A 1J5PA 3C8UA 5IASA 4AQDA 4W5QA 3GARA 4RPIA 2ZPUA 4P0QB 2RHHA 3R1IA 4AWXA 5FUYA 2PU5A 4KAAA 4B47A 1OAAA 1TRHA 2ZI5A 3MK31 3HI4A 1ZGCA 1J42A 3I4CA 3WWZA 3ZZNA 3ETEA 4QQNA 3OT5A 1JAYA 3W5VA 1TIKA 3ROQA 2HWXA 1OI2A 4FFDA 3PUKA 3T7DA 4CM4B 5K0TA 1WABA 3VZBA 4BKUA 3O3CA 3F71A 1FSFA 4MVJE 3A27A 1K6MA 3D8SA 1C7JA 2D2XA 2WTAA 4PE5B 4D79A 1FOEB 1RJEA 1P8JA 3UAGA 4DRXB 5K99A 1GY8A 4O2BF 3NRBA 1Z2DA 2HRRA 4XUEA 3DFKA 3STVA 5AOCA 4MAAA 2BLLA 4OJYA 1G7TA 4F5EA 1H2BA 2JCBA 3IEUA 4XZ3A 3CMMA 5HPYB 1SG6A 3JVEA 1G64A 2G72A 5E1MA 3S81A 3KSMA 4GHWA 3A8TA 4RSMA 4HDCA 4CG3A 1G8PA 4RAOA 4UE3S 2BWJA 4ZVNA 1KJWA 1HE8B 2HU8A 2D6FA 4DQKA 3LUDA 1M6HA 5IAOA 2JHCA 4M8LA 4NG4A 1FRFS 1JAHA 1Z18A 1VRCA 2PQMA 4JA0A 4BWGA 3HXTA 4KIUA 1CX9B 4BECA 5FWNA 3P97A 4HY3A 1JU4A 1GGFA 4ER7A 5DIFA 3GP5A 3WLHA 1KP9A 1SHTX 3BZUA 1K27A 1YI1A 4YRLA 1CZHA 3RSLA 2J7PA 1LLQA 4Q1EA 3JYOA 4FQ5A 4DNFA 1F7UA 3PC2A 5J5CA 3F5QA 4WESA 3MINB 4MDFA 5HDBB 1WZ2A 1ESNA 1N75A 2ZCJA 1X7WB 1PFUA 1PKXA 3VPSA 4PAOA 3VNVA 1EK1A 2ZS8A 3SDBA 1VPLA 1Q6ZA 1JA9A 1K4KA 4Y7CA 3DBHA 1M1YB 4FE3A 2O2YA 4PHGA 5FBKA 2P3SA 1J23A 4J43A 5HDQA 1IXKA 2M6KA 3RYCA 4LMAA 1FJGB 3EEBA 2QN3A 3QKUA 3UO8B 1ECFA 4CLOA 1PS9A 2ZG6A 4YHHB 4M54A 4ANFA 1NMXA 5DM4A 5A0TA 5D3ZA 5JCJA 4ZGBA 2O3RA 4XIIA 4CGYA 1KJYA 3A9RA 3D6JA 1DKRA 1VGQA 5CJ2A 3TVYA 4MKXA 1MRNA 2IYFA 2PRKA 4B0OA 4DEYA 1N2CA 2WUGA 4E33A 4F93B 1LPSA 3CMCO 1TQ8A 4XQGA 4EFMA 1DUVG 2WB4A 2FUKA 3INGA 3SM9A 2C97A 1Y8QA 3Q88A 1HGXA 2DTEA 2FSVA 4OUKX 4TVKA 3NEYA 1IIRA 3VX3A 3WKCA 5A9TA 4JC0A 4PONA 1E3EA 2FGKA 2JCSA 1P1JA 1C2TA 1FP1D 2OCXA 1IPFA 1PHPA 1OROA 2MOKA 3PUJA 5DGIA 3WIVA 1KR2A 4B6FA 1PR6A 1UINA 4ND1A 1XRNA 1IOLA 1H8ED 1NXPA 1HETA 4WA7A 1BWQA 1JEQA 5TY0A 4ND5A 5I8ZA 3H4MA 1QKIA 2XDYA 2BEJA 5FLKA 2ZYVX 3T15A 3W0LB 3A1UA 3PNYA 4QFCA 4RVHA 3Q3CA 3Q7PA 2QUKA 5J4KA 4HB4A 1LA2A 3Q3JB 2AFVA 4Z51A 2GZHA 4BEJA 5JBIA 3NC0C 1VIAA 1P18A 4TT8A 4NAHA 2J87A 1AK1A 2WU8A 1X7GA 1I1NA 1I4EB 5K7SA 5EY5B 2IUFA 7GPBA 3VTFA 1JL3A 1YWGO 2EW8A 3M3HA 3ORYA 4TPKA 2J7KA 4BNUA 3C8ZA 1UK9A 2CHVA 2HA5A 3OZ7A 4FTWA 4F86A 4MK4A 3WAGA 3RADC 3AKDA 2CJXA 1DWPA 4RMJA 2H29A 3FYDA 3ZZMA 1U7ZA 1VHLA 4OYLA 5GQSA 3FZYA 4EB3A 5KTRA 5CDFA 1KFEB 1CLUA 2NTJA 3L7DA 2GLTA 4L73A 2H48A 5AHXA 3S2SA 4IMRA 2J08A 4A0SA 2H0RA 3O8CA 3ROMA 3LWZA 3QE2A 2OWDA 2HJHA 1WUYA 3PJDA 2XKJE 3ES9A 2WW8A 3GLKA 4L7QA 4PWYA 3SMVA 4ENVA 3QOXA 4JDPA 3GD5A 3KQTA 2X0KA 3G0DA 2NOAA 3V33A 3ZIAD 1PQPA 2FSIA 4H77A 4GYYA 4NENA 1PGOA 1B41A 3GCZA 3SICE 4WJLA 3OTGA 3REOA 2PA0A 5CNIA 1VHQA 3DE3X 4LE1A 3FHCB 3RUPA 4CCWA 1ZH2A 2OA0A 6REQA 5K0GA 2QAIA 3IBFA 5HRUA 3FRIA 4JUDX 3AY3A 3M6LA 3RT7A 1Z4IA 4XYLA 4F3TA 4N5NA 1JVNA 3FPSA 3HUTA 1MQ8B 3WMFA 5KYVA 2FG7C 4BVFA 2X5XA 2O8DA 1LS6A 1I7PA 4B3HA 3PIDA 2AQIA 3VM6A 3ZV6A 5KZMB 3P9PA 4GRAA 4BN0A 1PWEA 2HCRA 2DULA 4R1NA 3WMXA 4J1TA 1GTSA 2W71A 5K6AA 1CG6A 2BFPA 1ZKMA 3IQGX 5A7GA 4R5HA 2R0QC 4HDKA 8ABPA 1EUCA 1HZZC 4QTZA 3CWZA 3CTMA 4WNCA 2FFJA 4M0LA 1G6OA 5SYNA 1A7KA 1MC1A 1C0EA 2P9FA 2W5UA 1F51E 1NN5A 1PUXA 2B78A 2HH9A 3AETB 4YAJA 2NWQA 1SXJB 2BPOA 2H4JA 3TLMA 2OESA 2I8LA 3LXRA 3ECSA 5K9ZA 1N5RA 3O6VA 4IVQA 5DNDA 5K0LA 4LDZA 5B4TA 4MJ3A 3U1TA 3EVDA 1RZVA 1U98A 2H2GA 2PK3A 1NJ6A 1PF7E 3WIBA 4GL2A 5AW4A 3HL4A 1DC3A 2C4UA 3H7IA 3HACA 5GONA 2JIMA 2XF8A 4M87A 4EW2A 2YMQA 3AV3A 3GNSA 4H7DA 1V5IA 4YP0A 4J0CA 4MLDA 4MIEA 3IIMA 1L5GB 1XK7A 3Q7QA 3R7WA 3KHTA 3NBZC 3OIDA 4DOMA 1KDPA 4UREA 1M2VA 3S70A 1P19A 2XXAB 1TM3E 1IM2A 2EQ5A 4FW8A 3V1YA 1NJFA 1H5QA 4V24A 3JWGA 4JUFA 4HRYA 5EVJA 2NYAA 2VUSA 1IQPA 1N8TA 1U8TA 2NUTB 3RAGA 2B25A 3HN6A 4DM7A 1K3UB 4I1RA 2VXYA 4MRAA 4QA9A 4V2IA 2BVNA 4MZDA 3G02A 4K9SA 1WUTA 2MDTA 2PUJA 1JPJA 4A9AA 5IC5A 4URVR 2WE8A 1XL0A 3SHTA 5A2GA 4RMGA 3NGXA 3VNSA 3BWYA 2ATCA 3VNAA 1QU3A 3B36A 2ZZNA 5EMHA 5COQA 1T36B 1BD3A 1NHGA 3OJFA 1X8XA 5EXXA 4BN4A 4EG7A 2GHTA 3CIOA 4ZEMA 5I3CA 2A9RA 2C3UA 2JGMA 1U2QA 1RM4A 3E8XA 3TRKA 4BEWA 1OLUB 3RV4A 4DCNA 5C8YB 3JATB 4BFCA 3D0KA 1H9AA 4OJQA 4R2LA 4Z9BA 1J90A 1K75A 1ES9A 2QPOA 1Q1QA 3KLMX 4P82A 4A15A 1V8ZA 1XCPA 5JQGA 3RFFA 3GUYA 4NFSA 1JBQA 1H4QA 4NAVA 3SC4A 3OFSA 2HDWA 3Q11A 1X8JA 4FC7A 4YPVA 3PNLA 5D7NA 1HE4A 4U7FA 3CLKA 4OQXA 3NTOA 4DTCA 3JW8A 4W5RA 4JZKA 3DKVA 3AFHA 1P2VA 4MI1A 3TRFA 4D1YA 4Q4AB 1C7FA 2JJQA 1Y7TA 3ZI7A 5J2UF 1H8EA 4Y2UA 2IIQA 2P27A 4E7PA 3CCFA 2I1QA 4GH5A 2H1LA 5BWLA 3BQ9A 3IE0A 4KMSA 4TTSA 3SYNA 4KXVA 2GCIA 2WIKA 4RD0A 4KREA 4GOXA 3UY4A 4IILA 3Q2OA 1S9HA 2FUG6 3BCSA 5GJCA 1FXWA 3D0QA 3HY6A 3WB1A 3B1YA 4MVJM 3GDGA 5TDHA 2GXUA 5B4VA 3IP6A 1ZM7A 1J8QA 3EEYA 4GSYA 3HABA 4OXQA 2PSHA 4YDHB 3HO1A 2CFOA 2REBA 1QGDA 5JYDA 2BCGY 2WVGA 3IUJA 4PC3A 3T3IA 1UBHS 2CVOA 4U2EA 3NTXA 4G4SO 3SXJA 3GJQA 1VSTA 4R3WA 4DNQA 5CT9A 1E0KA 2IVZA 2H4YA 1B2RA 1VHWA 3AXSA 4QFDA 1ID1A 4DXDA 3IAAA 4LYDA 1P81A 2JLVA 2Q50A 3S99A 5F3RA 2G5GX 3OTWA 1P2DA 3ELUA 1D0VA 1VGVA 2AMLA 4K8OA 4XWGA 5IM5A 3G85A 2ZWOA 2PVPA 4EYOA 2FQWA 1FFXA 5CH3A 5CURA 5A03A 3WBBA 2PFGA 1XRPA 3LBHA 4FEYA 2H51A 2JFBA 2OMKA 4O4JF 4C4AA 1ABBA 1E7YA 1PQWA 3NHUA 3BK2A 4AJIA 4WBXC 3ZIAA 5EI5A 2VH2A 2FP4B 1NN3A 4MKGA 5JS8A 3ZY2A 4CKWB 1S96A 3RPEA 1BJTA 1KVQA 1XNGA 2OLKA 3B70A 2GZRA 3CPHA 4ITUA 2CN1A 3S27A 1KH3A 2PT9A 1NFRA 1K88A 2ZJ3A 5TE9A 4WXMA 5JHHB 4LK2A 3GQVA 2I2BA 4X1KA 1Y98A 3I9LA 3V7UA 1RCUA 2R84A 2APJA 4TTIA 4M36A 3W6NA 2R25B 1ZEJA 2G5TA 3U4MA 1GIAA 4OJKA 1ZG3A 5GM1A 1BCRA 1XVAA 3BF7A 2ON6A 2GPNA 4G1UC 4HTAA 4YCJA 2Q7DA 3W9UA 3WK9A 4MUFA 1I2BA 1KHTA 1YQQA 5B36A 5FA6A 2J6CA 1SWVA 3EWIA 2V7TA 4HGOA 3L4KA 2W93A 3VAAA 2QAGB 1WOYA 3ZXSA 1Z82A 2HXSA 1DBRA 3HA5A 2FSFA 1M73E 1N9KA 2VVTA 3VR0A 5A9SB 2VP4A 1J2TA 2ZOSA 3VO2A 1XQVA 1XA0A 3FA2A 1LJLA 3UHOA 2QGZA 1H2FA 3LXMA 3ITKA 4C4YA 5ED4A 5G02A 5G3ZA 1GYPA 3EC2A 3FVWA 4LDPA 4AUKA 4K7JA 5JCXA 1CDOA 2RC5A 1GT6A 3QYJA 1JR3E 1MXFA 3R3JA 2B0CA 5AW1A 1CWUA 3G3EA 1ULBA 1YRHA 1R0RE 2IHYA 3VR5H 4HWTA 4GOND 1DQRA 2D0OB 2GEUA 2Q1TA 5JSHA 4CIYA 3DW3X 2NVOA 2GLUA 5DXJA 4JI8B 4H4EA 1DRWA 3BXXA 1IJFA 4MS4B 4DCGA 2GSWA 3KALA 1VGRA 1CR6A 2FMTA 3EUWA 2B0JA 3M4JA 1T4CB 4L6AA 4B85A 4KE9A 5AVOA 1M5RA 4YMIA 4LX8A 2BFDA 4DLWA 1QE0A 2ZAIA 3CGGA 4KLNA 4EUSA 1PVVA 2JFYA 1I5EA 4MR7A 4RL4A 1HDEA 4FFMA 2FQYA 1NONA 2JD2A 5AIBA 1DQSA 2I76A 2YZMA 1BVYF 5JNLA 4AY2A 1E62A 2R6DA 2W58A 2XR1A 4FFBA 4G0NA 3U40A 3UTCA 4IHJF 4J9VA 4CTNA 1KQFA 5T7BA 1XB2A 1MNQA 1GL6A 2QYOA 4MWTA 4R9UC 1Q6YA 3VKWA 2VAWA 3VSBA 2LUOA 2CHQA 4FEEA 4YALA 5IT4A 1PP4A 3LL7A 2QHXA 3RNOA 1TAHA 13PKA 4FFRA 4REQB 4Y1EA 4AJPA 3LU1A 3P2OA 3SVTA 4A8HA 5I48A 3LF1A 2Q1YA 3PQEA 1UOOA 3MINA 4FDTA 1X9HA 1E3IA 4RH1A 4PR0A 5EHIA 2C5HA 2Z2JA 2A14A 4PNEA 2Z6VA 2OUKA 3AEKB 3CF2A 4H0CA 4W63A 1ZR4A 7ADHA 4B3GA 4RPJA 2EFEB 1LK0A 4A8PA 4LDJA 3PQ3A 4JLMA 4QNRA 1P7VA 1USUA 2IE8A 4ZKDA 1U0BB 1GZ6A 1U2GC 2XECA 4AQ7A 3UK0A 1A9RA 3IULA 1N78A 1YV9A 5EZYF 1E9VA 5CP8A 4KYVA 1ZSYA 2EBFX 4XM0A 3ROPA 2J30A 1QK5A 4Z4QA 1R2QA 1GCGA 1U31A 2C7GA 4G5FA 4WFJA 5ALKA 5EP2A 2IH5A 4WCFA 1GAQA 4E4RA 2CBGA 2VN8A 3U7RA 3ZWDA 2JHFA 4TSRA 4RE6A 2EKPA 5DGXA 1VLZA 3LPLA 1G5RA 1QH9A 1QNFA 2O2XA 4IIHA 4PLCA 3GRAA 4GGMX 4RACA 2PXCA 1A27A 3NHLA 4UQPA 4PGHA 4DA0A 4YJHB 1SXHA 2JCYA 3W5UA 1KQOA 1M76A 3L7CA 5GZ1A 1DEXA 1MCZA 1SCAA 3SFTA 1Z35A 3PIIA 3UA3A 4AECA 3C3MA 3KV1A 4ND3A 3S29A 1P4SA 1GRCA 1S02A 3S2GA 1D6JA 1LSJA 3VV2A 3GRUA 4CETA 1IL0A 9MHTA 1XAIA 5ALPA 4BXOB 3DWIA 4EMBA 3NHYA 2C98A 4X8OA 2C8VA 1DE0A 1N0VC 1H2RS 2FUG1 2FPRA 3GZTB 2B21A 3IUPA 2FQ1A 4E94A 1C3LA 1JBKA 1BFUA 4WDRA 2HHCA 5EJEA 4YP1A 2QJOA 2IF2A 5AUNB 2HDOA 2H07A 2WAXA 2E21A 5BW5A 4DCUA 3FI0A 4JBNA 3D6HA 1EEXB 1JGTA 3WLLA 3MHTA 1PUJA 3G17A 2JHGA 4EMSA 3KLBA 3DCIA 4DV4B 3F2VA 2F43A 1N0HA 5E6UB 4B3TB 4H6WA 4JX8A 3UWOA 1FZQA 2B4AA 1A4XA 2IZ5A 4GW3A 3O9VA 4OHPA 3CU5A 1R4MB 1ZC3A 5CR9A 2GK3A 2G9QA 4GLBA 1SO8A 4Q1CA 1RPZA 4YMHA 4X65B 4W4TA 4C0JA 1WUKS 3FOZA 5FI1B 2LE0A 1K6XA 2I4IA 4B76A 1WMAA 4D4HA 4DJDC 3CX8A 2FWMX 4JR0A 3SXUB 2OD2A 3EQ6A 2D4AA 1H1LB 4UEQA 2YQ4A 1NP6A 4QPJC 1M8FA 2CUZA 4MQEB 4K0RA 4CV0A 1RYEA 3JD4A 3GLFE 1ZOLA 3N8NA 2NO6A 3AG6A 4RZIA 4A6EA 3B6MA 5BSKA 1WZUA 1CRLA 1R6DA 4QG7A 1NQXA 4LY3A 3T94A 4EGAA 4KAFA 3O2SB 3ZTWA 3U60B 3AIKA 3Q7EA 1ZFNA 2XMSA 2UUCB 1WBBA 4Q1BA 3R9XB 4AYWA 1GADO 4BN5A 4MV0A 5FNVB 1UQTA 2FN3A 3KL2A 1EA5A 2Z95A 4RDCA 4DQDA 2AUMA 2WF8A 1J0DA 2R68A 1W36B 2CFTA 1ZVVA 3HKDB 1DJLA 3BIOA 4QVKA 2XCOA 2XUZA 5BURA 1KH2A 2H2FA 1DUSA 3RJMA 3I62A 2YHUA 1LI5A 4UARA 4D9KA 2CT8A 4XI9A 1I6WA 3T7KA 5D01A 1RXIA 3D1VA 3D0OA 3CG0A 1P33A 2A88A 3NLLA 3Q8WA 3RC3A 4BQEA 4E14A 5LUBA 1B15A 4XWKA 3IAM6 1LX6A 1YIAA 1GPYA 3A6PC 2BUAA 3H9EO 3AETA 1Q0LA 1U8EA 1VDZA 4L4SA 4PO3X 5DHRA 4MULA 4AQYB 2OK8A 3IV6A 2D3TA 4PIMA 1SXJA 2JI4A 1XL1A 2DGDA 3DEFA 1QH1B 2FF5A 4IO0A 4NOMA 1VRVA 3S2EA 3JYQA 2PZMA 3F6SA 5K3BA 1W5SA 5FBHA 3ELYA 1VE5A 4AO7A 2GWHA 3GDFA 4FXPA 5BN5B 2D5LA 5IANA 4UTZA 5L6MB 1AZLA 2VG8A 4LJ8A 1OFUA 2O7VA 1CYDA 2XIQA 2ZTSA 3IDZA 4MDEA 3QELA 5F9HA 5GZ6A 2E4YA 1OKKD 2JAUA 1UBNA 1KP3A 1NVVR 2XXAA 3DDHA 3PQ8A 3G2QA 4ND6A 1Z17A 3F74A 3OOHA 3L05A 1V8FA 4FHDA 3DYVA 4NL4H 4GOKA 1QQ6A 2OAQ1 4TMWA